5JOPD

Crystal structure of anti-glycan antibody fab14.22 in complex with streptococcus pneumoniae serotype 14 tetrasaccharide at 1.75 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
218
structure length
218
Chain Sequence
DVLLTQTPLSLPVNLGDQASISCRSSQTILHSDGYTYLEWYLQRPGQSPKLLIYRVYKRFSGIPDRFRGSGSGMDFTLTISGVEAEDLGIYYCFQGSYVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 14.22 light chain
publication title T cells control the generation of nanomolar-affinity anti-glycan antibodies.
pubmed doi rcsb
source organism Mus musculus
total genus 50
structure length 218
sequence length 218
chains with identical sequence L
ec nomenclature
pdb deposition date 2016-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jopD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jopD01
4JRYA 1S7UB 1W8NA 4LPYA 3IFPB 3T3MF 2Y7QA 4JO1L 1MY7A 1MHCA 4XC3L 1RHFA 3L7FA 4RMSA 4B7IA 2MPAH 1DBJL 3CDYA 4GW5B 2G5BB 5DD0L 3EOAB 2W0LA 1JTOA 2RHEA 5CZXC 2AXGA 1QPXA 4JAMA 2CKBA 1NGQH 2D3VA 4RMWA 1TQBC 4PJGE 4XWGL 5FO8B 1C08A 1AGDA 2WINB 4FQPA 4KJWC 1OB1B 5AUMA 4P2OD 1YC7A 3QUYD 3I85A 2PO6A 4NHUB 3MRRB 3C60A 3SHSA 4EBQL 2GTWB 3QUZB 5CEZL 4KTDH 4FXGA 5C0CA 3H7BB 4LF3A 4JO2H 1CLCA 4QTHB 4YAQB 5JLZB 4JDTL 3T04D 1NAKL 2GW5A 5T1KA 1IAKB 5DXWA 3RTQC 4XCCL 2PYFA 5T1DL 4LHUD 4XPBL 4PPTA 1S7QB 1X5XA 3UP1A 5E6ZA 2EYRA 5HYJD 3HZMB 1LD9A 4W6WB 3QIBC 2JK5B 2YA1A 3QZWA 4HGKC 4HS6A 3GM8A 4UNUA 4Y5XB 5HGBA 4LVEA 2VZ3A 4I48B 2HTLD 4WHTB 4RAVB 5TF1H 1T4KB 2AJ3A 5DD1H 3OXRB 4L8SB 2HJFB 3EUUA 2Z31D 4HGWA 4HIEA 4HUUA 3HFMH 2DBLH 2GY7B 5EUOF 4WEMB 2GSIA 1RZJL 5B8CC 1EVTC 2EC8A 3ARGD 3TYFB 5F7EH 1LP9B 3EHBD 4GAFB 1AQKH 1QQDB 4GMTL 2BY1A 4QRRB 3LKOB 3MLYH 3L9RA 2BVOA 12E8H 1RZIB 4RWHA 1KEMH 4HULB 4JO3L 3QPQC 1XIWC 1MLCA 5E6IB 3BPOC 5EIIA 4Y5YB 4AL8H 3OAZK 2XA3A 4TOYL 4HH8A 5J11C 3SKMB 3EZJB 2WP3T 4M7JH 4EI5A 4CUCA 4HMDA 2JB5L 2BVQB 1GC1H 3PWJA 2VDQH 4EJ1C 2HFGL 1AY1H 4MNGB 5F7KC 1Q0XH 1OM3H 4QXGH 4HUXB 1XGYH 4ELKA 5KSBF 1PLGH 4G8GE 5D1XB 2B39A 4LCIH 5FO9B 1FG2A 5C07B 1QNZL 5CEYB 1H5BB 4PJ8A 3HC4L 4JZNB 3T0EC 4X5XA 2KBGA 2GT9A 3D48R 2Y36L 5IG7A 4MNHA 5FUCC 5BJTB 3E0GA 1KPUA 1C1EH 2WQ8A 4U1NB 2Y6SD 2Y07H 4MJ2A 4ODWA 1FO0A 4S2SA 5EU4A 4BUGA 5IM7A 3MV7B 4K3DL 2JIXA 2DTMH 3O4LA 1CTOA 3TBSA 2YD6A 4IOIA 4JRYB 4EN3A 2H45A 1ACYH 4PJDA 2Y7QB 4PJIA 1MHCB 4X7CC 2R69L 5CZVH 1ZANH 3UX9B 2XQBH 4JKKA 3QG7L 4N5ED 1BGXH 4JM2C 5A3ID 3ARED 3S3SA 4NFCA 3DBXB 5DRZA 3TC9A 2CKBB 4LFHG 4BZYA 3ZT6A 3HNSL 4MLSA 1DLFL 1C08B 4PJHE 1AGFA 3HTLX 1PKQA 5AUMB 4TSCL 1JGLH 5FHBL 4XP9L 2VXSL 3GEWB 3ARZA 3C60B 3QHZH 5DMGD 4P2RD 3IDGA 3PF2A 5LBSH 4QRPA 3RWDA 1YEEH 5CKGA 2VDMH 4KVCH 4FXGB 5C0CB 4JGUA 4F15B 3ESUF 3BFOA 1A1NB 3LKQA 3UYRL 1JJUA 1B0GA 4DN4L 1KN4H 2J8UF 4Q9RH 5D5MA 3ZKNC 3IJSA 1AO7E 1M7XA 4OLYH 2EH8L 2AK4A 4P3WA 5T1KB 3PP3H 3X11A 1VDGA 3N1QC 4HSQA 1IMHC 5L2JB 1AJ7L 4JM2F 4P5TD 2EYRB 2J2ZA 1LD9B 1AH1A 2NY1C 3MV11 4LU5L 4TQEH 1DQJA 4HS6B 1RUAH 4HIXL 4OLEA 1FL6A 2YKLL 3WNMA 3RA7H 5C2UB 2NY5H 4PJCA 4LAQL 2AJ3B 4YDLB 4L1DA 2V17L 4HIJA 2CLVA 2GI7A 1UEYA 2FEDD 4HGWB 1SBBA 3MV7E 4HIEB 1CFVL 4HUUB 3RIFK 1KCRH 4LRNH 5DRWB 3RVUD 4ZAKB 1MCFA 3DXAD 2GSIB 4PRPA 4G8EA 1ORQA 4KXZH 4JFXA 1A7NL 4E41A 2NXZD 4CVWA 4TSBL 1S7RB 3CFDA 4Y2OA 5EA0H 4F37K 3F7QA 2GJ6D 3L9RB 2BVOB 3LD8C 4JZJC 5EU7C 1DTUA 1MLCB 5K9JH 4F57H 1O7VA 1FGNL 4XVTH 1SBSH 1V3JA 1QYGH 4EI5B 3GDBA 4QCIA 1UM6H 3PWJB 4ODVL 3FT2A 1NSNL 1NC4D 5LKNA 5IV2A 4XMLL 2CUHA 4OIIH 4ELKB 5GGVY 4JKPH 4ZS7L 5F9WB 3MRFA 4FFYL 3RDTA 1JWMA 4PJ8B 4WFGE 2YWZA 4X5XB 1A7BA 4CKVX 2GT9B 2KUTA 4MNHB 4XVSL 1H3PH 4PRBA 5I75C 4JREC 1QLEH 3K4DA 3V0AC 1P4BH 1KPUB 3K81A 5C09E 4WI3A 2B20A 3U30C 4ODWB 1FO0B 4S2SB 4D9RD 5EU4B 3WJLA 1IJ9A 1QSEA 2H2SC 8CGTA 5JW5A 1UT9A 5DLMH 3H9SD 3IXTA 3O4LB 3TBSB 4IOIB 4BK4A 3AS1A 4EN3B 2EEDA 2DLFH 4PJDB 43CAA 1TJIH 3MXVH 4P2QE 2YRZA 3D25A 1O0VA 3GI8L 1YJDC 5KS9A 4CN1A 4D0CB 2HT3C 1ZT4A 3T0DA 5E5UB 3FN0L 5SWSE 5MEND 1K4CA 2YSSA 3MJGX 1UWEH 4JG1L 1AGFB 1PKQB 2FX7L 1I8LA 3OKMB 4M9PA 4S1DD 3RY4A 1RFDL 1F6FB 1LNUA 1KB5L 2A1WL 3SDCC 1BREA 1WVZA 5I73C 4DZBA 4ORGA 3X17A 1EAJA 4L3CA 2VMFA 3VFNA 3IDGB 1FIGL 4QRPB 3RWDB 3B5GA 1HQRA 7FABL 4QXTA 2CDFB 3MSPA 1FL5B 4JM4H 3LAFA 3LKQB 2F74A 1B0GB 3QWQB 4M1CD 5D5MB 2KZ1B 1VFUA 4X9BA 2BNRA 2PXYA 3VGAC 3X11B 1BAFL 5E2TL 1RU9H 3B5HA 3EYUH 4Q9QH 4CRPA 5GRYA 4HKZB 1CLZL 4PJBA 3JUZA 4OQTA 1J8KA 2X70A 1MQKL 1BVZA 1UM5L 3ES6A 1MF2L 3H0TA 1IT9L 4WFEE 4MA7L 4E5XA 3EYFB 1DQJB 1VA9A 1E4JA 4UQ3A 5CWSA 5DVKA 3KJ6L 3VXUA 1IAIL 4DOHE 3NABL 1S3KH 1H3GA 1TLKA 4HIJB 2CLVB 1MAKA 2ICWJ 5JHLH 5J6HA 2EDLA 2DIAA 4NKDB 4EZMA 4RCAA 1TJGH 1G7MA 3TO4D 4NNPH 4AYFA 4PRPB 4MJ5A 4Z95H 4G8EB 1ORQB 2Q7NA 4JFXB 1HYSC 5JXEC 4KHXL 3RIFF 5BS0A 5CIPA 4E41B 4LDEB 4JGJA 3CFDB 4N8CH 3W81A 5ESQB 1PX4A 1U8IB 4HEME 2AGJL 5CJ8A 3QXAA 4F37F 2CJUH 5EZOH 4IRSB 1FORH 5DJCA 3BPLC 2HAZA 5DRXA 3MJ6A 3MC0A 4OCLC 2IH3B 1MI5E 1FNEA 2A38A 1MFBL 5F21B 2CR6A 4ZTOH 5IVNA 5DEFB 5C3TA 4KUZL 4IBLT 1ZLVH 2FJFB 2P5EE 2BERA 3FT2B 4GFTB 5JR1H 5IV2B 1XF5A 5KW9H 3SJVD 3U7WL 4NKMA 1YA5A 2E27H 3MRCA 4LPUA 2UWEA 4YHPA 3MRFB 