5JORA

Crystal structure of unbound anti-glycan antibody fab14.22 at 2.2 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
218
structure length
218
Chain Sequence
DVLLTQTPLSLPVNLGDQASISCRSSQTILHSDGYTYLEWYLQRPGQSPKLLIYRVYKRFSGIPDRFRGSGSGMDFTLTISGVEAEDLGIYYCFQGSYVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab14.22 heavy chain
publication title T cells control the generation of nanomolar-affinity anti-glycan antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 50
structure length 218
sequence length 218
chains with identical sequence C, E, L
ec nomenclature
pdb deposition date 2016-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jorA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jorA01
5D8JL 5AG8A 1ZEAL 2ATPB 4ODTL 2CDEB 4NC0B 1NLDH 3HE7C 3MJ6A 2CDGB 4GXVH 5BQ7B 1TLKA 4KK6C 1OPGL 2AK4A 1YJDH 1I7ZB 4XGZA 4UDTB 5HYSG 4U1HB 4O51A 2BXZA 2O5YL 3K8KA 2X4QB 3S36L 1X5FA 1MHCA 1WCQA 2PF6A 3PL6C 1RU9L 1VKXB 2WBWB 3RA7H 4K71C 2BNRB 4ERSH 1P2CB 4TNWK 2LV4A 1FBIH 1JYWA 2PYED 2IH1B 4OZ4B 3GBNL 2GY7B 2EE9A 2VLRB 4X9HA 1OQXA 1GXEA 4N90D 4QRPB 4XNXH 5IMKA 4GQ9H 1OTSD 3LN4B 1HOCB 3L3GB 5FV1L 1AGCA 4L29B 1FVEA 4NQVB 4V1DA 3H9SE 4NCC1 5KANG 4ZFGL 1U58A 4KZDH 4TSAL 1YEKH 2XNAA 3MBEA 3X13B 3HPLA 2Q8AH 1W72H 1EFXA 3WXVL 1XR9B 2QR0B 3SPVA 2FBJL 2RIKA 4GSDL 4ZUWA 3R06B 5DVNA 4G9FA 5EULV 3WFEL 3NCMA 3LKSA 1HDMA 3L3DA 3RU8L 2X05A 4XVJL 4PJFE 5DVMA 2ED7A 1V7ML 4JFPB 4R0LB 3GRWH 5GGSB 4P4RA 4XHQA 4KI5C 4ZUTA 3AY4C 2VAAA 3QUYB 3T0XA 3E2HB 4JRYE 1Q0XL 1N8ZB 3AU1B 1U91A 4L4JA 3K8MA 1YMHA 4J8RB 1UYWH 4PR5B 1RD6A 1CD1A 5F9AC 2ENSA 2R56L 1QSVA 1T22A 3ESUF 2ENYA 2YBRA 4JFFA 5I1HH 4ZS6D 4IMLB 3CVIL 3IRZA 1CVSC 1FVDB 5I15L 2FGWH 3BH8A 4XAWH 1S9XB 4KZEH 3QFJA 1A7QL 2MKLC 3KXFD 2DICA 3O9WD 1SJVA 2OK0L 5LBSH 1N2RA 2JELH 1WZ1H 4G6KL 4Y88A 4D3CL 2Z31C 5I8EB 1QOKA 4HUWB 3TJEH 3VFGL 1IRAY 4XBPB 3QDHA 4KUZL 3HLAB 1FGVH 1N0XH 5IQ7H 1KCVH 1MCBA 4OSUH 1HEZA 4ZNEA 3LH2H 2ITCA 5FO8A 4JCLA 4Q0XL 4OUOA 1UCBH 5KVDL 5E5MB 4XPTL 1MFBL 3MROB 3CFDA 3STBA 4Z7WB 4LAQL 2NYYD 2XTLA 2FJFB 4PRPA 1KCSL 1RIVL 3P0YL 3HPJA 1G1CA 1JRHI 1K6QL 5J1AB 2KBGA 1U8MA 2DLEA 4DZ8A 1F3JB 4GRWE 4KK9C 1SYSA 3V0AC 1CFTA 1U8QA 3I3DA 1RIHL 5JZ7C 3EO0B 3HE7D 3H3PL 2EXYD 1UM4H 3C5ZC 3JTSB 3AAZA 1LEKA 4RGMB 3Q2CA 4DGIL 3KPRD 4ZPVB 3GZKA 4N0CC 3KPQA 3PL6A 3BUYA 1EO8H 3QUXA 5D2LA 4Z7QF 3MZTA 1G6RB 3LQZB 1SY6L 2C4XA 5GS0H 2IFFH 1WTGT 4OCRL 5JPNB 3QG7H 1HI6B 1KCRL 5GS3A 4R96B 2EDDA 3U82B 3UPRB 1G9ML 5D1XB 3KPSE 4Z7VB 2PO6B 4Y1AA 5F6HJ 5GGSY 3LN5A 2ADJB 3B3IB 1EGJH 1ZMYA 4MNQD 2OZ4L 4RMTA 5DDHB 4L3ED 4LLMB 1ACYL 2CLZB 5T1DH 1NGQH 4ODWA 3MXVL 4YFLF 4BQ8A 2UVFA 1KSRA 4LF3B 1UWGH 5CLWA 1C5DA 4LVNB 1HN1A 3OTTA 4XNUL 3TCXA 5FO7A 1FZJB 2CLVA 1CLZL 2Q3AA 5DT1L 4UAOB 5LVEA 5EIIA 2GYSA 4EDWL 3NIFF 3QCTL 4YE4L 1YY9C 3FT4A 3KLAA 3SGEH 5L8KB 4PJ9A 1NDMA 1LEIB 2R4SL 3MV11 4IS6B 5LWYH 3DROB 1SVZA 4X4XA 4QXGH 3A6CL 4UV7L 3VFPB 2DBLL 3CVHA 3D39E 1MAJA 4F8QA 5TE4H 4YC2B 2YXMA 2DN7A 2BVOA 5AD0A 3MZGB 1Z9OA 3KYAA 4N9GA 3MTRA 4XP1L 4H88L 4F8TA 1KOAA 3CMOL 4PJ8C 1WC7A 2A9ML 3QHFL 5DJ0A 5JW4Q 1EJOH 2AK4B 4U2YA 4XGZB 1UKQA 5KVGH 3VDBA 1T4KA 4KDTC 1DBML 4PJCF 5EZJA 2R2HA 5CJ5A 4XVTL 2G5BB 4O51B 1JWSA 1LK3H 1MHCB 3QUKA 3UTPE 2R4RL 4LSVL 4PGCA 1KGCD 1KFAL 1KTLA 1MF2H 2DLIA 1O5DT 1S5HA 2Z31A 1UJ3A 1MVUA 3QWRD 3DETC 2GI7A 1M1SA 3BJLA 2V2TA 1OLZA 1CL7H 3TCLA 5IW6A 1P6AB 3WNKA 1ND0A 3QQ9D 4D9QD 4ESKA 3O6KL 2EO9A 4RIRA 2GJ6D 5HHOE 5C3TA 3RTQC 2FWOA 4MNGA 1AGCB 3P11L 3ZT6A 1FVEB 4U6XA 5ID1A 3FHQA 4V1DB 3QDME 4NBXB 3OXSA 4NWUH 1U58B 2AJVH 3UPAA 2XNAB 1ZLUK 3RVXC 3MBEB 3HPLB 1OF2B 3VDAA 3BSZL 1D6VH 1EFXB 4M1DH 4M6AA 5GXBB 1MI5D 1V3MA 3SPVB 1IARB 4Z0BH 5HHVH 4ZTPH 4ZUWB 3VD7A 2B4CL 2RHEA 3QYCA 4Z7UE 2PW2A 1S7UA 4XP4L 4G9FB 1ITBB 1EVUA 1R5VA 1HDMB 3LKSB 3L3DB 4PY8I 3O3UN 4TSCH 2X4OA 3GHBH 3E0GA 1NMBH 1RZJH 2AK1H 1SVCP 2ZP0T 4C54A 4QHUA 4P4RB 4QYOA 4ZUTB 5F21B 2VAAB 2HT3C 4KRPB 5CMAA 4EUPA 2IBZX 1MRFH 4ISVA 2HRPL 1U91B 4LHUG 1YMHB 2AS5M 4OZGF 3T0ED 3RVWC 1MFCL 1NL0H 4JR9L 4JFHE 4GRLD 3LDBB 1T22B 2YBRB 2CK2A 3SQOH 3D3VD 3MJ9L 4JFFB 5CEZE 5IF0A 1U6AH 4XPHH 5E94A 4ZUUA 3BH8B 5E2VH 1QFWI 3QFJB 3NN8A 3RY6A 4HJ0D 3VH8A 1N2RB 1ROWA 1S3KL 3UC0H 2YSSA 5EUOA 2XKUA 1MPAL 3GEWB 3RHWK 2VZOA 3WIHH 1XEDA 4P23D 1HEZB 3OAUH 1YYLH 4R3SA 4K3GA 2DQEH 2ITCB 3PWLA 5FO8B 2V2XA 5D4QA 2BOCA 2XG5A 1YNLH 25C8H 1WQVT 1G7JA 1P1ZA 2Q1EA 5JHDE 5IOPA 3CFDB 4Y2DA 2Y06H 1RY7B 5DRZA 4G7YH 2VKWA 4PRPB 3SDCC 1F6LL 1DFBL 4NZTL 5C0DA 4NGHL 1RI8A 2E27L 1ZGLP 4D2NA 3HPJB 4G5ZL 1RMFH 5ADOH 2CDFA 1U8MB 4DZ8B 1SYSB 3GFUA 4R97C 3ZKXC 1CFTB 1U8QB 5EOQH 4I77H 1PY9A 4X6DE 2VDRL 4NNXA 1GGYA 3LKNA 1PVHA 4WUUE 2GSGA 2Z91B 3BD5A 1GAFL 4PJ8D 5ALCH 4UNVA 2FSEA 3AAZB 1LEKB 4GMSL 3JVGA 3F12A 3WIFA 3MX0A 3RX7A 1T1WA 2VDQH 3RWHA 1GOHA 3FAWA 3KPQB 4NRZA 3PL6B 3BUYB 3QUXB 4XP5H 5HVWA 5D2LB 4MA1B 1ZVYA 4JDTL 3BRFA 4K71B 3RPKA 2JJVA 4Y19E 5ISZE 5D9SA 4KROC 3QRGH 5CINL 3VXRD 4U0QB 3ALPA 1KB9J 1ZWIA 1YEJL 1LO4H 4G6JH 5J6HA 4Y1AB 3B83A 4LCYA 5D8JH 3DETD 3LN5B 3PWPE 1ZEAH 4ODTH 3RTQA 1NKRA 5IVNA 4ODWB 4Q9CA 3UMTA 