5JORA

Crystal structure of unbound anti-glycan antibody fab14.22 at 2.2 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
218
structure length
218
Chain Sequence
b'DVLLTQTPLSLPVNLGDQASISCRSSQTILHSDGYTYLEWYLQRPGQSPKLLIYRVYKRFSGIPDRFRGSGSGMDFTLTISGVEAEDLGIYYCFQGSYVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab14.22 heavy chain
publication title T cells control the generation of nanomolar-affinity anti-glycan antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 50
structure length 218
sequence length 218
chains with identical sequence C, E, L
ec nomenclature
pdb deposition date 2016-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jorA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jorA01
1A9EA 4K2UL 3FQWA 3TT3H 1JZ5A 3I84A 4QXTB 3OAUL 2HG5B 1DR9A 3N06B 1SY6A 5LGKA 1VFMA 4QHMA 2XN9B 4OB5H 5MEPA 1MI5E 2AJSL 2GI7A 1E27B 4D3CL 5F3BB 2P44B 3H7LA 4OQTL 4IDJL 2MNUA 4H0GA 1NMCC 1ES0A 5IVXB 3BGFC 2XICA 4JR9L 2EKSB 1DANT 4YBHA 3T0BA 4KUZH 2Q76B 2NZ9D 1AHWC 4KKCC 1FL5B 4UT9H 3V4PH 1P4IL 5SX5K 3RUGF 1TNNA 1MFAH 2HJLB 4KDTC 3WN5B 1RY7B 3UO1H 2ICCA 1GAFL 1VFBB 1A6UH 2F58H 3F7RA 3I3DA 4ZXBD 1FC1A 1DANU 3L9RB 3P77A 2Z92A 3SQOL 5C09E 5T1MA 1QRND 4PLJD 4FTVB 1CR9H 3UXFA 3DYPA 2EDHA 1DBKH 4DGYL 2FZ3A 1DSFH 4R6UA 2D7TH 1IC4L 3UTZB 2AJUL 2LFGA 1IC7H 4BK5A 3UTQB 1WFNA 1D9KA 4K3EL 5DZOA 3REWB 1WCQA 1OL0A 2VL5A 1HQ4B 1CI5A 4OTXH 5DK2A 5BMFL 1ZWIB 4JQIH 1E6OL 2R9HD 4LVEA 1XR8A 3DX7A 3H9HB 3GSUB 4Y8AA 5HGDA 1QNZH 3MRFA 4ELME 2R2CA 1RZJC 2CIIB 4OGXH 3SGEH 3HI1B 4U1NB 1A47A 4LSDA 2VLKB 4HIHB 4I2XA 4YAQB 4HK3J 3VU2A 1P6FA 2OZ4H 4X6FB 3G5VB 3ULSB 2NW3B 3THMH 1KB9J 5IJVB 2BVYA 2HJKB 4EQ2A 4LSTH 4ZUWB 4MQXC 4Y1AD 1H15A 1XGRA 3HNTH 5ECJE 1RHFA 4QWWD 4U3HA 4YDLB 3F6IA 1KJ2H 1TJHH 3H9YA 1DUZB 1Q94B 2NY2B 3MLUL 4LFHG 1MWAA 3TZVB 1V7NH 3NCMA 4OSUH 3RWDA 4PRAA 1BLNB 3OB0H 1QLEL 1OARH 5DQDH 2R1XA 4HWBH 3T0VA 2XT1B 1QRNE 1NBYA 2IBZX 5SX4I 3T3MF 3ROLA 5IBLD 3D25B 2F8VA 2BSSA 2ZWLT 5SWZA 4OD2B 5EA0L 1ZHNA 4HUUB 4R0LC 3ARTA 1JE6A 1P7HL 3HMWL 5JPMB 1B0RB 4NNPH 4YFDB 3NCEB 2DQDL 4KRLB 1DN0B 1H5BC 3NTCL 1YECL 4NUGH 2EH8H 3PWPB 1OGAD 2XIDA 3UROR 2OI9B 4MVBD 5FA3B 3VI3F 1XF1A 3E8UH 2AVGA 4KK9C 3H9SD 1ORQB 2O5XL 2ZG3A 2ZUUA 4QXGH 2IBGA 2O93L 4N0RA 3X12B 3TT1L 3L3HA 1MRDH 2YD1A 5TGBB 3VXNA 1S7VA 2XOTA 4UTBH 4KUCF 3BQUA 4NO0D 5D2LA 5BV7B 3D0VB 4YJZL 3MBXH 3R4DA 4P5MA 2H8PB 4HD9A 1XGTB 5T3ZH 5EU4B 1JTTA 2DYPD 2HLFC 2VLRD 3EYSH 5DDHB 3JWDC 2Y6SD 1MIMH 3RTQA 4AH2B 3TM6A 5JQ6H 5GXBB 4Y1AE 1U3HA 5IBUG 1I1AA 3RUGE 3LKOA 1U91B 5DS8B 5JMRA 2LVEA 4L8SB 3RA7H 5LWYH 2VZTA 1KN2L 4P99A 4P9ML 4E42B 1KG0A 2MSPA 1KEGL 1B2WL 3BDYH 2CO7B 3O9WD 3BD3A 4L5FH 1A7OL 4KHTH 5E2UL 3MRNB 2VLLB 4G43B 4K07A 4F57H 3GSVB 3M07A 3OAZK 3FT4B 3WUWA 5KZCB 3F6LA 3VXMA 3QIWA 1KLGB 5F44A 1Z9MA 2EH7L 3IJYB 1ZXQA 2EEDA 5IMLA 4DEPC 3QCUL 4G9FD 1P4LB 3QIBA 5JOPD 1AKJB 1NUGA 1RUAH 4ZFGL 2GY7B 4QRUA 1AIFA 3P11L 4QOKB 4DKFL 4P4KB 5I1JL 4PPTA 3LEYL 4KKCD 3KXFD 1U8LA 5C71A 1OGAE 1LK3L 3JTSB 1ZA3B 4LVNC 3CX5J 1J1XH 1UKSA 2V2WB 3QUZA 1ZLUK 4G3YL 3H9SE 1TVHA 4GRWF 5I1IL 5JR1L 2Y36H 3HA0A 5CEZL 4KUCD 5DJDB 2D9QB 5BRZA 5JIIA 1NKRA 5J89A 5CILH 5DD6A 1B90A 3KR3L 3MXWH 4NQUA 3CGTA 3GJFA 2EE6A 3GMRA 3X11B 5F1IB 4OKVB 2VLRE 4ODHH 4HUNB 2NTSP 2VXQH 4XPTH 4MAUH 1YEFL 2XWBA 2NY0C 1W8NA 4NKMA 1DQTA 1MHHA 2D7PA 5F7NC 1IQWL 5I15L 1T2JA 2IFFL 5J6HA 5INDB 5KG9B 4PJBA 2CDFB 3QULA 3SDXF 2R1YA 4O02H 4QF1B 1G7QA 1G1YA 4LCYA 4XAKD 5HHVH 4CW1B 1YN6B 1QP1A 5DMGC 1LQSR 1IFHH 3UPRB 1KCRH 2VXVL 2GUOB 2AKRA 3VFPB 4BJLA 1U8MA 1AXIB 5JUEL 4G8EA 4F3FB 2CLVB 3OKMB 1UXWB 3TV3L 4G9FE 4PGJA 4LPWA 4TNVF 1G9ML 1MCWM 5JOPE 3S8WA 3BHBB 3QI9B 4BSWA 3OJDA 5KOVC 1FORH 5K9KA 5ESVB 4P2QA 2I5YH 5F9WC 4MQXD 2XRAL 3VI3E 3KXFE 1FZJB 5CUSH 5C7XL 2YBRB 1UZ6E 5AUMA 4I3RH 3IDYB 2EZ0C 5E2WL 5AZEL 4BQ6A 4M6AA 4XP6L 4U1KB 3ARUA 5EO0B 5I30H 4P46D 2I9LA 3CXDL 3HG1A 2BNUB 3U9PL 4PJAB 5TH2B 1NFIB 2NY3B 3HZVA 5E08L 4WI7A 4FQQB 3IJHA 3TH3T 1A9BA 1QYGH 2Q6WB 4NQTA 5FUZL 1EMTL 3DTXA 1CD0A 5F1OB 5J1SC 4MDIA 1P7QB 1FVCA 1LEGB 4H26B 2X4TA 1K6QH 2ENYA 3PV7A 4WHYH 3WS3A 3T08A 4CDHA 4ALAL 5MEQA 1OLLA 4E9LA 2I26N 4U1HB 3GBMH 1OF2B 4ZS6C 5C07D 2YPVL 1UB6B 3KLAB 4M8VA 1NGQH 3RWHA 5JORB 5BJTA 4XAKE 1AQDB 3MJ7A 4I0KA 3RP1A 3O3DA 4CN1A 4KK9D 1V05A 4PJFB 4M61B 4F7PB 3U82B 4L8CA 1DEEA 4FQJH 2GK0A 1L0YA 1O7VA 2BMKA 2DS4A 3EO1A 1NL0L 2HLFD 4PJHF 2C1OB 5I73B 5KVEL 5SV4A 4MD0B 1XAUA 3QFJA 1RPQA 1M7DA 1XF4B 4YFLF 3QDJD 2X1OA 1ZA6A 2H1PL 1R5IB 4MAYB 5C08D 5B39B 4N9OB 4NJ9L 1HWHB 2ITDB 1JVKA 4GRWE 2VC2L 12E8H 3OAYK 1J86A 3N1FC 4NWTH 4X7DC 2W0LA 1H9VA 1T6VN 4Z0BL 8CGTA 4GBXA 2JIXB 4P9HH 3O2VH 1OM3L 2EYTB 4P2OC 4Y5YA 2LV4A 4N5UA 3ARFB 1OCWL 2PTUA 1LNUA 3H42H 1DQDH 5DRNB 1T1YB 4M48H 3TBVA 3VGAB 1OQXA 3D2UB 2VKWA 1HHJA 3BSZL 5HY9A 4G6JL 1QSZA 1S5IL 3W0WD 4WO4C 2KBGA 1JWMB 3VGEA 1UCBL 2VDNL 3MFGB 4S1QL 3CLEL 5J12C 2CUIA 4CJ1A 4HXBH 1BZQK 4M5YL 4OD1L 4TVPL 5DI8A 3D3VA 4NZRH 2OSLB 5IHBA 5C07E 3SDXE 1A1NB 3MA7B 3MCKB 3P4MA 2R56H 4JM2C 4NN5C 3DRTA 3WIIH 4F2MA 1FP5A 3QH3B 5EN2B 4G6AC 4C59B 4E0RB 5IJKA 2A9MH 1VCAA 