4F7MA 2H1PH 3RDTB 3R8BB 1JK8A 3HPJA 3QI9D 2Y23A 1DQMH 5SWZE 4PRBB 4P4KD 4EEEA 1NFIA 4MGXA 4YC2C 1TJHL 5CUSH 2Z92A 4HS8H 4TVSa 1HHKA 3I3BA 4S0TD 4WEBL 4ENED 4UT6H 5JW5B 3IXTB 4PG9A 3BKMH 5GHWL 1S9VA 4ZXBC 5FYKL 3HNTL 3H3PL 5EUOA 5KVFL 4LSDA 4HW6A 1FZOA 1F8TH 2P7TA 43CAB 4LDLB 4Z7WF 4KROC 2JF1A 1EUUA 2WMPA 5FOJA 5BZDA 2PYED 3F65A 1G9NC 5KS9B 4UAOB 2R1XA 3RTQA 3V0WH 5JW3H 3S96A 1AXTH 2IFGA 3NFSL 5F6IC 4K71B 1K4CB 4N9OB 5EORL 4M5ZH 4ELMB 1J7VR 3QIBA 2JJSC 5CINH 2LABA 4GQPH 1S9KC 2VLJD 5TPWH 3O6FD 4HIHA 4ORGB 1UB6A 4DZBB 4JLRA 4L3CB 3VFNB 2V5MA 3GKWH 3EYSH 1J5OL 3PL6D 5KJRH 1HQRB 4QXTB 4QXUL 3H9YA 3OMZA 5C08E 4K7PY 3NGBC 4XB7A 5KSBA 4H1LH 3CJJA 1I3GH 5CZKA 4OF7A 5C0FB 1U9KA 5B8CA 2BNRB 2PXYB 2OXHA 3BIAX 2XTLA 3SDXF 4JVWA 3TYGL 4HBCH 4PJBB 2DLTA 4PB9H 1L0QA 3F62A 1IEHA 2X70B 3P4MA 2I5YH 1XIWA 1QACA 3H0TB 2J5LC 5DHVA 1MAMH 5CMAA 1EMTL 4E5XB 3REVB 4UQ3B 5MI0C 5CWSB 4NJAH 3VXUB 4I3SH 4KDTC 4U6VH 4F58H 4UV4L 5J6HB 1BEYH 2APWA 5CD5D 1C16A 1Z3GH 4JDVB 2PR4H 2E7HA 4Q58C 5ALBL 4YHZL 1G7MB 4FXLA 1T2XA 2IPTL 4MJ5B 1BWWA 1QHPA 5HI3D 5D7LD 3VRLE 4M02A 4WDIA 4TVPH 5BS0B 4MJID 5CIPB 3B2VH 5FKPA 4FN0A 4KKBD 5E1AB 1A7OH 2DKSA 3QDAA 3QO0A 4GMSL 1YQ2A 1OP5K 4D2NA 3P9MA 3T0EA 4Z7UE 4JRXD 3FB7A 3OKEA 4FZEL 4ZSOE 3QXAB 4ELME 5DJCB 5HYJE 5DRXB 2BVPA 4DQOH 2DL2A 4UILH 4RGOL 1FNEB 2B0SL 1CBVL 4EOWL 3WXWL 1E4WL 1A6TA 1AR1D 1UWXH 2EKSA 1VGEL 2J8UA 2RCSH 2CSPA 2C1PA 4Y2DC 1KCUL 2GIYA 2ICCA 4I4WA 3IAQA 1NCCH 1TCMA 3LH2L 4NKMB 3PQYD 1J12A 3MRCB 4YHPB 4HXBH 4JM2A 4F7MB 2Y25A 4PIRF 3WDHA 1MEXH 3SDYH 1JK8B 4KQ3L 1IC4L 4GKZA 3H7LA 1OGAD 5K59E 1PG7L 1NFIB 4HKXA 1UCBH 2Z92B 2EDWA 1EBAA 1HHKB 3HUJF 2HWZL 3CZJA 3DMMD 2FHCA 3HAEG 3PV6A 1X7QA 5JOFA 1QBBA 4PG9B 1K2DB 3BW9A 4NQCA 1QR1A 1A7QL 1S9VB 4UDUA 1UCTA 5EUOB 3MUGA 3T3ME 1FZOB 1J1OL 2EE3A 2EXYD 1MCPL 5I1IH 5BZDB 3KPTA 2DD8H 2R1XB 3S96B 4N8VA 5HHOD 4YH6A 2VITB 5EZIH 5EBMB 3O0RL 4G9DB 5C0AA 4IJ3C 1I9JH 1RUKL 5KANI 4DCQA 3OQ3B 3S7GA 1VADB 4QOKD 5JA8B 2XTJD 3H9HA 1UH4A 4GBXC 2ARJA 2EE9A 3ME0A 4YBLB 1UB6B 4JLRB 4CDHA 3FQXA 3QFJA 5DO2D 3ZDXF 3LB6C 3EYOA 5DURD 2WIIA 3X3GL 3DIFB 2AW2A 3DNKA 5DHXB 5A40E 5KSBB 5FYJH 2ZNWA 3I3EA 3NCYP 5B8CB 2BOCB 2NZ9C 4OZ4A 5DJAA 2NY2C 2IBBA 1WF5A 3MACL 4AEFA 3GRWL 1CT8A 5TE6H 3VD7A 3UPCA 2PF6A 4JZJA 4LEOA 2NY7H 3P4MB 5EU6E 4OFYA 3UJIL 1XIWB 5DHVB 3LQZA 4LQFL 5CMAB 4DWHA 4D9LH 3QWRD 4H0GA 5F7LB 1JZ5A 1U58A 1BP3B 5J11B 1OAQL 4ETQB 3DVFA 3OAYK 3B9AA 5HDBE 1UC6A 1C16B 2R0ZL 3DROA 5BXFB 4TRPH 5GRJH 1A6PA 3DVNA 5FYJU 4OZIE 5I1JL 2P45B 4EXPX 3EJYC 4WDIB 1A6UL 4X8JA 5FKPB 3QO0B 1AP2B 4TTGA 4P99A 3P9MB 2RR3A 2GUOA 1KCVH 3IETA 3NFNB 3T0EB 3P77A 2R8SL 5HVGB 2AERT 3FB7B 3OKEB 5EBLA 3V8CA 2R0KH 1JHKH 5DRNA 1GHFL 5MP6L 4K2UH 4MYWB 3ZE2E 4C58B 5C2BL 1UB5A 2BVPB 3F7YA 3Q2CA 4D9QE 2P5WE 4K7PX 1FBIH 6FABL 5I8CA 3HE7D 1A6TB 4N68A 1RZFH 1N7MH 3BXNB 5L7XL 4IMKC 1MFEH 2EKSB 2FEEL 2J8UB 4CW1A 2C3VA 2QSCH 3OKNA 4OLZL 2C1PB 3QDJA 5DFWH 4I4WB 5T5NG 2EDFA 3A0OA 1GPOH 1WAAE 4JM2B 5D1QB 3DXAE 2O61A 1PKOA 1KXVC 5J7CC 3U79A 1MREL 2EE6A 4GKZB 1I4FA 2K7QA 3FQWA 3H42H 5C0RL 5C07D 4HKXB 4HUVA 4KMTH 1NLBH 3SDCA 1QOKA 4DKEH 3PWVA 5GISL 3PV6B 1P4IH 1X7QB 2D03L 5F88A 5JOFB 3BW9B 4NQCB 2QKIA 4UDUB 4PLKC 5IFJB 4XRCA 3MUGB 1DR9A 4JCMA 1JMXA 4J6RH 3ZKSD 5D2NE 1HXYA 1IQWL 3BP6A 1HE7A 3ULVH 2VDPL 5ENWA 4RDQF 1QFWL 4N8VB 1DQQA 5IHLB 3EO1A 1NFDF 5C0AB 4XVJH 2FDBP 1F3JA 4KK6D 1NMBH 1EGJH 4DCQB 4DW2H 2LVEA 2NY1B 4EDWH 3NBNA 1EEYA 2EZ0D 3MOAL 3H9HB 5BV7C 2I60H 1AI1L 1J1PH 2AJXH 2ARJB 3QRGH 4HF5L 2WBWB 3FQXB 3QFJB 1S5IH 3AFLA 1B2WL 1U2HA 2PETA 3OZ9H 3EYOB 2WIIB 1YN6A 2XICA 5ACZB 2PO6D 3G6AA 3L5WA 1FVCA 5E5MA 1PZUB 3C60D 3H9SE 3G6DH 5FO7A 4LCYB 4KDVA 4OZ4B 5JXEA 1MCCA 4Y1AA 5DJAB 1YC8A 1YZZA 2R23A 3TZVC 4F8QA 3I6GA 3ZT7A 3TCXA 1CT8B 2R29H 3LQAC 3LQAH 4LEOB 3B3IA 2RAMA 1UZ8A 2CLZA 1WFOA 5E1HB 3LQZB 2ZSVA 4PJ9C 2D7TH 4MA3A 1FE8L 3TP4A 3UO1L 2OX5A 3GHBL 4YDKH 1QKZH 4PRAB 4G43A 1U58B 1JPSH 1NCWH 2ADGA 3HNVH 3W2DH 1HZHL 2M1KA 2AJUH 3MA9L 3TJHD 4Z7WA 3DROB 5JHDA 5F9DC 3DVNB 2NY0C 2FO1A 3CLFH 2YK1L 1JF1A 3EO9H 3RUGF 4EDXA 4HZLB 4LEXL 4FABH 4X8JB 1MUJB 3D85D 1RJLA 4M3KB 1JGVH 5IT2L 1M05A 3LKRA 1J11A 3KLDA 3CSBA 2GUOB 3IETB 3A6CH 3P77B 2YPKA 3K4AA 3EYVA 2Z4QA 5DRNB 4L4VA 3MRDA 2YA2A 4P9HL 3F7RA 2FR4B 1FN4A 2YD4A 1VESA 4OGYL 5H94B 2OZ4A 5I8CB 1YECL 4ZXBA 4OAWA 1CS6A 2PCPA 1YMHB 4P5KA 4CW1B 2C3VB 3OKNB 4U1JA 4KRPD 3BESR 4QRQA 3SDXA 3NCCB 2O61B 3BSZL 4HFUH 1W0VA 4X83A 1VFOA 2MQ0A 3L3GA 1CF8L 1I4FB 1MFCL 3HI5L 3KPRA 2JJSA 4OB5H 3SGEH 3NIFE 1Y0LA 5C3LD 5I76B 4HUVB 4G9FE 4PJ8D 3SDCB 4NZDA 1T1WB 3PWVB 3C09B 3V6OE 5F88B 1Z0MA 3MLWL 1ZAGA 3QQ9D 4XRCB 3MUY1 5IW1B 5HYSG 4IOFC 1HXYB 1L6ZA 3BT2H 5TDPA 3BP6B 2JIXD 3VGAB 3O4LD 1HEZA 4Q2ZA 5ENWB 4U1HA 1NCDL 1DQQB 4NWUL 3FAWA 4JVPA 1JF6A 2OL3A 3EO1B 2FATH 3CVHA 1CLYL 4KZEH 5ITBH 2HH0L 4FFZL 2VDNL 2M26A 1TZGH 1EEYB 2X4TA 4LCWD 2VDLL 2CUMA 1T80A 1KENL 2P44B 1U8NA 4XPTH 4XMPH 2HFTA 4KDTA 3DV4A 4TULH 1SYSB 4S11A 4F3FA 3MLVH 5CJQH 3G6AB 3L5WB 1FVCB 3QXUA 5E5MB 5SWQA 3CNKA 1DVFA 5KTEL 3GSRA 5J1SC 2XXMB 5FO7B 3DGGA 4QRPD 5GJTL 2R23B 5E8PA 3VRJB 5GS0D 