5JP4A

Crystal structure of s. pombe dcp1 in complex with the decapping enhancer edc
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
EDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the SpEDC/Dcp1 complex
rcsb
source organism Schizosaccharomyces pombe
molecule tags Peptide binding protein
molecule keywords mRNA-decapping enzyme subunit 1
total genus 33
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5jp4A00
5J3QA 1XKEA 5D3VA 1WG7A 2D9VA 3M1IB 1W1HA 5CLQB 2DHIA 2ROZB 2DYNA 1MK9B 1UPQA 3KZ1A 5D3YA 4WSFA 1UPRA 5JP4A 1RRPB 2COFA 2DKQA 5C6RA 5KQ4A 1FB8A 1UNQA 4A6HA 1U5DA 1DDMA 1U5FA 2JP2A 2HTHB 1ISNA 1P3RA 3T06A 5KCVA 2DA0A 1X86A 1E5WA 1KZ7A 4K17A 2M14A 1DYNA 2K2JA 2H7EA 4K81A 2IYBA 2UVMA 3A98B 1I2HA 3FEHA 4H8SA 5GOWB 1WJMA 1RJ2A 3PVLA 3DXCA 4HAXB 2Q13A 1W1DA 3BINA 2L1CA 1M7RA 4F7HA 1WGQA 2UZRA 1GC6A 1OMWA 2CAYA 1SGHA 1P5TA 3SYXA 1MIXA 2N23A 3AU4A 4BBKA 5D3WA 2DYQA 1M7EA 2YS5A 2GCLA 3KRWA 1FHOA 3F0WA 3X23A 2RGNB 2ELBA 3PSCA 1ZVRA 2LOXA 2CRFA 2LOZA 3ODWA 5DI9B 2DLWA 1FHXA 2EMSA 4F7GA 2RVBB 4GZUA 1TJ6A 4ZRIA 2DX5A 1PLSA 3FM8C 1MKEA 4MT7A 4C0AA 4CYEA 4CHJA 3D8FA 1U27A 3V5WA 4K2OA 3U7DA 1AWEA 3CIKA 3PVUA 4HATB 1DBHA 2Z0OA 4NSWA 3F5RA 1KZGA 1Z87A 2NZ8B 1BTNA 3P6AA 3N7CA 2YVCA 4YONA 1X1FA 5LOPB 2YS3A 3CXBB 5JLJB 2YT1A 2J0JA 5FI1A 2H7DA 5FI0A 2Z0PA 3FSSA 2KCJA 5C5BA 1FHWA 4TKNA 1QQGA 4IOYX 4DX90 5DHFB 5HE3A 2GCJA 3VOQA 2M38A 1NTYA 2R0DA 4HAZB 3G9WA 3ULCA 2K00A 2V76A 4IAPA 2P0DA 3O96A 4DXAB 1WJ1A 1XR0B 4KHBB 3PZDA 1AQCA 4A6FB 1UEFA 1FOEA 2I1JA 3ZDTA 2EMTA 1DDVA 1NU2A 1XX0A 2D9YA 1TQZA 2N0YA 3KY9A 3ML4A 3HQCA 2YRYA 3ULBA 2QKLA 2FJLA 2D10A 4Z2NA 1KI1B 2YF0A 4PNKA 2P0HA 4KAXB 2CY4A 2RSGA 3A8PA 3QWMA 4ZRJA 1OQNA 1K5GB 1OY2A 1ZC4B 1FAOA 2XQNM 3KRXA 2GJYA 3MDBC 3TFMA 3ZVRA 1ZC3B 4F7UP 4KHAA 3PVWA 2DKPA 2J0MA 1FGZA 1XD4A 4HDQA 3TVVA 1LW3A 3TCAA 4P7IA 2DN6A 4GMXB 1V88A 2DX1A 5D3XA 4Z2MB 1U2BA 5JHHA 2DTCA 2RUKB 1GC7A 2HE7A 5C16A 1BTKA 3OANA 2MFQA 2PZ1A 2YSZA 3NSUA 2Y8FA 2J59M 4D0NB 1FGYA 5C5BB 3ODOA 2EJ8A 3WYFB 4DX8A 3RCPA 3QIJA 1UNPA 2LULA 4HAUB 4NY0A 4MK0A 4KHOA 2ADZA 1W1GA 1J19A 5J3TA 3SO6A 2GS0A 1MK7B 1UNRA 4Y94A 3ODXA 3KSYA 1EVHA 2AL6A 2MWNB 2D4QA 1H4RA 1I7AA 2Y7BA 5C79A 4HAWB 5J3YA 1GG3A 4HB3B 3DXEA 4MY6A 3HK0A 2E2XA 2W2XD 3PEGA 5CLLB 2DFKA 2LG1A 1J0WA 2DHJA 3SV1A 2MDXA 4A5KA 4K2PA 5DIFB 4YL8A 3DXDA 2YT0A 3IVFA 4HDOA 4L6EA 4CHMA 4WVFB 1X11A 2QKMA 2BCJA 1U5EA 1WI1A 2W2WA 3TW1A 5D27A 4GN1A 1DROA 1LB1A 1X1GA 1BAKA 1Y19B 2I5CA 3D8DA 4IFSA 4WJ7A 2D11A 4KVGB 4EMOA 1V89A 4A6KA 2I1KA 2IFSA 1B55A 5HE1A 1DDWA 4GMVA 1WGUA 2YS1A 1EAZA 4GXBA 4XWXA 3PP2A 2K2UA 1EF1A 3TO1A 1BWNA 2OTXA 2NMBA 3D8EA 5DHAB 1PFJA 4HAVB 1SHCA 3P7ZA 2D9WA 3AU5A 3WA0A 2LYDA 5L81A 4DBBA 1XCGA 3AJ4A 2UZSA 5JHGA 4HB4B 1K5DB 4EKUA 2J0KA 2KGXB 3GYPA 2RNRB 5EFXA 4HHVA 2Z0QA 2COAA 2COCA 1V5PA 2ZPYA 2LKOA 3MPXA 1V5MA 2EC1A 2CODA 1IRSA 1XODA 3HW2B 2DHKA 2W2XC 2L2IA 2P0FA 4B6HA 3U8ZA 2D9ZA 1MAIA 1MPHA 4EJNA 1U29A 3A8QA 2G35A 4A6FA 1ZM0A 2CY5A 1TXDA 5HE2A 2ELAA 2I5FA 4TYZA 1N3HA 2KUPA 2R09A 2X18A 5HE0A 1EGXA 3UZTA 1P6SA 2OQBA 1V5UA 2AEHA 1H10A 2VSZA 4HAYB 2P8VA 3PG7A 1PMSA 1Y5OA 2MKRA 4HB0B 2VKIA 1X05A 3SUZA 3LJUX 1NTVA 4GPTB 1U5GA 2D9XA 4PQ0A 1WVHA 2D2QA 1QC6A 5DH9B 3QBVB 3SNHA 5LONB 5KQ1A 1V61A 3VIAA 1Q67A 2Y8GA 1NI2A 4HB2B 1MIZB 1ZSQA 3BJIA 3GYOA 2RLOA 2VRWB 2ROVA 4ZRKA
