5JORB

Crystal structure of unbound anti-glycan antibody fab14.22 at 2.2 a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
207
Chain Sequence
b'EVQLQQSGPELIKPGASVKMSCEASGYIFTEYYIHWVKQIQGRSLEWIGYVHPKTGDVIYNQNFRGKATLTVNRSSNTAYMELHSLTSEDSAVYYCARWDSWGQGTTLTVSSAKTTPPSVYPLAPGCGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab14.22 heavy chain
publication title T cells control the generation of nanomolar-affinity anti-glycan antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 39
structure length 207
sequence length 211
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2016-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jorB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jorB02
3DXAD 1K6QH 1WF5A 4WFFD 1DANT 5KSAC 5I1LA 3TT3L 3NFPA 1UZ6E 1H5BB 2R4RL 3C60C 1FFQA 2HJLB 1TZGL 3KXFD 2Q7YB 4EI5B 5C92A 2OTWB 1ZOXA 1TJGH 3L95A 1LO3H 5E8EA 5TE4H 3QRFM 1PQZB 3MODL 1YEKL 1C12B 4UT7H 2VZ3A 1TPXC 3LKNA 5H37H 5IQ7L 5FCUH 3SDAB 3SKNB 7FABH 2YD1A 1ZT7A 3RNQB 3I75B 3BQUB 4JANA 5HHVL 5JDSB 3FQTB 4S1RH 5KSAD 2ZSWA 3KVQA 3UO1L 2PW1B 2QQQA 1YC7A 4K3GA 1GGBH 4OF7A 4YDKL 3C60D 3SPVA 2PNDA 1YA5A 4Q6IB 3Q6GH 2CGRH 1A02N 5IMMB 4LEXH 3KPNA 2GK0A 1NUDA 5HDBF 5DQJB 2GSIB 1HINH 4HFUH 2JB6A 2V7HB 4RIRA 4BZYA 4S1DD 5L8JB 4HG4J 3KXFB 1FHGA 3V52H 1E6JL 4P3CH 2VMFA 2W59A 4PRNA 1V3LA 4XCFH 4BFGA 4KC3B 2AJXL 3UROR 5I1LB 3FB7A 4P3DA 3NFPB 1D5ZA 1WWAX 1K85A 5HYEA 1T0NA 1SY6A 4ODSL 2E7HA 3TYFA 3D3VD 2LFGA 4YEFA 1OAYL 3LH2H 1LILA 3CX5J 3L95B 5E8EB 4ACPA 2VDRL 4RMTA 3LKNB 3C60B 4AENA 4GKOA 1ZLUK 1LWRA 1ZT7B 4IMLA 4HIEA 1QLRA 1NAMH 4JANB 3GKWH 3TNNB 4GMTL 4MXQC 2DM3A 1IC7L 2ZSWB 1TPXB 4G43A 1AE6L 5FM5O 1LHZA 2ARJQ 3CDYA 4DUXA 3WHE1 3SPVB 3QUXA 4G6KL 2R0KL 3KPNB 5GGRA 3ZDXF 3ZHLA 2DKMA 2GK0B 2YPKA 1U8KA 2JB6B 2JJTA 4JRXE 3LV3B 1BM3H 3LS5L 3FB8A 3NPZB 4PRNB 4B53A 5CAYB 2OL3L 3P0YH 4KI5E 2CKBA 3K7UA 4M6OH 5EZIH 1NQBA 5KW9L 1P4LA 5JXAH 3FB7B 4MXQD 4P3DB 1D5ZB 3C08H 2XRAL 3MLRL 3RVXC 1T0NB 1JI1A 2AXGA 3ARGA 1HIML 3ECBA 1NC2A 3TYFB 4MCYA 3WHXB 2NYYC 2D03L 1I7TA 2FD6L 2J6EA 2YUWA 3LEYL 4OM0H 2FNBA 2ZCHL 1WEJL 2X9YA 4NQED 4Y5VA 2F53D 2AI0L 4IRSC 5F9AC 3V0AC 4WEUD 1QLRB 1NC2D 3PDGA 5AD0A 1P4IL 2CDEA 1KGCD 4IRZL 3X3GH 3T0EC 1KJVB 2VLMD 3QHTC 4G43B 5CEZH 1RIUL 5FOJA 2QHRL 5EOCJ 3RVXD 3QUXB 5GRWA 2D7OA 1X5AA 1GPOL 2XQYK 5GGRB 5D1XA 3T0EA 1CT8B 1V7MH 2YPKB 2CKNA 2NYYD 5A2JH 3ZTJG 2AV1A 5D8JL 1OGTB 4FFVC 4NZRH 1H3PH 2AEPL 3KLDA 3FB8B 3L9RA 4HXAL 3VXSA 5IG7A 4IRSD 5T3ZD 2APXA 3BKYH 2GT9A 7CGTA 4B41A 5GQBA 3BIBX 3HC4H 5GGUA 5E6IC 1P4LB 4EVNA 1NGPH 3T0VA 4WV1A 3HI5H 3O9WA 3O2VH 4NQEB 5DTFB 1FNEA 3BPLB 5GISH 5HVHC 1NC2B 3G6DH 5IROA 4MCYB 3FHAA 4YDIH 1S7WA 4IIQC 3GHBH 1I7TB 3OPZH 4X0KA 2WIMA 4XNYH 2VXTH 1T1YA 4Y5VB 4R8WL 3QPQC 3JVGA 3WLBA 2BCKA 4LSDA 2OJZL 4IIQA 5AD0B 4QHKJ 3V6FB 2DTSA 3MNWA 4X4YA 5T3XL 3FOLA 3K2UL 1C8PA 5E6ID 2A9MH 5HD8C 1JHKH 2NY6C 5DF0A 4XVTL 4N68A 4PLNC 1Q72H 5GGQH 1EGJL 2UY7A 1G0YR 3VRJA 1IL1A 4WHYG 1Q1JH 3WIIL 4FQ1L 1JI2A 2FO4A 4NQCA 5D1XB 3T0EB 2WUBH 3G5ZA 1MH5A 1AHWC 4XMKL 3C5ZC 2AV1B 4D9LL 5C0EA 4TPRH 3O4LA 3QPQD 5IG7B 4K3DL 3SE9H 1W0VA 3LQAH 2GT9B 3QP3A 5GGUB 2E7MA 1EA9C 1EBAA 1ZKAA 4EVNB 4NQCD 1BP3B 3ZDZE 5HD8D 5E6ZA 1BOYA 4IEFB 5A2LH 3V95A 5FA4B 4UV4H 5CZKA 1FNEB 4HF5L 1WCQA 1WAAF 5IBUB 5C0JA 1CXIA 3SE8H 4ZNEA 3GI9L 2UWEE 1Z9LA 3BKCL 3QBTB 1AD0A 4X0KB 1T1YB 5F9JA 3C5ZD 4Q9QH 5HVHB 5KOVC 2MFNA 4GAYA 3VFUA 2ZCLH 4LSRH 4NO0A 3WLBB 1BQUA 2BCKB 4KK6C 4IIQB 5FGCB 2E9WA 3MNWB 1H3XA 3T1FA 3FOLB 5HJ3A 3QZWA 3VXSE 3T65B 4KDTA 3TJEL 1PKQE 1ZEAH 3FAWA 3VRJB 1Q9KB 1IL1B 2P44B 5F7UA 3SDYH 4AEHH 2FO4B 4NQCB 4NO0D 3FQRA 3G5ZB 1MH5B 2NY6B 3AU1A 1IGMH 5IVNA 1CLYH 5DURD 5IGXH 1UM4H 1N7ML 1PG7H 1P7QD 5C0EB 4CL7A 4YHKL 5J6HA 3V4VL 3OX8A 3O4LB 3C2SA 5C08D 1W0VB 4Q9BA 2YMXH 3EFDL 4KK6D 3WUZA 3GRWH 1UXWA 4RFEB 3W2DL 3IAPA 4XNZC 1F3DJ 4WHTA 2MPAH 3VFWA 4LVHC 5LVEA 1MEXL 4UQ3A 4PGDB 2F5AH 1NH6A 1J88A 1D5IH 1NANI 4G8GA 4M62L 5GS0L 1AD0B 4CBPA 2IQ9H 3L6FA 4WI6A 2X89D 3TC9A 5F9JB 3VFUB 4YK4C 5J1AA 3CFIC 4NO0B 4G80A 4XNXL 3JSSA 3FQXB 1AKJA 1JTPA 3T1FB 3DBXA 1RZKL 5HJ3B 4BZ1H 3O4LE 1P7QB 3QZWB 3GBNH 2I24N 4L4TE 4EXPX 1BWMA 2KUTA 3BIAX 3S7GA 1IGYA 2G75A 4JJ5A 3VGDA 3FQRB 1KIRA 4X7SH 3MRHA 1CE1H 3AU1B 4WEBH 4ZUSA 1OY3B 2QV2A 1WWWX 2RHEA 5JR1H 4KJYA 4CN1A 2VH5L 1CFSA 5FV2A 5J6HB 4KAQH 3GO1L 3NCCB 3OX8B 1YJDH 4QRRD 3D85A 2RR3A 2J8UE 5IR1A 1L9NA 1RU9H 3GSUA 1F3JA 1MQKL 3QA3A 2OCFD 4NZJA 3RGHA 4WHTB 1U41A 1EMTH 3VFWB 2FGWL 2J5LC 3CSBA 2VZVA 4UQ3B 4O02H 4K9EH 1QBMH 4U6HB 4YHML 5L9DL 4PJBF 3ZKSD 5KSBA 4XNZB 4G8GB 3L6FB 1IFHH 1SYSA 4WW2F 4LVHB 1AJ7L 1ORQA 3VMPA 4Q2ZB 1MUJA 1G7QA 2W38A 2HG5A 4M03A 5J1AB 1X5GA 4Y4KC 2EYTB 1MRDH 3KPOA 4ERSL 4G80B 3HHRB 2RGSA 1AKJB 1KN4L 3DBXB 4MD0A 4YEEA 2CR6A 3B3IA 1KPUB 1FFRA 5MEOA 1HE7A 4QRRB 2B4CC 4YK4B 4NRXA 4A6YA 1AQDB 1IGYB 2G75B 3DGGA 3NIFF 4OBSA 4Z7WA 2XKSA 4D3CH 4U1JA 5D1QA 4LSSH 4TUJA 2FL5A 4ZUSB 2F19H 4KJYB 2DLEA 3LKRA 1CFSB 5DD5H 2AEWA 3LPFA 4G8GE 3ARWA 4G7YH 4PY8I 3D85B 4DVRH 2D7NA 4JKPH 4Y4KD 1ZGLM 4PJ7A 5IR1B 3GSUB 1F3JB 1NLBL 3QA3B 5DGRA 1F6LL 