1QBLL 1XGTA 3I6GB 4K8RD 5GZOD 2PYEE 4WW1A 3B3IB 1UZ8B 3RVXC 4H0IA 1U8LA 3QUMA 4MHHG 2AK4D 1JGUL 3U4AA 2DLGA 2ZSVB 4AG4H 4MA3B 3HUJA 5CD3A 2DB8A 3ILQC 1IAII 2WBJC 1P4LA 1IGIH 1IAOA 3BPLB 1AFVL 4G43B 1JYXA 4RBPH 4F9LC 1Z2KA 4ZD3H 2YXMA 5CILH 2VLJE 2I26N 4L3AA 4Y4HD 4DTGL 3CK0H 3NCYS 4PTUA 4Z7WB 4R4NC 5JHDB 3N1GC 4N0YH 2YRPA 1JF1B 3KPNA 4EDXB 4KKLD 3ULUE 2DQCH 5JDJA 5F72S 3SPVA 3NIGF 3DVGA 3IS0X 3HCVA 1A6AA 3LKRB 1M05B 2QHRH 4GLRH 2H9GA 3VRIB 4NQEB 2RB8A 3FCTA 4RMRA 5I1HL 2YPKB 5F96L 3EYVB 2Z4QB 1IC5H 2YPLD 4L4VB 5ANMA 1U8OA 3MRDB 1IKFH 3UDWC 5DA4A 3UJJL 2Y06L 4ZUWB 3FO0L 2CMRH 1FN4B 4PP1C 4QKXB 2XZAH 1CGTA 43C9A 5EOQH 5IBUG 2R56L 4O58L 4OAWB 2AI0H 4P5KB 4EI6A 4RISL 4WUUA 2X05A 3EAKA 1LE5A 4U1JB 1XF4A 4PV8B 4S1QL 1A0QL 3X3FH 3GMOA 2XFXA 4QRQB 1G0DA 5DJZA 3SDXB 2QQLH 2A9MH 4GUPA 4HT1L 1W0VB 4QGTA 5KSAB 5D7LE 2IG2H 1HIMH 4MJIE 3MR9A 3L3GB 1EFQA 3GMRA 5F6IB 4B5EA 2A73A 2BRRH 2ICWA 1HSBA 5LQBH 4PBVC 3IDXH 3KPRB 1OTUD 1Y0LB 1F6AA 1DEEB 1A6WL 3RDTD 3X12A 4W70A 3LEVH 4JRXE 2L4OA 2IANA 4YE4L 2YOCA 1RVFL 5DJ0A 3B2UC 3RP1A 2Q8AH 3NGBB 5DI8A 2X6MA 3BHBA 3P0YL 2AK1H 1QSED 5B4MC 5TDPB 1OSPL 3P9WB 2MOVA 4C83A 1HEZB 4Q2ZB 3W11D 3C5ZC 4U1HB 5A2FA 2F54D 3PDGA 1L7TL 2UY7A 3CVHB 4WTZG 2B1HH 4Q6YA 4MAYD 5KVGL 4M62L 4Z7NE 3V7AG 2MWCA 1OPGH 2QTEA 1X5HA 3GSNH 2J5LB 4JVUA 2BY3A 1MCLA 2OR7A 2X4TB 4NQEE 2AJSL 4YBQC 3BD5A 1EO8L 1U8NB 5MI0B 3IF1A 4XCYA 3QG6A 2KQNA 1OGAE 5EC2A 3HMXA 5HHVL 3DV4B 3QEQB 3U0WL 4F3FB 4NP4L 2J3SA 1MNUL 5SWQB 1DVFB 3GSRB 5KVMC 1P6AB 4YQXH 5E8DH 2OK0L 3DGGB 2EDYA 3D6GA 4HPYL 1JHLH 2IBZY 1J05A 3MCLL 5E8PB 1NMCC 1XGTB 4RNRA 5E5RB 5F9OL 1JPTH 5E8NB 4WW1B 4LVHC 5HI5C 4XZUA 3QUMB 1ERNA 4QY8A 5HHOE 1I9RH 1DE4A 25C8L 5KVEL 4UBDC 3HUJB 1TQCC 5CD3B 1P4LB 3O2DL 1IAOB 2MHAB 4YHNA 3NFPA 1GGBH 4QOKE 3VGHA 2XTJE 4BQ6A 4FNLH 3ZTNL 4WI4A 1QUNA 2DI8A 3RRQA 4IMKA 4PTUB 3TF7C 2DF3A 5GZND 3T2QA 2AABH 2NR6D 2VUOA 1J10A 1T2QH 1FGVL 3TWCL 3KPNB 5LXGL 3GBML 3QA3A 1L0YA 1U95A 3O4OC 1KC5H 3TT3H 1VEOA 4B0MM 2NY4C 1NFDA 3DVGB 3HLAA 3QDGA 3HCVB 1KACB 1A6AB 3JWOC 4OCRL 3SE3A 1OAXL 2H9GB 1A1OA 3QEGH 1GAFH 4OD1H 1IM9D 5ANMB 4F7CA 2XN9B 3VDBA 5AYUH 3B9KD 1I1RA 5I8EA 5DWUL 4FQHA 3B83A 4HQQH 4EI6B 3QEQE 3V79C 4NCC2 3AMKA 4Y16A 4KPHL 3SE4C 1LE5B 2C9AA 1XF4B 2BMKA 4MQ7A 4J1UA 3CFCL 2EO1A 3GMOB 3ZSTA 4UB0L 1FVDA 4XMKL 4OIBA 1L0XA 1PZ5B 2B4CC 5JQ6H 1BFOA 3U1SH 3MJ9H 3ARFC 3MR9B 3GMRB 4YHML 1RIVL 2A73B 1IILE 4JDZA 2ICWB 4IJ3B 1HSBB 4DGIH 3PV7A 1NAMA 1BFVL 3S88L 1LILA 3T09A 5HDOA 3MLRH 5CZXD 4RA3A 4MA8L 2IANB 5BQ7A 2XKNA 4WWID 2KZWA 3HC3L 1DLHA 2B7DT 1E6JL 2E6JA 5EU3A 3BUTA 4PJ7F 3QCTH 1F97A 1CD0A 1R6VA 3LS4L 1JUFA 5DI8B 3O6LH 1LWRA 4P23B 1EV2E 4Z7QF 5D7JC 1EUTA 1A5FH 3KLHD 5A2KH 2DBJA 3E8UL 3IU4H 3TZVA 3V4VL 2HVKA 2IQ9L 3ZLQC 2IMMA 3WE6B 5JZ7C 4PJ9A 3RTQD 5KVDL 1EFXA 3C8DA 2ZG3A 3IF1B 5DUPH 4XCYB 3QG6B 1XF1A 5EC2B 4YDIH 2XN9E 1CE1H 4ODHL 4NQDD 1Q0YH 3U2SA 3ZDXE 5GSVA 3QIBD 1U3YA 3D9AH 1ZEAH 4G6AC 1MCWW 1IGJA 3NIDF 3N9GH 2GJZA 5F97E 4UZGA 1RHHA 1QTYT 5C8JB 1UM4H 2CIIB 1GH7A 1PYWA 2BJML 2J8HA 3CXDH 1AR2A 4RNRB 5IB5A 3D2UA 2EDNA 1CG9A 3QWOA 1KIRB 2GITA 4V2BA 4JEGB 4XZUB 4QY8B 1CGYA 1JBJA 2DM7A 1DE4B 5BRZE 4NUGH 3U82B 5IQ7L 1MIMH 1MCJA 1K5NA 4P3CL 4YHNB 3NFPB 1UWGH 3QPQD 4JFPA 1I7ZB 3TBVA 3SGDI 3VH8G 1CICC 2GAZA 3QNZA 2JCCA 4D3CL 2ZCKL 5DVMA 1N0XL 3G9AB 3VXMA 1FNSL 3QA3B 1CK0L 1U95B 3BZ4A 5J9PA 3NACH 2WBKA 5FYLH 1WK0A 5I30L 5J8OA 1ZA6A 3DARA 4KVNH 5H35A 5DMIL 2J4WL 1NFDB 3QDGB 3HLAB 2ED8A 3TT1H 3VXOA 3B8YA 1CL7L 4OCWH 4WWKD 1PSKL 1S7WA 2ZCHL 1N6VA 4F7CB 4MXVE 1MJ7H 3CSYB 4JPWH 3IDYB 3B9DA 2EECA 4JKWA 1TNNA 4WI5A 5IP4A 4FQHB 1T7VA 5IMMA 1N6UA 1BOYA 3STBA 5B38G 4PBWD 3WHE0 4M8QA 4WFFD 4Y16B 2IBZX 4R97C 4CU6A 1A9BA 4J2XA 2BMKB 4MQ7B 4J1UB 4LP4A 1OP3H 3HB3D 1JF5A 2CKNA 1FVDB 1LEKB 4DVRL 1XMWA 1R5WA 3KR3H 4EUPG 1CDCA 1SYVA 2BNQA 2ZG1A 3ALPA 1JV5A 1ZGLP 3W82A 5D71L 1G84A 2F5AH 3E1F1 4XNUL 3VXRB 1DFBH 4HH9A 1NAMB 3PWPA 4UIKL 5BV7B 4WW2C 4LSTL 5BQ7B 4L4TA 2XKNB 3TIDA 5AZ2H 4ZNEE 1U8MA 3O2VH 1E0OB 1OAKH 5EU3B 1S78C 4ONHA 4CMMA 4X80L 3K4ZA 1JUFB 1BM3L 4ODXA 3RUGB 2NY3C 1YYMH 3SGJA 1CFQA 1CU4H 4OUUA 1QFWI 1YMMA 4YWGH 3TZVB 2B5IC 2Z0BA 4X5WA 5I6XC 1F42A 4NHCL 4IIQC 3ZKND 2DICA 4R90H 4P57A 4LLQA 2A0LD 3QFDA 4PJ9B 4MWFA 1EFXB 1WC7A 4HLJA 4F9LA 2LAAA 1T03H 4WW2F 4NZTL 3IDMA 2A83A 5GSVB 2EIBA 1H3WM 4XVUC 4G8IA 5J0BA 2UVFA 1BQHG 3U48A 5I1EH 2GJZB 3DURA 2NY0B 1RHHB 4OD3H 5E2UH 4HC1L 1T1YB 3VXSD 1R3HA 2VDKL 4LK4A 1PYWB 9CGTA 4GOSA 1YEJH 3D2UB 1CG9B 3QWOB 1YEFL 4QT5A 3PUCA 4BSVA 2GITB 2DMBA 4GS7C 1J87A 5HHQA 4RFNB 3VXRE 2DLEA 4OCMC 4G8FB 3O6KH 2WV3A 4NQUA 3UDWA 1K5NB 1CD8A 1JNNH 4OFYD 3GSOA 4LCWE 3KPOA 1MCIA 3TBVB 2IPUK 2W92A 4YZFE 2GAZB 2YD8A 3QNZB 4I3RL 3PABB 1R3LA 1RZJC 4O9HH 3VXMB 3RUGE 3BZ4B 4PJ5B 4CVZB 3TFKC 5J9PB 5DT1H 2XIDA 1ZA6B 4NO5A 1IFHL 2OR9L 3UTSA 3VXOB 4HJJH 5DHYA 3CFEB 4NO0B 5CEXA 3B43A 2VAAA 2COQA 4HCRA 4S1RH 3I50H 1W72H 1HILA 2CXKA 2ARJQ 3B5TA 2VR9A 5IMMB 3WNKA 5K9OA 2BZDA 1ZVHA 1H3UA 4LQ1A 1RURH 1L9MA 4M8QB 4M6ML 5C0BA 3DX6A 4M5YL 1A9BB 4PLOB 1FDLL 4KGJA 1R5WB 2XRAH 1SYVB 3C5ZA 1M7IA 2BNQB 4ZFGH 4P59H 1SJEA 