chains in the Genus database with same CATH superfamily
5J3QA 1XKEA 5D3VA 1WG7A 2D9VA 3M1IB 1W1HA 5CLQB 2DHIA 2ROZB 2DYNA 2KR0A 1MK9B 1UPQA 3KZ1A 5D3YA 3HIEA 4WSFA 1UPRA 5JP4A 1RRPB 2COFA 2DKQA 5C6RA 5KQ4A 1FB8A 1UNQA 4A6HA 1U5DA 1DDMA 1U5FA 2JP2A 2HTHB 1ISNA 1P3RA 3T06A 4QXAB 3NWAA 2DA0A 5KCVA 1X86A 1E5WA 1KZ7A 4K17A 2M14A 1DYNA 2K2JA 2H7EA 1T77A 4K81A 4OT1A 2IYBA 2UVMA 3A98B 1I2HA 3FEHA 4H8SA 5GOWB 1WJMA 1RJ2A 3PVLA 3DXCA 4HAXB 2Q13A 2ZKMX 1W1DA 3BINA 2L1CA 1M7RA 4F7HA 1WGQA 3HSAA 2UZRA 1GC6A 1OMWA 2CAYA 1SGHA 1P5TA 3SYXA 1MIXA 2N23A 3AU4A 4BBKA 5D3WA 2DYQA 1M7EA 2YS5A 2GCLA 3KRWA 1FHOA 3F0WA 3X23A 2RGNB 2ELBA 3PSCA 1ZVRA 2LOXA 2RRFA 2CRFA 2LOZA 3ODWA 2KUQA 5DI9B 2DLWA 1FHXA 2EMSA 4F7GA 2RVBB 3NWFA 4GZUA 5I2SA 3U12A 2K49A 1TJ6A 4ZRIA 2DX5A 1PLSA 2NBVA 3FM8C 1MKEA 4MT7A 4C0AA 4CYEA 4CHJA 3D8FA 1U27A 3NWDA 3V5WA 4K2OA 3U7DA 3B77A 3OHMB 1AWEA 3CIKA 3PVUA 4HATB 1DBHA 2KIGA 2Z0OA 4NSWA 2FJUB 3F5RA 1KZGA 1Z87A 2NZ8B 1BTNA 3P6AA 3N7CA 2YVCA 4YONA 1X1FA 5LOPB 2YS3A 3CXBB 5JLJB 2YT1A 2J0JA 5FI1A 2H7DA 5FI0A 2Z0PA 3FSSA 2KCJA 5M4YB 5C5BA 1FHWA 4TKNA 1QQGA 4IOYX 4DX90 5DHFB 5HE3A 2GCJA 3VOQA 2M38A 1NTYA 2R0DA 4HAZB 3G9WA 3ULCA 2K00A 2V76A 4IAPA 2P0DA 3O96A 3A58A 4DXAB 1WJ1A 1XR0B 4KHBB 3PZDA 1AQCA 4A6FB 1UEFA 1FOEA 2I1JA 3ZDTA 2EMTA 1DDVA 1NU2A 1XX0A 2D9YA 1TQZA 2N0YA 3KY9A 4D6WA 3ML4A 3HQCA 2YRYA 2Z59A 3ULBA 2QKLA 2FJLA 2D10A 4Z2NA 1KI1B 2YF0A 4PNKA 2P0HA 2CY4A 2RSGA 4KAXB 3A8PA 3QWMA 4ZRJA 1OQNA 1K5GB 1OY2A 1ZC4B 1FAOA 2XQNM 3KRXA 2GJYA 3MDBC 3TFMA 3ZVRA 1ZC3B 4F7UP 4KHAA 3PVWA 2DKPA 2J0MA 1FGZA 1XD4A 4HDQA 2YT2A 3TVVA 1LW3A 3TCAA 4P7IA 4CSQA 2DN6A 4GMXB 1V88A 2DX1A 5D3XA 4Z2MB 1U2BA 2KIEA 2DTCA 2RUKB 5JHHA 1GC7A 2HE7A 5C16A 1BTKA 3OANA 2MFQA 2PZ1A 2YSZA 3NSUA 2Y8FA 4OSNA 2J59M 4D0NB 1FGYA 5C5BB 3ODOA 2EJ8A 4DIXA 3WYFB 4DX8A 3RCPA 3QIJA 1UNPA 2LULA 4HAUB 4NY0A 4MK0A 4KHOA 2ADZA 1W1GA 1J19A 5J3TA 3SO6A 2GS0A 1MK7B 1UNRA 4Y94A 3ODXA 3KSYA 1EVHA 2AL6A 2MWNB 2D4QA 5IRSA 1H4RA 1I7AA 2Y7BA 5C79A 3NW8A 4HAWB 5J3YA 1GG3A 4HB3B 3DXEA 4MY6A 3HK0A 2E2XA 2W2XD 3PEGA 5CLLB 2DFKA 2LG1A 1J0WA 2DHJA 3SV1A 2MDXA 4A5KA 4K2PA 5DIFB 4GOUA 2R2YA 4YL8A 3DXDA 2YT0A 3FVCA 3IVFA 4HDOA 4L6EA 4CHMA 4WVFB 1X11A 2QKMA 2BCJA 1U5EA 4GNKB 4L1RA 1WI1A 2W2WA 3TW1A 5D27A 4GN1A 1DROA 1LB1A 1X1GA 1BAKA 1Y19B 2I5CA 3D8DA 4IFSA 4WJ7A 2D11A 4KVGB 4EMOA 1V89A 4A6KA 2I1KA 2IFSA 1B55A 5HE1A 1DDWA 4GMVA 1WGUA 2YS1A 1EAZA 4GXBA 4XWXA 3PP2A 2Z14A 2K2UA 1EF1A 3TO1A 1BWNA 