5I19H 1KN2L 1Q0XH 2CLVA 4JHWH 2X4NA 1ZGLA 4TQEH 5EUOF 1QBLL 4K94C 5J89A 1X4ZA 1KCRL 2Q8BH 5KSBB 5DEZA 5DO2C 5ABDE 2MCPH 5FK9A 2EDDA 4ZO7A 4ESKA 3KJ6H 4URTB 3WEXA 3NTCH 1LD9A 1SYSB 3EHBC 3VGFA 1EFQA 2J5LB 5CEZE 1ORQB 1G84A 1MUJB 1DLHA 1G7QB 5CJ8A 1W72H 2IADA 2HG5B 4MJ5A 3KPOB 1DLFL 2NLJA 3MV9A 4MD0B 5GZOC 3B3IB 4M6MH 1DQLH 2Q87A 3MRCB 1GGCH 1RULH 4Y4KB 3Q1SL 4XP1L 4A6YB 4R96A 3DGGB 4Z7WB 5JO5A 4U1JB 5D1QB 4LSUH 1EUUA 5D9SA 1YEFL 5LXGL 4TUJB 1OM3H 1U42A 5DO2D 2FL5B 5HTSA 5IKCA 1MIMH 5KJRH 4BKLA 4WFHE 5DR5H 5AAWA 1A1OA 2QJDA 5E1AA 4JVWA 4U0RB 5DS8B 1I85C 4JFPA 2QSCH 2VXVL 2P8LA 2R2CA 4PJ7B 3S37X 4KMTH 2VO5A 3F62A 1UM6H 5GZOD 3LMJL 4N0RA 1KCSL 2W9DH 1I85A 1JYVA 2CLVB 2X4NB 1ZGLB 1X5IA 1FAKT 3GRWA 5CP3A 2WLYA 5TQ0H 5GRUL 3U48A 3MJ9L 1QFPA 1MCSA 3QAZC 1BJ8A 2HKFH 5FK9B 3V5DA 1KF9B 4Z8FH 1B4RA 1OQXA 3WEXB 1LGVA 4WCYL 1LD9B 1FAIH 4JPIA 5CILH 2E7LA 1DLHB 4OCNC 4XB8A 1NGQH 3V7MA 5SX4H 3MLSH 4MJ5B 3L5WA 2NLJB 1JPST 3MACH 3MV9B 1OWRM 5DQDL 5FKPA 5LCVL 4G5ZH 1KT2A 1NCDH 2FB4H 1UM5L 1NSNL 3CVHA 4XAKD 4PJ7E 2PYFA 4M7LH 3VI3F 1HN1A 5DI8A 4MCZA 2Z93A 3ALWA 5CJXA 4R96B 5ERWA 5B8CC 4E5XB 2Q3ZA 4OZ4A 4ZUWA 4DOHE 1AY1H 3KYNA 4X83A 2K9UA 4YBQC 4UAOC 4CADA 1BJMA 1A1OB 4OSUL 4QEGA 5E1AB 2JJWA 4G3YH 4AY0A 4JFDE 2FIKA 5EU4A 4XNUL 3UC0L 3KPSD 1WJ3A 3PGCB 2P8LB 3CH8A 1RZIA 3ZKMC 2VDKH 4MXVF 5D6DC 4OD3L 3MLUL 4CNIA 2O5YH 4FZEL 3RTQC 4E41E 1A3QA 4HZAA 3PG2A 1CLZH 3U4EA 3SO3C 2I5YH 1BECA 4BJLA 4YNYA 5D6DA 1GL4B 2DB8A 3B9DA 4DUWA 5E2TL 3V5DB 5IF0A 2IFFL 5F7MC 4JPIB 4YBQD 2BX5A 4TSBL 3G5XA 2CKBL 1JWUA 4TUKH 4PJEF 4ZFZA 3UZVB 3L5WB 4XI5C 1T7WA 2AJSL 2DQHH 2W9EL 3ZKMD 2D0HA 1BAFH 1KT2B 5DJ8A 3EDJA 4M7LT 2DYPA 3CVHB 5SWQA 2AV7A 2PYFB 3RTQD 2OXGA 3KPSB 5C6WH 1BMGA 4MCZB 2Z93B 2M1KA 3CK0H 4YH6A 5ERWB 1CK0H 4B5EA 1N0LA 2NY2B 4ZUWB 4OZFH 3E6HA 4FQJL 2Y06H 3KYNB 3VXTA 3OKDA 4CADB 4LCWE 1BVLA 4ZDHA 3M45A 1P1ZA 2FIKB 4AMKL 5EU4B 1FG2A 3MRLA 4GQ9H 1R3JA 1RZIB 3OKEA 4XI5D 2B1AH 3I2CL 5I8EA 4UAOB 3LKPA 5EU7E 4CNIB 3MRMA 1JPTL 2X4OA 2XT1B 3U4EB 4QRQB 4YNYB 4LSVH 4RSVA 1XFPA 3ARVA 4TSAL 4UT9L 5IF0B 5EIIA 4XVSH 1GGUA 1JNLL 5E08L 1CDCA 3RTQB 1E4WH 4WW1A 2ZSVA 3VFTA 3SO3B 3PDDA 1IEBA 4NWTH 3NIGF 3MXVL 5BO1L 2I9TA 1JWUB 4DKEH 2UV3A 3L3DA 4NNPH 4P9HH 1F8TH 5F1NA 1W72A 5FO7A 1FLRH 1K6QL 4O4YL 5DJ8B 5K9KB 3DMMA 2DYPB 2AV7B 3BFOA 2KQNA 1CVRA 1A6AA 3BPNC 4CN4A 3F7PC 2FH8A 3EO1B 3VE0A 3JV4B 3E6HB 4MMZC 3AREC 1WITA 3EO0B 3OKDB 3VXTB 5IVXA 5I66A 4LAQH 3KLAA 1BVLB 4K2UH 4RMWA 1DR9A 1TJGL 1FG2B 3LN5A 3MRLB 4UT7L 4JR9H 3OKEB 5FCUL 7FABL 2IBZY 3FOMA 4PS4L 3LKPB 1AC0A 1OW0C 1KJ2A 3AY4C 3MRMB 4XCYA 1J1OL 1OF2A 1ND0A 1T04A 3LEVL 3Q0HA 1AD9A 2P1YA 3VXQA 1OSPH 1RZJC 3T0DA 2HA1A 5BRZA 1GGBL 2EIDA 5EIIB 5ELIA 3ARED 1C16A 3IU4H 1ITBB 2CGRL 2OK0H 1JWMA 4LEXL 4WW1B 4EJ1C 2ZSVB 1YNKH 2XWTA 3VFTB 1IEBB 4PG9A 3ZE1F 4OFKA 4HFUL 4OZIF 1GGIL 3L3DB 2XZCH 5KVMC 2KZWA 1E6OH 1X5YA 3V52L 5F1NB 4FFZH 1W72B 1F4XH 5FO7B 3FT3A 3D25A 3DMMB 2HT3D 3WKNA 3U0TA 1MHCA 1ODAA 1A6AB 3SKJH 4DGYH 3OQ3B 3VE0B 4P2CG 5B3JE 1YECL 4Z7UA 2EH7L 2GUOA 5IVXB 4YZFF 4GJTB 2K1MA 3LH2L 3LY6A 3UP1A 1PD6A 1U2CA 3BPNB 1URLA 3LN5B 3S8WA 3CFBA 4XZUA 3AREB 3FOMB 4TVPD 4KQ3H 1NAML 3GKWL 1KJ2B 2HP4A 3PWLA 4XCYB 3HAEG 5JW3H 1OF2B 1ND0B 1T04B 1FFNA 1AD9B 3VXQB 1VEOA 3EOTL 1R5IA 1C16B 5SWSA 3DUSA 2V2WA 1JWMB 5EORH 2XWTB 1XEDA 3PL6A 4PG9B 4GRLC 3ZMRA 5A43C 3AAZA 2GITA 3BZEA 1BM3L 3FMGH 3P0YL 3RL2A 2CH8A 4DGVH 5DHYA 3FT3B 5EZIL 3BEWA 3OAUH 4K7FA 2BOCA 2XY2A 4GRLA 4OF8A 3U0TB 1MHCB 2CD0A 4TRPL 3ILQC 2NY5H 1IARB 2FJGA 2GUOB 4LBEA 1ES0A 4GW4A 5BRZE 5J13C 1J8HD 3O41A 4GRLD 1HYSC 3S97C 4X9FA 3CFBB 4WO4C 4XZUB 3VA6A 2VXQH 4YXHH 5CFHA 1QSED 3SEPA 4G42A 1MFEL 4OIBA 1AI1H 3PWLB 5F3BA 3GGWA 1FFNB 5CEZL 1ZT4A 3ILQD 1EJ6A 1JPFA 2B5IC 3LPGA 4RGNC 4HKBA 3PJSA 4U6VH 3GM8A 3GSNH 2V2WB 3JWNC 3MRBA 2Y4SA 2DQGH 4Z7UE 5ADPH 5T5FH 1OCWL 2VSDA 3BUTA 5DC0A 4LVEA 5B4MD 3RU8H 4JFZH 1FO0B 3AAZB 3S36X 3QT2A 3MLWH 4WO4D 2D31A 2GITB 3BZEB 3HMXH 1ZK9A 3RL2B 4RDQF 2PTVA 5DHYB 3BKYL 3BEWB 4XWGH 4YPGB 5BVJA 3HC4L 2BOCB 4GRLB 1A9EA 5C3TA 4LPXA 4HEME 3LQZA 3O2VL 1WIUA 1QSEB 2VZUA 3RI5F 4WI8A 2DI7A 3GB7B 4LBEB 5GISL 4R7NA 1ES0B 1WUNT 3G6DL 4RGND 4V2BA 3CVIH 2AK1L 4GW4B 1JZ3A 3ES6A 3GHBL 5L8LB 3NOIA 5F88A 3O41B 2H2SC 3OPZL 5CSZA 5SWSE 3QFJE 3BN9C 3QDGE 1KLUA 5DRZB 5GRJL 4ZUVA 2Y6SC 3P73A 4ODVH 1QZ1A 4UOJA 3BHBA 2HTKC 4FQXD 3TYGH 1FCCA 5J13B 5IBLC 4P5TC 3UJIH 5F3BB 3GGWB 3CGTA 5GGRY 4ONGH 4JY4A 2A9ML 3L3GB 2EC8A 1ZT4B 1JPFB 1Q72L 1MI5D 3OR7B 4Z7VF 2X7LA 4HKBB 3PJSB 1Q1JL 4P5TA 3HUJF 3MRBB 1G9EA 2WUBL 1ERNA 5F7EL 4TUOA 2WBJA 4HDIA 4NQUA 2H2SD 2B5IB 4B7LA 3BN9D 4OD1H 4RGNB 2D31B 5I17A 4TPRL 2Y6SD 4HIXH 1S7TB 5HGHA 4UILL 1DEDA 4GAGH 3SE9L 4AIXA 4G8EA 2HTKD 4FRWA 5BVJB 5F97E 5IBLD 1A9EB 1T89A 4LEOA 1LO0H 4X6DF 3WFHA 3DGCR 3T08A 4M7ZC 3LQZB 1JE6A 4UV4L 4TNVK 4N0YH 1DTUA 4UTBH 3SE8L 2F15A 3ES6B 1IAIL 3MOQA 5F88B 5CSZB 5J12C 5F7KC 4ZUVB 2ZUYA 4J1UA 3BHBB 3PQYA 2VLRD 1Q9WA 3W0WE 1CICD 1U8QA 5JHDA 1CXFA 1NBZA 4FTVD 3KLSA 3N06B 2X7LB 1T83C 4L5FH 3WFBH 3DNKA 3MLTA 4P5TB 3VDBA 1A0QH 3SDYL 3IDNA 3PQYD 5JXED 2C1OA 4TUOB 