1AGDB 1PJ9A 1Q38A 4WI2A 5A16B 3TYGL 4HWEH 2YD8A 3C8KB 1H8OA 4JFPB 3RNKA 4P23C 3U36B 4FNLL 3EYUL 5C9KA 2BNRD 3RL1A 3CVHL 1RUPH 3RWEB 5I76B 2DRUA 2XY2A 5CBEB 3ZT7A 5DMYA 3LKRA 4L29B 1B4JL 4RA3A 1JWSB 1R5VA 1CXFA 3GRWL 1AGCA 3T0XA 5EUOF 4RFOL 5C08E 5IB3A 1DVFB 4FQ1L 4OV5B 2IALA 15C8H 3LS5H 3MRCA 3KNBB 4LLWB 3GJFK 4X7SH 3NCJH 1GGCL 4YO0A 5DMGD 5CD3B 5TE4H 1HIML 3UTSD 1INEH 4J2XA 2P5EB 4HJJH 1NCCH 5D6CA 1IGCH 1H0DA 5C0DB 3KG5A 1I7UA 4R7NA 4ZTOH 1KPVB 4PY8J 4PGZA 5T5NF 4RAVA 3W0WE 4U1SB 4U1IA 5EZJA 4Y5VC 2VLJA 4HAGA 3E6FA 3SJVB 4Z77A 1MUJB 5HHQA 2IMNA 3IJSA 4MJ6A 2EZ0D 4QRPD 2GCYA 1KN4L 1K5NB 5FYKD 3ZT6A 1JCKA 5HYJB 5T3XL 5C2BH 4GRLC 4L4TA 3DXAA 3ZT5A 3RHWF 4RIRA 5D7JA 3EZJB 1U8QB 5IW6B 4X4YA 4ISVA 3MLZL 4PJHE 4UIMA 4EEEA 2E9WA 1T2QH 2VIRB 4JLRB 3VGFA 1ADQL 3RGHA 3HNVL 4XHJC 3I6KB 4R9HA 1F42A 3IKCB 4Y4HC 1SJHB 4XVTL 2P8LA 2X7LA 5L6YH 5T5FL 5IESL 2QQKH 3VFMB 3GJEA 4J4PA 2E27L 3MLTB 5C0RH 1TTGA 2OL3A 2GT9A 4N0UA 2X5PA 2BY2A 3N1GC 4Z5RB 5ALCL 2F5AL 2Q3AA 1FJ1A 1QFUH 3FMGL 1UKTA 2QR0B 2VDOH 2ZSVA 5FO8B 4JM2F 2AI0L 3UTSE 3NZ8B 3T4AA 1A0QL 1AD9B 1Z9LA 1JGVH 4I1NB 3WBDA 1QBLL 3P4NB 4ZUUA 4PGCB 4ZPVB 1ZK9A 4PJDF 3S4SA 1A7RH 4LKXA 2DLHA 1CQYA 3QQ4B 5HDLA 3LD8C 3L6FB 1NC4D 3S37L 2CUMA 4XI5C 4BKLB 3NFPB 4DUWA 3QWOA 4ODXB 1FVEA 3ZTJG 3L95B 4NQSB 3BW9A 2IAND 2GJ6B 1PG7H 1IAOB 5BQ7A 5HYSG 3KYKL 2UZIL 2WUCH 2QADC 1MCRA 4QRPE 3SDAC 1HSAA 3WHE1 2Y5EA 1XZ0A 4YUEH 5FYKE 4G8IB 1R3IH 4H25B 2YPLA 4AQ1B 1KBGL 2JTDA 1YEHL 3I6GA 2ZUQB 1DJSA 1EEZB 1T20B 2PXYC 4O2EB 5CEYB 4YXHL 1G7PA 3PWJA 5L2KB 3BVNA 4NQCD 2C1PA 1F90H 4AMKL 5KJRH 3VWJD 5FXCH 3GMMA 4PD4K 3GMNA 4WO4D 2NY7H 5EUOE 2V17H 3SKOA 4X6DF 3GGWA 1HXYB 3LKPB 1N0LA 3CFDB 4MYWB 4R26L 4GFTB 1OAYH 1U3HC 2XY1A 1AXSB 2F9BT 5SWSB 2AJ3A 5FF6A 1MREH 3ZL4L 1KNOA 4Z7QF 2VXUL 4JM2D 1Q9KB 5BV7H 3I02B 4G6AD 4ZUVB 5EIIB 1S7XA 1OT2A 1IJ9A 3EDKA 4H88H 2AEQL 2VR9A 3RGVB 5HVWA 3KYNA 4YDKH 4HUWB 4K71C 4OLWL 4P23D 4ONGH 3M17B 4HIEA 4GG8A 1XF5A 2BXZA 5GRXG 3SKMA 4LEXL 3BUTA 2IGFL 3KPLB 3LPFA 3SOBL 4IRSA 2EYRB 3O4LA 5LAXA 5DJ8B 5HJ3A 4MLIA 5IB1B 4XBPA 3H0TA 1YEIH 5M94B 3EYFB 1FVDB 1NBVH 5CKGA 1JPSL 3MRDA 2OP4L 3BKCL 2DQIL 4FQXC 2IMMA 4GG6F 1S9XB 3RWCB 3CDYA 1IKNC 3AY4C 1KEGH 4H1LB 2FO1A 2APXA 3HNSL 4JRYA 2MPAH 1E4XI 4NQCE 1QR1A 4P4RA 2X4SA 4EN3C 1I9JH 2HLAB 2UWEA 3VH8G 4LRIA 1YDPA 2DWDA 4LNRA 2NTFB 1KPUB 1TZIA 2EDKA 1A7QL 1CE1H 1MCDA 5I1DA 4K3JH 4DK3A 3SKJH 4NZJA 5KVGH 2VDLH 3CLFH 2JB5H 1OWRM 1FZOA 3MLXL 2P4AB 5LBSL 2HVKA 1WZKA 2IADB 2QQNL 1D9KD 4G5ZH 3BEWB 5E8EB 3X14B 4JFZL 2P7TB 3VFTA 3B8YA 2AV7A 4PY8I 1V3KA 4GRLD 4UDUB 3ZDZF 1P2CA 3VXQB 3VXUD 2R0KL 4AT6A 2EO9A 3FTGA 2FX7L 3SGDI 1OP5K 3M45A 3MFFA 2DAVA 5JR1H 4KAQH 3BH9A 3PDOA 5T5NG 5I74B 1BVLB 4XHJD 4OLYH 4Y4HD 1LP9B 2OBGA 4X7EC 1OAXH 3FRPG 1HZHH 4HKJA 1ZHLA 1LO4H 3N1QC 3NIGE 3QRFM 4XMKL 5IQ7L 1KB5B 3DX6A 1INQB 3SPVA 4NKOB 5K9OB 3Q6FA 1G9NC 3V5HA 4YZFF 3IXTA 4XXCA 3P9MB 2IWGA 3K7UA 1A1OB 1ND0B 2QSCL 1WUNT 1BIIA 1DL7L 4IRJC 4EUPG 2BP3A 4Q6YA 3FT2A 3OKDA 2PW2A 4U1GB 2FHCA 4U49A 4X6DE 2D0GA 3IDXH 1RU9H 2V6HA 1VSCA 5TDNB 5F6IC 5E70A 2J88H 1NGZB 3OB0K 3CSYB 3FB7B 2IQAA 5CIPH 4EIGB 3T77A 4Z7QE 1T04B 3ULVC 4XVSH 4PB9H 1RK0A 4XCEB 1HWGB 3S9DB 3QEGL 5F71A 4Z7UB 1P5VA 5TPWH 5KSUB 1NANI 4P5KB 2HTLC 2WIIA 4MSWA 1S7TB 4M1DH 3U7YL 1F5WA 4ZO8A 4L9LA 5GPRA 3RVXC 3VXUE 1A6AA 5I1CH 4U1MA 1L6XA 2PXYD 1SYVB 4HPYH 1W0VB 1KENL 2FD6H 3LV3A 5E8NB 4OZGA 3EDDA 1B0GB 2APFA 4L3CA 3ZTNH 3CNKA 4L3AA 3PABB 3WSQH 1M7IB 3H3BC 5C2UB 5E5MB 1G0XA 1ZMYA 2ESVB 4I2XE 2LAAA 5FUZH 1EMTH 1NMAL 4LVOB 3MRHB 4WEUD 3GSQB 5IROA 4AEIH 1KELH 1U3HD 3G6JA 4JY5H 2EKJA 4GW1B 1Q9OA 2E7MA 2IH1B 1HHKB 3EOAB 5ELIA 4GG6E 1JBJA 1JPTL 4PJCA 3B9VA 3MRBB 2YR3A 4G9DA 2BHYA 3D5OF 4PFEA 5I2IB 3DGCR 4PJBF 4LASH 3PHOB 3TNNA 5F7UA 4JFQA 3VI4F 2MJWA 2A6DA 5B39A 5I1AA 4PLOB 3VXMD 3QIWD 5T1DH 4LGRB 5FA4A 5D72L 1JYVA 5D1ZB 2D3VA 3HS0A 3OB8A 2Q7YB 1MCOH 1EBPA 2NR6C 3PXJA 4AK1A 4RQQB 4JHWL 4APQC 5ICXA 5MI0C 1MHPH 5GS1C 4K7PX 5E9DB 1NL0H 3EJZC 4BH8B 3C8DA 4HF5H 4YHMH 5ERWB 4HMDA 1JGDB 4Z7VF 2F74B 3ARGA 1AO7B 2B0SL 3PGDB 4RDQF 3S36X 3QNYB 1J05A 2H1PH 3BP5B 4FQXD 1G0YR 3LB6C 1ZGLP 4XMLH 1WSST 4Y0GA 5IJKC 4HHAB 4XC3L 4ZFOA 4OI8A 4KH2A 1CICB 4Z0BH 1BJ8A 5MERB 4EN3D 5D2LE 4ONHB 2GTZB 4JFEB 2VISB 4RWYL 4LARH 4KWUA 1QO3A 1AJ7H 1JZ8A 5DRXA 5C0BA 1JI1A 1JYNA 3C60C 1IGIL 5F7KC 3WHXA 4BSJA 3U7WL 2VKXA 4MDJA 1A6VL 2BX5A 1AGEA 1QFWI 3QUXB 4YZFE 1NEZB 5F9JA 3CLEH 3LRHA 1BFTA 1MPAL 3GIZH 1CGUA 5EO9B 1XIWB 4TVPH 1WEJL 1PBYA 3CDFA 5M7QA 1R0AH 2Q8AL 2V5MA 5D8JL 4DW2H 4UUJA 4YBLB 4CAGA 3B2VL 2WIMA 4OLVL 5BXFA 3DVGB 4U2ZA 2WBKA 2DQFA 3VXME 1KCSL 1FNGA 2QEJA 3BP6A 4P48A 4X83A 4GRMA 2DM4A 3HHRB 2J6EA 5ALBL 3UZEA 2FEDC 5IIEA 3DIFA 1TCRB 5F1SA 1DBJH 5JLZB 4JZJA 5E6IB 3Q3GB 3FQNB 5CHNB 3EOTH 4L1DA 5JHDA 4J6RL 4DZBB 3SE9L 4PJEA 2QHRL 5EH1A 1NGPL 4KTDL 4B50A 3UAJC 4XCYB 3TN0B 3IXAB 3O45B 3OJ2C 5F89A 2FX8H 3ECBA 5BW7C 2XFXB 3G6DL 3RVTC 4OFIA 5D7JC 3RL2B 2H26A 4ZSOA 3OZ9L 3MCLL 3IDIA 1ZS8B 1TZGH 3DJ9A 3HG1D 4IRJD 4UBDD 1A6TA 3HPLA 3WXVH 1ZLSL 2VTFA 3GK8H 4TSBL 4RGNC 1A5FH 3UBXG 4WW2C 5DVKA 