2OTXA 2NMBA 3D8EA 5DHAB 1PFJA 4HAVB 1SHCA 3P7ZA 2D9WA 3AU5A 4QJ5B 3WA0A 2LYDA 5L81A 4DBBA 1XCGA 3AJ4A 2UZSA 5JHGA 4HB4B 1K5DB 4EKUA 2K8EA 2J0KA 2KGXB 3GYPA 2RNRB 5EFXA 4HHVA 2Z0QA 2COAA 2COCA 1V5PA 2ZPYA 2LKOA 3MPXA 1V5MA 2EC1A 2CODA 1IRSA 1XODA 3HW2B 2DHKA 2W2XC 2L2IA 2Z13A 2P0FA 4B6HA 3U8ZA 2D9ZA 1MAIA 1MPHA 4EJNA 1U29A 3A8QA 2G35A 4A6FA 1ZM0A 2CY5A 1TXDA 5HE2A 2ELAA 2I5FA 4TYZA 1N3HA 2KUPA 2R09A 2X18A 5HE0A 1EGXA 3UZTA 1P6SA 2OQBA 2Z4DA 1V5UA 2AEHA 4QJ4B 1H10A 2VSZA 4HAYB 2P8VA 3DCXA 3PG7A 1PMSA 1Y5OA 2GUMA 2MKRA 4HB0B 2VKIA 1X05A 3SUZA 3LJUX 1NTVA 4GPTB 1U5GA 2D9XA 4PQ0A 5I2MA 1WVHA 2D2QA 1QC6A 5DH9B 3QBVB 3SNHA 5LONB 4KHBA 5KQ1A 1V61A 4QJ3B 3VIAA 1Q67A 2Y8GA 1NI2A 4HB2B 1MIZB 5LG4B 1ZSQA 3BJIA 4HSIA 3GYOA 2RLOA 2VRWB 2ROVA 4ZRKA 1ZYIA 1MI1A
chains in the Genus database with same CATH topology
5J3QA 1XKEA 5D3VA 1WG7A 2D9VA 3M1IB 1W1HA 5CLQB 2DHIA 2ROZB 2DYNA 1MK9B 1UPQA 3KZ1A 5D3YA 4WSFA 1UPRA 5JP4A 1RRPB 2COFA 2DKQA 5C6RA 5KQ4A 1FB8A 1UNQA 4A6HA 1U5DA 1DDMA 1U5FA 2JP2A 2HTHB 1ISNA 1P3RA 3T06A 5KCVA 2DA0A 1X86A 1E5WA 1KZ7A 4K17A 2M14A 1DYNA 2K2JA 2H7EA 4K81A 2IYBA 2UVMA 3A98B 1I2HA 3FEHA 4H8SA 5GOWB 1WJMA 1RJ2A 3PVLA 3DXCA 4HAXB 2Q13A 1W1DA 3BINA 2L1CA 1M7RA 4F7HA 1WGQA 2UZRA 1GC6A 1OMWA 2CAYA 1SGHA 1P5TA 3SYXA 1MIXA 2N23A 3AU4A 4BBKA 5D3WA 2DYQA 1M7EA 2YS5A 2GCLA 3KRWA 1FHOA 3F0WA 3X23A 2RGNB 2ELBA 3PSCA 1ZVRA 2LOXA 2CRFA 2LOZA 3ODWA 5DI9B 2DLWA 1FHXA 2EMSA 4F7GA 2RVBB 4GZUA 1TJ6A 4ZRIA 2DX5A 1PLSA 3FM8C 1MKEA 4MT7A 4C0AA 4CYEA 4CHJA 3D8FA 1U27A 3V5WA 4K2OA 3U7DA 1AWEA 3CIKA 3PVUA 4HATB 1DBHA 2Z0OA 4NSWA 3F5RA 1KZGA 1Z87A 2NZ8B 1BTNA 3P6AA 3N7CA 2YVCA 4YONA 1X1FA 5LOPB 2YS3A 3CXBB 5JLJB 2YT1A 2J0JA 5FI1A 2H7DA 5FI0A 2Z0PA 3FSSA 2KCJA 5C5BA 1FHWA 4TKNA 1QQGA 4IOYX 4DX90 5DHFB 5HE3A 2GCJA 3VOQA 2M38A 1NTYA 2R0DA 4HAZB 3G9WA 3ULCA 2K00A 2V76A 4IAPA 2P0DA 3O96A 4DXAB 1WJ1A 1XR0B 4KHBB 3PZDA 1AQCA 4A6FB 1UEFA 1FOEA 2I1JA 3ZDTA 2EMTA 1DDVA 1NU2A 1XX0A 2D9YA 1TQZA 2N0YA 3KY9A 3ML4A 3HQCA 2YRYA 3ULBA 2QKLA 2FJLA 2D10A 4Z2NA 1KI1B 2YF0A 4PNKA 2P0HA 4KAXB 2CY4A 2RSGA 3A8PA 3QWMA 4ZRJA 1OQNA 1K5GB 1OY2A 1ZC4B 1FAOA 2XQNM 3KRXA 2GJYA 3MDBC 3TFMA 3ZVRA 1ZC3B 4F7UP 4KHAA 3PVWA 2DKPA 2J0MA 1FGZA 1XD4A 4HDQA 3TVVA 1LW3A 3TCAA 4P7IA 2DN6A 4GMXB 1V88A 2DX1A 5D3XA 4Z2MB 1U2BA 5JHHA 2DTCA 2RUKB 1GC7A 2HE7A 5C16A 1BTKA 3OANA 2MFQA 2PZ1A 2YSZA 3NSUA 2Y8FA 2J59M 4D0NB 1FGYA 5C5BB 3ODOA 2EJ8A 3WYFB 4DX8A 3RCPA 3QIJA 1UNPA 2LULA 4HAUB 4NY0A 4MK0A 4KHOA 2ADZA 1W1GA 1J19A 5J3TA 3SO6A 2GS0A 1MK7B 1UNRA 4Y94A 3ODXA 3KSYA 1EVHA 2AL6A 2MWNB 2D4QA 1H4RA 1I7AA 2Y7BA 5C79A 4HAWB 5J3YA 1GG3A 4HB3B 3DXEA 4MY6A 3HK0A 2E2XA 2W2XD 3PEGA 5CLLB 2DFKA 2LG1A 1J0WA 2DHJA 3SV1A 2MDXA 4A5KA 4K2PA 5DIFB 4YL8A 3DXDA 2YT0A 3IVFA 4HDOA 4L6EA 4CHMA 4WVFB 1X11A 2QKMA 2BCJA 1U5EA 1WI1A 2W2WA 3TW1A 5D27A 4GN1A 1DROA 1LB1A 1X1GA 1BAKA 1Y19B 2I5CA 3D8DA 4IFSA 4WJ7A 2D11A 