4TNVK 2OBGA 4K7PX 5D7KE 4RMRA 4H1LA 2DMBA 4C56E 4DEPC 4EBQL 1BEYL 1C5DB 1A4KA 2XICA 2APXA 2HLFC 4NNPH 2E7CA 4HULB 5FO7B 2CLVB 2O5YH 3S36H 4C4KT 3BDXA 4Q7DA 5EIIB 1HE7A 3FT4B 1RU9H 3KLAB 4PJ9B 1NDMB 4RBPK 4X4XB 2P5WA 3CK0L 1FCGA 3CVHB 3LB6C 3UP1A 4RMVA 2HTKC 1QD0A 3GBNH 5KN5A 5TPWL 5F88A 4LCWE 4JQIL 2BVOB 5EPMA 5AD0B 4HS3A 4N9GB 3S35X 3CNKA 4PRHD 1S7TA 3ILQD 1YEHL 3O2DL 4ONFL 1WC7B 4TTDD 2HT3D 5DJ8A 1IM3A 5DJ0B 3QISA 4ZFGH 2X4PA 1T4KB 4TSAH 4L3AA 2R2HB 4CVWA 2EIZA 2V9QA 3WXVH 1JWSB 1MWAA 1LK2A 3O8XD 3QUKB 1Q1JL 2FBJH 1KCUL 4GSDH 4WO4D 5FYLD 4PGCB 5IWLC 4V2BA 1F3DJ 2VISA 1KTLB 2Z31B 3JZ7A 1S5HB 1UJ3B 1MVUB 5E5UB 2QHLA 3WMSA 4XVJH 3QP3A 2ZUWA 4WCYL 2V2TB 3ABZA 3TCLB 4BSWA 5IW6B 1V7MH 3PQYA 1M6OA 1GHFL 1ND0B 5EO1A 3RGVD 1HZHL 1D7FA 4RIRB 1Q0XH 4E41A 2FWOB 1DQML 4MNGB 1ED3A 5ID1B 4U6XB 2DF3A 2KH2B 3OXSB 3GIZL 3SDCA 4JRXD 3D2UD 3C5JA 1MCNA 1CICC 1QPXA 2BCKA 2D9QB 5HGDA 1UADC 3QA3A 2YMXL 5J57B 3TO4A 3RX8A 3T3PF 1A6AA 4UINL 2W9DH 4XVUC 5I15H 3TBVA 1WICA 2C3VA 4UQ3A 1F2QA 5FYKE 1A7QH 3C8KA 2PW2B 1S7UB 2ZUQC 1R5VB 1OLLA 2OK0H 3LIZL 1GZQA 4G6KH 4D3CH 2X4OB 4K23L 2H2SC 2BVQA 3VFGH 1TTGA 4U1GC 4KUZH 4QHUB 3V5DA 1PG7W 4QYOB 4IMKC 2J8UE 4XPAL 3TFKC 1DSFL 2HWZL 5CMAB 3RUGF 4EUPB 4ISVB 4Q0XH 4YGVA 5KVDH 1I9JL 1PG7L 4PRID 4JO2L 4PLKC 1S5IL 4XPTH 4C83A 1WBXA 4W4OC 2APBA 2DAVA 1MFBH 5GIRA 1FE8L 1QFUL 4LAQH 4PJAF 1FO0L 1JRHL 4I48A 2VDKL 5DZOA 1TCMA 1KCSH 5CBAA 4KROD 1RIVH 2DM4A 3D9AL 4KH2A 3P0YH 3KPMA 4CRPA 4ZUUB 4YHOH 2I5YL 5E6ZA 3VRLF 3RJDA 1K6QH 4BA8A 4I18C 5D1ZA 3NN8B 4MA3A 4YBQD 2PYFA 3VH8B 4KTEL 4UTAL 5IB4A 4XHJC 1RIHH 4U6HA 1NEUA 2YSSB 1CWVA 3H3PH 5EUOB 4MXWH 4R3SB 2HMIC 3CU7A 1RZKC 4DGIH 3PWLB 2V2XB 3VFRA 2HLFD 3B9KC 2BOCB 2CRYA 1GIGH 1JHLH 2CR3A 1G7JB 4XXCA 1P1ZB 4XCNA 1AJ7L 1SY6H 4JFOA 4X8XA 5IOPB 4Y2DB 1VFAA 4OCRH 2BXYA 2VLRE 5DRZB 2FHBA 1QSED 1BVZA 4POUB 4JY5L 4MGXA 5C0DB 5I74C 3TH2T 1G9MH 2RAMA 3PP4L 3D0LA 5FGRA 4M00A 2PKDA 2CDFB 2Z8WC 3SKMA 3V7MA 4P57A 1GH7A 2OZ4H 4FFWD 1ZLSL 1ACYH 4M6OL 1CD9B 4NNXB 3LKNB 3MCLL 1BVKA 2GSGB 4Z8FH 2FSEB 3F12B 3D85A 3SKNA 5IMMA 1JF5A 1L7TL 4KJWC 4XNUH 2A74A 3WIFB 1A0QL 3ZTNL 1T1WB 3RWHB 3U7WL 1YEIH 4NRZB 1CLZH 4LLYA 1JK8A 5DT1H 4OI9A 4EDWH 3QCTH 4YE4H 3SKOA 1Q9LA 2B5IB 4MCZA 5D9SB 1V05A 4WFFE 2R4SH 3CFJA 5T3ZD 5K9OA 3A6CH 2DBLH 5EDXA 1WCBA 3ZT7A 1ZWIB 2W9EH 3EZJB 1BM3L 2YUWA 1WAAF 3LZFL 4PJEF 1A6WL 3IRPX 4PLJC 5J6HB 1NAKL 4LCYB 3FFCE 3VDCA 5A43C 4N0UA 2VXSL 3FZUD 4XP1H 3RTQB 3QDGD 4H88H 4KKNA 3CMOH 1M4KA 2A9MH 2D0GA 4H1LB 1A9BA 3QHFH 4I3SL 1CICA 1VERA 4YDIL 5KSBE 3TT3L 1A4KB 3MNZA 1DBMH 3KG5A 4DWHA 4XVTH 4P2OC 3PUCA 4WHYH 4PBWD 4LSQL 1YNKL 4MWFA 2N7AA 3B2UD 2R4RH 4K3DL 4LSVH 2C5DC 1PGRB 4L8CA 1MAKA 4XVUD 2P5WB 1H8OA 3RBSA 4ODSL 5KN5B 5F88B 3LN9A 5EPMB 3TBWA 1IQWL 4HS3B 2H2SD 4TULL 1V5JA 3EFFA 3O6KH 1S7TB 3VFTA 2CLRA 1X4ZA 5DJ8B 1IM3B 3P11H 4X9GA 1WGOA 3OHXA 3OF6D 1SEQL 4OZGA 2X4PB 4MLIA 4PLKD 1L9MA 3BSZH 2EIZB 3FN9A 5CEYA 1MWAB 1LK2B 4C59B 5GGQL 2B4CH 2ICWA 3BPNB 2VISB 4R26L 3RNKA 5HDOA 4XP4H 2EC9T 3EDJA 2H32H 3F65A 4FQQA 2BSTA 1I3UA 2FIRT 2L7JA 5C0RL 5EOCJ 1PKQA 4BSWB 5E8EA 3O3AA 3HZVA 3PQYB 4K55A 1M6OB 4JAMA 5EO1B 2GKIA 4UNTA 1I85A 4O5LL 4R2GB 2IEPA 2NW3A 3MREA 1TXKA 4E41B 5C0BD 1ED3B 2HRPH 4WEUD 1J8HD 1IC4L 5TFSL 5JLZA 3BZDA 1MFCH 4JR9H 1CQYA 4ZO9A 3JV6A 3OKEA 1OP5K 3SDCB 3C5JB 4WJ5A 1YY8B 2BCKB 4LDOB 5HGDB 3JXAA 3QA3B 3TO4B 5IFHL 1QFWL 1A6AB 3MJ9H 4JHZA 4BM7A 4PGJA 5T5FL 4QXUH 3ZKXB 4JFXA 3TBVB 3OG4B 2C3VB 4UQ3B 1OHQA 3C8KB 2OJZL 2WK2A 3QO1A 4QO1A 1NCBL 3TLRA 5IMLA 1GZQB 3MLZL 1S3KH 3T09A 2BVQB 5BRZD 3RIFF 1MPAH 3V5DB 5CCKL 4H20L 1RUAL 4G6AC 2AXHA 1LO3L 4YFLI 3V6BR 1OB1A 4KJWD 4YGVB 1FFRA 1MCJA 2ZSWA 4NQEA 1IC7L 5BV7L 5C07E 4C83B 1WBXB 2AV1A 5GIRB 4HSQA 4GLRI 2GSIA 3WNMA 1MCEA 5K9KA 4I48B 4J23A 2E7LC 1DFBH 4IRZL 4NZTH 5CBAB 1LHZA 4NGHH 2E27H 3KPMB 3L3HA 4X7TA 4ZOBA 3DECA 2ADIA 4PLJD 5D1ZB 4MA3B 2PYFB 5IP4A 4DEPB 5IB4B 2YD5A 4L4TA 4U6HB 5GHWL 3I6LD 3QH3A 1T7ZA 1KTRL 3UAJD 3MNWA 1KCKA 3BQUD 3TF7C 1BWWA 3QIWA 4OIAA 4GMSH 2JLLA 3D5OF 3VFRB 3MRQA 4JDTH 4E0RA 4N90E 1WIPA 4XCNB 4DK6A 4JFOB 1QRND 1VFAB 3DHJA 3TA3D 1ZA3A 1EEUA 2NW2A 4GXUN 1LEGA 5CINH 4WVRA 4K8RC 1Q9WA 4KY1L 5DVKA 3HRZA 2GAZA 4XVSH 3I84A 3D0LB 1CS6A 3BD3A 4P57B 1P7KA 4M7JL 3V0WL 5JOFA 3QQ4A 4FNLL 4JB9L 5E7FA 3W0WD 1GJIA 2YK1L 2GTWA 3GB7A 1BVKB 1FSKC 3PWVA 1XIWC 1BEYH 2DQCL 3D85B 3SKNB 5IMMB 5LAXA 2A74B 4BFIA 1EEZA 5FUCE 1EBPA 4LLYB 1JK8B 2GJZA 4FS0A 2P8LA 1CXFA 4HUVA 3SKOB 3T2PA 1Q9LB 4MCZB 1JGLL 2ZUYA 4M9PA 3CFJB 2R2CA 3CK0H 1WCBB 2RB8A 3MODL 4G8GA 3MV9D 5TPWH 1AI1H 3RKPA 5K33A 4JQIH 4H0IA 2VSCA 3WFBL 5LGJA 3VXMD 2V5MA 1T66D 1YEHH 3CFCH 3P0VL 3O2DH 4NM4L 4ONFH 4LHJB 2VO5A 1A9BB 3L3JA 3HE6D 1CICB 5C2UB 4CADA 3KXFE 3V9FA 4JFFE 5LCVH 3MNZB 3HG1E 3PE9A 5JIHA 3UTSA 1GOFA 2B1HH 2P48B 1UEYA 1OAUL 1Q1JH 4MWFB 1KCUH 5D7LA 2YZ1A 5ELIA 1NCNA 1P84K 4NRXA 4L8CB 3O3EA 4DZBA 4HPYL 2FCBA 1FPTL 2VRAA 2UV3A 4DAGL 5A2KH 5CD5D 2OQJA 3LV3A 4WCYH 3GM0A 1MCQA 3HAEH 1GHFH 3EFFB 3S37X 5ALBL 1HZHH 3LD8C 3VGGA 3VFTB 4HF5L 1FN4A 4NPYB 4JVWA 2CLRB 1INDL 4MVBC 4PJGE 1DQMH 3RUGA 3CZFA 3OHXB 