1U8OB 1KEML 3DGGA 3GI8L 4I13B 3L7EA 2BVOB 3W82A 5E5RB 1TITA 5DJYA 5A2LH 1KIPA 3A67L 2Y1VA 2F8XC 4PRNA 3GMPA 4Z78A 4KZDL 1S7UA 2YUXA 4JE4B 1SVCP 4RFNB 5C0JA 1N3NB 4KJQD 3ZMRA 3MO1A 1JTPA 3HZKB 2NY6D 5AG8A 2LABA 1WWWX 4LLVA 4G7VH 4PJBE 3UC0L 4Q9BA 3RVXD 4ZFFA 4WV1A 4U3CA 4OBRA 1AE6H 4YWGH 3VI4E 5HTSA 2OTWA 3K0WA 4MXVF 1BFOB 4NKIL 2G75B 1VKXA 3D85D 3QISA 4PJXB 5BOZG 2NLJB 4ZFZB 1F4HA 4ELKA 4HWZB 2IPUK 4XP9L 3QUYA 1GOGA 3WFDL 1H3WM 3HKFA 1U8HB 5EU6B 4AIOA 1IGFH 1WT5A 4MA7H 4GO6B 3LKQB 5JDSA 5JW4R 1EEYB 4Z7VE 5IHZB 2ZZUT 3RI5K 1BD2A 3MYJB 4WHTA 3ARSA 3QFJD 2BVTA 5T5FH 2GSGA 3TJEH 5KTEH 3MRJA 4LLMB 1TTUA 3CK0L 3G6AA 3OKLA 2Q7NA 3VGGA 3DMMC 3T0EB 5ADOL 3HG1E 1EZVY 1R3KB 3QRGL 5DJZA 3QIUC 1G7IA 1EHAA 5GGTL 5AAMA 1LE5B 2FLRT 5E2TL 1BFVH 2WBJA 3QEUB 4RSVA 3QHZH 1ORQA 2Z93B 3VFSA 3QDMA 3BO8B 1FIGH 2L0DA 1FZMB 2NR6D 5IB2B 2EECA 3VFOB 1MSPA 1KSRA 4APQD 3FHQA 1QFOA 2IAMB 4WUUA 3WFHA 5JOFA 1HKFA 5IEKA 4H8WL 3BGAA 3V4UH 2W9DH 1N7MH 3GSRA 1JNNL 4HJGB 4U7KA 4YBQC 1WBXA 1NMBH 1QSVA 1QKZL 2X40A 2K7QA 3KPRA 4E5XB 2UZIH 3MRKA 4X98B 3LB6D 1JZ2A 2BFVL 5HHPB 3LEXA 3MGAA 1S7WA 1I1FA 4JKMA 5FB8B 2A6KA 2ATPA 5I8OH 3FO1A 3MC0A 5JXEC 5FIEA 2F53D 2IF7A 3MR9A 3L3IA 1JGUL 5IFHL 4XP4H 1Y18A 1J1PL 43C9B 2PTTA 3GKWL 3IU4H 1A4JA 4WW2F 1TQBB 5F21B 2H6PB 1N6QH 3ZKXB 1F11A 5EC2A 4F37K 2YD2A 4U0RB 3C60D 3N85H 1JMXA 1IM9B 3KPTA 1KLGA 3QFJE 1LE9B 5DJXA 4NJAH 5CINH 2X9WA 4PJGB 2HT4C 2E6JA 3MJ8B 4GQPH 2UY7A 5C0FA 4BSVB 4H5SA 4RDQG 3HUJA 1BZ9B 2BK8A 5GGUB 3L3DA 4D0DB 4QOKA 4NDMB 2Y06L 3EFDL 3ZSSA 4Z95H 4PY7A 5IV2A 5I16B 2CIKB 1U2HA 1ZHBB 4DQOH 1HHHA 3C5JB 4RGMB 1OGTA 1UB5A 1VFAA 2O26U 2FEDD 5JXAL 2M1KA 4YGVA 3WIFA 3NPSC 1FZKB 4LSPL 2CDEA 3TP4A 4X0KB 1EGJA 4NBYB 5MP6L 4NRYB 4LCIL 5F7DB 3L3GB 4WTZA 3MLVL 3QO0B 1NDMB 3EYOB 3ZDXF 3DSNA 1DE4B 1K85A 3LN9A 3RVTD 4L4TD 5D7JD 4AJ0A 4X9IA 5J56B 1H3TA 2DN7A 1U8PA 1T3FA 2Q8BH 1I8IA 4JAMA 4MB4A 4YFLI 5FHBL 5D2NB 2C7UA 4OV6F 3LIZH 3OXSB 3FFCA 1JHTB 1LO0H 5C0IB 4UU9A 4MMZC 2DLGA 4TTDC 4J4PD 4PJ9A 2FR4A 1CDYA 3BT2H 4MX7B 2C4XA 2FB4L 4FOMA 4FQ2L 1C08A 5DJ0B 3JSSA 3WO4B 1FL6B 3CC5B 2QQLH 4GAGH 4OZ4B 3W81A 4XCFL 4XXCC 5AZ2H 3STZB 4OCWL 1UQSB 3HRZB 4NO3A 2HH0L 2PCPA 3VFNB 3UTTB 3PV6B 4X7FC 2PN5A 3BD5A 2R0KH 5ICZB 1E4XL 1CDGA 3TNMB 6CGTA 2FWOA 4NQVA 4AM0A 1KB5H 5CIPA 4HMCA 3QXVA 1S3KH 2HFEA 4HAFA 3EIFA 3TFKC 1A6WH 4RBPH 4XBGA 4LHQB 2FIKA 3EO0B 1NFIA 3L1OH 2H3NB 1QSED 2YA0A 2PKDA 4ZTPL 4NP4H 5LGHL 1CLZL 1CGXA 4JM4H 4XPFL 1Q9LA 1P7QA 2EIBA 5E00B 3RZCC 2VQTA 2FO4A 3FQTA 2YPLD 5ENWB 1P7KB 4L4TE 4YHZL 3DMMD 4FQIL 4GKSB 3VFVA 5L0QC 4JFHD 4R4FL 4URTB 3FOMA 3QIUD 5MENB 3NFNA 3FB8B 1C5BH 4I77L 5T3ZD 5J3HC 1WTGT 1BQSA 1GC1L 4KVCH 3UJJL 1EHLH 1X5ZA 4OIBA 1YNTB 1ZT1B 3PXHA 5H94A 4HCRA 1F3JB 1FC2D 2ZCKL 3QUKB 5ANMB 4ELMB 4N8VB 3IDMB 3S5LB 3BESR 4N0UE 1CZ8L 1QHPA 5IROC 1MRFL 3ALPA 4FFYL 1Q0XL 5IB5A 4XNUH 2BXYA 3KPMB 4M6NL 3WDHA 3PQYA 3LVEA 5JO5B 5IBUB 3O6ML 3VXPA 4P9HC 1RZKH 2YPKA 2Q86B 5I6XB 5B21A 1S78C 2DQUL 4YC2B 4HUMB 2ITDA 4LOUD 3B9KC 4XVJL 5CEXB 1DLFH 3P0YL 4OQ1A 1KENH 4Z76A 2IPKA 1VGEH 5BZDA 4U6XA 4XNZC 4NNYB 1TLKA 4B7LA 1YN7A 4X80H 5DD3L 1QSEE 3IVKB 1CLYH 4IRSD 3ZDXE 3D2UA 2VITA 2L7UA 4Z7NF 4C4KT 3ARGC 3C6SB 2YPLE 3HPJA 4FFVD 2AQ1A 3MNZB 2QHLA 3AS2A 3QUMA 4JO4L 4LPYA 3BRDA 5HBBA 1A4KB 3DARA 1PZ5B 2X89A 5DJCA 2E7LC 3H2WA 1NKOA 2OTUA 4JRYD 5T3ZE 4F9PA 4ZQKB 5IVNA 3Q48A 4RFEB 5ID1A 2F5BH 3V8CA 2JJWA 4CN4A 2YUWA 1DQLL 4HS8L 1B88A 1MQ8A 1Q72H 5D4QA 3L5IA 1HN1A 3RWJB 3RRQA 4QHNB 2E7HA 4WU5A 1IAKB 3ARBB 3SE4A 5J11B 4GAYB 4LLUB 3HE6A 3QDGB 5IT2L 4TSAH 1NUFA 3KWWA 4H20L 2EIZB 4KI5C 3TYFA 5LGJB 1RULH 3KLHC 3RUGB 3IFLL 4HKXB 3RI5F 5MEOA 3RDTB 5JHLH 5H8DA 1KCUH 1WICA 4X6EA 3CJJA 1A3LL 5B22A 3LZFL 4NFCA 3WN5C 4XWGL 5GHWL 5D7LA 4KJYB 1YEKL 4XXDB 5EOCJ 4BQ9A 1LO3L 4R4BA 2EC9T 2P5EA 5DJAB 3SCMA 4TTDD 3O4LE 3IT8D 5EBLA 2XYCA 4MJ4A 3NN8A 1FLTX 4P3DA 4M7ZB 1H3PL 1YJDH 1IGIH 3BKYH 3TH4T 5K59F 4JKLA 4OF5A 4W6XB 1MLBB 3WFCL 5BS0A 4ONOA 1X5YA 4PJCF 4OBSA 1NLBH 1NLDL 2EC9U 5D93B 4NM8L 2X4NB 4JRYE 3QWRA 5DRZB 1OGAB 2LTQB 2W9EL 3IFOB 1DFBH 3VG9C 2UWEE 4HK0A 3UTPD 2CGRL 3MACL 2GTWB 3H9SB 3MV8A 1J0HA 3TFKD 3KYMB 3DRQA 4PS4L 4OLXH 2R0WL 2E9JA 5E2JA 2EDWA 2P8PA 3KPOA 1T5WA 3T4YB 1SJEA 4XPGH 5ITBL 3RZCD 3BUYB 3LN4B 3DX8A 3VJ6B 4EOWH 4QYOA 2QHRH 4Y2OA 5FK9A 4F37F 2W65A 1BGXH 3UDWC 3L3OB 4ORGA 2GKIA 1CT8A 2PYFA 1OAUH 1T0NA 4YDLC 5J3HD 2DIJA 5TDPA 3BDBA 3O9WB 4RZCB 4I4WA 4PGBA 1T5XA 2NY2C 2LU4A 3QUYC 4PGDA 2V2TB 1WT5C 4O5LH 1MY7A 3WD5H 2YC1B 4I0CC 1MCPH 2FYYB 5DLMH 2JJSA 5IF0B 1F4XL 1C5DA 2Z8WC 3O6FB 4KK5C 4HUKB 1U95A 1RUQH 3G04A 3P73A 4JEGB 4D9LL 3RVUC 3I2CH 3OJMB 3V6OA 5C0AA 1IBGH 1S78D 2OJEB 1F6FB 3GEWB 5IVXF 2A73A 3KXFB 5KVDH 1JIBA 4KI5F 2V5SA 1FGVH 4F58L 3TCLA 2GAZB 1G6RL 3UTPE 5EUKA 2OI9C 1PYWA 3V79C 4CADA 1SBSH 5C8JB 5T33L 5CJ5A 4HULB 1OAQH 2VZ3A 5IMKA 5ID0A 1JHKL 3RNQA 1G7LB 5BV7C 3S34H 1AP2B 3ARGD 4JREB 1G6RB 3SDCA 3UBXI 1YMMD 4PJEF 1KTDA 1NCDL 3LSOA 1CS6A 1RZJL 5ICYB 2R8SH 3ME0A 4OUUB 1QQDA 5GGSA 4NC1E 2X4RB 3FCTB 2XA8L 3Q1SH 4OZGE 3S3JA 5TDOA 5DMKB 4ODVL 3JVGC 4R96A 4L8SC 4RCAA 4A6YB 2FL5A 