4NM4H 3QDJD 4JFEB 4WU5B 2WWMC 4PJAE 3CSGA 3BIKA 3DSFH 4HH9B 2VAJA 2EDBA 3OKLA 2VH5L 3PWPB 3G5VA 4R3SA 4YXHL 5EOCH 3TPUB 2AQ1A 3DO7A 4L4TB 2BXYA 3MOBH 3TIDB 2YPLE 1U8MB 1YEDA 4ONHB 5BO1H 1QG3A 4CMMB 5J3HC 2JB6A 1IGYA 4ODXB 3NCMA 2FBOJ 4OUUB 3WNNA 1JNLL 1Z0NA 4PGEB 3RWGA 4HWEL 4HXAL 4U6TA 3RKDC 3PGCA 4PJ5E 4YHIA 2VQ1A 4Z7OF 2I9LA 4X5WB 3VD9A 5DUML 1OTTD 2FGWH 2ZUYA 1MVFA 4P57B 1DLFH 2CXGA 5DF0A 3H8NA 1U8QA 1T66C 4LLQB 4BQCA 3FHAA 1D9KD 1VEPA 4TUKL 3GMMB 1WC7B 5I15L 2MKLC 4WIQA 2P8LA 4ZUSA 3CC5A 3IDMB 2A83B 2P48B 4C56A 3L3HA 4X6EA 3VWJC 1ES0A 1OQXA 2HKHH 3DURB 4KQ4L 1FAIL 4LVNC 3T65B 3U83A 1JGEA 2W91A 1R3HB 4LLUB 4ZTPH 3T1FA 3VWKD 3RBSA 3FT4B 4AY0A 3P30H 4FQQA 1YNLL 4QT5B 4BSVB 2QQNH 1R5IA 4GRMA 4JFQA 4NFDA 2AEQL 3VA2C 4JFEE 5JQHC 2F54E 5JXED 1HYSD 4Y1AD 3RBGA 4HUNB 4LAJH 3U9UA 4HIXH 3I2CH 1UACL 3PP4L 3PGDA 4N5UA 4HAFA 2Q20A 4PJ7A 3GSOB 3KPOB 3IVKA 1BQUA 5LCVL 2F58H 1CFVH 4O5LH 2DQFA 3PXHA 2JELL 2E6QA 3E3QE 5AZEH 1R3LB 3SE4A 3ZE0E 1YYLH 2VC2L 1INEL 5DC9B 1Z9MA 2W1NA 1NUDA 4MD0A 5C0EA 4NO5B 5DHYB 4NKIL 3ARFA 5CEXB 2CRZA 3V95A 5ESAA 5GXBB 5EFIA 5C7XL 4ESKA 3MV9A 4Z0XA 3V6FA 1QRKA 1HILB 2P8PA 5E6YA 1I7UA 1IKNC 4N9GA 3ULUL 1KEGL 5E56A 3GO1L 3RY6C 3HG1E 5K9OB 4OZHF 3TPKA 1M4KA 4RDQG 4XTRC 5C0BB 4OCSL 2XWTA 5JPMA 5D1ZC 3SE9L 5B39B 4ZXBD 2HJLB 4TUOA 3EOBA 1E4XH 1M7IB 3C5ZB 1PW3A 1CR9H 3QCVL 1SJEB 1PY9A 2HFEA 2HLFC 2CGRL 4KROD 3BIKB 4JCLA 4O4YL 3OKLB 4LSUL 3HPLA 3KVQA 4X4YA 3X13A 3G5VB 3WIIL 4ONFH 3SKOA 2ADIB 3FRPG 5A2JH 4UTBH 1FFQA 4DUXA 1YEDB 3WHXA 2V6HA 2BDNL 3FRUA 2EDOA 2JB6B 5GRVL 5E7FA 1IGYB 4K9EL 4ZOEA 3MJ7A 1F6LL 5L2KD 1RQ5A 4AMKH 4WI7A 3SO3B 1CTNA 4EQ2A 5GGTL 4ZDHB 3RWGB 5HYIA 4G6MH 4RRPA 4YDJA 1LDPL 3PGCB 1FH5L 4FQ2H 2VQ1B 2I9LB 4GRWH 3UPAA 1NGZB 4AEIH 3FN0H 3NH7L 1I3RA 4LVHB 4I5BB 2VDOH 3AMLA 3OTTA 4PB0L 5CJ5A 2HVJA 4DAGH 1L7IL 2D0GA 4FQCH 1TQCB 5T33H 3EFDL 2A1WH 2VLKD 5DTFA 3WO4C 2P8LB 4ZUSB 3ZDYE 3CC5B 5ID1A 2R0LH 1FIGH 2HKFH 5T3ZH 3QQ3A 5AG8A 1GSMA 4XPAH 4OM1H 3RL2A 4C56B 4X6EB 4XCFL 1AGEA 1J1XH 1J8HD 1CICA 1P1ZA 1SY6L 1DL7H 3RWCA 1A7RH 2VQTA 2MQCA 1WICA 3L5XL 4UV7L 1V7NL 3DI2B 4MB3A 2ADFH 3RZWA 4Z9KB 3T1FB 2NY4B 3K8KA 2DDQL 5MEOA 4FQQB 1R5IB 1UXSA 1CYGA 4GRMB 4JFQB 1CVRA 4NJ9H 4AIZB 3O3AA 1MF2H 4TVPD 1NCAL 2VKWA 2P47B 5FHAL 5H2BA 2I25N 3TA3C 3ARBB 4U2ZA 3PGDB 5HGAA 4PJ7B 2H6PA 1FNHA 1T20A 3UTTA 4DEPC 3IVKB 1G9MC 1G9MH 3GHEL 2DQFB 5DC4B 4O51B 5I71B 4NQDE 5F44A 1KFAH 4KK8D 4OZFA 1DUYA 4LCCC 5EO9A 1F4YL 5A43C 4MD0B 4Y19A 5C0EB 2ITDA 3SQOH 4O2FA 3TV3L 4KI5F 4Y2DD 3VD5A 3ARFB 3S6CA 2OM5A 5ESAB 1BIHA 4Y4FA 3U9PH 4Z77A 5DR5L 2B1AH 5EFIB 2F19L 4A6YH 3EFFB 3MV9B 3V6FB 4PJXE 1RPQA 3R1GH 2P8PB 5INDB 4DGVH 1I7UB 4HV8A 4WW2A 1WWBX 1RK1A 1JMZA 4N9GB 1NMAH 3BYYA 3FFCB 4KUZH 2GY5A 4XPFL 3BISA 2XOTA 5LAXA 3OKKA 2XWTB 1D6VH 5JPMB 4WY7H 5E9DD 1AD9A 2WZPD 1Q72L 3BN9C 2D4DA 1Q9WB 3EOBB 5IMLA 4WUUD 4GKSA 1U2CA 3O2WL 4IIQA 3LKNA 3FO9B 1MHHA 4YGVA 5DVLA 4NN6C 3GSQA 4KY1L 3HPLB 1A14L 1TJHH 1YNTB 4Q74A 3X13B 4Z5RB 3WS3A 4U1SB 1TNMA 2I24N 3RL1A 2X4OA 4X98A 3TBYA 2YMXL 3KYOA 3WHXB 3IDJA 1JL8A 3FRUB 5FYKH 1T1XA 5MEQB 2LTQC 3NPSC 4POZD 3WCYA 3B4NA 1RMFH 4GBXD 3FO1B 5FUCE 4HIIA 4BELD 5EN2A 4O02H 4NZRH 4PJEE 3QUML 4WFFE 3LB6D 3THMH 1OARH 4YDJB 5SX5K 3DETC 4U6YA 4JFDA 4KK5C 3MMEA 1I3RB 1NANI 1MCOH 2QADD 3C08H 3V4UH 2BSTA 2NZ9D 2HVJB 2NY2D 3BQUD 3S5LG 2F15A 3LMJH 1X5KA 2UY6A 1I1CA 1WCQA 1QSFD 5DTFB 1RK0A 4CN6A 1B0WA 3OG6B 1SJXA 3QQ3B 4GXVH 3HR5A 3RL2B 2X7LA 1AGEB 3HZKA 3FFCE 1P1ZB 4ZG1A 2BFVH 4X6DF 3C2AL 1CGSH 3RWCB 1FFPA 4I0PC 3NAAH 1LK3H 4P9ML 2VQUA 4XP5H 2F53B 1NEZA 2NMSA 4YLQT 3SDAA 4FZ8H 4HEPG 4UUJB 5MEOB 1ONQA 4ODSL 1HNFA 1UXSB 2BSRA 5EU5A 3M45A 1C8PA 3EJYD 3O3AB 3WUWA 1WTGT 3DRTA 5H2BB 2A74A 3EJZD 4HGMA 3ZDZE 3K2MC 1NGPL 5H37G 5HGAB 1CXLA 3WKMH 4B41A 1GJIA 1T20B 3UTTB 4NWTL 3RU8L 3VXNB 5ESVB 4FQLL 2J88L 3M8OH 4U1IA 1BD2D 3OKDA 1P7HL 4R97B 2IPTH 5F1IA 3K74B 5EO9B 3LRSA 4Y19B 4K3HA 2ITDB 4WGWB 3L3OA 4O2FB 5IHUL 5CJOL 1JWUA 2GFBA 3VXSE 2H8PB 4Y4FB 4Z77B 2OMBA 1YUHA 1MQ8A 3ZKMD 4NC1C 5F89A 1E4XI 1C5DA 1K3IA 1EXUA 1PBYA 1PQZA 2W0KA 1MRCH 1PEWA 1RUQL 4HV8B 4OLUH 4WW2B 3WIHL 1RK1B 4G6JH 4JKLA 1TZHA 2Z9TA 5LWYL 5D8JH 3RFZC 1CBVH 1E28A 3EOTL 2Z35A 1VGEH 2AJVH 1IGFH 1QBAA 4TSAH 2ZOKB 5GGRY 5LAXB 4KAQH 5GGSY 3PWNA 3QDMA 2NY3B 3OKKB 5TE4L 2IH1B 4FQXB 1AD9B 3H3BC 4K7PL 1QSZA 1U93A 3WXVL 2B5IB 4L5FL 4WI8A 2Q86A 2F53E 5I6XB 4GKSB 2Q87A 4OF8A 1RUMH 4IIQB 3LKNB 1MHHB 4YGVB 1CIDA 1MPAL 3GSQB 4LSVH 3D69B 1LO0H 1DQDH 2X4QB 3Q6GL 3WS3B 5BVJA 1CXFA 2VZ1A 2DIBA 2HMID 4LLVB 3QQ4A 3ILPB 3RL1B 4X98B 3TBYB 2VDRL 3KYOB 3TVMA 4JHZA 3O6ML 4P2CG 3VFOA 3BD3A 3IDJB 4MCYB 2GK0A 1EHLL 3VWJA 1X4ZA 5B39G 1J1OH 3KXFA 4HLZH 4HIIB 5EN2B 1MCKA 1YQVL 3CLEL 4M48H 4Q0XH 3INUH 4WI9A 1EJOL 2ATKA 4U6YB 15C8H 4JFDB 5ELIA 2NY6D 5HGHA 3MRMA 1SEQL 4ZS6C 4GS7B 4UMGA 1K6QH 4XXDB 2BSTB 2HRPL 4ZUVA 1MCRA 3SN6N 1BECA 1CZ8L 3NVQA 3PNWA 1ZTXL 4OZHA 3EDJA 4KJQD 2GCYB 2EC9U 2NW2A 4OT1H 4AT6B 3HR5B 4G7VH 1JPFB 3HZKB 4Z0BH 2DWDB 1EFXD 3UMTA 1ACZA 1FFPB 1UKTA 3CFJB 1ND0A 4NGHL 1Q9LA 4YUEH 4FA8A 1G6RL 3UC0H 3MACH 3GRWH 3SDAB 1N2RA 5GJSH 