4Z7NE 4PRPE 3E3QE 3HKFA 4OZGB 4Y5VA 1B4RA 2E6QA 3Q1SL 4WNQA 1NC4D 1PLGL 5CEYB 2YMXH 4F37F 4PJAA 1MUJA 4D8PA 4N1EA 3TYGL 3TJHD 3C60A 4UINH 2ADGA 1QZ1A 2ICWB 1JYNA 2JCCF 4HWNA 3KPRE 3RNKB 4YHNA 5EU6D 3TH3T 4BSVA 4G80A 3LIZH 2HKFL 4FQQB 2BSTB 4AQ1B 5CUSL 4K23H 3TO2A 1PKQB 3OKKA 2F8VA 5E8EB 3HZVB 4JAMB 5E6IA 2VUOA 4XPAH 1DSFH 2HWZH 3GDBA 3QHZL 3PDGA 2NW3B 5D70L 3MREB 2E7HA 3BKJL 3IF1A 5H37H 3PXHA 1PG7H 5JLZB 4JO2H 1S5IH 3BMVA 4MNQE 4L3EE 3JV6B 3MV7E 3OKEB 4O58L 3QXAA 5I74B 4WJ5B 1FE8H 1QFUH 2CUHA 1FO0H 4JFDA 1JRHH 2JJTA 2QQLL 3D9AH 4RDQF 2DMCA 3HMXL 4BZ2L 2I5YH 4K8RD 3SN6N 3MV01 1FHGA 4JFXB 3ARFC 3TIDA 1L4IA 2OX5A 3QO1B 2EIEA 3V6FA 4LKCA 4KTEH 5IMLB 1YMMA 4UTAH 1JGUL 4NIKB 3DYPA 2A77L 4S1DC 1DUYA 2J7LA 5GGRA 2OS7A 2AK4D 1WLHA 3P4NB 4YHML 3TBTA 1OB1B 4QNPF 3KNBA 2ZSWB 3AVEA 4NQEB 3JUYA 1AJ7H 2AV1B 3OKMA 2GSIB 4KI5E 4OFIA 5K9KB 2XYCA 1FFNA 4ONOA 3LKPA 2BVUA 4JY5H 5HI4C 1A5FL 3S4SA 3PP4H 1WAAA 2FO4A 4FQJL 3L3HB 5ACLA 2EYRA 4U1NA 4X7TB 5I1DA 2ADIB 4M7ZC 3Q6GL 1ZLSH 5DEZA 1JNNL 4P48A 3FRPA 3LY6A 4M6OH 3AFLA 4L4TB 1FL3B 2C3WA 2HFGL 3MCLH 3QH3B 3IVKA 1P5VA 2UWEE 4BZ1L 3MNWB 1QFHA 1ORSA 3QIWB 4GQPH 3WCYA 1JYVA 3QDJD 1L7TH 5JA8B 1A0QH 2H2PD 3U7WH 3ZTNH 2Z35A 3MRQB 1EFXD 4FTVA 3IS1X 1MY7A 4E0RB 3BPCA 2XV6B 1D5ZA 3VG0L 3UX9B 1ZA3B 2NW2B 5ID0A 3DLQR 1LEGB 5E1AA 1NFDA 1IE5A 1Q9WB 4G9FD 3LZFH 1BM3H 3GBLA 3JWOC 3AMLA 3HRZB 2GAZB 3UBXA 1A6WH 5HHQA 1NAKH 1T2JA 5T3XE 3BJ91 3NFSL 2VXSH 1P7KB 3TNNA 5JOFB 3QQ4B 2IF7A 3ARSA 2ICES 2R15A 2GTWB 5SWZA 2NY3C 4M61A 3QUMA 3GB7B 4H1LG 4I3SH 5J6GA 4LSSL 2J5LC 2H1PH 2QV2A 4YDIH 3PWVB 5DJAA 1KB5L 5FYLL 1H3TA 1EK3A 3K74B 5LAXB 3WFHA 4BFIB 4OCSL 2X42A 1EEZB 2ATKA 5FEBA 3SGJC 2GJZB 2WNGA 1NCWL 1YNKH 4LSQH 5DEGA 2P8LB 4K3DH 4HUVB 4CMHC 5SWQA 4EXKA 1PKOA 3CU1A 4Y0GA 2ZUXA 5HI5C 4N8PA 4XXDA 3CX5K 1RUPL 4Z9KB 4GW5A 4LRIA 4G8GB 2D7TL 4ODSH 1WSST 5MHSE 5E4IA 4JQVA 1IQWH 2HJLA 4KV5E 4TULH 1D9KD 4LLAA 3D3VE 1DTUA 5F71A 5LGJB 5JXED 3PP3K 5E56A 4JGMA 4TQEL 1KELL 4YPGA 2RCSH 3L3JB 2VH5L 2J6EL 4CADB 1J1XL 1SEQH 4NQDD 3ZKSD 3MBXL 4OGZA 3UTSB 3IDJA 5KSAC 3MUJA 2AJZA 5GGQH 3ARFA 3WD5L 5D7LB 1AP2A 3QEQB 2KL6A 3L7EA 2DL2A 5C0NC 4NRXB 2VKXA 3O3EB 4NQUA 4R26H 2ZOLA 5EUOE 4DZBB 1TZIA 3SY0A 2OQJB 3LV3B 1CLOL 5C0RH 3IDYC 1JMZA 2HYMA 1D5BA 2OTPA 4YK4C 3SEPA 4O5LH 1FN4B 1A7NL 4Y4KA 3RUGB 3CZFB 1LD9A 4FMKA 4Y5VB 4WNQB 3V7AG 4KUCF 1P5UA 5LG1A 4HKXA 4PJAB 1MUJB 4D8PB 5IFHH 1QFWH 3C60B 3G5XA 3LQAC 1WZMA 5T5FH 2ADGB 1H3VA 1MNUH 4LVHC 1QNZL 4XNZC 5I1KL 2BNUA 5GSVA 3ARDA 4U1LA 2OJZH 1NANI 4YHNB 4RGNC 1FRGL 1NCBH 4BSVB 1I8LA 3FQRB 4G80B 5T1LA 2Z8RA 5DURD 3MLZH 5DLML 4EQ3A 5HDBF 3W9EA 1E4XI 3TO2B 3OKKB 5MP6L 4DN4L 1JZ2A 4F15C 3ILPA 3LRSA 3PHSA 4YHLL 5CCKH 4H20H 5E6IB 4G6FB 3VXRE 3DX8A 1RUAH 4OV6F 1LO3H 3IF1B 5MENA 3QEGL 4CU7A 5BV7H 1IC7H 4UIMA 3OKDA 2HA1A 5ICXA 3QXAB 1RHFA 3DMMA 4JFDB 5EU3A 5C71A 3RZWA 1E6OL 4IRZH 4DUWA 5E8DL 4B5EA 1DBKL 3H0TA 5C08A 4URTB 2OL3L 3TIDB 5C0EA 4FABL 2CUIA 2B1AL 3V6FB 3BMWA 3ULSA 1B4JL 5FAAA 4HIIA 4LKCB 3ULVC 3VD4A 2EE6A 5GHWH 4ELME 3KLHD 3BKCL 3O0RL 4NT6A 1DUYB 3UPCA 1YPZE 1JBJA 5GGRB 4UQ2A 3QULA 2NY3D 1I8MA 2DKMA 2V5SA 1ZT4A 4QRUA 5T3ZL 2R0WL 3TBTB 4X6CF 2CR6A 1H3PL 3KNBB 4JHWL 2EDEA 2P5WE 4N0YL 5ANMA 3EBAA 1VESA 3OKMB 3L7FA 4XWOD 2FX8L 1I7RA 1FFNB 1TPXC 4MQ7A 4PREA 3LKPB 4P5KA 5IM7A 3S4SB 5DA0B 2EC8A 4LIQE 3LOWA 2FO4B 3ARZA 5D6CA 5FUZL 2EYRB 4U1NB 1XGYL 5I1DB 4G8EA 3CDYA 3GI9L 4M7JH 1IAIM 3V0WH 2IAMC 4FNLH 4JB9H 2A6KA 2YK1H 1EIBA 4TN9A 3IVKB 3BW9A 1J86A 3GMNA 4HCRH 1ORSB 5KSAA 1A3LL 5JW3L 4YHPA 5L0QC 4NRYA 2Z35B 3ZYIA 3T2NH 1NEZA 4FTVB 4X4MA 3WUZA 2HKHL 2VN7A 3BH9A 3BPCB 5FKPA 2KUTA 1D5ZB 2VSDA 5T5NF 2XWTA 1JGLH 2R39A 4HPOL 2FZ3A 1N7ML 3L5WA 5CSGA 5ID0B 5E1AB 5C0ND 1PSKH 1NFDB 2WW8A 4WFHD 3PQYE 3UBXB 3MODH 3AB0B 1RFDL 4PJHF 4X4ZA 5HHQB 4JRXE 4DGYL 1AGFA 3VGFA 3LD8B 5H8DA 2IPUG 2IMNA 2VDML 4ONGL 4OB5L 3TNNB 5D7JA 1DUZA 1KJ2A 2DIJA 3WFBH 1HINL 4NM4H 5SWZB 4WI3A 4M61B 3QUMB 4NQSA 5J6GB 4G42B 4N0RA 3ROOA 5DJAB 4X9FA 3DARA 3WFHB 1UH3A 5F8QC 3DGGA 5JTWA 2ATKB 4I2XB 1OAUH 4FZ8L 5DEGB 5GSRA 4KQ4L 4WI4A 5CZXC 3U9UA 2F9BT 1CIUA 5SWQB 2JCCA 1YJDC 3N1PC 4NQCD 4HPYH 1KENL 3QNYA 5D93C 1FPTH 4LNRA 2IAND 4XXDB 5CS7A 4DAGH 4GW5B 1J11A 1HH6A 4R8WL 1N5YH 5GGRY 3VD9A 2HJLB 3BOVA 3IFLH 3R4DA 4HHAA 5GS2D 2XXMB 5ALBH 3LS5L 3AS3A 4Y4FC 4Z7QE 4HF5H 2J8OA 4ZFZA 3UTQA 1INDH 1HHGA 1AQDA 3GMQA 4PG9A 4YPGB 4LVOB 4YNYA 5CFHA 1QKZL 3WLBA 3PABA 4QTHA 1PLGH 4W4NA 2ZCKL 3IDJB 3LEYL 1OP5H 1P7QA 4TUOA 3TYGH 2AJZB 5FM5M 3ARFB 2NY1B 1AP2B 2D7OA 3L7EB 1ACZA 4LARH 3VMOA 3OJDA 1UCTA 1CXIA 2ZOLB 4HUMB 1TZIB 2FH6A 2HKFH 3DI3B 5F7UA 3SY0B 5CUSH 4KKAC 3F7RA 5CILL 3ULVD 1X4XA 5HI3D 5BMFL 1D5BB 1MIML 4JM2A 1EEYA 3QHZH 4QRQA 4DTGL 1AO7D 5KJRH 5D70H 1RZGB 4JCMA 3BKJH 1CDYA 4HBCL 4IRSC 4XH2A 4Y4KB 1LD9B 1V3JA 3BYTA 1G7HA 5E95B 1Q9KA 3D25A 15C8L 4O58H 1N26A 3HMWL 1CDHA 4HKXB 3QUZC 2QQLH 3G5XB 3NCBB 3HMXH 4BZ2H 4KAQL 1VSCA 2EC9U 2BNUB 4M6NL 5ERWA 5GSVB 3ARDB 3BZFA 4U1LB 5CJXC 3LMJL 3VI3F 2G75A 1CGWA 5T1LB 5TGBA 1JGUH 1U3YA 3NFPA 5IEHA 3W9EB 4AEHL 2A77H 2XRAH 4PJCE 5T3ZE 3C5SA 3ILPB 3LRSB 