2VZVA 3S88L 5KSAA 4EZMA 2CD0A 4JPIA 4NNXA 2H41A 1HKLL 4ODBD 2AERT 2L7JA 3CSPA 2MCPL 5INCA 1ZTXH 2CLRB 5K59E 2XN9D 4DAGL 2P49B 2DLTA 4U1LA 2ADJA 4WI6A 4PJCE 4Y4KB 2YD9A 5ACLA 1C1EL 4J3VA 4HUVB 3BE1H 3ILPA 1ULVA 3V4VL 4KI5D 3TWCH 1BZ7B 3PP3K 2Z35A 3KLHD 1GGIH 4P4KC 4N1CA 3P9WB 4M7KL 1DUYA 1S8DB 4FS0A 3ARVA 3MJ9A 1YEJH 1KXQE 4JPVL 1R24A 1JNLH 1CXIA 4G6KL 4AEHH 3GBNH 4P46B 2ATKB 1GGTA 4FRWA 4WHYG 3LH2H 3WFBL 5EU3B 4PB0L 4JDZB 5F88B 3GKWH 1ZANH 3ZDYF 5JHDD 1DQQB 1G84A 3PWVA 1BQHG 4ODTH 4WWKA 5CD5C 4YE4H 1MHCB 2B39A 2ADIA 1HYSC 5DD0L 3MODH 2XG5A 2GJJA 4UDTA 5EWIH 1IEBA 5GGQL 1G7HA 5CP3A 2EDYA 4FP8L 1V7MH 4S1RH 5FM4A 2XKUA 4LSRL 3ZYJA 5C07B 3E3QC 3SDXB 1CFNB 1S9VB 2VQUA 1AQKL 5GJSH 3JWDL 4Q9QL 2X1QA 4HFWB 4UOW1 3NCYP 4LMQI 2ENSA 5EPMB 1QBMH 4LCCB 3FO0L 4YDJA 4LSPH 1T21A 2P24B 4NQDB 5DA0B 2W9LA 1D5IL 3RY5A 4GXVH 1RJLA 4S0SD 3OMZA 3KPNB 1LO5B 3CZJA 4KI5E 5JW5A 4M1GL 4AIZB 3BP7A 2Z31A 5C08B 1KB5A 3CFBA 4K9EH 3TPUA 5CLWA 4JDTL 1MCKA 4CKVX 3VWKA 4ZO7A 1Z0NA 5GISL 1EERB 3IDYC 2KKQA 4JO1H 3I75B 4YEFA 3Q0HA 3CVIH 1JF1B 1HSBB 3V5DB 3C5SA 3QUYD 3V5KA 5B39G 1G9MC 5B4MC 5ISZA 3ROOA 1EAJA 4HZLA 4DN3H 4NKDA 5JHDE 2CKBB 2R0ZL 4MNGA 1T0MB 3U0PB 1YYML 1U8KA 4MA1B 4PJEE 4F7CB 2HMIC 1IM3B 4KK5D 4WHCA 3C9NB 2ZG2A 1B4RA 1EK3A 3RVUD 1IAIL 4QGTA 1T1XA 1LDPH 1A7PL 2WZPD 3QG6A 5EU5B 3SHSA 2X70A 5DEFA 1HEZA 1X4XA 3PWUB 4Y5XA 4BFBD 5GIRA 1CBVH 5CJXA 1S7TA 5ETUB 4LEOB 3NAAH 4JPKH 1RZ8B 2WBJD 3VCLA 1HINH 3H7BB 3U0TB 1VHPA 2EIEA 1R3HB 1FPTL 1M6OB 4WUUD 4LCWA 5IVZA 4PJHB 1MAML 2BRRH 1JN6B 2BOCB 3V95A 4DFHA 1ACYL 3KPRD 1Q1JL 3L5WB 1J0IA 5F3HB 4D0BB 4U1JB 1GSMA 2J2ZA 4MAYC 2Y5TB 5F97E 2DF3A 4PJIB 1BM3H 4UV4L 1M1SA 1FGNL 5TQ2L 5E6YA 1LK2A 3IFNL 3UTSB 1W72A 1AFVH 2YD3A 4GW5A 4HEME 3ZDYE 2A1WL 3QEHB 3HR6A 1MFCL 1DEDA 3ALWA 2BVPA 4FZEL 1P6AB 1RJZA 1XF2A 3CFKA 3ARFC 5FYKL 1EXUB 1ETZA 4YDIH 1WJ3A 1CQKA 3VGAC 1OP3H 3HC0A 4PJ8A 4LSVL 4YHPB 2FJHB 4NHUA 5AEAA 3WYRA 2JF1A 5E0QA 5F96H 4XB8A 5GRUL 4QOKD 1JF5A 1QFHA 4JG0L 4P4KD 3LY6A 5ERWA 1JGDA 1UACL 3BPCB 2WLZA 4QRPB 1WV7T 1D5ZA 4LDOB 2VERN 5ILTH 5E8DL 4M8QB 1FRGH 4OD3L 1YQ2A 4K7PL 3ARYA 4OCRH 2E6PA 5E8OA 4HDIB 3JTTA 3VH8B 5JDJA 1F4WL 1JZ6A 1J5OL 5JIHA 4WUUE 3V0VB 3MNWA 2X44D 3S36L 1KTLB 3WDJA 4UIKH 5GJTH 4PJAF 2FSEA 4MNHA 3SE4C 5CD5D 4DN4L 2D7NA 3MLSL 3MV7A 1HYSD 3VDBA 3CZFA 4BFIB 3O6KL 5EUOB 1P9MA 3KPRE 3H3PH 2APWA 3VGBA 4PRHB 1EO7A 3BJLA 2LAGB 4M6OH 4B41A 2ED8A 4JGMA 3PGFL 2VDPH 2XWJB 3ARQA 4OLZH 4PR5B 1K8DA 1DVFC 1MCBA 4BH7A 4KPHL 4TUJB 4XZUA 2CJUH 4N8CH 1OB1B 5HGAB 5ACZA 5IMMA 4G8GB 3BMVA 1CDHA 3K2UL 3GUTA 3FFCD 1LEKA 3MNVB 3SCMC 2O61A 4HS8H 4PJFF 1MH5A 3IAGC 4FQLL 4QT5B 5ADPH 3MROB 4I48B 1N8ZA 4P2YA 4C56A 4FQHA 3HUJE 4NSKA 1X44A 5FEBA 1F6LL 4OJFH 5E6IA 2V7NB 4PUBH 4QOKE 3P30L 3DUUB 2CDGA 4X6CA 2I9TA 3UYOD 1WZ1L 2G9HB 2R23B 4ZNEA 2X6MA 3BIKB 3LHPH 3PWLB 5BOPA 1K2DA 1IQDA 5CAYB 2XFXA 2CLZA 2HA1A 4W4OC 1MCHA 3M1BB 4NQCB 4HGMA 3VWJB 3PDDA 1H3UA 2HMID 4HXAH 1RZGB 1HDMA 5A2JH 3MBEA 1X9QA 1WFUA 1P7QD 4MXWL 4GMSL 4RBPK 3SGEI 5IFJA 1UJ3A 2Z0BA 2P42B 1PKQA 4U4BA 4K8RH 5EZOL 4P3CL 3ZKNC 3FQXB 3E3QE 3OKOB 1E6JL 4L4VA 1I9RL 4L8BA 1DBMH 4XCNA 4YHLL 2FIRT 3WLBB 2ICES 1K4CA 4OCSL 4OI7A 5HVGB 3RU8L 3MA9L 5I1HH 2XKNB 3KPQA 1AH1A 2W9EH 4TUOA 1A9EB 25C8H 1YC7A 3FFCE 4PBXA 3FQWB 5IWLC 5HHMB 4QHKJ 4QHMB 3GIVA 2OR8A 5MEPB 2YEZA 4HT1H 3R8QA 1U8HA 5DEZA 1D5XA 2W0KA 2JELH 5CGTA 3CU7A 1ES0B 3LKQA 4GKZA 2HJFA 3B9DA 3K4DA 2DJ4A 4KHXH 4RMQA 2AXJA 3V6OC 1JPGA 3X13A 3QHFH 4MAYD 5DUPH 2X2YA 4LLMA 1YZZA 3EW3B 2WUBL 3BPOB 4U7MA 2ZSWA 4XNMA 2DMBA 1S7SA 1T1ZA 3T0EA 1R5WA 4QCIA 2EEBA 2ZUQC 5KW9H 4PJAE 3G08A 5ESQA 2LU7A 3P77B 2Z92B 3AMLA 4N0CC 2V2XA 5T1MB 1JNJA 3T65A 4K94L 4OI9A 2OJZL 1FBIH 3WJLC 3D2UD 1H8SA 1MFDH 2FZ3B 4YHOH 2AJYL 5F8QC 3SDCC 2EDFA 1FO0L 2IAMA 1I1YA 2BCKA 4XT1C 1ZV5A 1D9KB 4NOBA 4M7LT 3RFZC 2VL5B 3BAEH 5DK2B 1S9WA 4XP1L 4J3OC 1XR8B 3DX7B 5AWNH 1PG7X 2VDRL 3JV4A 4PJFE 1QBAA 3RGVC 5HGDB 2VMFA 3MRFB 3QWQB 1INDH 4NHCL 4XCCL 3R06A 3LMJH 4M1CD 4XBEL 2PF6A 1MWAL 4A6YH 4I2XB 3RAJH 1JK8A 4WUKL 1VEPA 5DFVC 5GSVA 1HH6A 1TVBA 1H15B 1XGRB 4LCUA 3BFOA 5DVMA 4BQ8A 3C5ZA 1GH7A 1T6WA 4JFOA 4CU7A 2GFBA 1CFSB 3WL9A 4LPXA 5FGBA 1MWAB 4FFZH 2C26A 3RWDB 4LSSL 2LQRA 2P5ED 2ZUSA 3O8XA 2R1XB 3SCMD 1NBYB 3ROLB 1CF8L 3KS0J 2BSSB 2UVFA 4F15B 5SWZB 1ZHNB 2OQJA 2PO6A 2Q87A 3O3AA 2E6QA 4OQTA 1FDLH 1TJGH 5BS0D 1EJOH 2I07A 3RWIA 1NJ9A 3HMXH 3VMOA 4OGZA 1FNEA 5L7XH 3LQAH 2AEPH 3QWRD 4OZFA 3V0WL 4N5ED 4YQXH 5JMOC 5HYJD 1GCFA 5HPOA 2VH5L 3L3HB 2ORBH 1EEQA 1N4XH 3F12A 5EU7C 4GKNA 3WIHH 5EZLA 5TE6L 3VXNB 1S7VB 1RIHH 3BQUB 5D2LB 4KC3B 2NY5L 3ARDA 4P5MB 1EO5A 4AG4H 1GZPA 3SKNA 5I74C 4L4JA 2VSDA 3RTQB 3ZKND 5CSGA 1U3HB 1XT5A 5F7YC 1I1AB 2ARJA 1I8MA 3LKOB 3EOBA 1EFXA 4ENEC 2AJVH 5GS3A 1FFOA 1OAKH 1NH6A 2FHBA 3J7HA 4GSDL 2HKFH 1KG0B 2KUTA 3GHBL 5GSRB 5GS0H 4DVRL 3STZA 3L5JA 3DNKA 5D7LE 2FJFA 5CJOL 2A6JA 4D94A 2P5EE 1F2XK 1UWEH 2ZNWA 5DQ9A 3WUWB 1P4BL 3VXMB 3QIWB 4Q9QH 2OMNA 3QYCA 1Q9WA 2HRPL 2DD8H 5IMLB 1RUKH 4GS7B 5CCKL 3QIBB 4QRUB 5BS0E 2ICWJ 1MEXH 1AIFB 4JHAL 1FNSL 4BZ1H 3MV9A 3QP3A 1BOGA 2COQA 2FATL 