3GSRA 2YD8A 1IGML 3MJ8A 2EDWA 2WBJB 5IGXL 4NPYA 2A74A 5JHDD 3R1GH 2AGJH 2JKXA 5HGHB 1QKZL 1X4YA 1T1WB 3DROA 4HUMB 4AG4H 4XB7A 4G8EB 3VXPA 4YIQA 2YMXL 1Z2KA 3W81A 4LEOB 1UZ6F 2YPLA 3WFHB 2YA1A 2MPAL 1IEHA 1PKOA 3SQOH 3VXNA 4OF0A 2F5AL 1D5IL 1I9IH 1TVHA 4JRYA 4LKXA 3I6KB 3NPSC 4M7ZB 2IQ9L 1SBSH 3SJVA 1B0GA 1SQ2N 1T6VN 4J1UB 2J3SA 5EU6A 4ZD3L 1PX4A 2EEAA 3MBEC 3NCBB 3PQYB 3W9DA 1JZ4A 3HI1A 5JQHC 5C8JA 1UCTA 2W1NA 3M8OH 4BZ1L 1Q9WB 4F37F 1U8QB 5FUCE 3MROA 4JRYD 4PTTA 5JHDB 4UI2A 1NBZB 4Y4HC 2R0WH 3QH3A 2DQCH 5EULV 3MLTB 3PWJA 5EU6D 3IDNB 4JQVA 1WT5C 5T3ZH 4PRPA 2C1OB 3GSRB 1CE1L 1EZVX 3ARQA 4Y4HA 1FJ1A 4NPYB 3GSNA 2A74B 3ABZA 1YJDL 3DROB 3MBED 5GGTA 1ED3A 4YIQB 3VXPB 5KSUA 3O45A 4C59B 2GAZB 1R3KA 1RU9L 5FM5M 1PZUB 4NHUB 1EHXA 2HVKA 4OLUL 3Q6FA 2PTTA 3HMXA 4CMHC 1BJ1H 4O02L 3VXNB 4K9EL 3DRTA 1QBML 5LJYH 1KIPA 4M6NH 1MCPH 3GSVA 5ID1A 3V0WL 1RHHA 4TTDC 4JRYB 1CXKA 4LKXB 1U36A 3N1PC 1IFHL 1QR1A 5CSBA 2HRPL 1B0GB 3OZ9H 2A1WH 5DK2A 5EU6B 1UT9A 3BJLA 3W9DB 3HI1B 1MRDL 3N85H 2BVPA 3TBYA 3NPSB 5C8JB 1IAII 3FO1A 1I7ZA 2H2PC 2IG2H 3MROB 4PTTB 4OZHF 1YUHB 4WTZA 5E70A 1D6VL 4RFNC 4JG1H 5BS0A 3BGMB 1CGVA 3QH3B 2YPLE 3FFCD 3PWJB 4D3CL 4AM0A 4W6XB 3G5VA 4MD5A 1UC6A 4LSSL 4PRPB 3SY0A 1KYOJ 3O3EA 4J8RA 4TTDD 4N8VG 3IF1A 2F19L 4Y4HB 1FJ1B 3IDGA 3GSNB 3ZHKA 2CMRH 9CGTA 1PW3A 5DD5L 4PJHF 3ZT7A 3ZTJH 4G7YL 4NUGH 3EZ8A 4JKPL 2BNRA 4HPOL 5KSUB 3SJVE 3FQWB 3O45B 4AQOA 3MV7D 1R3KB 1FGVH 2OBGA 2R2HA 1V3MA 5E5MA 1A6VH 3Q6FB 2H2PD 1F2QA 3PF2A 5I19L 1Q0XL 4ZODA 4JKLA 3GMNA 4TQEL 1KIPB 1E4KC 5E2WH 2Q8BL 2R69H 3EUUA 3GSVB 3U6RA 3C6SB 1RHHB 2V9TA 1GOGA 5GRZA 1VESA 3NTCL 4CMHB 4PRPE 3FFCB 5DK2B 3U30C 4OLZH 3I3BA 3TZVC 1A7BA 2BVPB 5K93A 3TBYB 2FX8H 5C1MB 2BXZA 3I3EA 1I7ZB 4Y8DC 4ZPTB 3WO3B 3DJ9A 4XVJH 1GGCL 4N0FB 4UIKH 1RULL 3OAZH 5BS0B 3ZE2E 3DSFH 5DJAA 3MV7B 4AM0B 4BZ2H 4MD5B 5CZVH 2ZP0T 4HW6A 5J6GA 3TH2T 1OM3L 3O3EB 4J8RB 4WHYH 1ZS8A 1MIML 5KJRL 3IF1B 2DIAA 3IDGB 4Q9CA 3HNVH 2WAHA 4NHCL 4U1MA 5IQ9A 3TBSA 2QSCL 2BNRB 3TZVD 2E27H 2R2HB 5KANI 5E5MB 3QCTH 4PB0H 1UM6L 3DUUB 4D94A 3A6BH 4P59H 2W9DL 5HGBA 4XPFH 4ONFH 5TQ0L 2IBBA 4HT1H 4HWZA 3U6RB 1X44A 2HKFL 2ZPKH 1A6ZA 4PJ8C 5BS0E 2GQHA 3KGRA 2NY3C 5DJYA 3CCHA 3WLWD 3L3JA 1ZXQA 1NGQL 2XZQL 35C8H 3MLSL 3T2PA 1WISA 3HNSH 1KV3A 3RVUD 3QIBA 1NCDL 2FB4L 1ZTXH 2R29H 4I0PA 4ISVA 4M61B 5DJAB 5JPMA 4ZMAT 4DAGL 4LNRA 1AY1L 3D3VE 1NDGA 4PJ8D 1UH3A 1AR1C 2ED7A 2BVYA 4NNXA 4U1MB 3NACL 3IKKA 3TBSB 1A1NB 3KNBA 5J8OA 1JMXA 1HHJA 3FONA 5DSCA 2VDKL 3LHPH 1TJHH 1G9NC 4ZQKA 1DUYA 2LVCA 5C0CA 1IMHC 3JUZA 3OWEA 2O5YL 3H3PL 1CLZL 5HGBB 2I5YL 3UZEA 2EO9A 3SBWC 1YN6A 4WENB 1RJLA 1FPTH 1KLGA 4WRLA 1RY7B 5DD1H 4M9OA 4X7TA 1YNLL 4GRWH 2UWEF 2ZJSH 1XF3B 1A6ZB 5GRXG 4EI6A 4ZS6C 3EO9H 4BH8A 5DJYB 3CCHB 5HXMA 3L3JB 3WCYA 3DVFA 5J56B 1AR1D 4XPAH 3HR5A 3Q3GA 4TUKL 3C87A 4JCMA 1P84K 3P4LA 4BSJA 2DQHL 5FYJU 3F65A 1YPZE 1L9MA 3SDXA 2NY3B 3HB3C 5AYQA 3QEUA 3QIBB 1LDPL 4FS0A 3VWJC 1ZVSA 4I0PB 4ISVB 4MNQA 4PJCA 3CK0L 5JPMB 2DLTA 2D7QA 4KKAC 1NDGB 5KS9E 4ZS6D 4WI2A 3C5SA 2B7DT 4NNXB 5D7IA 1CBVH 2BOBB 3CPLB 1IAMA 4MNQD 3SQBA 2ZKHH 3DURA 3KNBB 4GQ9L 1HHJB 3FONB 2NX5D 3P4NA 3EDKA 4JHZA 4DW2H 2B1AL 4ZQKB 1DUYB 5C0CB 4NRZA 1RV6X 3BMWA 1KGCE 4QKXB 5EC2A 4BSWB 2VLME 3VWJD 5J9PA 2WNGA 1HKLL 1YN6B 4JVUA 2WINA 2KPNA 4K3EL 1KLGB 5IFHH 3PE9A 4X7TB 2C4FU 4EI6B 4XVSL 5F96H 2FHCA 2OP4H 3U7WH 1T0PB 4KKAD 3VCLA 1E4WL 5ACMA 4GXUM 5E2UH 1QSVA 4NWTL 1HQ4A 4MZ2A 4YHLH 3Q3GB 2PF6A 4NNPL 2HFFA 3EBAA 4P9ML 3THMH 1F8TL 1CGWA 1ZLWK 3SDXB 5T3ZE 4JZJC 3QEUB 1R3IH 1FNGA 4NO2A 4G6ML 3CU1A 4MNQB 4LRNH 5C0CE 4PJCB 1H8OA 4MA1C 5SX4I 1T1XB 1DCLA 4RDQG 3TO4A 4I2XA 3L3HA 5GHWL 1UA6H 4K2UL 3C5SB 3NH7L 1KB9J 3AS1A 4OCMC 1M4KA 5F89B 1XZ0A 5JW4Q 1V8HA 2R2BA 3DURB 1CZ8H 1YEJH 5BZDB 3P11L 3P4NB 1KTLA 2J8UF 3O8XC 3O6FC 4NRZB 4PJFB 4UNVA 3O0RL 2MHAA 1AO7D 5EC2B 5T1MB 3WNOA 5HHQA 5J9PB 3GMLA 1FZMA 3RWHA 2WINB 4LF3A 2ENSA 1OSPL 4F7CA 3O8XA 5IESH 2IMMA 4PJCE 4Z9KB 2APFA 3VCLB 3FO0L 3VD5A 2C5DC 1HQ4B 1P5UA 4UDUA 4ODUA 3QSKB 1I1AC 4Y2DC 5DMJB 4CVUA 5FOBA 2DMCA 3VFGH 3QHFH 3K1KC 4HWNA 3IVKA 2HT2C 4M5ZH 5D7IE 1E6OL 4JPKL 4GG6E 4LHUD 1F4XL 3QCVH 3O8XD 5CD3A 3O6FD 1XGPA 2V7NB 1FNGB 1RMFH 3T4YA 4NO2B 4HIJB 3KYAA 1I1AA 4TSCH 4F7TB 4O58H 3TO4B 2UUDK 2FLBT 1ZLWH 2WM0A 4FQCH 4I2XB 4AIOA 3OG6B 3L3HB 4NZUH 1GC1L 4JPWL 1YMHA 1SEQH 3CSGA 4JFOA 2R2BB 3T0XA 1I1AD 1X5XA 4Y2DD 3P2TA 1EK3A 1KTLB 3CZJA 1VADA 1VPOH 3VWKC 1WV7T 1UJ3A 2F58L 4KQ3L 2MHAB 3EDFA 3P9MA 1WFTA 5HHQB 5JW3L 3JZ7A 3GMLB 1FZMB 5EBWA 3QXAA 2R0ZH 3RWHB 1B0WA 4Y16C 4LF3B 1NEZG 2NW2A 1U3YA 1U8PB 4LHUB 4F7CB 3O8XB 1PG7W 4KUCD 1JIBA 5DWUH 5IWLC 2V9QA 5EORL 4IM8A 5DUPH 4FXGA 4UDUB 3EZJB 4I2XE 4ODUB 4Y16A 3ARZA 4Q6YA 5FOBB 5FUOH 3IVKB 4L1DA 3D39A 1C5DA 4KZDH 5C08E 2O61A 5IWLA 3FMGL 3VWKD 5CD3B 4DGVL 1XGPB 2YR3A 4CMMA 3OAUL 1ACYH 3P30H 3WIFB 2G5BA 1FDLH 1I1AB 2KH2B 3QDMA 4EKXA 4X4XA 1HHHA 3MV8D 2W60A 4Y16D 5GS2H 3EOBA 5I1CH 5KVFH 5IW1A 3LDBC 5ALCH 3TV3L 2XN9A 2RBLA 3D39D 5B22A 5HYSB 4DZBA 2C3VA 1DVFD 1YMHB 2UUDH 2FBOJ 4JFOB 2AS5M 3UTOA 1KB5H 4OCWH 3QDMD 1UWEH 2VXQL 3ALPA 4YXHL 1BIIB 