5LKNA 1OOAA 5DMGD 1IL1A 1C1EL 4Z78A 2H3NA 5GGVL 2C1OA 4YHMH 4OLUL 2YUXA 3JWNC 4P2RA 3P73A 4X5WA 4HKZA 5MENB 4QEGA 1HKFA 4RWHA 1KIRA 4WU7A 4UIMB 3OKDB 4YBLC 3ZE0E 5ICXB 2VUYA 3ZL4L 3DMMB 4WI8A 5EU3B 1NCTA 4N8VA 3NZHL 2QTEA 1WITA 1A5FH 4NNYA 3H0TB 2P49B 4FQJH 2YR3A 5C08B 5C0EB 2J88L 3Q6GH 2JJSA 3ULSB 4N5ED 3PDOA 1JNNH 4HIIB 5EBWA 4NUGL 3KPOA 3SO3B 2MFNA 2XTJC 5C09D 4KJPD 5HPMA 2FJHA 4PJ7E 4PV8A 1G7IA 4NT6B 4BZ1H 4UQ2B 1JPGA 3QULB 5F44A 1I8MB 1UT9A 1XGTA 4WW2A 5DHVH 5GRUL 1ZT4B 43CAA 4QRUB 1GCFA 1EHAA 1ITCA 1CDGA 2OI9C 4M02A 1ADQL 5ANMB 3U7YL 1B0WA 3UDWC 3BAEH 3L7FB 3UZQA 2R1WA 4KPHL 1I7RB 4MQ7B 2LAGB 1U3HC 2X4NB 4PREB 4P5KB 5IM7B 5DGQA 2PNDA 2R1XA 2WLZA 4M1CC 1PQZA 5D6CB 4C58B 1VCAA 4XX1G 4G8EB 4Y4FA 1X5YA 3C6LD 1HWHB 1NGXA 3NFSH 2B0SL 1H15A 2DQGL 2B20A 4OZGE 4OJFL 3V2AR 2A6KB 4EI5A 5E24E 3BW9B 3VW3L 4LLUA 3MLVH 4LSSH 3GMNB 1ZVSA 1KB5H 5FYLH 5KSAB 3GSWB 4OCSH 4YHPB 2NCMA 2J2ZA 5GS1C 4LASL 2XQYK 4NRYB 1NEZB 1NCWH 4RMSA 3BH9B 4PJIA 5FKPB 1MCPL 1SMOA 1KTKE 2XWTB 3K4AA 2YD2A 2FZ3B 3L5WB 1PKQE 5ACMA 4UNUA 1J8HE 3U0WL 1BQHA 1RUPH 1U3ZA 3T0VA 1Q72L 2D7TH 5EN2A 5FOBA 1AGFB 3W5NA 2VR9A 3G5YA 1MJUL 3Q5OA 5HHPA 1LP9F 2VTFA 4KKAD 5D7JB 1DUZB 1KJ2B 1QACA 3FN3A 1G6RL 4ELKA 1U8NA 4TQEH 2PCPA 1XT5A 2EYSA 1KELH 1T5WA 4NQSB 5ESVA 2K3TA 2VH5H 4C55A 2J6EH 3ROOB 2EYTA 1U3JA 3GRWA 4OLWL 3QUZA 5HGBA 2BNQA 5CJQL 3MBXH 1FCCA 3DGGB 2WP3O 3VXUA 3KHQA 5BRZE 4OD1L 5GSRB 3WD5H 2Y6SC 4JKLA 5L2KD 4RGNB 4MZ3A 3U9UB 1L9NA 5E8NA 2F53A 1OM3L 1AGEA 3K3QA 4CVUA 2JCCB 4I1NB 4FQ2L 3QNYB 5D1ZD 4F15B 2KQMA 4LNRB 1J1OL 2DTSA 1OAZH 1HH6B 1CLOH 3GBML 2VZ1A 4HHAB 2CQVA 5M94B 1I3GL 4NQEE 3HC3L 4ZFZB 3UTQB 3VA2C 1A7NH 1HHGB 3MGOA 5MEPA 1AQDB 3FO9A 3FQNA 3GMQB 3KLSA 4PG9B 2NX5D 5EIVA 3MCG1 3ZO0A 4K8RL 4YNYB 5F9WC 3WLBB 2VLKD 3NA9H 3PABB 4QTHB 3OR7A 1FNAA 2P5ED 3I6LE 4S1QL 1P7QB 4TUOB 3HFML 3MUY1 5D1QC 1QNZH 1FDLL 5I1KH 4KTDL 3OJDB 3EYSL 4LQ1A 1E4XL 1FRGH 3UYPA 2WBKA 2CD0A 4XNYH 1E4JA 5DLMH 5F6HI 5MP6H 4DN4H 2XTJD 4YHLH 4JM2B 2C4FU 4Y16C 2VJXA 1TDQA 1EEYB 4QRQB 1IFHL 4GLRH 3W2DL 4PRAA 2BX5A 3QEGH 4XH2B 2VDOL 4X6CA 1MJ7L 1G7HB 1TPXB 1Q9KB 3BN3B 3D25B 4QOKE 4PJDF 3OWEA 3U1SL 3C2SA 3W0WE 3I02A 1VPOL 1S9YA 1PY4A 2F5BL 1R3HA 5E8DH 1DBKH 1H5BA 2AJSL 3H3KA 5ERWB 5A2JH 1EBAA 3BZFB 2OL3H 3ORJA 1C8PA 1ES0A 4FABH 2B1AH 5DQJA 1B4JH 2G75B 2O26U 5TGBB 1CGVA 4HIXL 3N85L 3NFPB 5IEHB 4KKBD 4TUJA 3IJSA 3BKCH 3O0RH 2HT2C 4U7SA 5GS1A 3C5SB 4R7DA 1JGDA 2ZCHL 2N56A 3IXTA 4Z78B 2H3NB 2O5ZL 4ODVL 2C1OB 5T3ZH 2R0WH 4P2RB 3P73B 2OMNA 4HKZB 4X5WB 1BMGA 1H3PH 1XF5A 2JK5A 4JHWH 4JO1L 3DXAA 4J3VA 2QSQA 1KIRB 4WU7B 3WO3B 4N0YH 4GRMA 2IPTL 4PBXA 1M05A 5GJSL 2NY7L 3VXME 2R9HC 4ZO8A 4G8GE 2FX8H 4N8VB 1IKNC 4ZXBD 4JREC 3S4SG 3TP4A 2PTVA 4P9ML 4NNYB 3OJMB 4OQTL 4Y8DC 2A0LC 1JE6A 5FUZH 1A21A 3VG9C 2Z4QA 1XGYH 3GI9H 2ARWA 4RX4A 3PDOB 1UKSA 4R4ND 5EBWB 3FRPG 3KPOB 4LSTL 5HPMB 2FJHB 3IB4A 3L3KA 4NC1C 4PV8B 1G7IB 3ZYZA 4RA0C 1JPGB 2E3VA 1CDUA 1XGTB 4WW2B 1A3LH 4K7PL 43CAB 3T3PE 3QEQE 4HWBL 1K9TA 5HHME 3NTCL 4WI9A 1LGVA 1FL5A 4X6DF 1F00I 2HKHH 5SWSD 4Q6YA 1P4IL 4JPIB 4EOWL 1A6PA 4EDXA 1CTNA 1RK0A 5D93B 2Y6SD 3B5GA 2R1WB 4HPOH 1N7MH 5D96B 3WEXA 5I75C 1S78C 5A1AA 3QXUA 1NC2D 2R1XB 4Q6IC 4LK4A 3UBXG 2Z9TA 1RFDH 3V8CA 4DGYH 2QKIA 2X4RA 3QXWA 4Y4FB 2VDMH 4JQXC 1NGXB 4ONGH 4OF0A 4RMWA 1S7QA 4NN6C 3RUGE 1QFWM 1Q94A 1H15B 5MEQB 1HINH 1NMAH 2QSCL 3MRKA 4EI5B 2ITDA 1WWWX 3W39A 4LLUB 3BPOC 3S35L 3E6HA 2CIKA 1ZVSB 1REIA 2IPKB 3M45A 4PJAE 5EU6E 2VC2L 1OAXH 5D1QA 4NOBA 4X7CC 4TVPD 3VRLE 3G6JF 5EC1A 2UY6A 4FZ8H 4KQ4H 4PJIB 1Y6MR 4QT5A 5F9JA 3RBGA 3O6FC 3U7AA 2NLJA 4PB0L 2FLRT 3B9AA 3VGEA 5IVXF 4NKOA 2VL5A 1UWEL 4WDIA 1BQHB 3EO1A 5FOBB 5EN2B 3QB7C 3BI9X 4FXKA 5F9OL 1CE1L 1KLGA 3G5YB 5HHPB 2R2EB 2AV7A 3HI5L 3ARGC 2GHWB 4PB9L 3LS5H 3NH7L 4LSUL 4ELKB 1JVKA 4NJAH 1U8NB 2MPAL 4LOUC 2PCPB 3WNLA 2EYSB 2WWMC 1FZMA 1T5WB 4CMMA 1YQ2A 1L0QA 5ESVB 2ZUTA 4JFDE 3O4OC 2QSVA 1C12A 3MLWL 2FATH 2EYTB 3FCTB 2NNAA 5CSBA 3K1KC 3SE4C 3EYVA 3QUZB 5HGBB 1QKZH 1IZJA 3VI4E 4GXUM 4U7MA 4JO3L 1KNOA 2ZCKH 1KYOJ 3CPLA 3VXUB 3LEYH 2X5PA 2ZKHL 2ZG3A 4NSKA 2EEAA 2F53B 2O93L 1AGEB 1HSBA 3N1QC 4L8SC 4HX1A 3KYKH 5ESAA 1R5WA 1MCLA 5CILH 3QXDA 4F2MA 5BMFH 1MIMH 1KN4L 3L6FA 2K7PA 4DTGH 5DRWA 3WS6A 5MEPB 4HMDA 3GSNL 3MGOB 4XTRC 3FO9B 3FQNB 4HBCH 3KS0J 5DF0A 3SDDC 1GGTA 1HKLL 2YD7A 1J12A 4PJEE 4MXQD 2R9HD 4MD0A 2YN5A 2H6PA 4TVSa 4KAQH 4M6NH 2AERT 4WFED 1LO5A 2XQBL 2A0LD 5CKAA 3ULUD 1G7MA 2P46B 5F89A 4MCYB 4EZMA 1CQKA 5EO0A 2D9CA 2ESVA 1F4YL 4AEHH 5K59E 4POZC 5MEOA 4FTVE 1WBYA 1C1EH 1I1AC 5GGVH 2OI9B 4M8QA 5GJTL 4OLUH 3VFNA 4PRAB 5DJ2A 2VXQL 3JV5A 4TRPL 4X6CB 4YDLB 4PRDA 1W0WA 3ZL4H 3I02B 1EUUA 5B8CC 1A6UL 1FLTX 2YHGA 1S9YB 3NZHH 5TE7L 1WISA 3TZVC 3PG2A 3JSSA 1WJ3A 1EMTL 1R3HB 4JQXA 3QXVA 1AR1D 1S78D 3CFKA 5AYUL 1H5BB 5C0JA 4J7RA 3MPCA 4A2MA 2AXJA 4PJ5D 1G84A 1ES0B 2J88H 5DQJB 3IJHA 3P40A 3PV6A 5FGBA 3T08A 1NUDA 4TUJB 2GW5A 3IJSB 4YDVA 5GS1B 4DFIA 2F5AL 4R7DB 1JGDB 4ZFFA 4IOSD 3IXTB 4WEMB 4I2XE 5D72L 1X4YA 3IS0X 4XBGA 2EXWC 4FQPA 3UTSD 1U0QA 1XF5B 2JK5B 3DXAB 3BXNA 4YUEL 3U7YH 4GRMB 5D7LD 