3IU3A 3SY0A 4M5ZL 1KC5L 4XPAL 2GJ6D 1N59A 2DQGH 2YOCA 1RZFL 3FKUS 4QHKI 2CKBH 3A6BL 3OF6A 4QNPF 3QUZB 5HYJE 4JFXA 1RI8A 3S3PA 5F7EH 2MQ3A 3MV8E 4FA8A 1TVHB 1O7SA 2EDRA 1AR1C 5J4MA 4JFDB 4WFFD 1K8IA 4N0CD 5BRZB 5DD6B 5L2KD 4EBQL 3RIAK 3T8XA 5DWUH 5JA8B 3GJFB 3GMRB 4FZ8L 1RZKC 3NABL 4MS8C 1OPGH 1RZ7H 1OTSC 2ARWA 3SDDA 4IIQA 3SDCD 2XG4A 4UV7H 4LVOC 5IHUH 3IDMA 3S5LA 1NAMH 4NKMB 3VXOA 1A7NH 1MHHB 4ETYA 1ZLWK 1QOKA 5SWSD 1FSKB 4RISL 5J6HB 4PJBB 3QULB 4L3EA 1C5CL 2R1YB 1WFOA 2FBJH 4LLDA 1G7QB 4LCYB 1DBAL 3MOBH 1EAPA 3FJTA 4Z6AT 3RGVD 4YPGA 1CN4A 2B1HH 5JTWA 1G9NL 4JGJA 4G8EB 4OLUH 3C6LA 4LU5L 4JQVC 2ZJSL 3T2OA 2M26A 3JZ7A 2XXCB 3TVMB 5I9QB 2RHEA 4BSWB 1CLCA 2CKNA 5D1ZC 5HHOA 3OJDB 5E8PA 2MTPA 4NCC1 1A1MA 1IGYA 5K9KB 4WNQA 3V6OE 1LP9F 4P2QB 1JFQH 4X4ZA 5KBNC 4WI9A 1OWWA 4WDIA 5DO2C 1WWAX 3DVNA 2MHAA 4AYFA 1QLFB 3WUZA 1CL7I 4KK6C 1OY3B 1UGNA 2IJ0C 4JN1H 2OCFD 1RURL 1CVSC 1RVFL 2P48B 4RX4D 2EDNA 2I9LB 3FN0H 2NNAA 3HG1B 4MJ5A 4WFFE 5ITFA 3TJHC 4LDEB 3HZVB 5HDQL 1CICC 3IJHB 1A9BB 3N9GH 1YPZA 4LNVA 5IKCA 3DTXB 4P2RA 4WWKD 4MDIB 2N1KA 4JJ5A 1FVCB 1QZ1A 2X4TB 4RMTA 4MCZA 3WS3B 4QRSA 4HV8A 4F7TA 1IAKA 3FAWA 5SWSE 1WAAF 5IQ9A 5MEQB 3QUXC 2NY6B 4X5XA 5IM7A 3RWHB 1XIWC 5BJTB 4Z7UF 3MJ7B 4TTGA 3O3DB 4R3SA 2EIZA 3DX9A 4JG1L 3DO7A 2HFGH 4YBLC 3HC4L 4X4ME 3NZHH 4WEMB 1YJDC 1IKFH 1DEEB 4S1SL 5FCUH 4ZD3H 4NC2B 3T3PF 2BMKB 3EO1B 5H37H 1BEYL 1OTTC 4NGHL 4ZUSA 1X5XA 5E6IC 3CXHK 4LPTA 3VG0L 3K46A 4FQCL 2A0LC 1M7DB 3VA6A 5F6HI 4QNPE 4OM0H 1ZA6B 2C9AA 3VRIA 4ENED 2HT3D 1F8TL 1P69B 2GJZA 4EI6A 4F80A 1MLBA 4Y19A 4OCNC 2WMPA 4I0PA 3TN0C 1M71A 5D71H 1HOCB 2K1MA 4GBXB 5ISZD 4R4NC 3OSKA 4Y5YB 3BZDA 1RUML 1LNUB 3TT3L 3TBVB 5ABDE 4MZ2A 1HHJB 1AR2A 5HY9B 3IDNA 4EVNA 3MZGB 4OB5L 4GMTH 4Q6IA 1BPVA 1UM4H 2EE2A 1TJIH 5FYJH 4PJ7A 2BVUA 5F93C 5DI8B 3D3VB 4RFNC 3U48A 5I8KH 1WIOA 3U1SH 2ERJB 3T4YA 3P4MB 1J10A 5C0GA 4KUZL 2B7DT 3DRTB 5EBWA 2XZQH 4F2MB 2Y07H 3GHEH 4UT9L 3V4PL 3ESVF 1AR1D 1MFAL 1P1ZA 4LAJH 1T1WA 3SE3A 3OAZH 3UO1L 4UQ2A 4DJMA 1A6UL 4V2BA 3RNKB 2F58L 3RL1B 3P0VH 5D7KD 4MS8D 4KDVA 1FCGA 3R0MA 3LKRB 1R5VB 1DBKL 4NWUL 1DSFL 1SMOA 3NIDF 2D7TL 4LIQH 5IB3B 1UXSA 4MZ3A 4IMLB 4F7EB 3EYQC 2IALB 1IC7L 3O6FA 5DHYA 1SY6H 4WGVB 3AM8C 3ZKSD 3MRCB 1KULA 1TENA 4HGWB 4OTXL 4YO0B 5ISZE 3T0EC 2EDTA 3GNMH 4JQIL 1X5HA 3MCG1 4TUKH 1NCTA 5D6CB 1H0DB 4BZ2H 1I7UB 3PG2A 4R7NB 7CGTA 4H1LG 1QNZL 2WWMC 1X3DA 3PL6A 5DYOA 4RAVB 4LLYA 2NYYD 4U1IB 4MD4A 4OGXL 5EZJB 2D31A 1UA6H 3GFUA 3MOAH 2VLJB 1NCNA 1G6VK 4S0TD 2IAMC 2AAVA 3MRQA 3E6FB 4Z77B 1B6DA 4Z7UE 2OZ4L 5HHQB 2R29H 3THML 1MELA 1OP3K 5E03A 5D5MB 4HQQH 5KANG 1AO7D 3IJSB 4LSTL 4MJ6B 4WTXA 3V6FA 2GCYB 3HNTL 4KK6D 5DC4B 5HYQA 2MFNA 1UADC 4J1UA 2ZUVA 4L4TB 3DXAB 5DT1H 4RIRB 5D7JB 2WUBH 1KJ2L 1TJHL 3EO9L 5EB9A 2E3VA 2XI9A 3SGKC 3TJHD 3T3PE 4R90H 5DMKA 1CICD 4X4YB 4HLZH 5I1KH 1V7NL 3HTLX 4OSUL 4ISVB 1XFPA 4UIMB 5D7KE 1OARL 5DQDL 4HWBL 4NT6B 2P8LB 2X7LB 3ZKXC 3GJEB 3NIFF 2J8OA 2OL3B 4U0RC 3RY6A 2GT9B 1JZ7A 4N0UB 3QUXD 4CU6A 4NNPL 4S10A 1FJ1B 1XIWD 3HAEA 4NUGL 2EH8L 2ZSVB 3LDBB 3ZE0F 3VXRA 1I85A 3K8KA 3NPZB 1BBJA 1HH9B 2VO5A 1SJXA 2ZUWA 2Z8RA 4M00A 4ZUUB 3CIQA 4AL8H 3S4SB 4QXGL 2W38A 4RGMC 1UFUA 1MRDL 1EA9C 2B5IB 4PJXF 4UTBL 4C56D 1QSFA 3HMXA 3CVHA 4V1DA 2OXGA 2YWYA 5DC0A 5C3TA 1IGMH 3QWOB 5EU3A 2NX5A 4ODSL 5E6ID 5J57B 1FVEB 5T3ZL 1Y0LA 3BW9B 2A0LD 5BQ7B 3EYSL 3BWAA 4Z8FH 1MIML 1AO7E 4Y4FA 5JQ6L 4IEFB 4WUKH 3AUVA 1HSAB 3FZUC 5HYEA 1XZ0B 4G6FD 5IR1B 1GGBH 2YPLB 3B83A 3WIHA 3IDUA 3T0DA 4MB5A 3I6GB 5LWYL 4JJHA 4JDVA 1CFNA 4L5FL 1G7PB 3PWJB 1Z2KA 1RZIA 3BVNB 2C1PB 2DDQH 3QXWA 4F57L 3AREA 5E7BA 3GMMB 3GMNB 4U6HB 4IRZH 2B8OT 3SKOB 4KKNA 4K9EC 2J5LB 3GGWB 1RUAL 4X8XA 3WHE0 2A83A 2AJ3B 5FF6B 1ORSB 1KNOB 4L4VD 1T83C 3AFLA 4XPBH 3OAYH 3WO4C 5I17A 1YA5A 1S7XB 1K9TA 4JO3H 1YUHA 5A2FA 3KYNB 3NH7H 5GRVL 2VXTH 3SBWA 1IEHA 2Y36L 3CDGA 3Q5TA 2E8ZA 4HIEB 4GG8B 1JF1A 1XF5B 3QNXA 2J1KA 4HK3N 3SKMB 5CILL 4C56E 3MXWL 2VAJA 4N0FA 4IRSB 2N7BA 3O4LB 5LAXB 1JZ4A 1BWMA 2IPTL 5HJ3B 4XBPB 2VXQL 2KZWA 4XPTL 4C83A 4DGIH 3H0TB 4MAUL 4OIIH 4X6CE 1UH4A 3C9NA 3MRDB 2JJUA 1J1OH 4PJGF 3JWOH 4ZNEE 1RV6X 5HXMA 5J1TC 3T0ED 3RKDD 4U31A 2XZCH 1UM5H 2K7PA 4O02L 3LEVH 4JRYB 5HHVL 6FABL 32C2A 1J8HA 5EIVA 1QR1B 4P4RB 4J8RA 1IFHL 2X4SB 4OF7A 3OGCA 1KCRL 2UWEB 2YUZA 1XEDA 1YDPB 1RZ8A 2WWMD 4KV5F 1TZIB 5A2KH 1NAMA 5I1DB 3UEZA 1OTUC 3KJ6L 1PKQE 4PRPA 1NEUA 1R3HA 2EEAA 1FZOB 2IAMD 2HVKB 1FORL 2P1YA 5J9PA 3ZE0E 4L4VE 1JN6A 4XAWH 3IDGA 2I5YL 3VFTB 4RAUA 2BJMH 2J3SA 5CUSL 3MRIA 4HIIB 2AV7B 3MLRH 5IFAL 1NEZG 3GJFH 4I3RL 1GC1C 1P2CB 4AT6B 1YYLH 3U83A 5I18H 2DWEA 2NZ9C 3ZE2F 3FTGB 1Z9SA 4POUB 4YC2C 5B3JF 2R2BA 4PJXE 5FGCB 5I30L 4KMLB 4OZIA 2C3GA 3BH9B 3PDOB 1CE6A 2FDBP 1DBBH 3M8OH 3MX0A 4WVRA 1QYGL 5KAQF 3ILQC 4UZGA 5SWQA 1HI6A 3B3IA 1ZHLB 1K6QL 1A6PA 3DX6B 4LLAA 3SPVB 2AXGA 5L88L 1MVUA 4U6VL 3Q6FB 4CMMA 2X4QA 3V5HB 4DKEH 1VPOH 2D4FA 3IXTB 4M7LH 3GBML 2ZCLH 3DUSA 3T0EE 2F8OA 4KY1H 1NGQL 3MV11 1X5FA 1BIIB 4PTUA 2QBWA 4FMKA 1CFQB 1S9YA 3FT2B 4AEFA 2X41A 4KROD 3O8XD 2PW2B 3P9LA 1TTFA 5FYKU 1TPXB 4FQJL 1E28A 2IQAB 2BDNH 1JRHH 