1MIEL 2L0DA 1ONQB 4XC1L 2BSRB 5EU5B 3KYMA 1DUZB 1MWAH 4UIMA 5CGTA 2DIJA 4XNYH 3DRTB 2A74B 4CBPA 5TH2A 4G6FB 3P0VH 2W9DL 4LSSL 1VCAA 1ZA3A 2FH8A 3OB8A 2DM3A 4XWOC 1IKNA 1OAQH 3IDNA 1EHAA 4HWBL 4YHLH 1UH2A 3RY6A 1MSPA 4ODUA 4PJFE 4Y4KC 3UTPD 5IESH 2ZUXA 5E08H 1OWRM 4U1IB 5A16B 3OKDB 3DYPA 5F1IB 4PJGF 5JMOC 5D1ZA 3LN9A 3MV8A 4AEHH 3LRSB 1X9QA 4FQ1L 4MNQA 1N6QL 5FKAA 2UUDK 4K3EL 3L3OB 1JWUB 1I8IA 3WFHA 1QSVA 1UXWB 1MFAH 3FJTA 1YUHB 1W0YT 3HR6A 1P7QA 5F89B 1C5DB 3LPWA 5F3BA 3MLPA 1EXUB 1QP1A 4ZO9A 2R4SH 1BQSA 3MBXL 2P42B 1HOCA 5JUEH 1BJ1J 1BZQK 1E28B 2WLYA 4QF1A 4XAWL 3IFNL 2Z35B 4MQTB 5FUZL 3MYZA 1FNGB 3GSVA 4OLZH 1FYTD 3QDMB 4U6XA 2Q8BH 1Z5LA 4X7SH 1F02I 5GS0L 4KHTL 4Z76A 1NKRA 1U93B 1FRGL 5ACLA 4A2MA 3LIZH 4KRNA 4WHDA 2Q86B 3U7YL 1CXIA 1MREH 1MCSA 1AD0A 4IOFD 4FQJL 4H1LB 1GGCL 3T4YA 4OFIA 5IW6B 1TPXC 2FBJH 2VWEE 1KB5A 1T6WA 1OLLA 5I8OL 4HX1A 4YIQA 5EO1A 2XWJA 5BVJB 1GL4B 2VLRD 3QQ4B 4I77H 5FM4A 3TVMB 3VFOB 4B7LA 3F5WA 2GK0B 2BNUA 3VWJB 1KTLA 3ZYIA 4UT9H 4YXKL 2W9EL 5ISZD 1FPTH 2KKQA 1HH6A 3ALXA 3CDGA 3RNKA 4LVNB 2WWKO 3VG9C 5DQDH 2VDPH 3MXWL 3VGBA 2ATKB 3KNBA 2XZQL 4XP1H 4ETYA 5HGHB 3MRMB 1N64L 4JN1L 4UOW0 1LO4L 5EBGA 1RIHL 4PGCB 3NOIA 1TTGA 1YMMD 5IFHH 4TTDD 5DQ9A 1A6VH 3TA3A 3BRDA 1RIUH 3PNWB 4HF5H 1M7DA 4OZHB 2M2DA 2NW2B 4HHAA 3ARWA 4WCYL 2WBJD 4NM8H 2VTFA 2YBRA 5FDWA 3GNML 5K9KA 1ND0B 1Q9LB 1P53A 2ADJA 4LCCA 1IRAY 4RFOL 4DN3H 5L2KE 1A7PH 2J6EH 1XF2A 4R4ND 5HHXL 1N2RB 3OAUH 4ZFFA 3AVEA 4LLDA 1RAMA 4CJ1A 3BZDA 4URTB 4UIMB 4NQXB 3KLSA 5FOBB 2FCBA 3FMGH 1FE8H 2O5XH 4NO2A 4KJYA 4ALAL 1ZA3B 3V0VA 2R4RH 3IDNB 5CP3H 2VIRA 1HZHH 2X4UA 5TE7L 4ODUB 5D1XC 3NA9H 1JGDA 2VLKE 5GRXG 2ZPKH 1E4KC 1U3ZA 1H5BC 1K8DA 4L1HA 4PP1D 1J8HE 1R0AL 3MV8B 4PJHF 4MNQB 1A6ZA 3PHQA 3O9WC 5FKAB 1BPVA 1T89A 4WTWA 4Z8FH 1I8IB 3WFHB 3KPPA 5IKCA 4NKQB 1CDIA 2AP2A 5JOEA 4NFBA 1P7QB 4HG4J 3QIWD 1N3NA 4PS4H 4XI5C 5F3BB 4MX7A 1FLTX 4PUBL 1QRND 4P9HC 3UTSD 4DKFL 2ESVD 4TVPE 4V1DD 1HOCB 4NSKA 4L8DA 4QF1B 1NBVH 2NX5A 1WFUA 4K94H 3MBED 4OF6A 4X6DA 1KJMB 4J3SA 1F4XH 4U6XB 1Z5LB 3ZMRA 2CKBH 1NUFA 2VERN 1CIUA 4KZDL 4Z76B 4C55A 3MREA 4E0RA 3B2UD 4W6YB 2E6PA 4TPRL 2A9NH 5E94B 1BIIA 5D70L 3L3KA 2G60H 5C0BD 1JRHL 1AD0B 4JFZL 1KIUA 5B4MD 3BZEA 2PW2A 3T4YB 2FRGP 2VZSA 4WFHD 3LN5A 3HI1A 5CLWA 4ONOA 4JG0H 3CU1A 5E99H 1KB5B 3NN8A 1Q1JH 2AJYH 1OT2A 4YIQB 5EO1B 3NZ8A 2WQRA 2XWJB 2M8XA 1QBMH 4IRZH 3KJ4C 4POUB 3QEHA 1MHPL 3OB0K 3F5WB 4IHOB 4JB9H 4ONGH 3BKJH 2BNUB 1KTLB 1XGRA 4H8WL 4HS3A 3IKCA 1MJ8L 4YBQD 2O5YH 5ABDE 5I1AA 3A67H 1WFNA 5T1LD 4FFWC 3DV6A 5JIHA 4XP6H 1HH6B 3CDGB 4I0PA 3HMWH 2MQ3A 4GAGL 3KNBB 5E9DE 1KIQA 5CAYB 1KJ3H 5KANG 4J8RB 2CRYA 1HYRC 5CJBA 4Z6AT 3P73A 2VDNH 3U4BL 3D3VA 3TA3B 2VDLH 1DBMH 4EIGB 1VB9A 4ZAKC 1M7DB 5DFVC 2IFFL 5HI5D 3GUTB 2DLHA 3ULSA 3MRKA 2YEZA 2W38A 4UBDD 5HVWA 2YBRB 5FDWB 3HE6A 3ZHDA 2C3GA 3DX7A 3VW3H 3K8MA 2W59A 5L8JB 2ADJB 4LCCB 4MS8C 3D39E 3T08A 4C56D 2VN7A 3EGSA 1OGTA 4JFYA 5GGUA 4X4MA 2ZCLH 1XF2B 2MPAL 3R8QA 4ZFFB 1AE6L 4LLDB 4LARH 4MDIA 3RVVC 4LKXA 1NGQL 5FYJE 4NO2B 2JJWA 5ADPH 4KJYB 1OWWA 3V0VB 1AFVH 4DGYH 2VIRB 4EVNA 2MCPH 1JGDB 3DRQA 2D7OA 1QSFE 5F9WC 2DJSA 4HG4K 3MO1A 4KTDL 1K8DB 5DJYA 4JO2L 2QHLA 4HUKB 4LLYA 3PHQB 1E6OH 3T8XA 3U0TA 2AJZA 1WGOA 5D7IF 1R3KA 2F5BH 1G7LA 1FO0H 4XHQA 3KPPB 5IKCB 4JO4H 1LHZA 4LKCB 2AXJA 3OJMB 3B9VA 3RKPA 4LLMA 4MX7B 3UJJH 5IJVB 4UNTA 3MRBA 4NSKB 2X1XR 4L8DB 5C9KA 4M1DH 3P4LA 4JFFA 3FHQA 5B3JE 4X6DB 5TF1L 5DD1L 3NPSB 3WYRA 3S4SG 3HFML 2DBLL 3LY6A 1IEBA 3MREB 4WTXA 1BD2E 3CVIH 2ZUQC 3MNWA 3RGHA 3WSQH 1BIIB 2OJZL 5F7EL 3L3KB 2CLRA 3N06B 1AQKL 3SY0B 3BZEB 2PW2B 5D7JD 3MLYL 4KKCD 3AY4A 1ZMYA 3LN5B 3HI1B 1OD9A 1KEML 3NN8B 1A6WH 5ALCH 3Q6FA 4ODTH 3BH8A 4U3CA 2W0FA 1LO2H 3QEHB 5LG1A 1ZWIB 4AL8L 4Y89A 4YNYA 5K33A 1YEGL 1XGRB 4HS3B 3IKCB 4M7JL 4PJGA 3P0YH 3MRHB 1GC1L 4AM0A 2VDQL 4MA1C 4G6KL 1OD7A 2R2EA 1AY1L 1OM3L 1FSKC 1Q0XL 4H1LG 4QXGL 1XGYL 3U46A 5E4EC 5CLTA 1WITA 4G6AD 3NCEB 1KIQB 5HVHB 4LCIL 3I02A 3SOBL 3S36X 3JV5A 4RIRA 1JPGA 3D3VB 2AJSH 1EO8H 4XB8A 1LVEA 3ULVE 1HI6B 1C1EL 4ZO8A 3ULSB 1EPFA 2Y07L 4Y4KA 3M1BA 3C8KA 4MQXD 5FGCE 2Z8WC 1G0XA 3HE6B 3DX7B 2HRLA 2HA1A 4P0DA 1ZANL 4JFYB 5GGUB 4TNWK 1J0HA 1CICD 2E9BA 2XQBL 4IRSC 4OCYH 1JZ8A 5BOZG 1T2JA 1BGXL 4H20H 4NZJA 3RAJH 4MDIB 2CDEB 3ZYOA 4LKXB 1ZHLA 1VSCA 5FYLD 4LSPH 2YZ8A 3IFPA 1JGLL 4PGJA 3RJQB 5D2LE 5EWIH 4EVNB 3QIUB 4MDJA 1A3RL 2G2RB 2VOTA 3QHZL 3DRQB 4XGZA 2EE2A 1GOFA 4OD2B 5LBSL 2DYPA 1YEEL 2LU7A 3QO1A 2VDML 3WFBH 3MO1B 4KVCL 1NC2A 5DJYB 4X9HA 3CGTA 5FO8A 1MLBA 4U0RC 3ELAT 1KN4L 5T5NF 4LLYB 1OB1A 1X6LA 3T8XB 5ILTH 4OLYL 3MRJA 1U3HD 3T77B 1QPPA 3P2TA 4JFOA 1ZHNA 3MRRA 1G7LB 3EDEA 4MVBC 1OAZH 1N5AA 1BQLH 2R2HA 3NCJH 1WIUA 2NYYC 4LLMB 4RFEA 3WEXA 1WZMA 4TQEL 4G8GA 5JLZA 3MRBB 3VE0A 1CDGA 3RA7L 4LHJB 1OLZA 4GO6B 2NY5L 4JFFB 2KL6A 3U4EB 2JTDA 5D9SA 3UTPE 1KCRL 4LRNL 1IEBB 1S78D 1T0MA 3MNWB 5KSUA 1WZ1H 4N0UE 4ZPTA 1V3KA 2CLRB 1EEUA 3DSNA 2AS5M 3MLTA 4U1GC 2AKRA 4RAVA 4HAGA 4JFHD 1T4KA 4JPIA 5TDNA 2HTLC 4RGND 2VJXA 3OXRA 3DTXA 3SE8H 4HWNA 1DBBH 4OFPA 1KCKA 2UYLA 3BH8B 2Z31C 4KDWA 2LU4A 5K9JL 1LEGA 