1M05B 2BRRL 4KPHH 3O6FD 4S0TD 4JLRA 2X70A 1H3XA 2Z4QB 3UTTE 3NIGF 1IM9D 4DN3H 5BO1L 1NGYA 2B0SH 3T0AA 3GMOA 1HHIA 2DQGH 5B4MD 3RJQB 2H41A 1T89C 4OJFH 2WAHA 3ARGD 3SE4A 3MGTA 3NCFB 3L3KB 1CGSL 1S7SA 3RWEA 5KAQG 3VW3H 2H9GA 2WWMD 3OV6A 1JTPA 2W59A 3D39A 3LQAL 3H42L 2JB6A 1A4JA 2NR6D 3MLYL 1HXMA 4LASH 1DQTA 4AL8L 4KRMB 2X4TA 3FN0H 1FL5B 1BHGA 3WO4C 1IC5L 3RPIA 4HG4J 1MCPH 5GRJL 3D6GA 4EDXB 1RK0B 4DK3A 4G6MH 1T0NA 1KPRA 3WEXB 1HH9A 1BD2E 1FNEA 3U0WH 4BUHA 1Q72H 2QKIB 2X4RB 2DIBA 1MJUH 4AYFA 1WWAX 3OPZH 5INDA 5EU5A 1S7QB 1G6RH 1Q94B 1AXTL 1IC1A 3MRKB 3T0DA 3CIQA 4FRWA 5F9WB 2ITDB 3W39B 1DN2A 2ZG2A 3E6HB 1C7SA 2CIKB 2ERJC 1CD0A 2VR5A 4ZODA 1C5CL 3IDGA 4OLWH 4AH2B 3BX7C 5CJQH 3AC0A 4PGZA 4WU5A 3ARYA 5D1QB 3SDDD 5KVEL 4UMGA 5HDQL 4OD1H 5EC1B 3X12A 5J11B 1TNNA 3B43A 4QT5B 1FGNL 2EDXA 4N0FA 3ULVL 2NLJB 1OM3H 4UIKL 1BVLA 4HD9A 4XCEA 5DMJB 4NKOB 2VL5B 4WDIB 5F8RC 1J1OH 3DO7A 3EO1B 1YMMD 4Y16B 4QKXB 1P9MC 3GBMH 4JANA 1KLGB 2AV7B 4MAYD 3DURA 4NFCA 1MIEL 1I3GH 2QQNL 1OARL 3HC3H 1I1AD 5DMIL 4RFEA 5C0GA 1FZMB 3I9GH 2BERA 4Z7UA 3B9DA 2EDNA 4CMMB 1J0KA 1UZ6F 1YA5A 3WJLA 1C12B 2NNAB 4K8RH 1TQBC 3EYVB 3IDMA 5DS8A 2HG5A 4PJDA 3GKWL 1KNOB 3U83A 3CPLB 4S1QH 2ICEA 1I1YA 4AENA 4I9WE 2QSTA 1NANH 4TOYL 3B6SA 3R0NA 4NSKB 1FDLH 4KTDH 2NY4C 1HWGB 5I73C 3EYSH 1HSBB 1E4XH 2PXYA 4HX1B 5ESAB 5ITFA 1R5WB 3ARBA 3WUWA 5B38A 4NN7C 2DI8A 3QXDB 4F2MB 1OSZA 3RVTC 3L6FB 3H8NA 2APFA 2B4CC 2R69L 5DRWB 1DJSA 1IFHH 2ZUVA 4CDHA 1NH6A 1JHTA 3W2DH 5E00A 4OF5A 2VDOH 1H3GA 1MJ7H 1IQDA 1F6AA 4ZUSA 5JPMA 3RHWF 3U1SH 1FP5A 3GO1L 5FM5O 1VPOH 3EOTH 1KB9K 2F5BH 4MD0B 2P24A 2H6PB 1AE6L 2NXYB 1YQVL 1LVEA 1SY6A 1FH5L 1LO5B 2FYYA 4GG6F 2XY1A 1G7MB 1TIUA 3QBTB 5F89B 5JHDA 4HIXH 5T1KA 3CSGA 3N85H 5EO0B 2ESVB 4WFGE 2NMSA 4NUJA 3CUPA 1IILE 5F72S 1TVBA 1V3LA 3AS1A 5MEOB 2ZCHH 5HYIA 3MCKA 1WBYB 4WFHE 2O5ZH 2OZ4A 4M8QB 4ZO7A 5D71L 3O2WL 3VFNB 4KKLD 4GRWB 5DJ2B 4JO1H 4J12A 1BF8A 3WKML 3R1GL 4X6DA 2IPTH 4PRDB 1W0WB 2NY7H 5GJSH 4GBXD 4N8VG 1UEMA 3BZ4A 4RQQA 3AGVA 1MAML 4FP8H 4P9MH 1FNLA 4OQTH 3CFKB 4P2QD 5C0JB 4OLEA 4KGJA 1T0MA 2NY0C 4XCFL 1BF2A 3RL2A 5AWNL 3IJHB 4BKLA 1S7WA 3PV6B 3BPOB 5JO5B 4LSTH 2OSLA 1OTUC 1DEEA 4YDVB 4ZFFB 1NMCC 4K7PH 5DYOA 2IANE 4RGNE 3HRPA 4HWBH 1TQCC 1JZ7A 2W0KA 1GYAA 4XBGB 4U49A 1SEBA 3NTCH 3PWPA 4FFYL 2JCCE 3BXNB 3TPUA 2AP2A 3G6JA 4QRRD 3KDMA 1P4IH 2NY1D 5EG6C 4EOWH 2E9JA 2H26A 5IJKA 1CZ8L 5F1IA 4RA3A 3BGMA 4FXGA 5IVXA 2MQ0A 3B5TA 4J3XA 4NM8L 2X70B 3IDUA 3QFDA 4W6XB 1Z0MA 2GITA 1R0AL 1NGYB 3V0VA 3GMOB 1MVFA 1HHIB 2FH8A 3BD4A 3V4VL 1UGNA 3KPLA 4G7VL 3MGTB 3RWEB 3S35H 2H9GB 3V52L 4Y4KD 3D39B 1AXIB 4PTTA 2VC2H 2JB6B 1A4JB 3BT2L 3RDTC 1HXMB 4LCWA 4XP6L 1GGBL 3ULVE 5F7HA 2X4TB 1AY1L 2ZJSL 1X5LA 5DFVC 3MOBL 3RPIB 3NBNA 2CIIA 4WWKC 4PB0H 1AO7E 1T0NB 1KPRB 1HH9B 1YC8A 1FNEB 2NY4D 1UWEH 2EH7L 1H8NA 2FX9L 2HFFA 3K1DA 5F9OH 1CE1H 1DANU 5E8PA 1I1CA 3HI5H 4MA8L 4P46A 5DO2D 4DKAA 5INDB 5EU5B 5ACZA 4PB9H 3ARVA 3NH7H 4LSUH 2F8XC 5L9DL 5LBSL 2JELL 2H32A 1WFNA 2MPAH 3QZWA 2VLME 3CLFL 3S37L 4LQFL 3EIFA 3MLWH 4AIZA 3IDGB 4JN1H 4KK5C 4WU5B 4U0RC 5DFTA 4JO3H 1CDIA 1E6JL 3X17A 2Y23A 2ZKHH 3X12B 3MOQA 3IFPA 4IRJC 4XNMA 4N0FB 1G7LA 2AQ1A 2VZVA 3O11A 1BVLB 4CJ1A 4FQCL 4XCEB 5HD8D 2P8PA 3MJ9A 3DO7B 1QBAA 4JANB 3DURB 2FHCA 4P2RE 4F9LC 1KN4H 2Z8VC 4JKMA 2X10A 3NA4A 2W91A 4GJTB 5C0GB 4RFEB 3GSNH 4NJ9L 4Z7UB 1BBDL 2YD6A 1UM4L 1IGTA 4LU5L 1T6WA 3O4LA 3IDMB 4DJMA 5DS8B 1I9IL 1HKLH 2HG5B 4PJDB 2ICEB 1JCKA 1R24A 1EZVY 1I1YB 4BQBA 4AENB 5C0AE 4F9PA 4O2CA 2J8UA 3B6SB 4O9HL 2APTA 3NCCB 1KTDA 3ZTJG 4OLVL 1CN4A 4Z7NF 5DRNA 2XQBH 4QWWD 2PXYB 5ITFB 4JDVA 3SDAC 3ARBB 5B38B 1F4YH 5CP3H 1OSZB 3OGCB 3HR5A 1YEGL 3QAZC 2FEDD 5GJTH 5T1DL 3VXSD 1JHTB 1MCFA 3UTZA 4EN3C 2E6JA 2OP4H 4LMQI 3UEZA 2VXQH 1IQDB 1RULL 5IFAL 4ZUSB 2EKJA 5JPMB 4U1HA 2X1QA 1A6UH 4LLVA 5GGTL 5TE7H 5BS0D 5DMYA 2P24B 1EMTH 1UA6L 5AYUH 2BZDA 4XMKL 2FYYB 3D69A 2X1XR 1JNJA 2R2BA 2NTFA 4UB0L 5JHDB 4F7TA 5T1KB 4NUJB 3CUPB 5CLTA 4G9DA 4GW1A 2F5AH 1TVBB 5H94A 3FO0L 3VXQA 3MCKB 5D72H 1C5BL 4B7LA 2KPNA 2YS4A 4JZJA 1BZQK 5DJZA 4HAFA 5E2JA 1EJOL 3S88L 4YUEH 1G7PA 4X6DB 3BN9D 4JEGB 4M48L 1S7VA 4OZFA 5DFVD 2BRRH 1MRDL 3BZ4B 4RQQB 5J3HC 5FA4A 5FYJD 3QWQB 1OGAA 1T0MB 3MACL 5TF1L 3RL2B 5E9DE 5BO1H 1TTFA 1FNSL 4BKLB 5C0FA 5D6DA 1S7WB 1DLHA 2ZZUT 4WV1C 5MI0B 5L2KE 2ERJB 3PWNA 2OSLB 4TVPL 1DEEB 1CGSH 2DD8L 3DX6A 5E2UL 3NPSC 4LVEA 4JZOA 3LQAH 4YLQT 3H42H 5DYOB 5ECJE 3MLYH 3FFCA 4AL8H 4IRJA 3O2DA 2UUDH 1SEBB 3PWPB 5F7MC 3TPUB 3G6JB 5F70A 1IC5H 3UO1L 4CGTA 5GRJH 3VXOA 1VACA 5GS2H 4M1DL 4Q2ZA 5F1IB 1V8HA 4C4KO 3BGMB 4E5XA 5F6IB 5KSBA 5HDBE 3VGBA 2NX5E 4FXGB 4IOFC 1HIML 3P0GB 3W11C 1YDPA 5IVXB 1FYTD 1FVDA 2VLKE 3L3OA 3QFDB 3QI9A 2EO1A 4L4VD 5I19L 5INCA 2GITB 2P5EE 2YRLA 2XOTA 4RWYL 3V0VB 4JM2D 1AXTH 4NO0A 1SJHA 2G60L 4YWGL 3KPLB 2CO6B 2AK1L 4D94A 1OTSC 1C5CH 4PTTB 5HTSA 1RVFL 3STZA 4LCWB 5KVEH 1AKJD 3J8F7 5HDQH 2D3VA 2XTJE 5I73B 2CIIB 1FGNH 2B2XL 3GSVA 3BPLB 1UJTA 4GAFB 4UIKH 2NY6B 5GPRA 2EDRA 2CRMA 2EIBA 4NN7B 2E9IA 3QNXA 1NPUA 2BY3A 2P44B 1GOGA 1S7RA 2HFFB 4OD2A 5J13C 5E8PB 2I27N 3VXNA 4X6FA 