3T77B 3QFDA 2IFGA 1RK0B 4CVXA 3ARBC 4J7RA 5J11C 2WIIB 3FZUD 1IZJA 4MSWB 3S3SA 5CBAB 2E5EA 5EC1A 4L9LB 1UEMA 4NQEA 3UZVB 1A6AB 1CDBA 4U1MB 12E8L 1CGVA 3PHQA 3LV3B 4NWTL 3OXRA 4OZGB 2Q20A 4O51A 2P8MA 3RDTC 4L3CB 4X7TA 4P9HL 1AY1H 3BEVA 1X5JA 3KHOA 3O2VL 3BXNA 3HB3D 3ARDD 4NN7B 2GIYA 5D1QA 5FAAA 1E4KC 3H42L 1MRCH 1OW0C 4HG4J 4M48L 2RFXA 5EBMA 5E5UB 1W2KT 1CD9B 2WLYA 1I7TA 1MIEH 4DFIA 3G6JB 1U9KA 4HXBL 4ELMF 1Q9OB 5EO1A 1EFXD 4M7ZC 2DJSA 4PJCB 4NZRL 1MFNA 4OFKA 4G9DB 2R56L 2OS7A 4JQXA 3OX8A 3QZWA 3WIIL 2KQMA 5IB4A 5EOTB 5D93C 4ERSH 2VDQH 2A9ML 4KV5E 4RGOH 3TNNB 2HWZH 2LTQC 1U93A 1E4WH 1ONQA 2A6DB 4JFQB 5TFSH 3UTTD 5I1AB 1OVZA 3PDGA 5FA4B 5FKAA 3HC4H 5A40E 4K8RC 3HS0B 3C87A 3BPNB 1ZSDB 1RUPL 5ICXB 1NUDA 3HFMH 3QJFA 5DR5H 3NGBB 4I3SH 5T1KA 4YPJA 2WAHA 4R8WH 5HGHA 1JGEA 3VG0H 3OKNA 4FQCH 1J05B 3ZE2E 1I3RA 2UV3A 1MJUH 4XGZA 1P53A 15C8L 1CXHA 1SEBB 3LS5L 4UINH 5E94A 2BSTA 4ZFOB 3SE3C 3OKOA 4X7SL 3NCJL 4IMKA 4JKKA 2JJTA 5MEND 5TE4L 1MFEH 4OT1H 1INEL 5BO1H 4Y2DA 3L5XH 4HJJL 1NCCL 1T89A 3O9WC 4EDWH 1QO3B 4PV8A 1IGCL 5I19H 2PYEA 4NO5A 1ZLVK 2VDKH 4ZTOL 5DRXB 1A22B 1OTUD 1RUMH 5C0BB 2I27N 4MJ2A 3SDDD 4F7MA 3ARZA 4WJ5A 3WHXB 4MDJB 5B38A 1AGEB 4MD5A 1X4ZA 4X99A 5DJ2A 5F9JB 4J3SA 3O6FC 1F4YH 5GRJH 4X8JA 4P5TA 3VD3A 4GAJH 4UUJB 3GMLA 5C2BL 3O11A 1XMWA 1VFOA 3CD4A 3UTTE 5BXFB 2DQFB 1FNGB 3HI5H 3BP6B 5IW1A 1KJMA 1K3IA 2YZ8A 4GRMB 4OM1H 5DURB 4YFEA 5IIEB 3DIFB 5DVNA 3BPLB 1U3YA 5HHOD 3ILQD 4JZJB 4WFED 1T2QL 5D7IB 4X5WA 4F9LA 5JHDB 3DPBA 4LSUH 1U8NA 5L6YL 2QQKL 1OT1A 4PJEB 5C0RL 3F7YA 3KPPA 2XWTA 4NWUH 4PLKC 3O41A 4JREC 3TO4A 5D6DC 5F89B 2W1NA 3ECBB 1IILE 1PLGH 1QFUL 2H26B 4ZSOB 3IDIB 2VDOL 1A64A 1YNLH 2MQCA 3V0AC 1A6TB 3HPLB 5MENE 1UVQB 3H6JA 1OP5H 2DLEA 1N5AA 3CFCH 3VG9B 1JGVL 3FOLA 5F1NA 3DGGB 4WI3A 3L7EB 3N1MC 5DJYB 1KIPB 1A7RL 1LWRA 4PRNB 3GMPB 4Z78B 5KAQG 3LPWA 1S7UB 5ANME 4HBCH 4QHLA 5K9QG 1UT9A 5HHNA 5C0JB 4BELD 1IZKA 3ARBD 3MO1B 2OR9H 1A3RH 2X4PA 5F8RC 1XF3B 1PG7L 2DBLH 4LLVB 3QDGD 2R69H 2VR4A 4L3EE 2WUCL 4KTEH 4Y4KC 5CZVH 5AYQA 4ZFFB 4WV1B 2A6IA 4YUEL 1PQZA 2B4CH 1R3IL 3I50H 2OTWB 4NUJA 2EXYC 2NXZB 1VKXB 1KV3A 2XTJB 3K74B 2DTSA 2OL3H 3RDTD 1N5YH 4ELKB 1MVFA 3EO9H 4P59H 3TBWA 1CFSA 1S5HA 3QUYB 1Z9OA 1KLUB 4W4NA 5HHOE 4P46C 4WFEE 2APTA 1F90L 5KJRL 5CLTA 5JDSB 4MNQA 3GMQA 3LQAC 2NY7L 1BD2B 1GIGH 4WHTB 2V17L 4HIJA 5GGSY 2YN3A 2GSGB 2VAAA 3MRJB 4PREA 1GXEA 4ODWA 3ARWA 4I18A 4EI5A 1OAYL 2Z9TA 3G6AB 3S97C 3HE7A 4UT6H 3OKLB 4Y19D 1MREL 5FUOH 1NCWH 3SGJC 5BV7L 4G6ML 5DJZB 5DD1H 1IEAA 4OZHB 1C12A 1G7IB 3NCCB 4H88L 4HPOH 4RMUA 4JPWH 1UZ6F 2WBJB 3S6CA 4D8PA 4HZAA 1UYWH 4YDKL 2J4WH 4K8RD 5KANI 3JXAA 4ONGL 3QDMB 3VFSB 4PRIA 4KQ3H 5CP7A 1QLRA 3VGDA 1HYRC 4WUUB 2EDLA 4QRRA 4LCCC 3WFHB 5J13B 5JOFB 1KIQA 2Z8SA 3CCHA 5IEKB 5JPNA 3RX7A 1Q0YH 2C4FT 3IAQA 4HX1A 3C08H 5DC9B 4PRBA 3GSRB 4N8VG 4ODSH 3S5LG 5GS0C 1NFDA 3QDGE 1WBXB 1YEIL 3KPRB 4N0YH 3MRKB 2BVEA 3LAFA 1NBVL 1BQLH 3F7VA 3LEXB 1S7WB 1I1FB 2A6KB 2ATPB 1XGPA 3FO1B 2EE3A 5CEZE 5IVOA 3MR9B 3L3IB 2C4FU 1Y18B 4U6YA 5FKPB 2PTTB 3WJJA 2MPAL 5GSRA 1A4JB 5TJWK 4S2SA 1I9JL 1MCLA 1ED3A 1F11B 5EC2B 3MRLA 3OHXA 1CE1L 1XCQA 4K3JL 3SKJL 5DJXB 5KVGL 4YIQA 2VDLL 3CLFL 1NCAH 2JB5L 4MA1C 3KPSA 5SV3A 4JZNA 5C0FB 4H5SB 3O6FD 3AXLA 3HUJB 3JV5A 2CR6A 4Y19E 3L3DB 2VWEE 4G5ZL 1MCQA 1R3JA 2DTMH 3OKKA 4YDVA 1QFWH 1UC6A 1NC2A 4PY7B 5D70H 5D7SH 5HGGS 5IV2B 5B8CA 4UB0H 1FYTA 1HHHB 3TBSA 1OGTB 1UB5B 1SVZA 1VFAB 4PG2C 3TC9A 3PL6D 4YGVB 4XMPL 3WIFB 4KAQL 1KT2A 5J7CC 4JFDA 2CDEB 4CVUA 1L7IH 4OLYL 4PJ7E 3QB7C 3B6SB 4ZMAT 3SQBA 1OAXL 1HZHL 4HH8A 2IH3A 1LO4L 2Z4QA 4PLKD 4XH2B 3RVWC 3I85A 2IPTH 2OYPA 4D2NA 3NA4A 4OAWA 2I60L 2ILLA 2Z91A 1QUNA 1X7QA 1RD6A 3VD9A 2W0FA 3BKMH 3T04D 2BNQB 4K7FA 1U8PB 1BAFH 1T3FB 5EZIL 1I3GL 1I8IB 4JAMB 3RQ3A 5GGTA 4XNYH 2UYLA 2CRZA 5CMAA 2C7UB 1JF6A 1FAIH 6FABH 2DICA 3VD5A 1F6AA 4XTRC 3FFCB 3FFDA 3NVQA 3IDXL 4GXUM 1RU9L 4UU9B 4OCXH 4PJ9B 2FR4B 7FABH 4LF3A 2J88L 1DN2A 1U41A 3KJ6H 1B3JA 1DCLA 3TVMA 1BJMA 4WFHD 1C08B 3L3KA 4XVSL 4PB9L 1YEGH 4Y4KD 1KB9K 2XZAH 5TPWL 3DROA 5DUMH 1YC8A 3D69A 1CD8A 3VXRD 3U4AA 4M1DL 4NO3B 2DLFH 3IF1A 2EXYD 1XH3A 4QRQA 5H2BA 3RJQB 2DQJH 5IFAH 1QFWM 1X6NA 2BHUA 2PCPB 1G7JB 4LL9A 5I1CL 1CIUA 1QLFA 4HPYL 2FD6L 2FWOB 3CH8A 4NQVB 4AM0B 3NFSH 4GXUN 5CIPB 1LEIA 3FO2A 2HFEB 2UY6A 3ZTNL 4XBGB 3WSQL 3K4AA 2FIKB 2ZOKA 1CFVH 1U6AH 1LGVA 5KVFH 3MXVH 5IG7B 2VSCA 1Q9LB 4AEIL 4JY6A 1KELL 1MCSA 4JY5L 3FB5A 4KJWC 1E0OB 4LRNH 2FO4B 3FQTB 5FGSA 5IW3A 5L88H 4QKXB 3LKSA 5D96B 4U6VH 1FFPA 2YA1A 3VFVB 3FOMB 2G5RA 3NFNB 4LASL 4L1HA 3BYYA 1VESA 1FG2A 1D7FA 5T1DL 3RWFA 3ES6A 5H94B 3NCFB 4DKDC 4C54A 2DM3A 4ZAKA 4OIAA 4K23H 3ISWA 1MCOL 4B53A 1LDSA 3E6HA 1DDHA 4WFHE 2SEBA 1MHPL 3O3EA 5IB5B 5GS0D 4NQDD 4Z7WA 3W5MA 3MGTA 3PQYB 4HF5L 4YHML 1CU4L 4IHOA 3VXPB 1V3JA 2R0LH 3VXRE 2YPKB 4Y16B 3LS4H 4CJ0A 1PAMA 3GZKA 4JQXC 1SM3H 1JL8A 5LQBH 4XMLL 1WLHA 1MI5A 2X05A 1J88A 4LQFH 1KYOJ 4G42A 2HFFA 4L8DB 3LKNA 4Z76B 2IPKB 5BZDB 4U6XB 1HOCA 4PJIF 1YN7B 4LARL 1IGTA 5IEHA 3ARXA 1AJ7L 2MMXA 2VITB 5D1XA 2CK2A 3VWJC 1NDGA 2GYSA 4XPHH 3HPJB 1RK1A 3QUMB 35C8H 