1SEBA 1UJ3B 5KBNC 5DT1H 3QXDA 3P9MB 32C2A 4YC2C 5EBWB 8FABA 2NTFA 4JO1H 2Q8AH 4BYHA 2XPGA 1BHGA 3VWKB 3BSZH 5E2VL 3MLZH 2EH8H 1NGXA 4OCLC 4LLWA 4BFBD 4X6BA 2DQGL 1CD8A 2HH0H 4LASH 4M1DH 4FXGB 4GRWB 1O7SA 5ADPL 5T5FL 4Y16B 2AEIT 5TF0A 4JFZL 4JHAH 5DZNA 3D39B 3D2UA 1C5DB 3L5JA 2V5TA 2O61B 4OQTH 2GJZA 3HMXL 4N9OB 2JE8A 4CMMB 1XGUA 5IMOA 5ECJE 2G5BB 3QDMB 4X4XB 1HHHB 2W60B 3EOBB 1T2XA 5IW1B 5A1AA 1GHFH 1GGTA 3BP7A 1IM9A 4I77H 5DRWA 1JYNA 2IPUG 4FZ8H 5F7LB 1F00I 3IS1X 1UEYA 2C3VB 3VRLF 4Z6AT 4P48A 1P7KA 1SJXA 5E9DE 1CF8L 2XWBA 1NL0H 1OPGH 1SEBB 4GRWE 2X10A 2EYRA 4U33A 3V8OA 2R2EB 3TYGL 1IGTB 2O5XL 3QXDB 1TTGA 4H20L 5CZXC 3UJIL 3IYLW 3SN6N 4ONGL 8FABB 2NTFB 1T7YA 2PYEA 2XPGB 1RUQL 4HG4K 3RWDA 1T22A 4FHBD 5C0BA 4LLWB 5D7JA 5EB9A 3MRFA 1ORSA 4AT6A 4X6BB 4MA7H 3WKML 1EEQA 1J5OL 2CO6B 3GMRA 2XN9E 4RFOH 4NM8L 1QTYT 4XXDB 4OD1L 3D2UB 4HIXL 5I1DA 2ICWB 1IC4H 4LRIC 3C6LD 4F33A 2GJZB 1QHPA 1BBJA 1FQ9C 1GRWA 4KROC 3IDYC 1XGUB 2YUZA 5IMOB 5CZXD 4QT5A 3ZLQC 1LO0L 4CVXA 3U9PH 4LRIA 4XCCL 5FV1L 1FGNL 4N0YL 1GXEA 4UOW0 4X6EA 4ELME 3BP7B 5DRWB 4UTBL 4TVPH 2ZNWA 3QJHA 5DLML 5B38G 5I71C 3C8HA 1P7KB 1PSKH 4O2FA 1YC8A 4G6FB 1X5FA 3MO1A 4ODHH 5I6XC 1CVSC 2XWBB 4NQXA 2EYRB 3GJEA 2Y36L 2VLLB 2JELL 4DZ8B 4KROD 3MXWL 4PG2C 4XBEH 2DJSA 1T21A 2YD6A 2PYEB 3QDHA 3KPMA 4G9FA 2R39A 1CL7H 1XT5A 1JBJA 1P6AB 2H32A 4P2RA 3RWDB 1MJ7H 1T22B 3ULUC 2PTUA 5C0BB 3WFBL 4OZGE 3MRFB 1ORSB 4AT6B 3E3QC 1QOKA 5EZOH 1G6RH 4WIQA 3GMRB 3R8QA 5I0DA 4U6YB 3BDYL 5CEXA 3VDCA 2AGJL 3LIZH 2RQ8A 4PREA 4F33B 4C4KT 3KWWA 3V6BR 4KHTL 1V3JA 1FC2D 4QT5B 4F7PA 1QRND 3DV6A 2NNAA 1LMKA 4XVUC 4CVXB 1A5FH 4MJ2A 3UTPE 3DUHA 3PHQA 1QVOA 4X6EB 3FQUB 3ULUD 1JGDA 1Z9MA 2PYEE 4PLKC 3QJHB 4HWBL 3RIAF 1I9IL 3CDCA 2VLJA 4O2FB 4APQC 3MO1B 4JO2H 2GJ6A 1SBSL 3TT1H 3EW3B 2AXFA 4NQXB 5M95B 3DX8B 2W0LA 2DIJA 2A6JA 2AKRA 3KJ4B 3OJMB 1OAUH 3ZL4H 3WFEH 1KIUA 5CLTA 1KB5A 4KMLB 1A4KA 3VGAB 3M8OL 5HDQL 5I6XB 1RZFL 3I6LE 5C7XH 3VD4A 3U0WL 4Q7DA 3KPMB 4G9FB 4XVUD 4P2RB 2H32B 3OKOA 4UIMA 2DQUH 3X12B 4QRPE 2DQCL 4XBGA 1IGCL 1T4KA 4PLKD 5T3ZL 4NGHL 2EDYA 4PRBA 4F80A 1XF4A 4O2EB 1I9EA 3QQ9C 4KRPC 4LARL 2PN5A 5CEXB 4APQD 4MYWB 4PBWD 1VFOA 4PREB 5FECA 3KWWB 2VXSL 3QDJD 1NMAL 3EYFA 1IGIH 4LU5H 2Q7NA 1S3KH 4LPCA 4F7PB 1RPQA 2NNAB 4OQTA 4P2YA 1DBBH 1F5WA 4U7KA 1IEAA 5DJXA 2Z31C 2JB5H 3PHQB 4NKQB 1QVOB 3F7YA 1JGDB 5GRVK 1TCMA 3P0VL 3NZ8B 4QYOA 3TVMC 5I1KL 4P23A 1O5DT 1CFQA 2X4PA 4L3ED 2VLJB 4JQXC 3QQ9D 4E42B 2VN4A 2GJ6B 2Z31A 3TBWB 4K7PH 2VDQH 3OZ9L 2A1WL 2AXFB 4QO1A 5EPMA 2P5EA 5F9OH 4RMUA 3NVQA 4EUPG 2AKRB 2V9RA 3TVMA 2XXCB 4E0RA 1KB5B 1A4KB 1X5JA 2CDGB 2IG2L 5D1ZC 3K8KA 5EOCH 1LNUB 1KC5H 4TYUA 3OKOB 4JG1L 3Q2CA 2Z31D 5L0QC 4UIMB 2V17L 3EIFA 4XBGB 1I1FA 1T4KB 1XF4B 5HDBE 2KZ1B 1F58H 3DLQR 4OFYD 5D1ZA 4PGCA 2P8MA 4PTUB 3BH8A 4JB9H 3RGVC 5GS1C 2IALA 1BIHA 2VLJE 3WSQH 1A7RH 5FECB 3OXRA 5DQ9A 2GJ6E 4L3EB 2ID5A 4KRPB 3EYFB 1A6VL 4POYA 1KCUL 2E5EA 1IEAB 1B0RB 4XXCC 5CIPA 5DJXB 4BUHA 4R4FH 5F9WB 5KAQF 4LOUD 3F7YB 3A67H 3DO3A 4QYOB 5CKAA 1F13A 3QCUH 1CFQB 4X5WB 2Z31B 5DK3A 3RGVD 5ILTL 5EPMB 2P5EB 2VDPL 4LP4A 3TVMB 4WY7H 4RQQA 4UOW1 4WUUE 3OAYK 5BCAA 2R1XA 4HPYH 2FX8L 3S9DB 3ESUF 3MRPA 1E0OB 1FRGH 5T5NF 4XVJL 2EDBA 4U6TA 4MA8H 5SWZA 4GAJH 2H26A 2QBWA 2B20A 5C2BL 1QUNA 5ESVA 1I1FB 4BZ2L 3INUL 3ZDXE 5C0FA 2Q86A 4E9LA 5D1ZB 4PGCB 2P8MB 3BH8B 3DETC 4QOKD 4XC1L 2D7PA 3QXTA 2COQA 4PJGF 3HNVL 5L0QB 2IALB 3FKUS 4ZFGH 3IT8D 3QWOA 3DECA 5DQ9B 4HQQH 2E27L 1T5WA 2MJWA 3S34L 2P5EE 3MRQA 5D7LD 1P6FA 3QCTL 4PB0L 5CCKL 3TA3C 3OTTA 3A6BL 4NT6A 3TN0A 5CIPB 1YEGH 4QRSB 5E03A 3MNZA 3SDCC 4HT1L 12E8H 3A6OA 4JFHD 2CRIA 2C1PA 3TA3A 1MFDL 2IEPA 1BVKA 3DETD 4L8SC 5IFAH 2MMXA 5FF6A 1WVZA 35C8L 1GZPA 3SDCA 1RURH 4P0DA 4OI7A 4RQQB 1IQDB 4OF5A 2R1XB 2W65A 4LCUA 3VFNA 5DHVA 1WAAA 4Y1AD 5E5RB 3TA3D 1ZTXL 2AVGA 1U3HC 5SWZB 2R29L 2H26B 4XP6H 2ERJC 3OAYH 5ESVB 3D48R 4IDJH 4OKDA 3QQ4A 3RAJH 1Q0YL 3SDCD 3HAEA 5C0FB 2Q86B 1INDL 2AJUH 3CH1A 5E8OA 4WFED 1N6QH 3BD3A 3HN3A 1DJSA 3QWOB 1CLCA 1N0XH 3PP3H 1PGRB 1WTLA 4J3TA 4PGBA 5IHUH 3RBSA 4FNLH 4TVPE 2ATKA 5JA8B 1TJHL 5LG1A 1F3DH 2VQ1A 1MF2H 2X2YA 4S11A 2EDQA 3R0MA 4NT6B 2MOVA 3V79C 2NZIA 1U3HD 3HG1A 4MMXC 1UADC 3MNZB 1MLBB 5DD1L 2W0KA 3MCLH 3PABA 5FB8A 4HXBH 1CTOA 2XA3A 2C1PB 3TA3B 4HUUB 1BVKB 3MUY1 1QYGH 3HRZB 3HZVA 5EDXA 1MWAH 5FF6B 1IC5H 3SDCB 2CK0L 1ONQA 1JF5A 3VD3A 4LCUB 3WUWG 3VFNB 3HFMH 5DHVB 5I74B 3WJJC 4L8SB 3U46A 3GI8H 2FSEB 3PWPA 1HEZA 1BFSA 5A2FA 3QWRD 2O5ZH 5IBTH 5HYJA 3QQ4B 3QPXL 3HAEB 1S7UA 3MUHL 4YBLB 3WFCH 1MCFA 3IU3A 4OT1L 3WJJA 2Q6WA 3CH1B 5E8OB 1INQA 4JDTH 4I9WE 2MCG1 3CDFA 2HWZH 2ERJB 2Y5EA 1CGUA 4PGBB 2ZKHL 4DW2L 3P0GB 5HYJD 2VQ1B 2AXHA 3GJFK 4JFFA 1CCZA 1G0DA 3CD4A 3ZDYF 5KSVB 4P46A 4NKMA 1MFNA 4J2XA 1WAAE 5ESAA 5FB8B 3PABB 3MLYH 3PGDA 3B8YA 5F96L 1QO3A 3ESVF 4O5LH 2ZG1A 3U7WL 3RDTA 4JZOA 5LWYH 5E2UL 3HZVB 1UQSA 4ZFFA 4YHLL 1AQKL 1KEML 3U36A 1T7XA 4I5BB 1R5WA 4MWFA 4WW2C 4QY8B 5EBGA 2ADFH 3THML 4K94L 1JRHH 4FXKA 2C26A 4XGZA 4X4MA 1R3IL 3U46B 2FCBA 4PJBA 3PWPB 1HEZB 4GS7C 5GGVH 2VTFA 4HX1B 4WW2A 5ACZB 5HYJB 2Y07H 1S7UB 