4KVGB 4EMOA 1V89A 4A6KA 2I1KA 2IFSA 1B55A 5HE1A 1DDWA 4GMVA 1WGUA 2YS1A 1EAZA 4GXBA 4XWXA 3PP2A 2K2UA 1EF1A 3TO1A 1BWNA 2OTXA 2NMBA 3D8EA 5DHAB 1PFJA 4HAVB 1SHCA 3P7ZA 2D9WA 3AU5A 3WA0A 2LYDA 5L81A 4DBBA 1XCGA 3AJ4A 2UZSA 5JHGA 4HB4B 1K5DB 4EKUA 2J0KA 2KGXB 3GYPA 2RNRB 5EFXA 4HHVA 2Z0QA 2COAA 2COCA 1V5PA 2ZPYA 2LKOA 3MPXA 1V5MA 2EC1A 2CODA 1IRSA 1XODA 3HW2B 2DHKA 2W2XC 2L2IA 2P0FA 4B6HA 3U8ZA 2D9ZA 1MAIA 1MPHA 4EJNA 1U29A 3A8QA 2G35A 4A6FA 1ZM0A 2CY5A 1TXDA 5HE2A 2ELAA 2I5FA 4TYZA 1N3HA 2KUPA 2R09A 2X18A 5HE0A 1EGXA 3UZTA 1P6SA 2OQBA 1V5UA 2AEHA 1H10A 2VSZA 4HAYB 2P8VA 3PG7A 1PMSA 1Y5OA 2MKRA 4HB0B 2VKIA 1X05A 3SUZA 3LJUX 1NTVA 4GPTB 1U5GA 2D9XA 4PQ0A 1WVHA 2D2QA 1QC6A 5DH9B 3QBVB 3SNHA 5LONB 5KQ1A 1V61A 3VIAA 1Q67A 2Y8GA 1NI2A 4HB2B 1MIZB 1ZSQA 3BJIA 3GYOA 2RLOA 2VRWB 2ROVA 4ZRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3Q A;  1XKE A;  5D3V A;  1WG7 A;  2D9V A;  3M1I B;  1W1H A;  5CLQ B;  2DHI A;  2ROZ B;  2DYN A;  1MK9 B;  1UPQ A;  3KZ1 A;  5D3Y A;  4WSF A;  1UPR A;  5JP4 A;  1RRP B;  2COF A;  2DKQ A;  5C6R A;  5KQ4 A;  1FB8 A;  1UNQ A;  4A6H A;  1U5D A;  1DDM A;  1U5F A;  2JP2 A;  2HTH B;  1ISN A;  1P3R A;  3T06 A;  5KCV A;  2DA0 A;  1X86 A;  1E5W A;  1KZ7 A;  4K17 A;  2M14 A;  1DYN A;  2K2J A;  2H7E A;  4K81 A;  2IYB A;  2UVM A;  3A98 B;  1I2H A;  3FEH A;  4H8S A;  5GOW B;  1WJM A;  1RJ2 A;  3PVL A;  3DXC A;  4HAX B;  2Q13 A;  1W1D A;  3BIN A;  2L1C A;  1M7R A;  4F7H A;  1WGQ A;  2UZR A;  1GC6 A;  1OMW A;  2CAY A;  1SGH A;  1P5T A;  3SYX A;  1MIX A;  2N23 A;  3AU4 A;  4BBK A;  5D3W A;  2DYQ A;  1M7E A;  2YS5 A;  2GCL A;  3KRW A;  1FHO A;  3F0W A;  3X23 A;  2RGN B;  2ELB A;  3PSC A;  1ZVR A;  2LOX A;  2CRF A;  2LOZ A;  3ODW A;  5DI9 B;  2DLW A;  1FHX A;  2EMS A;  4F7G A;  2RVB B;  4GZU A;  1TJ6 A;  4ZRI A;  2DX5 A;  1PLS A;  3FM8 C;  1MKE A;  4MT7 A;  4C0A A;  4CYE A;  4CHJ A;  3D8F A;  1U27 A;  3V5W A;  4K2O A;  3U7D A;  1AWE A;  3CIK A;  3PVU A;  4HAT B;  1DBH A;  2Z0O A;  4NSW A;  3F5R A;  1KZG A;  1Z87 A;  2NZ8 B;  1BTN A;  3P6A A;  3N7C A;  2YVC A;  4YON A;  1X1F A;  5LOP B;  2YS3 A;  3CXB B;  5JLJ B;  2YT1 A;  2J0J A;  5FI1 A;  2H7D A;  5FI0 A;  2Z0P A;  3FSS A;  2KCJ A;  5C5B A;  1FHW A;  4TKN A;  1QQG A;  4IOY X;  4DX9 0;  5DHF B;  5HE3 A;  2GCJ A;  3VOQ A;  2M38 A;  1NTY A;  2R0D A;  4HAZ B;  3G9W A;  3ULC A;  2K00 A;  2V76 A;  4IAP A;  2P0D A;  3O96 A;  4DXA B;  1WJ1 A;  1XR0 B;  4KHB B;  3PZD A;  1AQC A;  4A6F B;  1UEF A;  1FOE A;  2I1J A;  3ZDT A;  2EMT A;  1DDV A;  1NU2 A;  1XX0 A;  2D9Y A;  1TQZ A;  2N0Y A;  3KY9 A;  3ML4 A;  3HQC A;  2YRY A;  3ULB A;  2QKL A;  2FJL A;  2D10 A;  4Z2N A;  1KI1 B;  2YF0 A;  4PNK A;  2P0H A;  4KAX B;  2CY4 A;  2RSG A;  3A8P A;  3QWM A;  4ZRJ A;  1OQN A;  1K5G B;  1OY2 A;  1ZC4 B;  1FAO A;  2XQN M;  3KRX A;  2GJY A;  3MDB C;  3TFM A;  3ZVR A;  1ZC3 B;  4F7U P;  4KHA