2A6DA 5ACZB 4EN3A 1MIEH 4X6CE 2A73A 1UH4A 2H32B 2QQNH 1OARH 3EYQC 3QZWB 5DMIH 4XPGL 1BQUA 3HZKA 2E9BA 1B6DA 3MLRL 5DD0L 5CGMA 4AIZB 1K3IA 2A1WL 4JFEB 1NCAL 4B53A 3GKWH 3ULUL 4OTXL 1YNLL 3SCMD 4A6YL 4TOYH 5F93C 3QJFA 5J12C 3IFPB 4XNMB 1G7LB 3AMKA 1UVQA 2MHAA 3O11B 4ZS6C 1FO0A 2YEZA 2P8PB 5KVMC 3MRHA 2DYPA 1X5HA 2I9LA 2VLJA 4CN1A 1EDQA 3O9WC 3OKLA 2A38A 4HBQA 2R69H 1A02N 3PJSA 2Y5TA 4XPFL 1WZLA 2AJUL 3DPBA 3MQIA 1QRKA 1II4E 1FZOA 2B7DT 1AD0A 1IGTB 1FNGA 1O7VA 3O4LB 3MV8D 1E4KC 5IHBA 1J0ZA 3GO1H 1PX3A 4YO0A 3BP4A 4PJHE 3M1BA 1T2QL 1R24B 1UQSA 3H9HA 4O2CB 2J8UB 1AE6H 1S9KC 1Z5LA 3DBXA 2NYYC 1KTDB 3PF2A 1FH5H 3N1GC 5DRNB 4IS6A 1KIUA 1P4BL 3QRGL 4G43A 4JDVB 5C07A 2ZUUA 4JO4L 4YHYB 4HKBA 1NMCB 4HH9A 3HR5B 3U2SA 4HUXA 1PW3A 2ZSVA 5C0CE 4JFZL 3QXTA 2Q6WA 5D71H 2EXYC 3O2WH 4ZFOA 2M1KA 5FCSH 3UTZB 4K94L 2RQ8A 3WKMH 4Y4HC 3R1GH 2BFVL 4NNPL 2G5BA 2G9HA 4LLVB 2FHFA 4JPVL 1P69B 1MAMH 2W60A 3CFBA 4IOFD 1XGPA 5KW9L 3W11D 3D69B 4XCFH 1MFNA 4TVPE 5AWNH 5BV7C 2R2BB 5DC0A 4GOSA 2NTFB 4F7TB 4L1DA 2V5YA 4IDJL 4OCYL 1NAML 3F58L 3VFSA 4G9DB 4GW1B 5I1CL 4H8WL 2W1NA 2YPLD 5H94B 5CSZA 3VXQB 5I2IA 5DHYA 2BNQD 4JZJB 4M7LT 4YR6A 4TSBH 4Y5YA 5I76A 5DJZB 4FFYH 5C92A 2QLVB 3MYJA 1WIUA 5CJBA 1G7PB 2UY7A 5HYJB 4ELMF 1F8TL 1FJ1A 5T1MA 4OZFB 1S7VB 3DVFA 4KGLA 4MJID 3BP6A 1YPZF 2WQRA 1OF2A 2F53D 5DZLA 4BH7A 5ICZA 3KR3L 1CZ8H 3SDYL 3GSRA 5FA4B 2F54D 4I4WA 3BIBX 5IGXL 5I9QC 4NM8H 1OGAB 1PEWA 2BVTA 1P4LA 5EOCL 1R0AH 5C0FB 1DLHB 3RWGA 4EI6B 4ZAKD 4BZYA 3PWNB 1NUGA 3OJ2C 4G7VH 3V4VH 4POYA 5F7YC 1OAYL 2CXGA 3DX6B 3EYQD 3WN5C 3V52H 3MSPA 4JZOB 5BXFA 3BT2H 1TMCB 2BVPB 4KRNA 1FL6A 4XP6H 1GGBH 1NCUA 3FFCB 4IRJB 4M3KB 5C1MB 1OWRM 3MRPA 1AY1H 2ZJSH 5F1SA 3RZCD 1Z0NA 3MOBH 3G04A 1U2CA 3VXOB 5AUMA 1UB6A 1VACB 3VI3E 3HB3D 1NFIA 4Q2ZB 3TYFA 4E5XB 5KSBB 3SE3C 3KXFA 3EW3B 3K4ZA 3O9WA 3HG1A 2EH7H 1YDPB 1RSFA 2MTPA 1TNMA 2W9DL 2FX9H 3L3OB 1NGZA 4MJ4A 3QI9B 3QIUD 5INCB 1A3RL 4MA8H 3TVMD 1FAIL 5BCAA 2C7UA 4NO0B 5HJ3A 5L9DH 1SJHB 5HGHA 3CLFH 1N6QH 4EIGB 4QCIA 3S37H 3QQ9C 5HVHC 4LQFH 5I71C 3C2AL 2MMXA 3STZB 2HTLC 3VFUA 2EDQA 3LS4L 1E6JH 1RHHA 2LABA 3P3YA 3KPPA 4EIZC 3B8SA 3D18A 3IKCA 5KVFL 1A64A 4NC1E 3GSVB 3L5IA 3WBDA 1VFMA 4PJGA 4FQLL 2ESVE 4I0PA 2APWA 4WGVB 2DS4A 2Z93A 4FQCH 4Z6AT 4CUCA 3QNXB 4P4KC 4YHOL 5FHBL 1S7RB 4OD2B 3HE7A 2NY2B 3VWKD 3VXNB 4X6FB 2A6DB 4EN3B 2A73B 4AEFA 5KG9A 4X98A 1CXKA 3KPRA 2D31A 4NJ9H 3SBWC 1BBDH 3HZKB 2VZTA 3LPWA 2CUMA 2Z91A 3WS3A 4LU5H 3WHE0 4HK0A 4QHMA 1DBJH 5CZKA 4MXWL 1I9IH 4Y4HD 1KXTB 3T0EC 4NCDA 1GIGL 1CI5A 1JHLL 4R4BA 3QQ3A 4O9HH 2E7MA 3N1FC 3QJFB 4GRLC 5AZ2L 5SX5H 4CN4A 3QUML 4OLVH 5KS9F 1XF2A 1UVQB 2MHAB 4N8CL 4HWZA 1FO0B 4MNQA 2YEZB 5JOPE 4RX4D 3WUWG 4L3EA 3MV7A 3T65A 5B38G 3MRHB 2DYPB 2I9LB 2VLJB 5BVJA 1OTTD 4RMQA 4HJ0C 4R90L 3LRHA 2WIIA 3BHBA 4WUKL 1YEGH 3OKLB 3RQ3A 3PJSB 2Y5TB 1J5OL 1DCLA 1FZOB 3H3BC 1E28A 3DX7A 4P23C 4QXWA 4CW1A 1AD0B 1HHKA 1FNGB 3IDXL 1RULH 5IFAH 4Z8FL 3IDIA 3AS2A 1CLYL 2VE6A 8FABB 2EECA 4YO0B 2NXZB 3BP4B 1YEIL 5GGTH 1FNHA 1MLCA 3M1BB 1UQSB 3BKYL 3H9HB 4FQXC 4AIOA 1UA6H 2WWKT 1QEWA 1LP9E 1Z5LB 3DBXB 4XMKH 4CBPA 3JV0A 2DQJL 5EU7C 5LXGL 4G43B 1IT9L 5C07B 4UB0H 2X9WA 2W9EL 3WN5A 4HKBB 3AY4A 4M1GL 4U6VL 4P59L 3VFOA 4AQOA 4HH9B 3U2SB 4ODHL 4HUXB 3FO0H 3RI5F 2ZSVB 3P9LA 1C5BH 4FXLA 2Q6WB 4ZFOB 1VFOA 4ODXA 4V2CB 1QTYT 5I16A 2HT4D 2X2YA 2F8OA 4L8DA 3ZE1F 3S88H 5EBLA 4KJQD 3Q5YA 3CH8A 2UZIL 4LPUA 4M48H 2P42B 3HHRB 4IBLT 2UWEA 2G9HB 4AZ8A 2O61B 1MRDH 3MJ7A 1F3DH 1P84J 4GUPA 1BX2A 3H9SD 2W60B 4CVZA 3CFBB 2LAAA 1XGPB 2Q76A 3MACH 5TF1H 4ZSOA 2YD3A 4W6WB 4RNRA 3ZE0F 5FM8A 1FNSH 4BYHA 2V6HA 2OR8A 1G6VK 5TE6L 4XI5D 1A47A 2GJ6A 4TVPH 3VFSB 2DD8H 4GT7A 1J05A 4K7FA 2ZCLL 1CCZA 5E2UH 5CSZB 5I2IB 3VMPA 5DHYB 3F5WB 4HIJA 1BLNA 4X83A 2HTLD 4YR6B 3ZKND 4Y5YB 5I76B 3MYJB 3EUUA 1KEGL 5I6XB 3UO1H 3BUTA 1FJ1B 4PJ7F 5T1MB 1QYGL 2LTQC 3BP6B 4BH7B 5ICZB 4JRYD 3GSRB 3S3JA 3D87B 3H7BA 2DLFL 1HIMH 4I4WB 1ODAA 3CH1A 2VOTA 1MREL 4LPYA 4HWEL 4WI7A 1ZAGA 4P4KD 3FFDA 3H9ZA 1CGTA 1P4LB 5I19H 4RWYH 5FCUL 3RWGB 4AEIL 1EO7A 3C5ZA 3U79A 2G60H 3GGWB 1TITA 3NCYS 4YWGH 4BQCA 1PZ5A 1BIHA 4M7LL 4PJDE 4FN0A 3T0EA 3ILQC 2MCG1 5JUEL 3WHXA 1RVFH 3OG6B 4MB5A 3FKUS 4TTDC 5BXFB 2EICA 1T21A 1FL6B 4O00A 4GRLA 5HYEA 3B4NA 2FLBT 3MRPB 3D3VA 2C3XA 3G04B 1ZHNA 1DBBL 2B2XH 4P5MA 3DO3A 5F1NA 4LEXH 5AUMB 1UB6B 3O8XC 1WV7T 3HI1A 2IG2L 1NFIB 3QCUL 3TYFB 4WO4C 5CJOL 3KXFB 4MYWB 3O9WB 3HG1B 4QXUL 1NGZB 3T77A 4PLOB 3SOBL 4P3CL 3N0PB 3RX5A 2C7UB 5HJ3B 4I8DA 4P23A 5HGHB 2C1PA 3QZWG 2CKNA 4XPGH 1ZE3C 4QCIB 4ODUA 3RGVC 4PS4L 3MLRH 5DD0H 2WZPD 2A1WH 2GJJA 4R9HA 3NIDF 1NCAH 3VFUB 4NHUB 4YHIA 3CCHA 1TJHL 3RAJL 4OTXH 3ULUH 1RHHB 3KPPB 4UBDD 3D18B 3QCVL 4A6YH 3IKCB 2IBGA 2V5RA 4FQXD 4PJGB 5C70A 1K8IA 4HJGA 4I0PB 5IKCA 1MFDL 1A22B 2Z93B 2GEEA 1EX0A 1MEXH 3FOMA 1LO0L 2EDTA 3DX9A 3HMXA 4IEFB 5DMKA 5FKAA 3HE7B 1Y6NR 4PJ8A 3ALWA 3N50A 2CPCA 4IJ3C 2IMMA 5K9QG 1AH1A 3KPSD 4XPFH 3OZ9L 2AJUH 4P2QE 4X98B 3RWFA 5KG9B 2QADC 3KPRB 2D31B 5L6YL 4KDTA 3FHAA 4OLYH 2B8OT 4F57L 4PRNA 2D0HA 3WS3B 3LEXA 4HK0B 1R3JA 4ZOEA 4QHMB 4XAKE 3EO9L 5JQHC 