3ARUA 3IU3B 2O26U 2VN7A 2WWKT 3HG1E 2Q6WB 5JIHA 5L6YH 5LAXA 2PXYA 1INQB 2DM2A 1UA6L 1I75A 1YEIH 3NN8A 4G9DA 4OV5A 1L7IH 3IDJA 3OJDA 2VDML 3BZ4B 4KGJA 4X9BA 4PGJA 1CZ8L 1YEJL 3TT3H 1A3RL 5GSVA 1AH1A 4DVBB 2XG5A 4XP5H 1K8IA 4P46B 4NKMB 1MVUB 3RBGA 2VKXA 1RVFH 5ESAB 2QQNH 3CMOH 4NO3B 3PGDB 3PWPE 3T3MF 3GJFH 1PBYA 5IESL 1QO3B 4IMKC 2LU4A 3RDTB 1N5AA 4JZOB 4X6FA 4YHZH 4XPGH 3GSWA 1T80A 1UQSB 1WFOA 3MCG1 4ZFFB 1XGTA 1AP2B 3U36B 1R5WB 1TETH 3BKJL 3VFGL 4MWFB 3QHFL 5HHVH 1QNZL 4M5ZL 1TNMA 1JYXA 4XGZB 4JO3L 1OOAA 1UGNA 5EUOA 2XICA 1QBAA 3IFNL 4PJBB 4OGYH 2EDRA 4YDKH 1J87A 4TSCL 5CJBA 5HVGB 1NUNB 2FECL 4PD4J 4O58L 4WW2B 3V4UL 4JFFE 4WI7A 5I2IA 1S78C 1ZANL 1ADQA 5IK3B 5LAXB 1FNAA 3IB4A 3NN8B 3SCMC 4GS7B 4G9DB 4NZUL 4OV5B 1E6JH 3IDJB 3OJDB 1SEQL 6FABL 4C58B 2AJXH 4JN2A 4KMQA 5BJTA 5L2KD 4R90L 1VPOL 1DQQB 5MEND 5GSVB 3PXHA 2VLRE 5EN2A 3SCMA 4KTDH 3F6IA 4XH2A 4QRUA 3LAFA 1K8IB 4ODSH 3HC3H 2R0ZL 2XACC 3K8MA 4FTVE 5IHLB 1OAYH 3OKNA 4F57L 1S78D 5DWUL 1N5AB 2VDRH 2FWOA 1IC1A 3CMGA 3GSWB 3SCMD 1XGTB 2DQJH 1NUGA 4GMTH 5JIPA 2XY1A 5I1IL 4LGPB 4KZDL 5EUOB 3VXUA 4OCYL 2QTEA 3DI2B 5BV7H 4J4PC 5MHSE 2GKIA 3TNMA 4MD4A 3NABH 1JWSA 1H3VA 3P40A 1FDLL 3C9NA 3QIUA 2NY1D 4MA3A 4G6KH 5L2KB 2WANA 5KANG 3CU7A 2R0KH 4NCDA 5KVFL 1JTOA 5ALCL 1N5YL 1D9KC 4J4PA 2DLGA 1NEUA 2OJEA 1I8IA 3UTSD 4R4NC 4JN2B 4IHOA 3E2HC 4OCWL 5BJTB 4L1HA 5KW9H 2A0LC 5T1LD 1KPRA 4KRMB 1FZKA 5DT1L 2YD4A 1R6VA 5EN2B 3SCMB 3G6AB 4XH2B 2XRAH 4QRUB 4J4PD 4XC3L 1PAMA 3SE4C 2FBJH 1PG7X 5CGMA 1HDMA 4JO1L 4NN7C 5EUOE 2Z91A 3MZTA 1CDIA 2YOCA 1M7XA 1W2KT 3BSZL 2CRZA 3MRGA 3OKNB 2EH8L 2OR7A 4WFGE 1D9KD 4W4NA 5FM4A 3LEYH 2I25N 4LASL 4M1DL 3SE4A 3LN9A 2ZCHH 1WEJH 5FYJH 3O3UN 3ARRA 4MAYC 3RA7H 4R4ND 1P4IH 1KTRL 4JHAL 1EO5A 2FIRT 4QF1A 1H3WM 1RIUH 3UYOD 3VXUB 3TNMB 1Z0NA 4MD4B 1JWSB 3UTSB 3C9NB 1RUMH 3QIUB 2DOCA 4MA3B 3QUYD 4MAYA 2BVTA 1CDYA 2OM5A 1FYTD 1GPOH 3KLHC 4HUWA 2GY7B 1GHFL 3QEQA 4I3RL 4I77L 4PJEA 2LVEA 5D8JH 4OM1H 1EO8H 4Y0GA 2AEPH 3I84A 1I8IB 4HXAH 2FECI 4IHOB 4MAYD 1MY7A 4BH7A 1OPGL 3O3DA 1N6UA 1F4AA 1IILE 5I30H 1K8DA 1NAKL 4Q9RL 1KPRB 1FZKB 1CD1A 3QEQD 4N8VA 2IQAB 5F1IA 1YEEL 5IVOA 4N90E 1HDMB 3VXUE 4M1GH 2Z91B 1QRKA 5LGJA 4I8DA 3MRGB 4DK3A 4ETYA 1S5IH 4LLYA 5HHOE 1C7TA 2D9CA 2VXUL 2GYSA 2APVA 4MA7L 3KHOA 2MKLC 4R8WH 3OMZA 3GJFA 1DL7H 5IW6A 4DQOH 2VL5A 4PRAA 1A21A 1YPZF 4QF1B 3K2UH 4HKXA 5FHAH 4XVTH 2BNUA 2QL1A 4JDZB 1FNSH 3QI9D 1Y6NR 1B88A 4MAYB 1KFAH 4N8CL 4FQ1H 2D7TL 4GSDH 3U9PL 4HUWB 4MNGE 5FCSH 3ULVD 3QEQB 5KS9F 4PJEB 4XMKH 4TVPL 3LKOB 1YY8A 5EO9A 1S8DA 2GCYA 5KAQG 1TXKA 4QXUL 2WIIA 1CD9B 1QACA 1AC6A 1R3HA 1PSKL 4ODHL 1QQDA 4MXVE 3ORJA 2HLFC 4BH7B 1CQYA 2HFEA 1BGXH 3O3DB 3QDAA 1K8DB 2P47B 2ESVA 3B2UC 4OGXH 4N8VB 1CD1B 4W4OA 1DBJL 3BRGC 5F1IB 4XBEL 2DQTH 3M17A 3GI9H 4FP8L 1CL7L 5AG8A 5LGJB 4UV7H 3BKCH 1MJ7L 1E28A 1LO2L 4LLYB 4NO5A 5T5NG 2VLKA 3MA9L 2X1QA 3Q5YA 3M1BA 1G6RL 1O0VA 3GJFB 5BZWA 5IW6B 1FL3A 4PJEE 2VL5B 4H26A 4PRAB 1LE5A 3D1MC 3BD5A 1LVEA 3ARFC 2Y23A 3LIZL 4HKXB 2HLFD 4GXVL 4N0UA 1FO0L 3B2UD 5EOQH 2CRMA 5GJSL 1OQOA 4H5SA 1T6WA 5I75C 1DBMH 1NCUA 5JW5A 2ATPB 3ARFA 4UZGA 1A5FL 5FYLD 4PLJC 5I8OH 5TDNA 4OZIA 1JNHA 1N7MH 2VNCA 5EO9B 1S8DB 2GCYB 3V4VH 4BQ8A 4ODWA 1ZHKA 2QSVA 2WIIB 3HI6L 4QLRA 3LRSA 4HMEA 2IAMC 3BMVA 4JO2L 1QQDB 1KJ3H 4AEIL 4KXZI 2HFEB 3AM8A 3KR3L 4HS3B 3ARFD 4L29A 2OL3A 1OAUL 3ZL4L 3WFEL 2EXWC 1MEXH 1CR9L 4XT1C 1I1RA 3M17B 1IZJA 2OX5A 2SEBA 5C7XL 2E9BA 4WHDA 1JNNL 4TOYH 1D5BA 1XCQB 2VOTA 1E28B 4PLJD 3P4MA 1A47A 2FJFA 2AJYL 3H9YA 2VLKB 4Y19A 4WWKA 1CFTA 3M1BB 3NIGE 3OJ2C 5BZWB 1FL3B 3HCVA 1LE5B 5IUSA 1BWWA 3WIHL 2IAMD 4N0UB 3C2AL 1NJ9A 1G0XA 1FP5A 2E9JA 1MCWM 2EXWD 4H5SB 4OZFG 1CDUA 25C8L 4LU5L 2ESVE 4Y19D 5JW5B 1DBBL 4UNUA 2IPUK 3ARFB 1S5HA 2JB5L 5TDNB 4OZIB 1FNHA 2BFVL 4RISH 4BK4A 1T5XA 3GO1H 4U1LA 5E4EC 1ZHKB 3OF6A 5HGGS 3LRSB 5F44A 2VZTA 4RZCA 1MAJA 3X17A 1PYWA 2VLKE 3H9SE 2EICA 1KULA 2VDQL 5F9OL 3CSYA 3BDXA 4PYGA 1MQKH 1EUTA 2OL3B 5IP4A 2FGWH 3LKSA 4HBCL 4L4VD 3VXOA 4YHMH 5LGKA 2SEBB 4HD9A 1T3FA 4NKDA 5FYKU 1KC5L 3RZCC 1D5BB 3P4MB 2ARJB 2FJFB 4Y19B 1ZAGA 3QQ3A 2WV3A 4WWKB 1CFTB 3ZE1E 5H2BA 1J1XL 3IGAA 3HCVB 2EDNA 4ERSH 4OZIE 1FZOA 1CL7I 4N5EC 4LDOB 3WSQL 1NJ9B 1QPPA 2VE6A 4DEPC 2EDXA 1S5HB 5EZLA 4R4FL 4GMSH 1EGJA 3RZCD 2A2QT 1UZ8A 3A67L 2D0GA 1G9MC 1SYVA 1T5XB 4U1LB 2UVEA 3MRJA 4PRID 1VENA 4RZCB 1PYWB 5T3XD 4J3SA 4Z7NF 1NLBH 4EN3C 2B0SH 5E4EB 4OUUA 2KKQA 2IGFL 1KN2H 3LKSB 4F7EA 3VXOB 5FYJE 2JK5A 1FRGL 1T3FB 1KCRH 4NKDB 2XTJC 3LRHA 1VEPA 4UBDC 1M6OA 2BNQD 1IKNC 5F72S 1X3DA 4NNYA 3MRDA 4WJ5A 5FYKD 3IFOA 1H3GA 3QQ3B 4PLOB 5H2BB 4JCLA 4WI3A 1T1ZA 2NW3A 4NDMA 1FIEA 1N8ZB 1NMBH 4ZFGL 1TQBC 1NBQA 4I1NB 4EN3D 4HQQL 3FO9A 4Z7VA 4NUJA 2VE6B 3Q1SH 4XP1H 4YHOL 1VKXA 1J86A 2F74A 3HUJA 4K8RC 5EZLB 1LP9E 2XTJD 1U92B 1U91A 5E7FA 5E6YA 4LDLB 1S7RA 4UBDD 1UZ8B 2ZUTA 3EYVB 4JN1H 2ZUVA 1SYVB 4DEPB 3MRJB 3VGGA 5KVEH 1MFBL 1I1CA 2VXVH 5IFAL 3UYPA 4MAUH 3RP1A 2JIXD 2ZG3A 3LMJH 1TZHA 1VGKA 4X6DA 4ZOAA 1RURL 1BPVA 3MR9A 1KCSH 4ODXB 4OUUB 4ODTL 1MCNA 5C09A 4F7EB 1VERA 2A9NH 1CE6A 5GRUH 3FZUD 1P9MA 5GS0C 4K8RD 