4X9IA 4F57L 3GJFK 3VRLF 1H0DA 4KK9C 1U42A 5D96B 4YNYB 4JRWA 4XVTL 4F33A 2NXYD 2XZCH 2D9CA 4IS6A 1SBSL 1QYGL 4PJGB 1UM6L 4OQTH 1NKOA 2Z93B 4PJHA 5TGBA 4AM0B 5CEZD 1ZT7A 4EQ3A 2FD6H 4Z7UF 4OM0H 2R2EB 1K9TA 1FYTE 3U46B 4OIIL 4RZCA 3S34H 2OTWA 4XVUD 4DVBA 3LSOA 4JKPL 5GS1C 3I02B 4MZ2A 3O8XA 3IFLH 3F58H 4RIRB 1ZS8A 1JPGB 2VLMD 5KVDH 1UFUA 1H3PL 3WNLA 1AO7A 3O41A 1QLEL 5C6TH 3UAJC 1GGUA 1P4BL 4X6FB 1CFSA 4DFIA 3TN0D 5D1XA 1EHNA 4Y4KB 3M1BB 3C8KB 5CIPH 2VLRE 3K0WA 4XNMA 5DLML 5DJDA 2O5ZH 1F3DH 2RIKA 1XCQB 1H5BA 1F13A 4RSVA 4WRLA 3STZA 2DLFL 5BCAA 3C8HA 2QQQA 2FL5A 1TJIL 3MXVL 5K59F 5ISZE 2EH7H 3O9WA 2HT2C 4BZ2H 3OF6A 1ZGLM 2ARWA 3UTOA 2FB4H 3FAXA 3LRGA 3SDDD 4TNWF 4CU8A 3MV7A 3TFKD 1HQ4A 1ZHLB 2D7NA 4JR9L 3MLUH 3D0VA 5F1SA 1PJ9A 4MDJB 2DJ4A 4XGZB 3BP7A 1MRFH 2Y9RT 2DYPB 4P4RA 3QO1B 4N5EC 3SBWC 1NC2B 3DBXA 5A3IC 4JM4L 3AREC 4JN2A 1U3JA 1CK0H 1JPST 1MLBB 3AS3A 5I30H 2EKJA 3BP5B 1AKJD 3E2HB 3MRJB 4JFOB 1ZHNB 1CL7H 1N5AB 1RU9L 3S9DB 3EYUL 2R2HB 1PSKH 4Q9QL 4JY6B 3JV0A 4OCXH 5DMGC 1TPXB 5L9DH 1I7RA 4L3EB 4RFEB 1A1NA 3HRPA 3WEXB 4S10A 3BEVA 4G8GB 2WWMD 1G9EA 3VE0B 1KGCE 3IAPA 4J23A 2XA8L 3CDCA 4O00A 1CI5A 4HKBA 4JHAH 1S3KL 4X6CF 2ZUUA 5JHLL 5D9SB 5L2JA 3DOSA 3AXLB 2QBWA 1OAUL 3O45A 3GM0A 4DVRH 4MB5A 3W0WB 3VG9B 1T0MB 1TJGL 5C09A 4NNPL 3V5DB 5KSUB 1WCBA 2V5RA 4Z95L 1FYHB 4NKOB 4ZPTB 3QPXH 1EEQA 4PRIB 4YBLC 3MLTB 4UTAH 4N8CL 2AKRB 4JPIB 5TDNB 4I0CC 5DC0A 3DTXB 3RKDD 5HDBF 4UIKH 4X9FA 3A6OA 4P2QA 5DRWA 2UYLB 2FEDC 4K7FA 4ZAKA 1BVLA 4LSTH 3ZKQD 2CJUL 4OZIF 1LEGB 2VXUH 5EZOL 3RVUC 1FORL 3VFRA 1H0DB 2EYSA 1T66D 4F33B 1QRNE 2ESVE 3NCBB 4V1DE 4IS6B 1S7RA 5SWSA 4ZTOL 2NXZC 4FMKA 5TGBB 4PJHB 1QLFA 1ZE3C 1ZT7B 5JR1L 3OJ2C 1TVBA 5DHVH 5KW9L 3CFBA 4RZCB 2OTWB 4A2LA 1JI1A 2E27L 3LSOB 4DVBB 3BAEH 4ERSH 3ZE2F 3MODH 3KXFD 3O8XB 2A2QT 1ZS8B 3BUYA 5I1GH 1V3MA 2YD9A 4GJTB 3V5KA 3ET9F 4YHYC 4P5MA 5IHZA 5D2NC 1DQML 2DQEH 1AO7B 3HAEA 3O41B 4L3EE 5HHMD 4GXUM 4WFHE 5CUSL 4HS8L 1CFSB 3C87A 1QFUH 1MCWM 1WAAF 1OVZA 2A6IA 4UT6L 4XNMB 5TFSH 5DJDB 3BKML 3FO2A 1RZ7H 3K2UH 4KJPC 3STZB 1F8TL 2FL5B 3O9WB 3W0WE 3HA0A 3L1OH 3RY5A 4M3JA 1YEFH 3V0WL 5JW3L 1RD6A 3QT2A 4NBXB 3VG0H 3SKUD 4PRIE 3C5SA 2VKXA 1HQ4B 1NJ9A 3ISWA 1XGQA 5I1CH 4M5ZL 3ARVA 4ZOAA 3WN5C 3D0VB 2V2TA 5CINL 2R2BA 4UNVA 4H0HB 5TPWL 2DM2A 4FQIH 5D72H 2XY1A 3BP7B 4LL9A 3GKWL 5D1QC 4P4RB 5KJRL 5I8KH 4D0CA 4JN2B 1U8JA 5LVEA 4JZOA 2Z8RA 4XBGA 3VMNA 3PHOA 3OKMA 3Q1SH 5C0ND 2YN5A 4LSRH 4S1DC 4XTRD 2F8OA 1MI5A 2YZ1A 3BIBX 2KDGA 4HBCL 5D1ZD 2QV2A 2P5EA 4IM8A 4CADA 2CDFA 5D93C 1I7RB 3VXPA 1FL5A 5E00A 3DECA 2I5YL 3ZZ1A 3BEVB 4QYOB 3KJ4B 2XG5A 2X09A 1SM3H 5DJ2A 4NJAL 4M1CC 3R4DA 1P7QD 4OBRA 4HKBB 4JANA 4U6VL 4F58L 4HKZA 3TBWA 1BEYL 5SWZA 3O45B 4FTVD 1Z3GL 2E8ZA 3DLQR 1XR8B 5C09B 5F3HB 1WCBB 1JRHI 4BKLA 3EYFA 4TVPL 4BQBA 1A7OL 2X1OA 5E24E 3RZCD 3VJ6A 3OAZH 3DHMA 5KG9A 4P2QB 5L6YH 4NKDA 4K7FB 1BVLB 4NBYB 1WEJH 3VFRB 5I19H 2EYSB 3TO4C 4DQOL 4XHJD 4UILL 1X5LA 1G1CA 2DN7A 4R2GD 5L0QC 5SWSB 1Y18A 1QLFB 2RCSL 3ARDD 4MQSB 5ESQA 5T3ZD 1CN4A 3FQNA 4HWEH 1TVBB 1U8IA 5IGXH 5D7IB 3CFBB 4KTYA 1NCCL 3EYQD 4IRSA 4N0RA 1W8OA 2QJDA 5DD5H 1F4WL 1YEHL 4Y88A 4HXBL 2NTSP 1R24B 2XZZA 5BVPH 4PBXA 1MEXL 2IH3A 3QR2A 3BUYB 5C08A 5DEFA 3V5KB 4U49A 2OQJB 1OP9A 4P5MB 5IHZB 2FJFA 3O2DA 5MEPA 3EZ8A 2RGSA 3HAEB 1UCBL 2CK2A 5GRVK 3D1MC 2WIMA 2PKDA 3H2WA 4AJ0A 2A6IB 2XNAA 4LRIC 3FO2B 2FJGB 3VFVA 1CFTA 4JPKH 3JXAA 5I1IL 1JZ4A 2OI9C 1CD9B 3NIFF 2UZIH 3QNXA 4P2OA 2DD8L 4JQXC 4LPTA 3K8LA 2FX8H 5A2LH 4DOHB 4N0CC 4M6NH 5EZIL 3C5SB 5ACMA 1NJ9B 4YEEA 1UGNA 4ENEC 1XGQB 4RWYL 3WFDH 3A6BL 1P9MC 2V2TB 2YC1A 2GSGA 2R2BB 4J7RA 1KPVB 5HYFA 1C7SA 1WSST 4FXKA 1YJDH 5DYOA 4TNVK 2O26U 3UYPA 2ZUVA 4Z7UA 4C54A 2VC2H 1U8JB 4LHUA 4ZSOA 1VPOH 4JZOB 4I2XB 5J6GA 4K23L 2MKWA 5D6CA 5FYJL 4XBGB 4ELMA 3PHOB 2ZUQB 5HYJA 3BDYH 2VO5A 3K80A 3WD5H 5D7IE 3WV0A 4AH2A 2N1KA 3UZEA 2ORBH 5CJXC 1MI5B 1YEIH 3C09C 3HI6L 4ZMAT 5TE6L 3O6FC 3BKYH 3BN9D 2NY7L 2P5EB 2BSSA 3BO8A 4CADB 3VXPB 5E00B 2VXQH 4UINH 2Z31A 4D9LL 4PRHD 3ULUC 5FYLE 5KAQG 5C0FA 5DJ2B 3AROA 5GS2D 3L3IB 4IRJD 2DAVA 1K85A 4JANB 5J4MA 3CXHJ 2I9TB 3QQNA 4NRZB 4QNPE 3F6IA 3TBWB 5SWZB 2X5PA 5L8LB 4MA1B 4TRPL 3IDIA 1XH3A 2NX5D 3KPSB 5FYKD 1FSKB 1WIPA 3VMOA 5E4EB 4BKLB 3REVA 3RJDA 5GS1A 1HXMB 1UZ6F 3DX9A 2CGRH 3UXFA 4JHBA 4JY5H 3VJ6B 1YEKH 1IGMH 2DQDH 1KCVL 5KG9B 4JDVA 5F9JA 1INQA 4KK5D 4LSQH 1IGCH 1JHKL 4K2UL 2XQYK 4G7YH 4CVXA 3ULUF 4G80A 5HI3C 3QH3A 1FBIL 4WO4D 5E1AA 4K9EC 4MJ4A 4U33A 1Y18B 1BVKA 1RZFL 2DM4A 1MFEL 3MLXH 5FCUH 4PD4J 2QSCL 3FQNB 1X5GA 3T2NL 4I2XE 4NN7B 5HGDA 3GBLA 1GPOL 4I0PD 2YPVL 2PTVA 2BOBB 3CMGA 5C08B 3QUKA 1JCKA 1ED3B 3OX8A 2BY0A 5MEPB 4JFHE 3H42L 4RGNE 2BP3A 4KMTL 3ESVF 1MJUH 1L6XA 3IXAA 1NLBL 4DKEL 5EB9A 3ZL4H 2XNAB 3LZFH 5HYSA 1NL0H 5EU6A 3JZ7A 3SBWA 3MRNA 5EO0A 1AIFA 3AREA 3DVIA 3VFVB 1CFTB 2HTKC 4J6RL 4U0RB 2E3VA 1I85C 2LQRA 1F5WA 3KPSE 3QNXB 1PAMA 4P2OB 3ULVL 1EA9C 5IMKA 4BA8A 2FYYA 3QUYB 2VE6A 1PFCA 3JVGC 1NCAH 2OZ4H 1AC0A 5T5FH 1K2DA 4XVJL 5IBTH 4NOFA 3P11H 1NMBL 4OZIA 1EGJL 4DW2L 3BOVA 4EDWL 5HVFB 2YC1B 2GSGB 5GRUL 3QAZC 2AV1A 3MLSH 5CCKH 