3GIZL 2ZPKH 4PV9A 5C09A 2C5DC 3R0NA 1IC5H 2AK4A 3CX5K 3IKKA 5DJCB 1R0AL 2OK0H 2OTUB 1V5JA 1J8HD 2JJTC 4DW2L 3GSXA 2FJGA 2W0PA 5ID1B 3RBSA 5BZWA 2ED7A 4K55A 3F62A 2AJZA 3P4OB 1N26A 2RJMA 3GDBA 4WU5B 2R15A 1DBJL 2R1WA 1MF2H 3X3GH 2FH8A 3QCTH 4NQDE 2AS5M 3MMEA 4WY7H 3EOTL 3DURA 3HE6B 4NO2A 3RVWD 1VDGA 5EOQH 1KCLA 3KWWB 1MJ8H 1WBYA 2DL9A 5T3XE 3TYFB 3ETBF 3MUJA 4IMLA 4F7EA 2FX8L 5MEOB 4RAHA 5I75B 4A2MA 4X6EB 1TZGL 3BPOC 4Q0XH 2DKSA 4HGWA 3SN6N 3WXVL 5I8CA 3GK8L 3AS1A 1A5FL 3EYVA 5D7LB 4XTRD 1M05A 4ZODA 5LJYH 4R4BB 3SCMB 2CUHA 2V9QA 5EBLB 4C57C 4R7DB 2PW1A 3NN8B 4P3DB 4N9GA 4KMQA 1I8LA 2J6EH 5BS0B 3IGAA 4KU1A 4ZXBA 2X09A 4GT7A 4G7VL 2W92A 2YD7A 3UYRH 3K8LA 1QRNA 1D9KC 5D5MA 1VGKA 1J8HE 1AE6L 2IG2H 3O3BA 1GOFA 3Q5OA 4YWGL 3NCBB 4HK0B 4K94C 3VFGH 2DBJA 3MV8B 2D7OA 4M6MH 5AYUH 2KZ1B 1MNUH 2YSSB 3IFPA 3RX8A 2ITCA 3DRQB 1S7QA 1IGFL 4MA7L 3KPOB 2P8PB 3O2WH 1T5WB 3LN5A 4FG6D 1SJEB 4KVNH 2XQBH 4M62H 4NT6A 5K93A 4H0IA 4KJWD 3CPLA 3TJEL 5KTEL 3DX8B 1EPFA 4QYOB 5FK9B 1IMHC 2Y7QA 2W65B 4PRHD 4ORGB 1CT8B 2PYFB 4PP1D 4OZIE 1BHGA 4KRMB 1T0NB 4PJIE 2YD4A 5TDPB 3F8UB 1ZT4A 4I4WB 4PGBB 1T5XB 1FQ9C 1HH9A 1N64H 1BFVL 4G8GD 4PGDB 3QXAA 1ITBB 4HUXA 3LQZA 3QHZL 4U7SA 1QG3A 4CUCA 4WW1A 1FIGL 3AGVA 3IB4A 5ESAA 2AGJH 1C16B 1C5DB 3MLYH 4MA8H 4F15C 1U95B 1KXTB 3G04B 3P73B 1BX2A 3V4UL 2W9DL 1N7ML 3VFRA 5E4EB 4R2GD 2QKIA 5C0AB 1NMBL 4WEBH 3FN9A 1VADB 3U0WH 1FE8H 2A73B 1IRAY 3LRSA 3GO1H 5IBTH 1JUFA 5H35A 3NIGF 3TCLB 4AZ8A 3HC3H 5IR1A 5EUKB 2X4OA 1PYWB 5I8OL 4CADB 1YNKH 4YXLH 4PBWD 4JY4A 4O2FA 5FYJD 4XP4L 1EEUA 2F19H 3SEPA 1EZVX 3RJDA 1SMAA 3IU4L 1QPPA 2Y25A 5ID0B 4QHUA 5IMKB 3MRMA 1N6QL 3RNQB 4BK4A 1UWGH 1TIUA 3BQUC 1DQJA 1PVHA 3N85L 4U6HA 4PYGA 3SDCB 4ODUA 4NJAL 5DGRA 5CINL 1KTDB 4OGYH 2D03H 1GPOH 3LSOB 5L2JA 4P49A 4PRHE 5E1HB 4UTAH 3RTQC 5HI3D 1QQDB 5GGSB 4NO0A 1I1AC 3AB0B 1ORSA 5TDOB 1J87A 1GZQA 5K9QI 4Z95L 4R96B 3QAZB 2FL5B 2DYPA 2VLRA 2VDMH 4G6MH 2NY5C 4Y2DD 5KSAB 1WZLA 3WJJC 5DK0B 4PG9A 4DQOL 1T4KA 2PTVA 2PYED 1L7TH 4G8GE 4JPIB 4NNXB 2XNAA 3TESA 4TULH 5FUCE 5INCB 5HHMD 3QIWC 1NGYA 1RIVH 3JWOC 4U1LB 2ADJB 2CPCA 4GS7C 1CDJA 1P84J 3WNMA 3QIBC 3CMOH 4YHYC 3A6OA 3ILPB 3BIAX 3QR2A 2Z35B 1T22A 3ZYOA 1CG9A 1DUYB 1SHMA 4G9FA 1R24B 4KZEH 3EDEA 4D0CA 5FYJE 3QUZC 2Q8BL 4OFDA 3SE8H 2Q3ZA 1IT9H 3C2SA 3IRZA 1BOYA 1AHWA 3F7PC 4NPYA 4U6TA 3LIZL 3SDYH 2AABH 4POZC 1LO0L 3PWVB 4KDTA 4WWKB 4E41A 3KAAA 1CVRA 2ADIB 3MUHL 3BT2L 4UDTB 3UZQA 2XKSA 1IEBB 5MHSD 1G7HB 2R4RH 4K3DH 2QQLL 4GAGL 1JYWA 2H9GA 1I7ZA 1BIHA 1EGJH 5AZ2L 1II4E 3NBNA 1FSKC 3DV4A 4HIIA 4N68A 5DUBA 2F15A 1BFSA 1FL3A 5H37G 3CFIC 2PYEE 4LIQE 2J8UB 3BX7C 1KB5L 3GMOB 3WS6A 4KTYA 5HHME 1S3KL 4PP2A 1A6WL 3N50A 2R2HA 4XMPH 4YDJB 1T21B 1WC7B 3OL2A 3D48R 4FABH 3L1OL 1U8IA 1FN4A 5C0EA 5D2LF 4X4XA 3TVMC 3ZZ1A 5I9QC 1RJLB 4QTIH 4NP4L 4JM4L 1SEQH 4YHKH 5JW5B 1G7MA 3BP7B 1VERA 2DOCA 2Z31B 1PSKH 3CFBB 3TPUB 2XPGA 2I60H 3PGCA 3VWKB 4PRDA 5FOBA 3F7QA 4GW4A 2N7AA 4UOW0 3T0WA 3C5SB 1C5BL 5DSCA 1YY9C 3V5KB 2VB5A 5EZIH 3FQUB 5ISZB 1I3GH 2DQHH 3O3UN 3ROOB 3DYMA 4HZLB 4ZUTA 3N0PB 4UBDC 1CFQA 4KVCL 4NKDB 1EHLL 4MNGB 3OR7A 4HJ0C 1U8KB 4JANA 3A6CH 5SWZD 1MFBH 5MHSE 3OQ3B 4XNUL 1T1XB 3MJ6A 1QPXA 2OLDA 2HKHH 3QG6B 3IAPA 4KJQC 2X70B 5DEFB 3QCVH 1E4JA 1HEZB 1RZKL 3ULUH 3QXDA 3BN3B 2NY6C 4Y5XB 4YLQT 5GIRB 5JNYB 1VEMA 5CBAA 1QR4A 4R0LA 2CK0H 4P0DA 2QL1A 5J0BA 3VCLB 3QPXH 3VW3H 1HXMA 1DLFL 4PRID 1H5BA 1EDQA 1VGEL 3K80A 3WLWD 4QY8B 2NY4D 5I1EH 3LCYA 4LCWB 5IVZB 4X80L 1CXKA 3BQUD 1TCMA 4NZUL 1OSZA 1CLYL 4HKZA 2AXFA 4JO2H 3C2AH 3RTQD 3BGMA 3RX5A 1I1AD 1BJ1H 2CQVA 4HCRH 4LSQL 2BSED 4HFUH 1TDQA 2VYRE 3UX9B 5C0CB 3O4OB 2A38A 1A6ZB 3VFWB 2H32A 1LK2B 2ZOLA 1W72B 1GHFH 4GW5B 5EOTA 4GBXC 3QDJA 3QSKB 5DHVA 2F5BL 2BVPB 3GSNH 4Y5YC 1RJZB 3L7FA 1XF2B 3CFKB 1Q72L 5LCVH 1ETZB 4LAQH 3HC0B 5SWZE 2C3HA 4PJ8B 4ZPTA 1NSNH 1QTYT 4NHUB 1PEWA 1ZSDA 3QIBD 5HYIA 1I75A 1HK6A 5F9DC 1PD6A 4IS6A 4TSAL 1CU4H 5FV1L 4HLZG 3ARRA 2ERJC 3CH1A 2WWKO 1TFHA 4NM4L 2V9RA 1RULL 1D5ZB 3CUPA 4RRPA 3QUZD 2VZUA 4DWHA 5JHLL 5HYSA 1EIBA 1KCUL 5E8OB 1SEBA 4PRIE 5AAWA 3JTTB 3QNZA 4JFYA 3MREA 4JFDD 1A8JH 1YQVH 2HP4A 5FM5O 4ACPA 3QUMH 5BRZD 3MNWB 1I9IH 1JPFA 1CK0H 2FSEB 4MNHB 4POZD 2JE8A 4JN2A 2HYMA 5E99H 3MV7B 4LBEA 2ZUTA 3CZFB 4CVWA 1B0WA 1ZHKA 1YJDL 1RJCA 3BKYL 3D18A 5IOPA 3PP3H 1BBDH 4G8FA 2BNRA 4WCYH 4M3JA 1K8DB 1NLBL 4GOSA 4BH7B 4K3HA 4TOYH 5E4IA 4XZUB 1FV1A 1DFBL 4J3XA 5CZKA 5ACZB 2PR4H 4PTTA 5EOCH 4YR6A 5IMMB 3PP4H 2AJXH 3GUTB 2MOVA 3Q6GH 5M95B 1LEKB 1D5MA 2O61B 1MH5B 1MJ7H 1R3LA 4OLXL 1N8ZB 4C56B 1EVUA 3KGRA 4FQHB 3TVMD 3VMPA 3GSWA 4NSKB 5D7IA 4AY0A 4XPGL 5D9SA 3VRJA 4P2QD 2CDGB 5CJQH 4JRXA 5I71B 3MUZ1 1QA9B 2EYSB 3DBXA 4EOWL 4X6CB 2I9TB 1FYTE 1CGSH 4G6FB 3L3JA 5C6TH 1BGXL 3DWTA 1QVOA 2ZCHH 4Q2ZA 3MGOA 1K2DB 1IQDB 1YY9D 1OAUL 2CLZB 4ORZC 1H8NA 4JFDE 3NA9H 2ADGA 1UVQA 5BRZE 3TF7C 4UQ3A 2ADFH 1A2YB 4FXKA 3T2NH 4HJ0D 2DB8A 2F54A 4O5LL 1HDMB 2OX5A 4UT7H 3WD5L 3MBEB 4IJ3B 3W2DH 4S1DC 3AAZA 3X3FH 1MCPL 1NFKA 5IFJB 1UJ3B 5DLML 3REVA 1PKQB 4J4PC 4MJIA 1RUQL 4JKPH 1C8PA 5E6ZA 5DD5H 2VZ1A 3I2CL 2A74A 4L4VB 4L8BB 4XCNB 