A;  3PVW A;  2DKP A;  2J0M A;  1FGZ A;  1XD4 A;  4HDQ A;  3TVV A;  1LW3 A;  3TCA A;  4P7I A;  2DN6 A;  4GMX B;  1V88 A;  2DX1 A;  5D3X A;  4Z2M B;  1U2B A;  5JHH A;  2DTC A;  2RUK B;  1GC7 A;  2HE7 A;  5C16 A;  1BTK A;  3OAN A;  2MFQ A;  2PZ1 A;  2YSZ A;  3NSU A;  2Y8F A;  2J59 M;  4D0N B;  1FGY A;  5C5B B;  3ODO A;  2EJ8 A;  3WYF B;  4DX8 A;  3RCP A;  3QIJ A;  1UNP A;  2LUL A;  4HAU B;  4NY0 A;  4MK0 A;  4KHO A;  2ADZ A;  1W1G A;  1J19 A;  5J3T A;  3SO6 A;  2GS0 A;  1MK7 B;  1UNR A;  4Y94 A;  3ODX A;  3KSY A;  1EVH A;  2AL6 A;  2MWN B;  2D4Q A;  1H4R A;  1I7A A;  2Y7B A;  5C79 A;  4HAW B;  5J3Y A;  1GG3 A;  4HB3 B;  3DXE A;  4MY6 A;  3HK0 A;  2E2X A;  2W2X D;  3PEG A;  5CLL B;  2DFK A;  2LG1 A;  1J0W A;  2DHJ A;  3SV1 A;  2MDX A;  4A5K A;  4K2P A;  5DIF B;  4YL8 A;  3DXD A;  2YT0 A;  3IVF A;  4HDO A;  4L6E A;  4CHM A;  4WVF B;  1X11 A;  2QKM A;  2BCJ A;  1U5E A;  1WI1 A;  2W2W A;  3TW1 A;  5D27 A;  4GN1 A;  1DRO A;  1LB1 A;  1X1G A;  1BAK A;  1Y19 B;  2I5C A;  3D8D A;  4IFS A;  4WJ7 A;  2D11 A;  4KVG B;  4EMO A;  1V89 A;  4A6K A;  2I1K A;  2IFS A;  1B55 A;  5HE1 A;  1DDW A;  4GMV A;  1WGU A;  2YS1 A;  1EAZ A;  4GXB A;  4XWX A;  3PP2 A;  2K2U A;  1EF1 A;  3TO1 A;  1BWN A;  2OTX A;  2NMB A;  3D8E A;  5DHA B;  1PFJ A;  4HAV B;  1SHC A;  3P7Z A;  2D9W A;  3AU5 A;  3WA0 A;  2LYD A;  5L81 A;  4DBB A;  1XCG A;  3AJ4 A;  2UZS A;  5JHG A;  4HB4 B;  1K5D B;  4EKU A;  2J0K A;  2KGX B;  3GYP A;  2RNR B;  5EFX A;  4HHV A;  2Z0Q A;  2COA A;  2COC A;  1V5P A;  2ZPY A;  2LKO A;  3MPX A;  1V5M A;  2EC1 A;  2COD A;  1IRS A;  1XOD A;  3HW2 B;  2DHK A;  2W2X C;  2L2I A;  2P0F A;  4B6H A;  3U8Z A;  2D9Z A;  1MAI A;  1MPH A;  4EJN A;  1U29 A;  3A8Q A;  2G35 A;  4A6F A;  1ZM0 A;  2CY5 A;  1TXD A;  5HE2 A;  2ELA A;  2I5F A;  4TYZ A;  1N3H A;  2KUP A;  2R09 A;  2X18 A;  5HE0 A;  1EGX A;  3UZT A;  1P6S A;  2OQB A;  1V5U A;  2AEH A;  1H10 A;  2VSZ A;  4HAY B;  2P8V A;  3PG7 A;  1PMS A;  1Y5O A;  2MKR A;  4HB0 B;  2VKI A;  1X05 A;  3SUZ A;  3LJU X;  1NTV A;  4GPT B;  1U5G A;  2D9X A;  4PQ0 A;  1WVH A;  2D2Q A;  1QC6 A;  5DH9 B;  3QBV B;  3SNH A;  5LON B;  5KQ1 A;  1V61 A;  3VIA A;  1Q67 A;  2Y8G A;  1NI2 A;  4HB2 B;  1MIZ B;  1ZSQ A;  3BJI A;  3GYO A;  2RLO A;  2VRW B;  2ROV A;  4ZRK A; 
#chains in the Genus database with same CATH topology
 5J3Q A;  1XKE A;  5D3V A;  1WG7 A;  2D9V A;  3M1I B;  1W1H A;  5CLQ B;  2DHI A;  2ROZ B;  2DYN A;  2KR0 A;  1MK9 B;  1UPQ A;  3KZ1 A;  5D3Y A;  3HIE A;  4WSF A;  1UPR A;  5JP4 A;  1RRP B;  2COF A;  2DKQ A;  5C6R A;  5KQ4 A;  1FB8 A;  1UNQ A;  4A6H A;  1U5D A;  1DDM A;  1U5F A;  2JP2 A;  2HTH B;  1ISN A;  1P3R A;  3T06 A;  4QXA B;  3NWA A;  2DA0 A;  5KCV A;  1X86 A;  1E5W A;  1KZ7 A;  4K17 A;  2M14 A;  1DYN A;  2K2J A;  2H7E A;  1T77 A;  4K81 A;  4OT1 A;  2IYB A;  2UVM A;  3A98 B;  1I2H A;  3FEH A;  4H8S A;  