1JFQL 3GJEA 2I60L 3U36A 2EXYC 2WSKA 2AJXL 3QRGL 4FXKB 1G9NH 3GJFA 2WW8A 1S7XB 5DYOB 5C92A 5KSAC 2VITA 3OZ9L 4Z7UB 2ICEA 3VFPA 4OLVL 5EBMA 4G9DA 1OAYH 4LHUB 4ZSOB 5HHNB 5IVXE 5J6GB 4P5TA 1F4YH 4Z7NF 5D6CB 4M61B 4TNVF 2VL5B 1GRWA 2DL9A 3G6DL 5HYJB 1VADA 1ZVSA 4G3YL 4ZUUA 5TDOA 2P5WA 4AH2B 1ZLSL 3SQBA 2XTJC 4U1GB 5IB2A 3CXHK 1NCTA 2R29L 3VFGH 3BO8B 2BSSB 3DIFA 2Z31B 2RJMA 5JXAH 1P69B 4YDKL 1QKZL 1WAAA 1DJSA 3GB7A 5EZLB 2BOCA 3DXAA 1JPSL 1NCWL 3OG4B 3HNVL 3W2DL 1BF2A 2AJUL 1Y6NR 2OL3H 2APXA 3PG2A 3CVHH 3O3EA 4KXZI 2HJKA 3IDIB 4LVOB 1XH3B 3KS0J 4XNXH 3N85H 3CLFL 1SJHB 3EO9L 4JFFD 3RPIA 3V9FA 5GS1B 3DX9B 4FABL 1JGVL 4ETQA 3OPZH 1U6AH 3A6CL 4PD4K 1KJ2B 5D2NA 5BXFA 4WEUD 5F9JB 1VGKA 1B9ZA 1INQB 1DVFC 4ZS6D 3OR7B 1NC4A 4CVXB 5A1AA 4G80B 3QH3B 1KELH 2WUCL 1AP2A 3T3PF 1BVKB 2Q3AA 2YD5A 3WLWC 1I1AD 1XCTB 4KV5E 4LCUA 3RWEA 3NFNA 5E8EA 3MGTA 4HC1A 5F8QC 3QUMH 1KJVA 4X99B 5SV3A 1KXTB 5L88H 5HGDB 5I74C 2IAMD 4J3OC 1F58H 2JJTA 1B88A 1T04A 3QUKB 3BXNA 5SX4H 3OX8B 3H9SA 1W2KT 1DCLA 3VCLA 4F9PC 3WN5A 4I18A 4YFLI 5DQJB 2Z8VC 3LEYH 3IXAB 2AEPH 2APBA 3G9VA 4X6CB 5F6HI 1FZMB 5D1QA 4L8BA 5HYSB 4JPVH 5EU6B 4GQ9H 3MRNB 5EO0B 1AIFB 3AREB 4XWOD 4Y4KD 5CP7A 3BT2L 1I8KA 1B3JA 4WTZA 5IMKB 2FYYB 2Q3ZA 4ODSH 2DQHH 2VE6B 1IEAA 2ITCA 5ADOH 3NZHH 2IQAB 2FATL 4P2RB 3VI3F 1S7SA 5IFJA 4KZEL 3TEUA 4M9OA 5ITBL 4OZIB 3WNOA 1DSFH 2Q76A 1TZGL 2QSQA 2XACC 3LEXA 1ORSA 2AV1B 3GJEB 4GKOA 4M93B 3U36B 4XPTL 4NWTH 4M7LH 3GJFB 1XZ0B 3MRPA 4XPHH 4DUVA 1SMOA 1IGTA 5KBNC 4OSUH 2ICEB 3VFPB 4TULL 5SV4A 3MLVL 1ZLWK 5CJQL 4P5TB 4B50A 5FA4B 5KSVB 1ZVSB 4KK6C 4ZUUB 5TDOB 4OF3A 2P5WB 2EZ0C 5BZWA 1XF3A 5CS7A 4CMHC 5IB2B 2IALA 3JBG7 1KUMA 1P2CA 3L3JA 2HG5A 4R0LA 1UA6L 2QL1A 1MH5B 3ARUA 1BMGA 1P6FA 5ERWA 5ACZA 1URLA 1KG0A 2X89D 5LWYH 5IVOA 4P23C 3QUZD 1IGIL 4K3GA 3GB7B 3EOTH 5GGQL 3TO4A 4LCYA 3DXAB 4U1MB 4X4XA 4ZD3L 5CILL 2ID5A 2G5RA 4F80A 4X6CE 2NXZB 5TE4H 4CGTA 3CK0L 4QEGA 3V4PH 3O3EB 1OP5H 1N5YH 3KG5A 2HJKB 4N0YL 1JIBA 3WFCH 4G9FA 3RPIB 2OYPA 5IFAL 4PRAA 2DQCL 3V6OA 5HY9B 3GIZH 3HMXH 4M43H 4DFHA 5CGMA 4OLWH 3WNPA 1B4JH 3GMQA 3T0WA 5E2WL 5TQ2H 4YHYB 5D2NB 2EIZB 4P2RE 1VGKB 3RVTD 1IC5L 4CU7A 1H15A 5IBUB 2EIDA 3ETBF 3ZHLA 1IKFL 1NC4B 5IMOB 3SEPA 3CUPA 3VGGA 5L8KB 4HZLA 1EHLH 1IC7H 2CMRL 4XAKD 2XZAL 1R3IH 5J57B 5EOQL 1MUJA 4LRIA 3IRZA 3D5OF 4KWUA 2AI0L 4LCUB 4FMFA 3RWEB 1A1MA 1AXSA 3MGTB 5E8EB 4G42A 4E42A 1EIBA 4FP8H 4I8DA 3QI9A 1KJVB 1A2YA 4AQ1B 4FTVE 4QRRD 2QQLL 4JQXA 4MXVF 3Q5TA 4OLXL 2A9ML 1X5YA 4R4FH 1UYWH 2FR4A 2IG2L 1HIML 1KCSH 1T04B 5H94A 5DZOA 4YX2H 5E6ID 3H9SB 1P5UA 2BRRL 5EZJA 1YMHA 2PTUA 5LQBL 3VCLB 3WN5B 3IDXL 1P9MA 1ZTXH 4I18B 4XP4L 2X9WA 5C1MB 4GSDL 5I66A 1F45A 3KDMA 4QRSA 3LEVL 2BSED 3IFOA 2FECL 3MTRA 4PY8I 2PYEA 3PWLA 4L8BB 3SE3C 2Q8AL 3P4NA 5GIRA 5D1XD 2AK1L 2Z91A 1IAMA 3KHQA 4KC3B 2GJ6E 5CP7B 1I8KB 3H6JA 1AHWC 3HZYA 5I76A 3N1MC 5T3ZE 4JKMA 5CJXA 1T1WA 3IDYC 3K3QA 1DBKH 1IEAB 1OTSC 2VLJA 2ITCB 3O6FA 3MJ8A 2B1HL 5D93B 1S7SB 1HINH 1OPGL 1A22B 3B8SA 5IW1A 1D5IH 2Q76B 3OF6D 4MXWL 4Y16C 4K3JH 3QQ9C 3LEXB 1ORSB 2VZUA 4QWWC 3CZFA 5DGQA 3MV7D 4UOJA 1N4XL 3MRPB 4XI5D 4JRYD 1HCVA 1IGTB 1I75A 5I1KH 2C4FT 1VFAA 3UROR 1NGWA 4ACPA 4QHNA 2ZUTA 1RUPH 1T83C 4KRLB 4E9LA 1NAMH 1N6QH 1CVSC 1KXQE 5E8DL 4YQXL 3ZHKA 3L5JA 5BV7H 1F4AA 5IB1A 1JHLL 5BZWB 1XF3B 1U0QA 2BHYA 2IALB 5IOPA 1P2CB 3GSWB 1JPTL 3L3JB 2HG5B 4R0LB 4U0QB 4YEFA 4PV9B 1SYSA 3OSKA 5ERWB 4D9RE 2R0WL 1V5JA 1MRDL 3H9ZA 1KG0B 1LDSA 2K3TA 3OAYH 1D7FA 3M07A 3VH8A 3TO4B 1Q9OA 4PP2B 4LHUG 1WV7T 4OJFH 1GGBL 4X4XB 5D7LA 3PGFH 5DZLA 4S1SL 5C0CD 3VRJA 3UJTH 4MJIA 4FNLL 5L0QB 4WUKH 4YK4C 5GS0C 3BGMA 1A02N 2P24B 3EKCA 4KHTH 5D6DA 5GZOC 5GGTA 2AABL 1TETH 1ZLUK 1T2QL 4KUCD 4G9FB 5T1KD 4PJIF 4JRXA 4WFGD 5MENE 1KC5L 3TT3L 4FFWD 1G7QA 3TJEH 2H41A 5HPMA 1LO3H 1R3JA 2A6KA 3WKNA 3GMQB 5I8OH 4YZFF 3QEGL 3CMOH 1FG9C 1GGIH 4OD1L 1H15B 1JTTA 1ZKAA 5DMYA 2CK0H 3IU3A 5B38A 3CUPB 3G5YA 2BVEA 5AYUL 1ADQA 3SJVB 4FG6D 4GKNA 4KKLC 3MRQA 1S9WB 4PRHE 4NCDA 1SY6A 3TM6A 2W9EH 1BZ9A 2VXTH 5E0QA 4ZAKD 4BYHA 5IQ9A 5C0IA 4HQQL 5E4IA 1A3QA 5DFVD 1A1MB 1AXSB 3WFEL 1BBDH 1C5BH 3GI9H 4NQEA 4G42B 4RFNC 5CBEA 3VRIA 4E42B 4EUPA 3QI9B 3MXWH 3W9EA 1A2YB 2OI9B 1I85A 4GAYA 5DJXB 5J89A 1OGAA 3I6LD 4P4KB 3G6JE 3N50A 1BJ8A 4ZUWA 5JQ6L 1S7TA 4ZPVA 4MS8D 5E2VH 3JVGA 3DMMA 3MJ9L 1F00I 1NCUA 5EZJB 4R8WH 5T3XH 2AXHA 4PV8A 3KDMB 5I66B 3RVVD 3MLRL 2ZWLT 32C2A 4MLIA 1IQDA 1WBXA 4QRSB 3IFOB 4EI5D 3BEWA 2PYEB 3PWLB 4Q6IC 1SHMA 1FAKT 5KSAA 5F1NB 1DBAH 4M6OH 4PJAF 5HHOA 4YR6A 4YHOH 3P4NB 5GIRB 1HKLH 3O6LL 1WBYA 5I18H 1MHEB 4OUOA 3JV6B 1Q9KA 2Z91B 4X0KA 2AVGA 3HZYB 1A5FL 1DEEA 4OZGE 3BRGC 1D5MA 1OTUC 2R1YA 4QOKA 5CFHA 2VR4A 4M4PA 3IU4L 3RWJA 2VLJB 3O6FB 3QRFM 3MJ8B 4M7KH 3EBAA 4WV1A 3GBNH 3T4AA 2V7NA 5F7FA 2CPCA 1F90H 3CZFB 4M4RA 5DUPL 3MUJA 3CDFA 3BI9X 4YDIL 4AIXA 1BQHA 1CE1L 4EN3D 1Q0YL 3AB0C 4IEFB 3SJVE 5FAAA 1VFAB 3D9AL 1NGWB 1ZEAL 4QHNB 4MAYC 3GK8H 5HD8D 2V7HA 1G7PA 1UM4L 4RMUA 1GIGH 5IB1B 4F7TA 3KLAA 3RIAK 3CXDL 5IOPB 4M1GH 4AENA 3CX2A 1RJZA 5AWNH 3QEQA 3E3QC 4H88H 4PUBH 4NUGL 4XCNA 1X6NA 1HHHB 3SGJC 3ZO0A 1MIML 3VH8B 1Q9OB 