3MZGB 1M6OB 4XP6L 2IWGA 4EN3B 4XMPL 5DRXA 1F6FB 4WJ5B 3K74B 5GIRA 1YMMA 3UJJH 2AJUL 3VJ6B 1T1ZB 2NW3B 1RZKC 1NEZA 4HC1L 4NDMB 5C09D 1BEYH 43CAA 5LCVH 5D2NC 1N0XL 1XH3A 1NSNH 5I8CA 3FO9B 4Z7VB 4IS6A 4NUJB 5HVWA 1MF2L 4ZOEA 4X6CE 4RBPH 2F74B 3HUJB 5AWNL 5D2NA 1U91B 2RIKA 2X41A 3IRZA 4ELMF 4KDVA 4MJ6A 3FFDA 4OSUH 3TM6A 5IHZA 5EWIL 4HXBL 4MLSA 5AZ2L 4HAFA 5CMAA 3WHE0 2GSGA 1QYGL 1W0WA 2IFGA 3QULA 1MWAL 3MLUH 1TZHB 3Q48A 1IC5L 4FZEH 3MR9B 5KVDL 3VXMD 1KYOK 5C09B 4X5XA 3HFML 1YYLH 3LB6C 4LLQA 3TIEA 1CE6B 1NUFA 2F8VA 1XR9A 4Y5YC 4Z7VE 5F8RC 2AJVH 3WE6A 1BZ7A 1GGYA 4OZGF 4QHKI 5IBTL 4TSBH 3HUJE 4D8PB 3WFCL 4QTHA 4NQVB 1YMMB 2XKNA 3ARDA 3D18A 1NEZB 3IDXH 4JDTL 1I3VA 4Y5YA 3RNKB 3JWDH 1H5BC 43CAB 1MJJA 2Y9RT 5TDPA 3VXRE 4KI1A 2VQTA 3EFFA 3ZKNC 1XH3B 1HSBA 1IAOA 3F12A 1I7UA 4EI5C 4HJ0C 5I8CB 3DIFA 4NZDA 3VA2C 4IS6B 3B5GA 4X6DE 3LB6D 2A77L 3T8XA 5D2NB 2R8SL 4MJ6B 5JUEH 3FFDB 4OGAC 5IHZB 1ZGLP 3MLYL 2OTPA 1S7SA 4AMKH 5C6PB 5CMAB 5FXCH 1XF2A 4NJ9H 2GSGB 5JIIA 1W0WB 3QULB 2APWA 4HGMA 3ZKND 1JPTH 2PO6A 4GG8A 4KJPC 4HJ0D 2ADFL 4EI5D 1JRHL 3L5HA 4X5XB 4EUPH 1KEGL 2ZOLA 4HUVA 4LLQB 3TIEB 5DVKA 4TSAH 1VFAA 1XR9B 4UT9H 5CS7A 3UTZA 5D7SH 1NKOA 1RIVH 1BZ7B 4C55A 5GGVL 3SDAD 1BQHG 4RX4A 4Z0XB 1A6UH 3RUGE 2Y07L 2X09A 1JF1A 4KDWA 3QG6A 1SBBA 3MTRA 4QTHB 2XKNB 5L6YL 2IH3A 2MSPA 3ARDB 3D18B 3RZWA 1YEIL 4Y5YB 5IEHA 1MJJB 1EFXA 1NGWA 5TDPB 5JMOC 3EFFB 1HSBB 1IAOB 4O4YH 3F12B 4H88H 4OZHA 1I7UB 4JKMA 3DIFB 5ACLA 1CG9A 3QEHA 3I3DA 4KJPD 2V5SA 3RWFB 4KI5C 3T8XB 4XP5L 4Z5RA 2CPCA 1E27A 3QYCA 3EYSH 4JRXA 1RVFL 3EJZC 4Y8AA 5GJTH 2QQNL 3CMOL 2FHFA 4PJHA 1S9WA 1S7SB 2MNUA 4HSQA 1A7QL 1XF2B 3M07A 4FQLH 4YHZL 5BOPA 4XPGL 4PS4H 3HZMA 2JCCF 4M02A 3WXWL 2BSTA 1TETL 5CJOL 2HLAA 1J1OH 2PO6B 1MLCA 4GG8B 1EH9A 4MLIA 3LEVH 1FL5A 2AK4A 5B38A 2ZOLB 4HUVB 3MJ7A 4KI5D 1VFAB 4OGYL 3UTZB 3F7VA 1QPXA 2GY5A 2PETA 3MQIA 5SX5K 3MFGB 3EJZD 3AMLA 3MJ9A 4PJ5A 3QG6B 5EOTA 2IH3B 5KG9A 1FVEA 1GGIH 4QHNA 5IEHB 5DFTA 1OTUC 3FHQA 1EFXB 4FABL 4EBQL 3WNKA 5E8DH 3GUTA 2DWEA 5HGAA 3QEHB 3ILPA 5IB2A 1PJ9A 4S2SA 3QUKA 2BHYA 5F21B 1B6DA 4KTDL 1YECH 2VDNH 3AROA 3SKMA 3V4PL 2ED9A 2EH7H 3HC3L 4Z5RB 1E27B 4JRXB 1XIWA 2BMKA 2BRQA 3WXVH 1T7VA 4PJHB 1S9WB 1REIA 1MRFH 1G9NL 2IPKA 4ZXBA 5KVGH 5D5MF 4BFEA 2RCSH 4D9QE 4F15C 1DANU 2DQJL 3QUXC 2BSTB 3T0BA 4B7IA 5ADOL 2BHUA 2HLAB 1MLCB 3WO4C 4U6XA 2AK4B 5I1GH 2BVQA 3MJ7B 5BV7L 2JJTC 2IJ0C 4OZHE 3DTXA 2BVUA 3NABL 5I1AA 3EOTH 5EU3A 1QRNE 3UXFA 2H8PA 3ZE0F 2VISA 4PJ5B 5I8KL 1JRHI 4JFYA 1MPAL 1L0YA 5ESQA 1OAXH 5EOTB 5KG9B 1FVEB 4QGYA 4RIRB 3RQ3A 4QHNB 3T2OA 1RHFA 3FN0H 2XZAL 4L9DA 4PJHE 5SX5H 3BPLC 3ARGC 2P42B 4D9RE 3QUXD 4M8VA 2FRGP 2DWEB 2QQLL 5HGAB 3ILPB 3UDWC 4TRPH 4BK5A 3BVNA 4S2SB 2VC2L 4HUNB 3QUKB 2N56A 3Q5TA 2DBJA 4R26H 3SKMB 2P43B 2FBJL 2AK4E 4Y5VC 3TCXA 4LPUA 4LFHD 1XIWB 3RHWF 3UDWA 3LVEA 1PDKA 3P4OA 4YFDB 1KPVA 4AENB 4ZXBB 4PJ5E 5DMGC 3DHJA 5FYJL 4IMLB 3BX7C 4HIEB 1MFEH 1EZVY 2AJ3A 3ARGD 1WLHA 1PEWA 1U6AH 3RA7L 1IT9H 5DC4B 5D1XC 3H9ZA 2BVQB 4EQ3A 3DTXB 3PWVA 4FQQA 2UWEA 5I1AB 1KB9K 4KKCC 4F15B 5D2LF 1RUML 2QSQA 4EUPA 1DE4A 3OGOE 3WO4B 4PRHA 4V1DE 1U8KB 3AXLA 1OCWH 1PFCA 4JFYB 5ESQB 3LD8C 5MERA 4WV1C 3O9WC 3F8UB 4OM1L 1EO8L 3DX7A 5DMGD 4RA3A 2H45A 5KTEL 2B1HH 2CKBB 3TCLA 5IROC 3LKQA 1G7PA 1PKQA 5I30L 5D1XD 3BVNB 3S35H 3T0ED 5HVFB 1VEMA 5D6CA 4J6RL 5KZCB 5J1TC 2NY4C 2BVEA 3ARGB 2AXGB 4ONHA 3ECBB 4KKCD 5DGQA 3UX9B 5FHBH 1D5MA 4M1GL 3RWJA 2LTQC 3JVGC 1MCHA 2AK1H 3VXSD 1RK0A 1U58A 4GXUN 1S5IL 3P4OB 4J3VA 3MOAL 5GRJH 1A6WL 1C5BH 1KPVB 3O9WD 2YUXA 4K23L 4FFVD 5JORA 1MRCH 1OWWA 3GIVA 3CX2A 1DL7L 2AJ3B 4DQOL 2CDEB 3L5IA 3NCEB 2IC2A 2JJVA 2FEDC 2DQEL 3QO0A 2XNAA 5FHAL 4FQQB 3PWVB 5HYFA 2UWEB 1FNSL 5CEYA 5FGRA 5GS3A 2NY4D 1MJ8H 2J8HA 3KPQA 4HMDA 1B2WH 1DE4B 1KFAL 4YFLF 2IANA 4GSDL 5F7EH 4ZTPH 5MERB 3RWIA 4R0LA 1CQKA 2WK2A 3KPRE 1JMZA 3DX7B 4UILH 3L9RB 4PIRF 4L4TA 1U8IA 3VXSB 3TCLB 1EHNA 3LKQB 1UFUA 1AGCA 1PKQB 2XTLA 3O3BA 1BGXL 4UB0H 3LD8B 2FEDD 4WV1B 3O9WB 4IOFC 4OGXL 3REWA 2NY6D 5D6CB 4ONHB 2ZOKA 1ZMYA 5E1HB 2DQTL 2UZIH 1FBIL 3V5HA 1D5MB 3RWJB 3O4LD 1S7WB 1PY4A 1IAIH 4UV7L 1RK0B 1U58B 2X9WA 2EDLA 2ZUSA 4HKZA 1ZV5A 2NY4B 4WDIA 4PRHE 2J8UA 2EDOA 4KDTC 4QOKE 4GRMA 5D72H 5JORB 2H9GA 2LTQB 2WSKA 3GIVB 4KVNH 1G1YA 1FC1A 4PB9L 4X4YB 3BAEL 3QO0B 4IRJC 2QSTA 2XNAB 3MMEA 4H8WH 2HFGH 2VR5A 4IOFD 5EOQL 1NAMA 5CEYB 5C0GA 1DBML 3KPQB 4FQ2L 2IANB 4IRJA 2Y5TA 3T0WA 3VFSA 5I8OL 3BRDA 3RWIB 2E9IA 2VR9A 4R0LB 3PWNA 3E1F1 1NCAH 3RIAK 4M93B 1QKZH 4L4TB 1NMCB 1U8IB 2UZYB 3TFKC 3VW3H 1AGCB 1G7JA 5IIEA 1KJ3L 4C83A 3O3BB 1J18A 2E7CA 4D0CA 5I9QB 4IRJD 3REWB 2YC1A 3C5JA 3T4AA 2YXFA 1OVZA 5DA0B 1GIGH 4YPJA 4NRYA 4Y1AE 5C0JB 2YN5A 3ALXA 2J1KA 4P4RA 4DN3L 2NXYC 4TOYL 5M94B 3FQNA 2XA8L 1BQLH 3DARA 1U8HA 3HNTH 3QHZL 2IANE 3KYOA 4WDIB 2J8UB 4GAYB 3BPOC 4GRMB 4WFEE 1KCKA 4KKNA 4ZD3H 3G5YA 2H9GB 2EECA 3TFKD 5D96B 1MELA 3IKCA 1CWVA 2VZOA 3ME0A 3MMEB 4G8GD 4AH2A 1NAMB 2QEJA 3GK8L 5C0GB 5IVZA 5CUSH 4PPTA 1BZQK 1HWHB 4X7EC 5EH1A 5AAMA 4IDLA 2X4SA 4IRJB 2Y5TB 1FORH 3K4AA 3VFSB 3WUWA 4YAQA 1AKJD 1P53A 2HVJA 2A83A 1BD2A 4RISL 1LK2A 3PWNB 3U7AA 4N1CA 3S37L 3ZKXC 3H6JA 1Q9OA 5IIEB 1AGFA 1G7JB 2OZ4L 1UXWB 4C83B 3I50H 4OLUH 1L0XA 3BXNA 4H25A 3L3IA 4MQTB 4Y4FA 3C5JB 3T4AB 1XMWA 4D2NA 4NRYB 2HYMA 2EDTA 1OGAA 3T2NH 4P4RB 3V0WH 3D85D 4XRCA 4U1SA 2V5MA 3FQNB 1U8HB 2C4XA 2HRPH 3MX0A 3KYOB 4NC1E 1MHPH 3MOBH 3ZYZA 3G5YB 4M48L 5F7YC 2NXYB 5D1QC 3IKCB 4WFHD 4OCRL 2DL9A 3BT2L 3ULVH 3WMSA 4AH2B 5E24E 3BPOB 4F58H 1D6VH 5ISZE 4MQSB 3L7FA 4U0RC 1KSRA 1ZVYA 5IVZB 3HPJA 3H0TA 1KXQE 2Z0BA 4JJ5B 1KIRB 2X4SB 4GMSL 3WUWB 3MRHB 3F7RA 2HVJB 2A83B 1LK2B 1QLEL 3KPLA 4KHXL 3LQAC 5IB1A 3B43A 4OCXL 4HPOH 1IGFL 2M2DA 1Q9OB 1AGFB 2Z35A 3U9UA 4QHLA 5GGSY 5D1QD 2J7LA 4RAVA 5INCA 3BXNB 3IDUA 2B0SL 3L3IB 4CJ1A 4Y4FB 5C0DA 2LQRA 1DBAL 3QG7H 4XPHH 3ZKXB 2MWCA 2CK2A 1OGAB 4M00A 1NFIA 1IAIM 1SVCP 4XRCB 4U1SB 4JFDA 1HNFA 3P9WB 1OP5K 1N26A 4N5UA 1IE5A 4GUPA 3N1FC 3OB8A 4HMCA 5IB3A 5C0RL 1BD2E 1WZMA 4E41A 1IKFH 4HLJA 1NMBL 3DHMA 5FYLH 2KBGA 4JFDD 5MEOB 1WBZA 2CUHA 1IQWH 1GJIA 4NP4L 5F3HA 3L7FB 4NRXB 5ICYA 4WWID 4E0RB 3H0TB 2DWDA 1CFNA 5ITBH 4E41D 4LQFL 3MV9D 1QFHA 4JN1L 1OGAE 3EHBD 3LKRB 1KIQA 4H0IA 3KPLB 3NCMA 5JLZA 5CINH 4NHCH 4RMVA 4O2CA 5IB1B 5KVEL 4OUOA 1CDBA 1U3ZA 4A2LA 2Z35B 4MAUL 3U9UB 3B83A 4QHLB 3TO2A 1NC4A 4RAVB 1AGDA 5F6IC 2EO1A 4OAWA 4DOHB 5JNYA 2VWEE 5C0DB 2E7LC 4P57A 2A9NL 4LCWA 3VH8G 5EU7C 2F54A 1JJUA 1NFIB 1OB1A 1A6PA 1T66C 4JFDB 1OAZL 2DQFA 2QLVB 5E8NA 1KNOA 1H8SA 5JQ6L 3OKKA 4X7DC 2IADB 2XZQH 3QNXA 4LSQH 1BJ1J 3UJJL 4M5YL 5IB3B 5CJXC 1BEYL 1OP5H 4E41B 4LCWD 4KPHL 2NY2C 5CBEA 2KQMA 1WBZB 5DVOA 5MENE 3S3PA 4HIHA 5F3HB 4FG6C 1TQCB 2C3HA 5JO5B 4DAGH 2DWDB 2R4SH 2Y72A 4J23A 2PCPA 5D9SB 1JZ7A 2BSED 1LK3H 2IPTH 4PJ9C 1CFNB 1KOAA 1T66D 5IKCB 2FO1A 4BKLB 3JWOH 1KIQB 5JLZB 3BPCA 3VRLE 3NACH 4O2CB 4JFPB 3KPPA 3G6JE 3LPWA 4PJ9A 5FA3A 1RQ5A 3TO2B 1NC4B 4XAWH 2NY2D 4JLRA 1AGDB 2Y7QA 1IM3A 3MRRA 4OAWB 5JNYB 4K9EC 3H3PH 3PV7A 4P57B 1YYLL 3STLA 4FG6D 4LCWB 2F54B 1YNLH 1WGOA 3I9GL 2AJVL 4AEFA 4PJ9D 1ZWIA 2DQFB 5F6IB 1XCTA 5E8NB 2HN7A 2XOTA 1FFOA 4R3SA 3QNXB 4A2MA 3TPUA 3IDXL 3VD9A 4PV9A 3JWDL 4NOFA 5EZJA 5FEBA 2ZZUT 5FKPB 1G7MA 5CBEB 4Q74A 5JOPE 5C0AE 1LDPH 1UJTA 3G9AB 4HIHB 5DI8B 4RGOL 4BM7A 1MIEL 1JZ2A 4C54A 4OZ4B 4MJIA 3GMMA 3SHSA 5JUEL 1EJOH 1X5ZA 4P5KA 2F54E 3BPCB 2DYPD 4GT7A 4X9GA 4LVNC 1ZHBA 4ZO8A 3QUMH 4N0CC 4NJ9L 4XNQA 4YE4H 1JGVH 4PJ9B 5FA3B 2DJUA 4GO6B 4JLRB 1MCWW 2Y7QB 4L8CA 1IM3B 3MRRB 4NWUH 4WU7A 1HKLH 2HJFA 4K3EH 3STLB 5C9KA 4O9HH 4I18C 5F8QC 1ZLVH 4OFPA 3K46A 5TE6L 5D7SL 1RIVL 2ADJA 1ZWIB 5CKGA 2G5RA 4GH7B 1A6UL 5T1KA 2HN7B 1WFNA 1BZ9A 1FFOB 3DMMC 3G5XB 4NKOA 3RPIA 1P69B 4I18A 4ZFZB 5BMFL 1K3ZA 4PV9B 1SJEA 1G1CA 4N0CD 4P9MH 5EZJB 1G7MB 1N4XH 3OKYA 4BUGA 1JPGA 2VRAA 4H88L 4Y2OA 4G6MH 5SWQB 1U9KA 5DJ0A 2CR3A 3SO5A 4MJIB 1F45A 4NYLA 2ADIA 4BFIA 4P49A 3GMMB 3HE6A 3F5WA 3UTTE 3EYSL 4M8QA 5GHWH 4P5KB 3VG0H 3NH7H 5GJTL 4ZDHB 1P1ZB 5BW7C 3DMMD 2AQ3A 2CUMA 1CDHA 1ZHBB 4FQLL 1NFDF 1R3JB 3P11H 4XNQB 1K4DA 5I8EB 4AL8L 3O0RH 5FKAA 3WNMA 5BW7A 3AGVA 5FO8A 2X4OB 4LVNB 1KJMA 2HJFB 2A73A 4LIQL 5I15L 1E4XL 1WCBA 1RZ7L 3MGTA 1J8KA 2FH6A 2ADJB 1R0AH 3FO0H 5T1KB 3ULVE 2EDHA 1BZ9B 4JFEE 2OSLA 4MJIE 1LEIA 5LGHL 2D4DA 3RPIB 2I9TB 4I18B 3O2DL 5TE7H 1K9TA 3D0LA 1SJEB 1HK6A 1RUPH 4JPKH 5BRZD 5E8DL 1OTTC 1JPGB 2FEEL 1D5XA 3TIDA 1MFCH 1ROWA 1I9JH 4ALAH 1B3JA 5TFSL 1IZKA 1XAUA 1A9BA 5DJ0B 4LDEB 1TIUA 1XGYH 2CQVA 1MJUH 1P5VA 3RY6A 2VDNL 2ADIB 4BFIB 4HJJL 2RAMA 3HE6B 3F5WB 2ITCA 5I66B 4M8QB 3KLAB 4ONOA 3VGHA 1GC1H 4JPWH 3WXVL 2E8ZA 1QBBA 4PJFF 1M7DA 4ZO9A 1MRFL 3UEZA 1EAPA 3RVWC 4KJQC 5KVGL 3B9EA 2RCSL 1KELH 2VERN 2F58H 5FKAB 1OTTD 1HXYA 3FAXA 4RWHA 1U8MA 5FO8B 3PL6C 1LO4H 1KJMB 2A73B 5I1GL 1HSAA 2YD9A 3NZHH 4JGJA 5BRZB 1RJZA 2HT4C 1U8LA 4YQXL 1KG0A 1TVBA 3QFJA 3QDGA 5FYLE 2OSLB 1LEIB 3RWCA 3BESR 2ITDA 4OLYL 4J12A 1OAXL 4OLWH 1QR4A 4L8BA 5EO1A 3D0LB 4NQDA 3TEUA 3FN0L 3RVWD 2R9HC 3MGAA 4KJQD 2NTSP 3WDIA 4TNWK 1FN4A 1D5XB 3D25B 3TIDB 5SWSD 1XR8A 3QDGD 2BJML 2ICWJ 1A9BB 3PL6D 1IBGH 3H9HA 4UMGA 1QSFE 1LP9F 3X11A 4R26L 4Z7UB 2EIBA 5CGTA 3TV3H 3ROLA 2HT4D 1YDPA 4JGMA 3SGKA 2BRRH 4OZFA 4P2QA 5DD0L 1D7FA 1P84J 1M7DB 1EAPB 5DRNA 4XCNA 3FT4A 3ZO0A 4YHIA 2ILLA 2R9HD 3DWTA 1KENL 5EBMA 1BFTA 3B9AA 1HXYB 1U6AL 1U8MB 2B2XL 1IT9L 3L3KA 4YDJA 3RWEA 4FQIH 1QFWL 1HSAB 1B4JL 1RJZB 5E2VH 3NMEA 1U8LB 4HWUA 1R5IB 1KG0B 1TVBB 2ADGA 5SWSB 3QFJB 3DUSB 3QDGB 2NR6C 1UYWH 3PL6B 1J9CT 4JJHA 1NCWH 3RWCB 4U1GC 1M05A 2ITDB 4P9HC 4L8BB 5EO1B 1HYSD 4PJGE 2DBLH 3JV0A 4HHAA 4BQ6A 3W0WA 2B1HL 1FN4B 3K0WA 4K7FB 3FRUA 2EC9T 4YO0A 3S35L 5MI0B 4X6CF 1EO7A 2AQ1A 1DQTA 3H9HB 4OLEA 4XP4L 3X11B 2FJGB 3ROLB 4O00A 5FHBL 2FEEI 1YDPB 4KUCF 4XP9H 1FFPA 3W0WD 5C86A 2NR6D 3GZKA 3WJLC 4OZFB 4U0QB 4BA8A 4P2QB 3AS3A 1UWGL 5DRNB 1C5BL 1CF8H 4XCNB 3MJ6A 5B39G 1TITA 1K5NA 1YZZA 3CAFA 4UINH 1MRCL 4YHIB 3UBXI 5EBMB 3LQMA 4G42B 2BY1A 2O5XH 4H20H 3WJLA 2H1PH 4WHCA 4NQDE 5K9OA 3RIFF 3EGSA 3L3KB 4ORGA 1TENA 4YDJB 3RWEB 4F8QA 2GI7A 4X8XA 2WBJC 3QEGL 4NFBA 1RUQH 3P9LA 4WTWA 1MJ8L 2ADGB 4HS8H 4K7PX 1L6XA 1B2WL 5FUCC 3WKMH 4ZTPL 1J5OH 1T89C 2ZWLT 4NM8H 5JW4M 4IBLT 1F2XK 4EEEA 3BZDA 1R3LA 