5GOW B;  1WJM A;  1RJ2 A;  3PVL A;  3DXC A;  4HAX B;  2Q13 A;  2ZKM X;  1W1D A;  3BIN A;  2L1C A;  1M7R A;  4F7H A;  1WGQ A;  3HSA A;  2UZR A;  1GC6 A;  1OMW A;  2CAY A;  1SGH A;  1P5T A;  3SYX A;  1MIX A;  2N23 A;  3AU4 A;  4BBK A;  5D3W A;  2DYQ A;  1M7E A;  2YS5 A;  2GCL A;  3KRW A;  1FHO A;  3F0W A;  3X23 A;  2RGN B;  2ELB A;  3PSC A;  1ZVR A;  2LOX A;  2RRF A;  2CRF A;  2LOZ A;  3ODW A;  2KUQ A;  5DI9 B;  2DLW A;  1FHX A;  2EMS A;  4F7G A;  2RVB B;  3NWF A;  4GZU A;  5I2S A;  3U12 A;  2K49 A;  1TJ6 A;  4ZRI A;  2DX5 A;  1PLS A;  2NBV A;  3FM8 C;  1MKE A;  4MT7 A;  4C0A A;  4CYE A;  4CHJ A;  3D8F A;  1U27 A;  3NWD A;  3V5W A;  4K2O A;  3U7D A;  3B77 A;  3OHM B;  1AWE A;  3CIK A;  3PVU A;  4HAT B;  1DBH A;  2KIG A;  2Z0O A;  4NSW A;  2FJU B;  3F5R A;  1KZG A;  1Z87 A;  2NZ8 B;  1BTN A;  3P6A A;  3N7C A;  2YVC A;  4YON A;  1X1F A;  5LOP B;  2YS3 A;  3CXB B;  5JLJ B;  2YT1 A;  2J0J A;  5FI1 A;  2H7D A;  5FI0 A;  2Z0P A;  3FSS A;  2KCJ A;  5M4Y B;  5C5B A;  1FHW A;  4TKN A;  1QQG A;  4IOY X;  4DX9 0;  5DHF B;  5HE3 A;  2GCJ A;  3VOQ A;  2M38 A;  1NTY A;  2R0D A;  4HAZ B;  3G9W A;  3ULC A;  2K00 A;  2V76 A;  4IAP A;  2P0D A;  3O96 A;  3A58 A;  4DXA B;  1WJ1 A;  1XR0 B;  4KHB B;  3PZD A;  1AQC A;  4A6F B;  1UEF A;  1FOE A;  2I1J A;  3ZDT A;  2EMT A;  1DDV A;  1NU2 A;  1XX0 A;  2D9Y A;  1TQZ A;  2N0Y A;  3KY9 A;  4D6W A;  3ML4 A;  3HQC A;  2YRY A;  2Z59 A;  3ULB A;  2QKL A;  2FJL A;  2D10 A;  4Z2N A;  1KI1 B;  2YF0 A;  4PNK A;  2P0H A;  2CY4 A;  2RSG A;  4KAX B;  3A8P A;  3QWM A;  4ZRJ A;  1OQN A;  1K5G B;  1OY2 A;  1ZC4 B;  1FAO A;  2XQN M;  3KRX A;  2GJY A;  3MDB C;  3TFM A;  3ZVR A;  1ZC3 B;  4F7U P;  4KHA A;  3PVW A;  2DKP A;  2J0M A;  1FGZ A;  1XD4 A;  4HDQ A;  2YT2 A;  3TVV A;  1LW3 A;  3TCA A;  4P7I A;  4CSQ A;  2DN6 A;  4GMX B;  1V88 A;  2DX1 A;  5D3X A;  4Z2M B;  1U2B A;  2KIE A;  2DTC A;  2RUK B;  5JHH A;  1GC7 A;  2HE7 A;  5C16 A;  1BTK A;  3OAN A;  2MFQ A;  2PZ1 A;  2YSZ A;  3NSU A;  2Y8F A;  4OSN A;  2J59 M;  4D0N B;  1FGY A;  5C5B B;  3ODO A;  2EJ8 A;  4DIX A;  3WYF B;  4DX8 A;  3RCP A;  3QIJ A;  1UNP A;  2LUL A;  4HAU B;  4NY0 A;  4MK0 A;  4KHO A;  2ADZ A;  1W1G A;  1J19 A;  5J3T A;  3SO6 A;  2GS0 A;  1MK7 B;  1UNR A;  4Y94 A;  3ODX A;  3KSY A;  1EVH A;  2AL6 A;  2MWN B;  2D4Q A;  5IRS A;  1H4R A;  1I7A A;  2Y7B A;  5C79 A;  3NW8 A;  4HAW B;  5J3Y A;  1GG3 A;  4HB3 B;  3DXE A;  4MY6 A;  3HK0 A;  2E2X A;  2W2X D;  3PEG A;  5CLL B;  2DFK A;  2LG1 A;  1J0W A;  2DHJ A;  3SV1 A;  2MDX A;  4A5K A;  4K2P A;  5DIF B;  4GOU A;  2R2Y A;  4YL8 A;  3DXD A;  2YT0 A;  3FVC A;  3IVF A;  4HDO A;  4L6E A;  4CHM A;  4WVF B;  1X11 A;  2QKM A;  2BCJ A;  1U5E A;  4GNK B;  4L1R A;  1WI1 A;  2W2W A;  3TW1 A;  5D27 A;  4GN1 A;  1DRO A;  1LB1 A;  1X1G A;  1BAK A;  1Y19 B;  2I5C A;  3D8D A;  4IFS A;  4WJ7 A;  2D11 A;  4KVG B;  4EMO A;  