5D7LB 5J1AA 4MJIB 4Y0GA 3LHPH 4YJZL 3U0PA 5E8NA 2WUBH 3BGMB 1KTRL 2ATPA 4Z7VE 5IROC 3LVEA 4OKDA 2IJ0C 4GG6E 2W65A 5B3NA 4JRXB 5CHNB 5DD6A 1UZ6E 3NACL 5FYLL 1G7QB 4KVNL 2MHAA 3GSUA 5HPMB 4DK6A 3TT1L 4YHKH 1CDBA 3WDJA 1R3JB 2A6KB 3Q5YA 4JQIH 3U7AA 3HE7A 4F9PA 2NLJA 4HPOH 3ZE0F 5GZNC 3IU3B 1D5BB 1DQLH 2NR6C 5B38B 3IRPX 1Z9SA 3G5YB 1MJ7L 4JPWL 4H8WC 4GKNB 1A3LH 3MRQB 2HYMA 3TO2A 1BZ9B 5E7BA 5GS3A 3ROLA 5IQ9B 1C5CH 5C0IB 1TDQA 4PGZA 4PRPD 1YPZE 4EUPB 5CBEB 3LDBC 35C8H 5FV2A 3W9EB 4E41D 3DYMA 4GAYB 3IJYA 4KTEH 1OGAB 4Y7MA 2XN9A 3FTGB 3KR3L 1I9IH 1DEDA 3JWDL 3O3DA 5FIEA 1S7TB 4ZPVB 3B9KC 4CJ0A 3DMMB 4LBEB 3H3KA 2F5AL 1E27A 1DFBL 3FFDA 4IRSD 4P3DB 2EDDA 3QAZB 2H32A 1YN7A 32C2B 3ZTJH 1IQDB 1WBXB 3PDDA 3Q48A 3BEWB 4R7NB 3I9GH 3O2VL 1OAKL 1PZ5A 3KAAA 4G5ZH 5C6WH 4YR6B 5HHOB 5BRZA 2IEPA 1WBYB 2A77H 1YYML 1Q9KB 2DQTH 4X0KB 1CU4L 4HCRH 1WIOA 1D5MB 1FFOA 2R1YB 4QOKB 1AE6H 2XTJB 4IDJH 4YWGL 1PY4A 3LKSA 3RWJB 4X7DC 4GAJH 3MROA 4MXQD 4WHYH 4R90L 4WV1B 3T4AB 2EEBA 1J88A 2P8MA 2V7NB 5DURB 3WIHA 1IBGH 1XAUA 4MVBD 2VZOA 4P23A 2D31A 1BFTA 1T03L 2NYYD 1BQHB 5HI4C 4APQC 3KLHC 5HDQH 3L3DB 3PQYE 4BZ1H 3BH9B 4UT7L 5MHSD 3FQUA 3WE6A 1NLDH 1U8HB 5TQ0L 5I1EL 2V2WA 3BGFC 5BMFH 4OD3L 2V7HB 1G7PB 4ZFOB 5E2UL 4KGLA 1JI2A 4LMQI 2FIRT 1OOAA 3WS6C 4F7TB 3KLAB 3MLZH 1YEJL 2UWEF 2VUYA 3ZDYF 4AENB 5F6HJ 2D7QA 3VFSA 1RJZB 2RQ8A 3RIAF 1Z6JT 1YNKH 4XCNB 5EIVA 3SO3C 3O6KL 5C8JA 2PNDA 3IJHB 1JNNL 3VFUA 2CIIA 3HC0A 5J1AB 3U0PB 2DQUH 1KIRA 2ATPB 3D85A 4QO1A 3QHFH 4KK9D 2BNRD 4M03A 3CX5J 2EDJA 2PXYD 3PP3K 4O9HL 2W65B 2ZUWA 1D3CA 4IMLA 4JE4B 1OCWH 2OJZH 4OF5A 5I74B 5DD6B 5DT1L 4ZNEA 5EULV 4HDIA 5DFTA 3GSUB 4HJJL 3L6FB 5DD3L 1G7HA 1I7ZA 2ZJSH 3HE7B 2WWKT 2NLJB 2J7LA 4S1RL 3I50L 1W72L 3I75B 3VXUD 3BE1H 4LLWA 1T7XA 5LGHH 1YEGH 2V2XA 3F7PC 3MA7A 2DQIH 4TUJA 3T3PE 3TO2B 2F9BT 3ROLB 1GC1C 1RURL 3JWOH 3UAJD 1JN6B 1QFOA 3MRIA 4G6KH 2EC9T 3HRZA 1G6RA 5BS0D 2ED9A 2XXCB 2CH8A 3IJYB 4WWKC 5BW7C 4PJXF 1AHWA 3ARBC 3V52H 4GG8A 2XRAL 3B6SA 3CSYA 3SOBH 3O3DB 4ZFGL 5DEZA 2ILLA 4P59L 4NM4L 3KPLA 3SGEI 3DSFL 1E27B 4UQ2A 2EXWD 3FFDB 2WANA 1CQKA 2HT2D 5DA0B 5I71C 3FRPA 4C59B 4J3XA 2ZKHH 3DPBA 2H32B 1YN7B 4HWBA 2G75A 5EOCL 5HJ3B 1MVUB 4LASH 1LEKA 4NNXA 3LS5L 1QEWA 3MOBL 3HB3C 5BO1L 2B4CH 2MCG1 4QHLA 5BRZB 4XAKE 3VXRA 1T83A 1XR9A 1KIPA 1RULH 3L7FB 1V7MH 3CIQA 3TLRA 1FNAA 1MJJA 5EU6D 4CDGC 1FFOB 3KWWA 1M1SA 1KOAA 4LCWA 4CMHB 3LKSB 2MJWA 1LP9E 4NN5C 2AXGB 5DSCA 4JAMB 3MROB 4QRRE 3DUHA 4KJWD 2FGWL 3VI3E 3FOLA 2D4FA 1ZVYA 1CLOL 3UBXG 1AGDB 2P8MB 5F8RC 1D5XA 3RUGA 2PO6B 4C4KO 1F2QA 1A3RH 2DRUA 4GRLC 2D31B 4PJEF 1J0KA 1FQ9C 4D0DA 5FUOH 1TMCB 1QVOA 2HT4C 4LIQH 3SKJH 2YXFA 1MFDH 1CFBA 3FKUS 4LF3B 3TGXA 3QCUH 3FQUB 1NDMA 2HKHL 1EDQA 2V2WB 3S37H 2VR5A 4WGVB 4R7DA 4MNGE 2A0LC 1KJ2L 2BXZA 4ZTPL 2PYFB 4PY8J 4HD9A 3VFSB 4X4ZA 5C07E 3P30L 3AU1A 1P5VA 1GGYA 3KHOA 2QQNL 1TZIA 2QQKH 1QFPA 4D9QD 2P5WD 3CX5K 4Y4HA 3QZWB 1VEMA 3F6LA 5HGBB 2DWEA 3I2CL 3FB6A 2NY5C 1T1YA 3BDXA 3VFUB 3HC0B 1WLHA 4PJAA 3C5JA 2F58L 4EXKA 3D85B 4QTIH 4O5LL 5AZEL 4JRYE 1YYLL 4IMLB 1OQOA 4HLZG 5IR1A 1HDMA 3ZDZF 4YPJA 4G8FA 4GLRI 2YPLA 4I0KA 4HDIB 4X7TA 1XIWD 4Y8AA 1G7HB 2EDHA 1KBGH 5EIIB 3PABA 3WL9A 3NTCH 4LLWB 3MRGA 4KRPB 2FX9L 4PJ5A 4CVZA 2V2XB 3BD4A 3MA7B 4Q6IA 3BKCH 5I2IA 2B2XH 4TUJB 2IGFH 2Q7YA 3CFEA 4NO0A 3MRIB 5C0CE 2R9HC 3HRZB 4I13B 1G6RB 1QHOA 2ZP0T 5IK3A 4MAUH 1AHWB 1CDUA 5J06A 4GG8B 1FG2B 3B6SB 3BPCA 1E4XL 3AAZA 4KJPD 1CR9L 3T0ED 4QGYA 1U36A 2EICA 3KPLB 4W81A 4UQ2B 5IG7B 2EYTA 1FC1A 1WFTA 2FECI 4OZFH 2G75B 4ONFL 4NNXB 1QEWB 2VXVH 3GGWA 5IM7B 4UTBL 1ZLVK 2JIXB 4YXLH 2OP4H 2DMCA 4JFEA 3S35H 2F54A 4WU5A 1UADC 4OTXH 4QHLB 4ZOCA 4Y4FC 4PJIB 2GQHA 3KYKH 1HWHB 1XR9B 1KIPB 4AMKL 4EIZC 4MAYA 1BJMA 4JM2D 5D1QD 1MJJB 3STLA 3S36H 3KWWB 3TPUA 2D0HA 4G6ML 1TENA 1PX3A 4FQ2L 4LCWB 5A2IH 2W9LA 5DRZB 5DSCB 4AEIL 3S5LA 3I6LE 2DQGH 4OIAA 1KPRA 2LV4A 4JR9H 3FOLB 2FLRT 2K1MA 2VDOL 3LV3A 4XX1E 1D5XB 4JO1H 2BC4A 4DAGL 2V9RA 3ARYA 2XT1B 4FQCL 5T33L 1IZKA 4XC3H 3UEZA 5E03A 4FQXC 4X5LA 2NPLX 2CO6B 1UKSA 1DBJH 4PGEA 4NQCD 5DD0H 2R0LL 2HKFL 5T3ZL 4YFLF 1QVOB 4D0DB 5DGRA 4WU7A 4XPAL 4OM1L 4YK4B 1J1XL 1A64A 5IROA 4XWGH 1NDMB 1DL7L 1A7RL 1OTTC 3LKPA 3IJSB 4BSWA 4R7DB 2DKMA 1NGXA 2ADFL 2AK4B 1JNJA 3GMMA 1D9KC 4EBQH 3HG1A 4MMZC 5C0AD 5CEZH 2GYSA 2DS4A 3AU1B 4PRNA 4ZYKA 2NY1D 1TZIB 4NJ9L 2H26A 4GW4A 3GMNA 3OXSA 2XQYG 4Y4HB 4JDTH 2DWEB 3MQIA 1FL6B 1NAKH 4F7PA 2XA8H 3QFJD 3T65A 3FB6B 4BSJA 4PJCB 4LLUA 4XCCH 3SCMC 5T1DH 3T2PA 4PJAB 4XPBH 3C5JB 3FT4A 4PYHA 1OAUH 1G9ML 3VWKC 3O4LE 1B90A 2YHGA 4HBQA 1KFAL 4PJDE 2FH6A 4PJIE 2VABA 5IR1B 1HDMB 2CRMA 1IM9A 2MTPA 2YPLB 3BN3B 3QDHA 3SQOL 3WJJC 3HZVA 4QRUA 2E7LC 3MYJA 3B9KA 4X7TB 2E5EA 2ZSWA 4PJFF 4G9FD 3TNNA 3MZTA 3U9PL 2B1AL 4F2MA 1TXKA 4A6YL 3WL9B 1PKQE 3R1GL 1FVEA 1RZJH 3DWTA 4DGVL 5F7UA 3MRGB 1SQ2N 2SEBA 3U6RA 2ENSA 4GMTH 4Q6IB 1NMAL 5I2IB 3SDAC 4QCIB 2Q7YB 4QRPE 1EERB 4JO3H 2VWEC 2XY2A 4U7SA 1OHQA 3ZE1E 5IK3B 1D6VL 4RA0C 4WY7L 4MB4A 5D5ME 4BK5A 1PG7W 4NOBA 3BPCB 2AK4E 1EX0A 3AAZB 4TOYH 1JWMB 3ZKXC 2JB5H 1VENA 4XBEL 2EYTB 1RZKL 1ITBB 2HFGH 3KPQA 4BH8A