3W0WB 2N7BA 4P2QE 2FYYA 5J4MA 1HWGB 1VCAA 3ZYIA 3E0GA 1I3RA 5TPWL 4U1GB 4P5TD 1RJCA 5I1JH 4YO0B 4UB0L 4X5LA 1DQDH 2VAAA 5IMKA 1JNJA 5EIVA 4MB5A 5D7KE 1FL6A 2WBJD 1ITCA 1HH6A 4XCCH 4UU9A 1FGNH 5GXBB 4R7NB 3O2WL 2UZIL 1FFPB 1SY6H 5DLMH 3O4OC 1OAQH 2P5WE 1EAJA 4Y5XA 1KLUB 1OSZA 4I0CC 1K5NB 3P73B 4KH2A 1Y6MR 1SJVA 5D72L 5TH2A 3F7QA 2Y36H 4KVNL 2JELH 5FGSA 1PZ5A 1CFBA 4C56E 5K9OB 3EGSB 4ORGB 3MXWH 4JY4B 4H8WL 2HFGL 1DP0A 3BI9X 1U2HA 2YD7A 4ZO6A 4L3CA 3P9LB 4NN6B 4QCIA 2R23A 3RUGF 1HQRA 2IBGA 1QFWI 4HDIB 3BDYH 5GSRA 4DJMA 5I17B 5IV2A 1NCAL 5TGBA 1R3LB 2FYYB 5C07A 4KHTH 2G60L 3FO2A 3VW3L 1I3RB 2NY5C 2DJ4A 4NM4H 3V6ZA 4DK6A 2VAAB 4PFEA 2EE6A 5IFJA 3B2VL 1FL6B 3ZDYE 4EXKA 1HH6B 4F7TA 2EDFA 2HKHH 1GIGL 5FDYA 4YGAB 4H0HB 1MCLA 4PUBL 5K9QG 4HWBH 1EX0A 1L0QA 3B9KA 4YHYB 2E3VA 4OTXH 1BQLL 4XPBH 4Y5XB 3HNTL 2WBWB 2YPLD 5IJKC 3BKMH 2HJLA 5HHMB 5TH2B 1B90A 3LOWA 1PZ5B 3O4OB 3DVGA 3L7EA 3QUZA 3NGBB 4JQVC 4Z95L 3QXWA 5HDQH 3O6KH 4YJZL 1RZFH 4PJAE 3U0WH 3JTTA 5IJKA 4P4KC 4L3CB 5ETUA 5HYQA 4J3XA 3AMKA 4QCIB 3SJVD 2R23B 5CUSL 3IAQA 1IGCH 4NGHH 3FQTA 1FORL 1C1EL 3MJ8B 3IXAA 3O81A 4LARH 4P4KA 1HZHH 3DXAA 5IV2B 5TGBB 3V6OE 3GM0A 1NCBH 3EYUL 4Q6IA 5C07B 2HJKA 2E6PA 2VXSH 1TZIA 3FO2B 1QFUH 1NMAH 3I50L 1VB9A 1MAML 5HHME 2YPLB 4PRPD 1KTKE 4PJDE 4ETQA 4WI4A 3IJYA 4QRTA 4Y4HD 1DQMH 3KXFA 3D0VA 4P4KD 5F6HJ 1I4FA 3P0VH 5L7XL 1N3NA 5I1KH 2DM7A 3T2NL 1TVHB 3B9KB 5K33A 3T3ME 5CLWA 4J3UA 4NCC2 3SJVB 3WDJA 3QQNA 1MHPL 3MOBL 4OI8A 3OAZK 4DKAA 3DVGB 3L7EB 3QUZB 4NQTA 5KSAA 4QHUA 1C08A 4U1NA 3ULVL 2DQIH 5C07E 1RFDL 1DBKH 4S1DC 3JTTB 3C60A 4F58L 5ETUB 5HYQB 3K81A 3FJTA 2V17H 2DDQH 5JTWA 3OL2A 3TNNA 2FX7L 3ULUF 2YWZA 1UKQA 2YA2A 3IXAB 3ZHDA 1S9KC 3NCJL 4P4KB 5I1EH 1IJ9A 3DXAB 3H3KA 3RRQA 4OCSH 3KS0J 4NBYB 3SOBH 1BQHA 5D71L 2HJKB 1EBPA 5BS0D 1ED3B 1TZIB 2X40A 1F4YH 2HVKB 2PTTB 1KCUH 4ETQB 3LV3A 3IJYB 4QRTB 1X6NA 4R97B 3D0VB 3QG7L 4NZTH 3D3VA 1C5CL 3DRTB 3MUGA 4XPHL 1I4FB 1OARL 5DJZA 1N3NB 4JE4B 4JY5H 3P77A 5ID1B 4LPYA 3U83A 2BNRD 4FOMA 2GJJA 1QR1B 3ISWA 4KGLA 5ILTH 3OHXA 2VDPH 1Y0LA 1PX3A 2Z8SA 5KSAB 3WHXA 3DXAE 4ZS7H 2P48B 1IKFL 4QHUB 3FO1B 1C08B 4U1NB 4WFFE 4OKVA 5FYLL 5I18L 1IQWL 1KXVC 5C2BH 5A2KH 5DYOA 1MCKA 3G5VB 3INUH 3SY0B 3KXFE 1KJVA 5ITBL 2DM4A 4XC1H 3PUCA 1YPZA 5CINL 1BQHB 3X14A 3PGFL 3EAKA 1Q9LA 1CT8A 3S34H 2AEQH 5CCKH 1DUZA 3FB6A 1OGTA 4FFYL 2WP3O 1L4IA 2YD2A 3D3VB 5ALBH 3WS6C 5KS9A 3GMNB 3MUGB 3FTGA 5DJZB 1BBDH 4HH8A 1WBYA 3P77B 5JOEA 1KCVL 1BQSA 1BFVH 1MFDH 2QR0A 3QIBC 4NQEA 2F53A 1A7PH 5DTFA 3OHXB 3RFZC 3WS6A 4HWBA 4JPVH 4I0PC 1Y0LB 4LSQL 2IMNA 4MB4A 4K3JL 4OKVB 1WZ1L 2R0LL 3DX9A 15C8H 5JHLL 3MLXH 3I02A 4NBXB 5HI5C 5DYOB 2R4SL 1Q0YH 3V6FA 5J6GB 1LK3L 1INDH 2IPTL 1ZS8B 3JWOL 1NBVH 1ZLUH 2NY3D 2E6QA 3QIBD 1YPZB 4IRSA 4KZEH 4QXTA 5IQ9B 4I0PD 3X14B 5DHXB 1Q9LB 2HTLC 3ARXA 3HZKA 4XAWL 3FN9A 1DUZB 3FB6B 4UTAH 5ICXA 3PNWA 1QHOA 5KS9B 3KAAA 3FTGB 2CXKA 2YSSA 3D5OF 5HI5D 4HWZB 1WBYB 1Q8MA 3TWCH 1RAMA 4JREC 2QR0B 5C0CD 3WS3A 2F53B 5FA4A 4PRDA 1UACH 2JTDA 1NDMA 2CK0H 4UNTA 5E6IA 1NCTA 2HTLD 3BGAA 3LS4L 4RAUA 3DX9B 3GKZA 5DMKA 5C2UB 3I02B 4I3SH 4HZLA 3RKDC 2I60L 4LNRB 3QPXH 1F90H 4A6YH 4OT1H 4JHBA 1T03H 3T65A 1EJOL 4AIZA 1NKRA 4GG6A 1O7VA 4IRSB 1Q9KA 4QXTB 4DKFH 1DN0A 2B4CH 5DDHA 2Z4QA 3QUML 4YE4L 4HS6A 4NQEE 1JGVL 5DSCB 1FE8H 2F53E 4X80H 3HZKB 3N50A 2BHZA 3HB3D 2J4WL 3LSOA 4PJIF 4ZAKC 5ICXB 4NWUL 4YHNA 3PNWB 5FYKL 1G9ML 1JVKA 1RJLB 2X6MA 2P7TA 3O6LL 4O9HL 2YSSB 3U4BH 4LHUG 3RKDD 1NPUA 4RFEA 3STBA 4BH8B 1AHWA 4HCRL 3C5ZA 4ZAKA 4G6AC 3WS3B 4PRDB 3N1QC 4OV6F 1AQKH 3JBG7 3HR5B 4PGDA 1KEMH 1KXTB 1NDMB 1Z3GH 3TO4C 5E6IB 4JREB 4K94H 1N4XL 4RAUB 2AW2A 1JV5A 3CXHK 4AQ1B 1V7NH 3G04A 5DMKB 4ZAKD 1ZVSB 3T0EE 1J1PH 1JN6A 5SV3A 5E4IA 4HZLB 4CVWA 2XKUA 3FQXA 4R4BA 1UENA 2L4OA 5L88L 1P7QA 1F11A 4AIZB 5HYSG 4PP2A 3VG0L 2A6IA 4G6AD 4MSWA 2YHGA 5D7IB 2FLRT 2D7MA 4GG6B 5C08A 2VDMH 5HDLA 1DN0B 5DDHB 2Z4QB 3T77A 4HS6B 2D9QB 3TO4D 3CFCH 1A3RH 3AFLA 4K8RL 4L9LC 4AYFA 3LSOB 4XMLL 2R1WA 5DUBA 3BP6A 1JL8A 3VG9C 4M3JA 4YHNB 2D2OA 3V7AE 2P7TB 1Z6JT 1CGYA 4L9LA 2X89A 5CP3H 3BRFA 1AHWB 1MFAL 3C5ZB 3PV6A 4ZAKB 1R0AL 1AXSA 5FGCE 4OD2A 4EDXA 4OF6A 4M7KH 5EBLA 1AR2A 4ZFOL 2ARWA 2YBRA 3BKJH 3MV11 4U6HA 5TE7L 4F2MA 1CXLA 1QNZH 2HFFB 1RUPL 2EZ0C 3PHOA 4KK5C 1FH5H 4JO3H 4BELD 1JV5B 2FGZA 1MQ8A 3IFNH 3CJJA 1JZ5A 1MFCL 4U49A 3G04B 4NQCE 4Q2ZA 1I9JL 5K9JL 4ALAL 1U8JA 1RSFA 1JN6B 5E00A 2C3XA 3V4UH 1UKSA 3CVHH 2EYTA 1EEUA 1XGYL 1MJUL 3K80A 4R4BB 5DURB 1ZANH 4WI5A 1RZ8A 1F11B 1KPUA 1UJ3C 1MCOL 4PP2B 1JZ8A 2A6IB 4MSWB 3FRPG 2MTPA 5DA4A 1CIUA 4QRRA 1XZ0B 5C08B 1EHLH 6FABH 1AQDA 2CJUL 3T77B 1QLFA 4R90H 3TPKA 8CGTA 1FV1A 2HT2D 2EZ0D 1KELL 2EDJA 4KK5D 1R5VA 4M4PA 2R1WB 5DUBB 3BP6B 4ZNEE 2YK1H 1LO4L 5A16A 2W07A 1HNGA 5J0BA 4YXLL 3F6LA 3NZHL 4YGVA 1F4WH 4L9LB 3R8BB 4F57H 4Z76A 3PV6B 5E9DA 1AXSB 3VG9B 4OD2B 3X3FH 4EDXB 2BK8A 3QFDA 5EBLB 2Z9TA 4OLWL 2YBRB 4F2MB 5I1IH 3PHOB 1UVQA 2XV6B 5JZ7C 4OCYH 3T4YB 3A0OA 2DLFH 1WICA 4PGZA 1U8JB 2FDBP 5E9DD 4BQ9A 5E00B 1IBGL 4PY7A 3JTSA 2DI9A 1N5YH 4QXGH 1RZ8B 1OT2A 1CU4H 3MRCA 3RHWK 2BRRL 4BQBA 2VL4A