1V89 A;  4A6K A;  2I1K A;  2IFS A;  1B55 A;  5HE1 A;  1DDW A;  4GMV A;  1WGU A;  2YS1 A;  1EAZ A;  4GXB A;  4XWX A;  3PP2 A;  2Z14 A;  2K2U A;  1EF1 A;  3TO1 A;  1BWN A;  2OTX A;  2NMB A;  3D8E A;  5DHA B;  1PFJ A;  4HAV B;  1SHC A;  3P7Z A;  2D9W A;  3AU5 A;  4QJ5 B;  3WA0 A;  2LYD A;  5L81 A;  4DBB A;  1XCG A;  3AJ4 A;  2UZS A;  5JHG A;  4HB4 B;  1K5D B;  4EKU A;  2K8E A;  2J0K A;  2KGX B;  3GYP A;  2RNR B;  5EFX A;  4HHV A;  2Z0Q A;  2COA A;  2COC A;  1V5P A;  2ZPY A;  2LKO A;  3MPX A;  1V5M A;  2EC1 A;  2COD A;  1IRS A;  1XOD A;  3HW2 B;  2DHK A;  2W2X C;  2L2I A;  2Z13 A;  2P0F A;  4B6H A;  3U8Z A;  2D9Z A;  1MAI A;  1MPH A;  4EJN A;  1U29 A;  3A8Q A;  2G35 A;  4A6F A;  1ZM0 A;  2CY5 A;  1TXD A;  5HE2 A;  2ELA A;  2I5F A;  4TYZ A;  1N3H A;  2KUP A;  2R09 A;  2X18 A;  5HE0 A;  1EGX A;  3UZT A;  1P6S A;  2OQB A;  2Z4D A;  1V5U A;  2AEH A;  4QJ4 B;  1H10 A;  2VSZ A;  4HAY B;  2P8V A;  3DCX A;  3PG7 A;  1PMS A;  1Y5O A;  2GUM A;  2MKR A;  4HB0 B;  2VKI A;  1X05 A;  3SUZ A;  3LJU X;  1NTV A;  4GPT B;  1U5G A;  2D9X A;  4PQ0 A;  5I2M A;  1WVH A;  2D2Q A;  1QC6 A;  5DH9 B;  3QBV B;  3SNH A;  5LON B;  4KHB A;  5KQ1 A;  1V61 A;  4QJ3 B;  3VIA A;  1Q67 A;  2Y8G A;  1NI2 A;  4HB2 B;  1MIZ B;  5LG4 B;  1ZSQ A;  3BJI A;  4HSI A;  3GYO A;  2RLO A;  2VRW B;  2ROV A;  4ZRK A;  1ZYI A;  1MI1 A; 
#chains in the Genus database with same CATH homology
 5J3Q A;  1XKE A;  5D3V A;  1WG7 A;  2D9V A;  3M1I B;  1W1H A;  5CLQ B;  2DHI A;  2ROZ B;  2DYN A;  1MK9 B;  1UPQ A;  3KZ1 A;  5D3Y A;  4WSF A;  1UPR A;  5JP4 A;  1RRP B;  2COF A;  2DKQ A;  5C6R A;  5KQ4 A;  1FB8 A;  1UNQ A;  4A6H A;  1U5D A;  1DDM A;  1U5F A;  2JP2 A;  2HTH B;  1ISN A;  1P3R A;  3T06 A;  5KCV A;  2DA0 A;  1X86 A;  1E5W A;  1KZ7 A;  4K17 A;  2M14 A;  1DYN A;  2K2J A;  2H7E A;  4K81 A;  2IYB A;  2UVM A;  3A98 B;  1I2H A;  3FEH A;  4H8S A;  5GOW B;  1WJM A;  1RJ2 A;  3PVL A;  3DXC A;  4HAX B;  2Q13 A;  1W1D A;  3BIN A;  2L1C A;  1M7R A;  4F7H A;  1WGQ A;  2UZR A;  1GC6 A;  1OMW A;  2CAY A;  1SGH A;  1P5T A;  3SYX A;  1MIX A;  2N23 A;  3AU4 A;  4BBK A;  5D3W A;  2DYQ A;  1M7E A;  2YS5 A;  2GCL A;  3KRW A;  1FHO A;  3F0W A;  3X23 A;  2RGN B;  2ELB A;  3PSC A;  1ZVR A;  2LOX A;  2CRF A;  2LOZ A;  3ODW A;  5DI9 B;  2DLW A;  1FHX A;  2EMS A;  4F7G A;  2RVB B;  4GZU A;  1TJ6 A;  4ZRI A;  2DX5 A;  1PLS A;  3FM8 C;  1MKE A;  4MT7 A;  4C0A A;  4CYE A;  4CHJ A;  3D8F A;  1U27 A;  3V5W A;  4K2O A;  3U7D A;  1AWE A;  3CIK A;  3PVU A;  4HAT B;  1DBH A;  2Z0O A;  4NSW A;  3F5R A;  1KZG A;  1Z87 A;  2NZ8 B;  1BTN A;  3P6A A;  3N7C A;  2YVC A;  4YON A;  1X1F A;  5LOP B;  2YS3 A;  3CXB B;  5JLJ B;  2YT1 A;  2J0J A;  5FI1 A;  2H7D A;  5FI0 A;  2Z0P A;  3FSS A;  2KCJ A;  5C5B A;  1FHW A;  4TKN A;  1QQG A;  4IOY X;  4DX9 0;  5DHF B;  5HE3 A;  2GCJ A;  3VOQ A;  2M38 A;  1NTY A;  2R0D A;  4HAZ B;  3G9W A;  3ULC A;  2K00 A;  2V76 A;  4IAP A;  2P0D A;  3O96 A;  4DXA B;  1WJ1 A;  1XR0 B;  4KHB B;  3PZD A;  1AQC A;  4A6F B;  1UEF A;  1FOE A;  2I1J A;  3ZDT A;  2EMT A;  1DDV A;  1NU2 A;  1XX0 A;  2D9Y A;  1TQZ A;  2N0Y A;  3KY9 A;  3ML4 A;  3HQC A;  2YRY A;  3ULB A;  2QKL A;  2FJL A;  2D10 A;  4Z2N A;  1KI1 B;  2YF0 A;  4PNK A;  2P0H A;  4KAX B;  2CY4 A;  2RSG A;  3A8P A;  3QWM A;  4ZRJ A;  1OQN A;  1K5G B;  1OY2 A;  1ZC4 B;  1FAO A;  2XQN M;  3KRX A;  2GJY A;  3MDB C;  3TFM A;  3ZVR A;  1ZC3 B;  4F7U P;  4KHA A;  3PVW A;  2DKP A;  2J0M A;  1FGZ A;  1XD4 A;  4HDQ A;  3TVV A;  1LW3 A;  3TCA A;  4P7I A;  2DN6 A;  4GMX B;  1V88 A;  2DX1 A;  5D3X A;  4Z2M B;  1U2B A;  5JHH A;  2DTC A;  2RUK B;  1GC7 A;  2HE7 A;  5C16 A;  1BTK A;  3OAN A;  2MFQ A;  2PZ1 A;  2YSZ A;  3NSU A;  2Y8F A;  2J59 M;  4D0N B;  1FGY A;  5C5B B;  3ODO A;  2EJ8 A;  3WYF B;  4DX8 A;  3RCP A;  3QIJ A;  1UNP A;  2LUL A;  4HAU B;  4NY0 A;  4MK0 A;  4KHO A;  2ADZ A;  1W1G A;  1J19 A;  5J3T A;  3SO6 A;  2GS0 A;  1MK7 B;  1UNR A;  4Y94 A;  3ODX A;  3KSY A;  1EVH A;  2AL6 A;  2MWN B;  2D4Q A;  1H4R A;  1I7A A;  2Y7B A;  5C79 A;  4HAW B;  5J3Y A;  1GG3 A;  4HB3 B;  3DXE A;  4MY6 A;  3HK0 A;  2E2X A;  2W2X D;  3PEG A;  5CLL B;  2DFK A;  2LG1 A;  1J0W A;  2DHJ A;  3SV1 A;  2MDX A;  4A5K A;  4K2P A;  5DIF B;  4YL8 A;  3DXD A;  2YT0 A;  3IVF A;  4HDO A;  4L6E A;  4CHM A;  4WVF B;  1X11 A;  2QKM A;  2BCJ A;  1U5E A;  1WI1 A;  2W2W A;  3TW1 A;  5D27 A;  4GN1 A;  1DRO A;  1LB1 A;  1X1G A;  1BAK A;  1Y19 B;  2I5C A;  3D8D A;  4IFS A;  4WJ7 A;  2D11 A;  4KVG B;  4EMO A;  1V89 A;  4A6K A;  2I1K A;  2IFS A;  1B55 A;  5HE1 A;  1DDW A;  4GMV A;  1WGU A;  2YS1 A;  1EAZ A;  4GXB A;  4XWX A;  3PP2 A;  2K2U A;  1EF1 A;  3TO1 A;  1BWN A;  2OTX A;  2NMB A;  3D8E A;  5DHA B;  1PFJ A;  4HAV B;  1SHC A;  3P7Z A;  2D9W A;  3AU5 A;  3WA0 A;  2LYD A;  5L81 A;  4DBB A;  1XCG A;  3AJ4 A;  2UZS A;  5JHG A;  4HB4 B;  1K5D B;  4EKU A;  2J0K A;  2KGX B;  3GYP A;  2RNR B;  5EFX A;  4HHV A;  2Z0Q A;  2COA A;  2COC A;  1V5P A;  2ZPY A;  2LKO A;  3MPX A;  1V5M A;  2EC1 A;  2COD A;  1IRS A;  1XOD A;  3HW2 B;  2DHK A;  2W2X C;  2L2I A;  2P0F A;  4B6H A;  3U8Z A;  2D9Z A;  1MAI A;  1MPH A;  4EJN A;  1U29 A;  3A8Q A;  2G35 A;  4A6F A;  1ZM0 A;  2CY5 A;  1TXD A;  5HE2 A;  2ELA A;  2I5F A;  4TYZ A;  1N3H A;  2KUP A;  2R09 A;  2X18 A;  5HE0 A;  1EGX A;  3UZT A;  1P6S A;  2OQB A;  1V5U A;  2AEH A;  1H10 A;  2VSZ A;  4HAY B;  2P8V A;  3PG7 A;  1PMS A;  1Y5O A;  2MKR A;  4HB0 B;  2VKI A;  1X05 A;  3SUZ A;  3LJU X;  1NTV A;  4GPT B;  1U5G A;  2D9X A;  4PQ0 A;  1WVH A;  2D2Q A;  1QC6 A;  5DH9 B;  3QBV B;  3SNH A;  5LON B;  5KQ1 A;  1V61 A;  3VIA A;  1Q67 A;  2Y8G A;  1NI2 A;  4HB2 B;  1MIZ B;  1ZSQ A;  3BJI A;  3GYO A;  2RLO A;  2VRW B;  2ROV A;  4ZRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...