3PF2A 3WEXA 1IBGL 1XF3A 5KVDL 1K4CB 4OF8A 3KPQB 1FGVL 3LDBC 4TUOB 3OV6A 4N90D 1HCVA 4TVSa 2PNDA 2A2QT 3AU1A 1SBSL 5L9DH 5IHLB 3GIVB 3ULVH 2YEZB 3WUWG 1OAQL 4HS3A 1KLUA 5TE7H 2B5IC 3B2UD 3ARPA 4NRZA 1D5XB 2ZKHH 4GKZB 2HJFB 3S34L 4YX2H 2X9YA 4P2QE 3U4BH 5FV2A 1JPGB 3X13B 1NC4A 4I5BB 5FO9A 4XRCA 3CFJA 2R8SL 5K9JH 5TQ0H 2ZSWB 3DVFA 3FRPA 4XNMB 3D9AH 3Q1SL 1S7SB 1T1ZB 4JB9H 3UMTA 4NZTH 2CMRH 1HQRA 3U46A 1R5WB 1W0WA 4QCIB 2YMXH 1IARB 2IANA 4GBXD 3Q5YA 3G08B 5ESQB 4LLQA 4OZHA 1BVZA 4HS6A 4QXUH 2V2XB 4O2CA 4MXQC 4W70A 2W91A 4DGVH 3T65B 5FDWA 2GK2A 2ID5A 1ZTXL 3GM8A 3G9AB 4EUPA 3E2HB 2J5LC 4P2OA 1I1YB 2BCKB 1TMCB 2AQ3A 4TRPH 2R4SH 2RBLA 3D3VD 5DFTA 5FYLH 3BE1L 3SO3B 2AK4D 3TWCL 2QSVA 1GGIL 4WO4A 1S9WB 5DGQA 1YEDA 5D5MF 3VXTA 1HHIA 4N90E 1YEJL 1JNLL 3SO5A 3JV4B 4AEHL 3O2DH 3GBNL 1J12A 4LOUC 1HHGA 3LH2L 2XACC 4JM2A 2G5BA 4KXZH 4TPRH 3R06B 5FKPA 1RIUH 2VN4A 1PX3A 4XP5H 4Z7WE 5IMOA 1ZANL 5LG1A 3MRRA 4ODTL 5J8OA 1BVKA 4PJDA 1JK8B 2FX9L 4YE4L 4F33A 1FFQA 3MODL 5GSVB 1HH6B 1DLHA 2P5WA 4IRSC 1EO8H 1TVBB 5EWIL 4P23A 1GVIA 4LCUB 1OLZA 1W8OA 1KFAL 5CGMA 1V7ML 4S1RL 2OM5A 3C5ZB 4FFVC 4JFOB 2GFBB 3QQNA 3WL9B 3OKEA 3BKJH 5GJSL 4O58H 4CBPA 4KROB 1MQKH 1PGRB 3O8XB 4MWFA 1QBML 4LRIC 2DQEH 1CFTA 3UJTH 2PO6B 2OQJB 4X9FA 3MJ9H 3QXUA 4PJ5B 4M02A 3O3AB 4X5LA 2P47B 1KCVH 5F7FA 2VLJD 2I07B 3RWIB 4GXVL 1NJ9B 3B6SA 3D3VE 2BY3A 2AK4E 5C3LD 1FNEB 5KN5A 4M7JH 2FEEI 4OZFB 4XH2A 4X6DA 3MUGA 1BQUA 3ZO0A 2X4UA 2VUOA 3NCYS 5EBGA 4K9EL 4M43H 1IAII 2V9TA 4Y5VA 3DXAD 3MTRA 4JO1L 3EFFA 2RQ8A 3CVIL 2BNQA 3F12B 4GKNB 5CP3H 5EZLB 3WS6C 1T7ZA 3QA3A 1DQMH 3ARDB 4DN3L 4GRLA 1GZPB 3SKNB 4DOHE 4M9OA 4S1DD 3VXUA 2YKLH 1EUTA 3GB7A 1FO0A 3VXSA 2RAMA 2ARJB 3WXWH 1I8MB 3E0GA 4W68A 3EOBB 1EFXB 2MQ0A 1LDPL 1FFOB 1KPRA 2ICWB 4Y4HA 4UNUA 3OR6A 5FECA 1CBVL 3CSBA 5JW4Q 3NAAL 1UM6H 4JPKL 2FJFB 2VE6A 2A6JB 2NY1D 1PKOA 5DQ9B 1G7JA 2DQTH 1HINL 2RCSH 4G7YH 4GG6A 1MJJA 4WU7A 3ALXA 1Q9WB 1U8JA 4UMGA 3KYOA 3FAXA 4MHHG 5DRWA 1TPXC 1B6UA 5FO7A 2VLJE 4LHJB 3QQ3A 2BRRL 3MV9B 2YRLA 1BOGB 5IG7A 3IU3B 3SY0B 1N59B 3QDAA 4KMTH 4LPCA 5D5ME 3I9GH 4JFXB 3RVVC 3DXAE 4L9LC 2HVJB 3S35H 1Y6KR 1BM3L 1K8IB 4NC1C 3V52H 3SDAA 1AFVL 4MXQD 1TETH 1MCJA 1KF9B 3T8XB 5HYFA 4GLRH 4M4PA 1F4AA 5F72S 4NN7C 2UWEF 4YDIL 3SDDB 4IIQB 4N8PA 4HBQA 2PXYA 1FFRA 1Y6MR 4OFPA 3UBXA 4Y89A 4M03A 3VXOB 2V7HA 5BVPH 3W9DB 5F96L 3KLDA 3EHBC 4OCYH 1G0DA 4FXLA 1BF8A 1WIPA 4L3EB 3RHWK 4LLDB 3GSNA 1UENA 4Y16A 1ZVSA 1EAPB 3JV6B 5ILTL 3GSOA 4YPGB 1FRGL 5IGXH 4YXKL 4OCRL 2MCG1 3C6LB 1QEWA 4L8DA 1S9KC 2WV3A 4NRXB 2W60A 1TZHA 5DHXB 5HHOB 4UIKL 5GJTL 5FHAH 5E8PB 3BPNC 2GSIA 2JCCB 1D6VH 1A1MB 1IGYB 4NZUH 1GYAA 4WNQB 3O4LD 3HRPA 1W72H 4TQEH 2VABB 2Y9RT 3NGBC 3H3PL 1ZT7A 4ZYKA 1RSFA 4WDIB 4QLRA 1IL1A 3DVNB 2MHAB 4XC1H 4M6OL 5GGRA 1JP5A 5AD0A 3BD4A 2VDPL 4OLZL 4LSQH 1WZMA 5CJ8A 2NNAB 3STLA 4MJ5B 3RPIA 3MUY1 5ITFB 1RMFH 2CJUL 4N8CL 3BP4A 3F58H 5T1LA 2ZUYA 1ZE3C 1YPZB 5IKCB 4P2RB 4FQXA 4E41D 4JJ5B 4WRLA 1IKNA 3AY4A 4MCZB 5ADPL 2DKMA 3ZLQC 3BRFA 3P4OA 4QRSB 5DQJA 4HV8B 3PJSA 3EKCA 4F7TB 3F5WA 4EN3A 4OJFL 4JFFA 3R1GL 4PUBL 5IQ9B 1O0VA 4X5XB 1N0XH 5IM7B 2B1AH 4S11A 2KH2B 1XGQA 1Z3GH 4R3SB 4XNXH 4NM4H 1Z6JT 1JV5A 3DX9B 5LXGH 5IK3A 1MHEA 4V2CB 3UJIH 3DO7B 1YMHA 3LHPL 5GGVH 3EDFA 4ETQB 4B7IA 4P57B 3W11C 4OZGF 2AEIT 3S4SG 1MCCA 4ZOEA 3QEQA 4EJ1C 2FRGP 3BPLC 1A14H 4HXAL 4NQXA 2E9IA 4ZDHA 4JZJC 4ZUSB 1U42A 4KQ4H 3T3ME 1I3VA 4R7DA 3VRIB 1T2XA 4K8RL 5CFHA 1J9CT 4QTHA 3G6JF 5JIKA 2AK1H 2GJZB 4EI6B 4Y19B 4TSCH 1YY8A 4I0PB 1DBML 1M71B 1CGTA 3WFEH 4Z7VA 5I1HL 4ZO6A 25C8L 4E41E 1I8KA 3IDNB 4EVNB 4ONFH 2YSSA 1NCBH 4G80A 4Q6IB 4HT1L 2EDOA 4IRJA 3QXTA 2O5ZH 5E2VH 4PJ7B 1TNMA 2D9CA 2VZOA 2JELL 3D6GA 3TBYA 4KHXL 1AD0A 1FNLA 5C0GB 1F58H 5KS9A 5EBWB 3QHFL 3RVVD 5DUPL 3OBAA 1XGUA 4WV1C 3E1F1 1QRKA 1WCBA 1P1ZB 1FHGA 1T1WB 2X1WL 1FH5H 2NXZC 4UQ2B 5FGCE 3QG7H 2XTJC 2MWCA 5KW9L 1REIA 1CLOH 1OSPH 3FO9A 4Q58C 1ZOXA 3MRGA 1D3CA 3O6LL 5C9JA 1KJ3H 1FBIL 2DQCH 4LHUA 3IS0X 2DI8A 1MFDL 3D85A 3V2AR 1U92A 5JW3H 4YHOL 1T03H 3JV0A 4HKBA 4YHNA 3NACH 1UXSB 5DJ6A 1C16A 3EHBD 5DHYB 3U6RA 2UZYB 1KTRL 3BAEL 9CGTA 1MLCA 5TF1H 1JNHB 1VADA 4FHBD 5KSBA 3K1KC 3V9FA 5AWNL 3PWNA 2V5RA 4HC1A 5F9OH 2G60H 1PX4A 3PL6B 2WBJC 5DYOB 4NN6B 4LLYB 1INDL 4XNQA 4MD4B 1YEEH 2D31B 3LMJL 2BOBA 3AVEA 3MRQB 4A6YL 5J13C 3RAJL 5D7IF 1ZLWH 3B8SA 3T2PA 4DTGH 1CD1A 5EORH 3V6FB 3O2DA 4PD4J 5HYQB 3FT3A 3BZEA 4J1UB 4APQA 3TIEA 5GS1A 2QSQA 2WINA 1AGBA 1OD7A 1OP9A 1CL7H 4FFZL 5BCAA 2NZIA 3BH8A 5DEGB 4MCYA 4ZO9A 5DK0A 5I1GH 1AGFA 3DSFH 2H45A 5C0BD 1ROWA 3IRPX 2F53A 2B2XH 5HPMB 3G6JE 1FDLL 1TJGL 1EJOL 5HHXL 4OCLC 3HMXL 5I66B 1UZ8A 3HAEB 2X10A 5L7XL 3LQAL 3VXRB 2AEPL 3C60A 1NAKH 1F97A 5KSVA 1L0XA 1BBJB 4YQXL 2YZ1A 4EDXA 2NY0D 3QDJE 1EVTC 3KS0H 1OHQA 2ORBL 4O9HH 1N4XL 3W11D 5DURD 3WIHL 1OAZH 1JPST 1RIHL 1QSFB 3LQMA 3CVHB 3QPQC 2UUDK 4V1DB 5C6WH 4OF3A 1NBZA 4K3GA 2RIKA 1ZEAH 2NX5B 1FLRH 1HILA 3VFUA 4AG4L 3B43A 1Y0LB 3BWAB 3HZYA 4JZOA 1UWXH 4PIRF 4JRXD 2FX9H 5J6GA 4Y4FB 4K2UH 4X6BA 1JZ3A 3OAUH 2IPUG 3C09C 2AJVL 1OAKL 1KFAH 2AJSH 2HKFL 4D3CH 4Q9CA 1BP3B 4JVWA 3TBTB