2XY2A 4LGPB 5DC9B 3VWJC 3WE6A 5ETUA 1T2QH 1F90L 4R4BB 3VXRA 3QQ3B 5T33L 5LQBL 5BV7B 2X89A 4ZD3L 4U1JA 2WUCL 4OKVA 1X44A 4I5BA 1XF2B 1M71A 3C9NA 3VGDA 2CJUL 1T04A 4HWZB 3EJZC 1P4BH 1XMWA 3ZDXF 1GVIA 1CIDA 4MNQB 3V4PL 4L3EB 1BECA 1RUQL 1KF9B 3MV7B 4JO4H 3T65B 4QRRE 4XVSL 4M8VA 3V95A 5HYQA 5BVJB 5JIKA 2EZ0C 4LL9A 4WHCA 4YBQC 2WIIB 3BHBB 4GKOA 2Y9RT 3WIIL 1B2WL 3G6JE 4JFZH 2RR3A 3SJVE 5HVGB 1E28B 2BHZA 3DX7B 4I13B 4CW1B 1HHKB 4K94H 5FYJL 3QHTC 3IDIB 3PHOA 2BFVH 5IVXE 1JI1A 2VE6B 3GSQA 4ELMA 3RGHA 1NJ9A 3F7VA 4JPVH 1YPZA 5I9QB 5IEKA 1MLCB 1QVOA 2QJDA 3FO2A 2DJSA 4OCNC 4S10A 1OAKL 4PP1C 1QEWB 2ZOKA 4OAWA 1L0YA 2D4FA 1KUMA 5KW9H 3L95A 1JWUA 1ZXQA 4UZGA 3UTPD 3WN5B 4PRHA 4IDJH 4OCYH 1NAMH 3F58H 1AI1L 4H8WH 3VFOB 5I1CH 4FFWC 1D5XA 3IKKA 3GMLA 5JDSA 3P9LB 5IHZA 4AY0A 3CFCL 4ODXB 3IJYA 5BZWA 5I16B 3O8XA 4L8DB 5IB1A 5EBLB 2ICWJ 3B8YA 1N3NA 1ZHBA 1F8TH 2AKRA 2Q3ZA 4WO4A 5LCVL 4OZFG 1KB5A 1NSNL 4RSVA 3VE0A 5HHOD 1L6ZA 2UWEB 2BVEA 3KR3H 3SDYH 5DJCA 3MJ7B 2B1HL 2DQDL 4GUPB 4YQXL 1BX2B 2YXFA 3QDMD 4F7EA 4CVZB 3ES6A 5IGXH 2MQCA 4FZEL 2Q76B 2VDPL 4ZSOB 2CGRL 4LCUA 4RISL 4RNRB 5EOCH 4S2SA 1DL7L 3QSKB 4GH7B 1ZVHA 3RGVA 4JFQA 5F7EL 2GJ6B 4JFEE 3FZUC 1OAYH 1CDCA 5J89A 1J05B 4K7FB 5EFIA 3UYRL 3GI8L 4PD4K 3NFNA 2OTWA 4NKDA 2V7NA 2N1KA 4WGWB 3VFMA 4JRXA 4HIJB 3D2UA 1BLNB 5D2NC 2FEEI 3KWWA 1G0DA 3TT1L 4X9BA 4U6TA 5EBGA 4DKEL 3IGAA 1YY8A 3B2UC 2EDLA 2BSED 3H7BB 3ARBD 4JFHD 3CH1B 4NWTL 1QUNA 3FFDB 4P5TD 2BSSA 5FM4A 1A3RH 5J06A 1FAIH 5CEZD 4LPVA 4HC1L 4LPCA 4P9HL 3C5ZB 3O4LE 1PZ5B 1JL8A 1CU4L 3LQMA 1A7BA 1SHMA 2IALA 2WBJD 4OFYD 1U93A 2QADD 3C2AH 4PRIA 3T0EB 4X6EA 3WHXB 2XZZA 1T21B 1ZANL 3QIBC 1TCRA 3ZSSA 3F6LA 4GRLB 3LS4H 4ZYKA 1VEMA 4OV5A 4RFOL 3CLEH 3G5ZA 4XWGH 4Z7OE 3UXFA 3D3VB 5KVFH 3VWJD 1ZHNB 4P5MB 5F1NB 4FQLH 3HI1B 3VXSE 2YA0A 2APVA 43C9A 1Q0YL 3GMMA 3EJZD 3ARED 4GKNA 5FHBH 3WDIA 3T77B 3RP1A 4OCXL 2C26A 1JTOA 5BS0E 2EZ0D 1A9EA 1HQ4A 5C6WH 4P23B 2C1PB 3VFVA 4L1HA 1M7XA 4BJLA 4RAUA 2NQCA 4ODUB 4XNQA 4OFDA 5KANI 2MCPL 4APQD 2KKQA 4XMPL 1XGQA 3C8HA 1CGYA 4YHIB 3CCHB 3SHSA 4WUUD 3L1OL 1DVFD 3NABL 4UOW0 1U36A 3MA9L 3NIGE 5AZ2H 3U4AA 2EDYA 1YEDA 1KN2H 3T1FA 3HC4L 3QUMH 1CLCA 4PP1D 1K8IB 4HJGB 1QSFD 4N8CH 5IKCB 3G5VA 2DLGA 1DEDA 2AGJH 3VI4F 3FOMB 2DWDA 4Y19D 5ISZD 1YYMH 3DX9B 5DMKB 5FKAB 1SJEA 4R90H 4WUKH 2OL3A 4PJ8B 1YECL 2EDHA 1N6VA 5HYJE 3T4YA 3RWFB 2X6MA 1J5OH 2XKSA 1X7QA 2JIXD 3IDXH 4PRNB 3LEXB 1R3JB 2XZCL 1CLYH 4R4FL 5K9JL 4FQHA 1NCCL 4PJCA 1OGAE 1BP3B 4DFHA 3WE6B 5ETUB 5IWLA 4C56D 3BKYH 5DUML 3VXRB 3DVGA 4U1JB 4OKVB 1IGYA 4I5BB 2DQJH 1M71B 3C9NB 1T04B 5LXGH 3AM8C 3FL7A 4WY7L 1IT9H 4AM0A 1MCKA 1H3UA 3QDGA 2Q86A 3CAFA 1UM5L 2F19L 5HYQB 1S9VA 4M1GH 4U6VH 4P59H 5CZVL 2AEIT 3I3BA 4ODHH 1VHPA 1L7IL 5J1SC 3PIQA 4NBZB 3UAJC 3ZSTA 3C6SA 3BQUC 4BFEA 4XCCL 4UOJA 4L4VE 1IKFL 2H1PL 4LHUD 1L6XA 5KOMC 3RKDD 2UZIH 3PHOB 4L9LC 3V6OC 5K59F 3GSQB 5F3HA 4PJ7A 4ELMB 2DQUL 1NJ9B 3CXHJ 3F7VB 4X7FC 5IEKB 1YPZB 1QVOB 1ZT7A 3FO2B 1RAMA 4P99A 3I50L 5KSUA 3TA3C 4OCMC 2ZOKB 4RAVA 4OAWB 2X4UA 4U6YA 1TETL 3EYOA 4OBRA 3L95B 3MLTA 1DN0A 4P46D 1JWUB 1X5JA 2I24N 3GSOB 5FDWA 1UZ6E 4PRHB 5TE6H 4IMKA 1J9CT 2VQUA 1AGBA 2ZCLH 1D5XB 4GKZA 2DLTA 4NKMA 1KG0A 2BY0A 3GMLB 5JDSB 1T3FA 5IHZB 5FECA 3W82A 1T5XA 4NPYA 4W4OA 4JM4L 3IJYB 2CXKA 5BZWB 3G6AA 4Q97A 2RCSL 2Y1VA 3O8XB 3QIBD 4YDJA 5IB1B 1KEGH 1N3NB 1ZHBB 3KYMA 2AKRB 4WO4B 2Q8BL 1KB5B 1QYGH 5TDNA 3MFGB 1QG3A 3QEUA 3VE0B 5DJCB 3TN0D 3U4BL 1DDHB 2DLFH 1UXSA 4F7EB 3ES6B 3MRNA 4HQQL 1MREH 4I18A 4O2EA 4HWEH 5GRYA 1JZ8A 4KVCL 5LGHH 2ZNXA 4LCUB 5J0BA 4S2SB 5FCUH 4BFBD 4PJXE 4AEIH 2EDBA 4JFQB 3RGVB 5CJ8A 1W2KT 5C0BA 5FYKD 5EFIB 4M7LH 3HZYA 3NFNB 1J8HA 2OTWB 1T66C 4NKDB 3B9KA 2ZPKL 3X14A 2V7NB 4QF1A 5JUEH 3VFMB 4JRXB 3D2UB 3HE6C 3F7PC 4YX2L 3KWWB 4JZNA 4CAGA 1DBBH 4GAYA 4GG6E 2G2RA 5I30L 3IGAB 4Y5XC 4ETYA 2IG2H 2VLJE 4J4PC 1KXVC 3QCUH 5CJOH 1MHHA 2D4DA 3MV8E 1MNUL 2FGZA 4N68A 4R97B 1A7PL 4IJ3B 5CGYC 2EDFA 2XN9D 2BSSB 5BRZA 2A2QT 1MCIA 1JWMA 3SOBH 1CFVL 4P3CH 5CD5C 4P49A 2KZ1B 1XF3A 4ONHA 2IALB 5D2LF 3NAAL 4PS4H 1U93B 4PRIB 4RGMC 4X6EB 4UI2A 3P4NA 2DQTL 4MJ5A 4UDUA 1URLA 1TCRB 4DOHB 5HGAB 4OV5B 1LO2L 4Y2OA 4ZYKB 1TJHH 1YN7A 3RAJH 1F97A 3G5ZB 3EYFA 3QCVH 4KROB 4GKSA 4KK8C 4L9DA 5EZLA 1KC5L 3F6IA 1KBGL 3TJHC 1OGTA 1MFDH 1MCWW 2BNRD 5EH1A 3TWCL 43C9B 3GMMB 5A2FA 1LO0H 3C87A 4GKNB 5I1EL 4OUUA 2VLRD 1C7TA 1EXUA 3BIKA 3BQUA 4M4PA 2V2WA 1A9EB 1HQ4B 2FB4L 3GJFK 4QRPD 3VFVB 3OZ9H 5ICYA 5L6YH 4L9LA 5DD5L 5A2LH 1FL3A 4RAUB 3ZLQC 3WJJC 4ZG1A 4XNQB 3FQTA 4P2OA 4F57H 1IGIL 1XGQB 3EO9H 1QRNA 2UVEA 3TA3A 2PYEE 5L88L 3C08L 3INUL 5FGCE 1F90H 2XT1B 2YPLE 4D9LL 1KV3A 5T33H 5LQBH 1VENA 4ZD3H 1AQKL 1YEDB 3T1FB 2WUCH 3UZVB 1HYSD 3DIFA 2CJUH 4FOMA 3G5VB 3V4PH 5TF0A 4QOKA 1RUQH 1LWRA 2P47B 4YC2C 3W0WA 3O41A 2DWDB 3EHBC 1U8JA 2JB5L 4WFFD 3ISWA 1SJEB 5C6TL 1T1XA 2OL3B 3WIIH 2MWCA 3QQNA 1B88A 1B2WH 4OF3A 2F54E 1CXEA 3T4YB 3QUYD 3CXDL 4Y8AA 4DQOL 3ARRA 4NFDA 1X7QB 5FYJH 4HCRL 3ARTA 4XC3L 3H2WA 5FYJU 5DK2A 1BJMA 3BDYL 4FQHB 1B0RA 4PJCB 4WTWA 1IAII 3T2NL 3DVGB 2ZWLT 1OAKH 3OXRA 2PW1A 1C08A 1ADQA 3MV9A 3D48R 1A7RL 1IGYB 5C2BL 3IT8D 3QI9D 5K93A 4AM0B 1PSKL 3QDGB 5TH2B 3TV3L 2Q86B 4HJJL 3VXMA 3ZDYF 1JZ4A 1X9QA 1U8HA 4JVUA 1S9VB 2X4SA 4PV9A 3HE6A 1NBZA 1UENA 3PIQB 4B0MM 3C6SB 3Q48A 3MC0A 4Y5XA 1W0VA 1ULVA 3MBEC 2H2PC 1FFOA 1A8JH 5F3HB 1NSNH 4PJ7B 4ZPTA 1ZT7B 2DQDH 4YQXH 3HN3A 5E8OA 4H0GA 5KSUB 4J4PD 3GUTA 2ZUQB 4RAVB 3QEQA 3TH4T 2X4UB 4FZEH 2IH3A 3DJ9A 4U6YB 2VDPH 5DR5L 3OAZK 2CGRH 3EYOB 2PN5A 2NY2D 4RISH 3MLTB 1DN0B 5CGYD 3T3MF 1DL7H 5IHLB 2GIYA 4UU9A 4U1GB 5FDWB 5F7EH 4BUGA 4DUXA 2VDLL 1A7OL 1ZLVH 1T7WA 1N5YL 1AGBB 3UYRH 3GI8H 4GKZB 1JNHB 2FEEL 3IFLL 4NKMB 1KG0B 1ZA6A 3GJEA 3V8OA 1T3FB 1KYOK 5FECB 3DSNA 1T5XB 4RGOL 1NC4A 2C4FT 1FVCA 1HHJA 5IQ9A 3G6AB 2UZYB 4YDJB 3TT1H 2ORBL 2Z92A 4MDJA 4YPJA 3KYMB 2E7LA 4DKEH 3LDBC 5TDNB 3MUGA 2YPVL 5KTEL 3QEUB 4KK8D 3QPQD 5EU6A 3O3BA 1IAKB 4CDGC 1UXSB 3MRNB 4NWTH 4O2EB 4I18B 5D1XD 4LARL 2IGFL 2PO6D 5D7IE 3ZDZF 1LDSA 2K9UA 1IEHA 3F7YA 3FQRA 4HC1H 1QR1A 4P9HH 5JMOC 1MQKL 1EPFA 2VABA 4J3WA 2WIMA 2FO1A 4FFZL 4RAHA 1KPVA 1CU4H 3MXWL 5C0BB 4U1IA 1D9KC 3HZYB 5JXEC 1J8HB 3B9KB 4N1HB 3X14B 4QF1B 3P4OA 1ZANH 5KJRL 4LFHG 2D2OA 1ETZA 4EUPG 2NXZD 4RFOH 4OM1L 4JZNB 1J0YA 3WXWL 3IDNA 4ZO6A 5F9DC 4GAYB 1K2DA 2G2RB 2YA1A 4YXLL 3F7QA 5C3LD 4JFYA 1CT8A 3CC5B 1MHHB 5C07D 1Q0YH 3DVNA 2OM5A 3ULVF 3AS0A 3NCEB 4OCXH 4WWID 5BRZB 5E0QA 3EHBD 1JWMB 4KHTL 4PLNC 3VH8G 1XF3B 1HYRC 4ONHB 1XIWA 1XZ0A 2XRAL 5D7SL 1IGFL 2MCPH 4XMPH 3EDEA 4MJ5B 4UDUB 1JGVL 1RJCA 3QUXC 2F15A 1YN7B 4MA1C 3L1OH 4DKDC 3EYFB 3NABH 3MA9H 4W81A 4GKSB 5EZLB 4OLXL 3HC4H 4YH6A 1OGTB 1NUNB 3MMEA 1CF8L 3MLXL 4PG2C 3MRRA 2A6JA 5I18L 4QHLA 2IFGA 2JTDA 4PJEA 4OUUB 3RI5K 5IB2A 1EXUB 1XCQA 3BIKB 3BQUB 2V2WB 1YECH 2AXGA 1GC1L 3BDBA 3QDJA 5ICYB 4L9LB 1KGCE 1MFAL 1A1NA 3FQTB 1YEEL 4P2OB 1F4WL 2BOBA 2XZCH 2CKBA 4U1MA 4R4FH 4V1DD 3HCVB 5K9JH 1QRNB 2J3SA 3TA3B 1NCCH 3MBED 1CG9A 4ZSOE 5DUMH 1BFVL 2HVKA 3CDGA 4PJ9C 5CIPH 4BSJA 4D9QE 3BAEL 4OZHE 3DIFB 2GJ6E 1WFUA 4WY7H 3P9WB 2HAZA 4QOKB 5DK0A 1UM5H 2F19H 3W0WB 3O41B 3BEWB 1RJYA 1U8JB 4OQTA 3FT3A 3M17A 3FOLA 5CZVH 3EOAA 3DV6A 2YRZA 1T1XB 3VMNA 1MI5E 2VZSA 4MQXD 1R3LA 3P9MA 1L7IH 2BK8A 3KLHC 1F4XL 1K3ZA 3S98A 4ZOAA 3RVUD 4XCCH 4KRPD 3MLVL 4HG4K 3MYZA 4G42A 1IKFH 5DK2B 4I0CC 1B0RB 2DQUH 2IWGA 4HWBA 5JQ6L 1E4WL 4I2XA 5GZOC 3I50H 4JFFD 3OXRB 5A3ID 3GSUA 3HG1D 2PW1B 1C08B 4XWOC 3MV9B 1TETH 1N64L 5CGTA 1UJ3C 4ODBD 3QFJD 4KHXL 1D9KA 3T0EE 5GQBA 3A6OA 3T04D 3VXMB 5JXEA 1U8HB 1Q38A 4LEOA 2X4SB 4PV9B 1MQ8A 3HE6B 2YA2A 4KU1A 1NBZB 4PBVC 4NQDA 3ZTJH 3UTTA 1WK0A 4JM4H 4OFPA 5I17A 4Y5XB 3ZT5A 1W0VB 1J0IA 2L7UA 1FFOB 3R0MA 2Q8BH 4BELD 5C8JA 4PIRF 1N4XL 3HTLX 4ZPTB 5CBEA 4I0PD 5CEZL 1ZT1A 1Z9MA 3U4BH 5E8OB 4PRPD 5DHXB 3GUTB 1OCWL 4HQQH 4Y7MA 4FQIH 3FAXA 5HHMB 2IH3B 4KVCH 4UU9B 4KK6D 1OAZL 4YXHL 4OIBA 2FX7L 3D1MC 1BD2A 4X4YB 1ZA6B 4LAJH 2ZPKH 3GJEB 5EU7E 1JN6A 5GGVY 2K1MA 2VNCA 4CJ0A 3R8BB 3HUJF 1NC4B 1RZGA 3REWA 1FVCB 4YX2H 1HHJB 5IQ9B 4MLSA 1KULA 3PL6D 4XBEH 3QUXD 2Z92B 4MDJB 1FFPA 2AJ3A 5BVPL 2LU7A 1PDKA 4PG2A 5I30H 5GRVK 3NA9L 3MUGB 4OBSA 5EU6B 3O3BB 4K9EC 3FB8A 1FG9C 3MV7D 2CO7B 1A7PH 4JRWA 5HHXH 2LE9A 2YC1A 4WTXA 4OZIE 4Y1AD 2DJUA 5DJ6A 3RY6C 1CFVH 3F7YB 1QR1B 2VABB 5EO9A 4DCQA 1C16A 4XNYL 1KPVB 4U1IB 3NAAH 3JWDC 1X5XA 2FIKA 3P4OB 1QHPA 2DQTH 5IT2L 1LO2H 2JF1A 1ETZB 4HLZH 1QLRA 3GSNA 4U3XA 3DV4A 3IDNB 4ALAL 4Y2DC 1K2DB 1KC5H 1X3DA 4PJBF 1KBGH 4AK1A 4MSWA 4PJ9D 2P8MA 4JFYB 1CXHA 1CT8B 3ROLA 1I7TA 3TWCH 3BEVA 3T4AA 1INEH 3DVNB 4NOFA 4IDLA 5I1EH 3MR9A 4KI5D 4XCYA 4YFEA 3MRDA 2FB4H 3B9EA 5HI3C 1FSKB 1IGML 1XIWB 5DD5H 5CHNA 1XZ0B 3OAYH 2R8SL 3EAKA 5CP3A 3OX8A 3JVGC 1IGIH 5DUBA 3SGJA 2VXUH 5L88H 3C09C 3C08H 3INUH 3VCLA 3KPNA 4D0DA 4D9LH 3TPKA 3U6RA 2B5IC 1AQKH 5GZOD 4PRHE 4D0CA 4NO5A 1KLFA 4GW4A 1SMAA 5AYQA 3MMEB 2X4NA 2Z31D 1G9NL 1BREA 3MRRB 2A6JB 5IMKB 4QHLB 5IG7A 2EH8L 4PJEB 2JB5H 1DBAL 5IB2B 5C6TH 4M3JA 1XCQB 1MOEA 2AXGB 4KXZI 3QDJB 1Q9OA 3CXDH 4Q74A 5FYLE 3GNML 2R29L 4DQOH 5T3XD 5DMGC 2AVGA 3K8LA 1IAIL 1A1NB 4U3CA 2BOBB 3ECBA 3FB6A 4U1MB 2CKBB 4XC3H 3BDYH 3GSWA 1KJ3L 4MB4A 5IB5A 5JR1L 1CG9B 3S3PA 3KJ4C 2HVKB 3CDGB 1AFVL 1FC2D 4KK9D 4MXVF 1A7RH 2X1OA 5C2BH 4K3EL 5E6YA 5JZ7D 3TV3H 5DK0B 5D5MF 5IBTL 1G0XA 4HJJH 1RJYB 3C5ZD 3FT3B 3M17B 3FOLB 4N5EC 4MX7A 5H35A 3EOAB 3DV6B 3ZE2F 4F58L 5I8KL 2RFXA 1R3LB 3BESR 3P9MB 4KJPC 4N0CD 1PEZA 1NMAL 1CD1B 1VGKA 5MHSD 4LFHD 5DJXA 1QBBA 3F8UB 4JVPA 1AGDA 1ZGLM 3P30L 1OD9A 2IBZY 5MERA 1OAXL 1MHPH 4GMTL 1LMKA 4NQCA 2XXCB 4GFTB 1X6LA 4PY7A 3GSUB 2IANA 5E08L 3BPNC 5FYKL 2DQIL 1T6VN 5DR5H 5JDJA 2DQHL 4HFUH 1R3IH 4WTZA 1O7SA 5DTFA 2BC4A 1D9KB 2OR7A 4PRIE 1NFKA 3C6LC 3OMZA 2VDLH 1A7OH 4LEOB 4DOHE 2Y36L 3B5HA 4R2GC 4NQDB 4NJAL 5H2BA 3UTTB 4RGOH 3CDFA 5I17B 1YY9D 4J6RL 1IZKA 5E99L 5KS9E 2ORBH 3RRQA 1GGCL 2FATL 4JDZA 1J0JA 5C8JB 1HILA 3WV0A 1BZ7A 5KTEH 2YPVH 4Y2DD 3TO4C 1X5GA 5CBEB 1ZT1B 2I9TA 5GRVL 4UUJA 4F7MA 4OGYL 1Z9LA 4NFBA 2A9NH 2IGFH 3B2VL 4GRWH 5AZEL 1I75A 1RZ7L 2IADA 3KYKL 4X5LA 4J2XA 2R1YA 4UT9L 1P7HL 1MQKH 4FFZH 3V4UL 1BOYA 5TDPA 1AO7A 3MXWH 4MD4A 2XPGA 1QSFE 2ZUSA 1BD2B 5JHLL 1QSEE 2AAVA 5CEXA 3BRGC 1PAMA 1JN6B 2IBBA