5JP4A

Crystal structure of s. pombe dcp1 in complex with the decapping enhancer edc
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
EDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA-decapping enzyme subunit 1
publication title Structure of the SpEDC/Dcp1 complex
rcsb
source organism Schizosaccharomyces pombe
molecule tags Peptide binding protein
total genus 33
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5jp4A00
3IVFA 3M1IB 2K2UA 1PMSA 4C0AA 2DFKA 5LONB 1Y19B 2LULA 1J19A 2UZSA 3D8FA 4K81A 4K2PA 1XD4A 1I7AA 4TYZA 4YL8A 3PVLA 1DBHA 1LW3A 2D4QA 1RRPB 2P8VA 3ULCA 4ZRJA 3A98B 4MK0A 3PVUA 4HDOA 5C79A 2ADZA 3UZTA 1NI2A 1UNRA 4MY6A 5DH9B 1V5UA 2IFSA 3T06A 2N23A 2Y7BA 5D27A 2K00A 1KZ7A 1NU2A 1X11A 2DA0A 3TFMA 1H4RA 1WJMA 2YS1A 2LG1A 5FI1A 5HE2A 4DX90 4F7HA 5DHAB 2J0MA 2DHKA 3RCPA 2RNRB 1V89A 2COAA 1PLSA 2VSZA 1BAKA 2M14A 2DTCA 3TVVA 1P5TA 5D3VA 1ZC4B 1EAZA 1K5GB 3ZDTA 4KHAA 3SV1A 1U27A 1WG7A 2D9ZA 1N3HA 3HW2B 4HAUB 3V5WA 2Z0QA 3DXEA 5KQ1A 2DKQA 2LKOA 3ODXA 1U2BA 4EKUA 4HB2B 1MKEA 5J3QA 5EFXA 1U5FA 4XWXA 2YT1A 2COCA 4HAZB 2EC1A 4HATB 2EMSA 2RSGA 5L81A 1FHXA 3PSCA 5HE1A 4PNKA 2OTXA 2UZRA 4GMVA 1XODA 3U8ZA 2V76A 1UNPA 4HAWB 4KVGB 4NY0A 5KQ4A 1FB8A 2YRYA 1IRSA 1M7EA 2I5CA 2UVMA 3TCAA 3SUZA 2K2JA 2YSZA 1MK7B 4A6HA 2DLWA 2DHIA 1UNQA 3NSUA 4Z2MB 3A8QA 1W1HA 2RLOA 4KAXB 2I1JA 1FHWA 4NSWA 2R09A 1FHOA 4WJ7A 3CXBB 2DN6A 2HTHB 1MIXA 5KCVA 4HB4B 2N0YA 5HE3A 1BTNA 4A6FA 1W1DA 1WGUA 4TKNA 4Z2NA 3KY9A 2EJ8A 5CLQB 2D10A 1V61A 2J0KA 1EVHA 3SYXA 2QKMA 3QIJA 2D9WA 4GMXB 2Y8FA 5FI0A 2I5FA 2H7DA 2H7EA 1Q67A 3QWMA 1DYNA 5GOWB 1BWNA 3VIAA 3OANA 2P0FA 4Y94A 2MKRA 1TJ6A 3VOQA 2LOXA 1Y5OA 2XQNM 3FM8C 3HK0A 2QKLA 4HB3B 2J59M 3BINA 1DDMA 1EF1A 3O96A 3ZVRA 4WVFB 2W2XD 1XR0B 3WYFB 1BTKA 1FOEA 1TQZA 1XCGA 4YONA 2NZ8B 4HDQA 2D9VA 4K2OA 1P6SA 1MPHA 2JP2A 1TXDA 2OQBA 5D3XA 3D8EA 3ODWA 2GJYA 2YS3A 1FGZA 4K17A 4B6HA 3SNHA 1KI1B 1SHCA 2CY4A 2RUKB 4L6EA 1U5GA 1SGHA 1MK9B 4CHJA 5D3YA 4A5KA 5DI9B 3ODOA 4DX8A 1K5DB 3PG7A 1QQGA 3KRWA 4EJNA 2LYDA 3TW1A 2KGXB 2RGNB 2L2IA 3HQCA 4HHVA 1J0WA 5HE0A 5JHGA 2MFQA 3F5RA 3D8DA 3AJ4A 4HAYB 1X86A 3PEGA 5C5BB 2J0JA 3DXDA 1E5WA 2R0DA 1Z87A 4IFSA 1U29A 5LOPB 2ELAA 3LJUX 2LOZA 3MPXA 3GYPA 5JP4A 2Z0OA 2D2QA 4CYEA 1H10A 2YS5A 5DIFB 2P0DA 1ISNA 2VKIA 4IOYX 2FJLA 2DX1A 3FEHA 4GXBA 1GC7A 4D0NB 2MDXA 2YF0A 2D11A 3BJIA 1NTYA 1WGQA 2P0HA 2ROZB 1AQCA 2ZPYA 1DROA 1X05A 5C6RA 1WJ1A 1GC6A 5DHFB 2W2XC 1WI1A 1X1FA 2EMTA 4F7UP 3KRXA 3AU5A 2W2WA 2IYBA 1GG3A 2MWNB 4DBBA 2E2XA 1W1GA 2CY5A 2DYNA 2DYQA 2KUPA 1EGXA 2NMBA 1UEFA 4GZUA 2ELBA 4BBKA 2L1CA 4MT7A 4GN1A 4CHMA 4ZRKA 1ZM0A 2GCLA 1OY2A 1KZGA 2G35A 3WA0A 4KHOA 1QC6A 1V5MA 2YVCA 1MAIA 4KHBB 1U5DA 5CLLB 5J3TA 3U7DA 3MDBC 2GS0A 2CRFA 3F0WA 2CODA 4HAVB 3A8PA 1XX0A 3ML4A 2D9XA 3TO1A 3PP2A 3X23A 1FGYA 4HAXB 2Q13A 2YT0A 2COFA 2BCJA 1OQNA 1V5PA 2ROVA 1NTVA 2CAYA 1FAOA 1XKEA 1V88A 3GYOA 2X18A 2AEHA 2I1KA 1P3RA 2VRWB 1X1GA 3ULBA 1DDWA 1MIZB 3AU4A 1ZVRA 5D3WA 3PVWA 1ZC3B 4H8SA 4ZRIA 1DDVA 2DKPA 2M38A 3DXCA 4GPTB 4P7IA 4HB0B 1PFJA 2PZ1A 4A6KA 3G9WA 1U5EA 2GCJA 1AWEA 3FSSA 4EMOA 3PZDA 5JHHA 4DXAB 2D9YA 1ZSQA 4WSFA 1WVHA 2RVBB 3SO6A 2DX5A 1UPQA 4PQ0A 4F7GA 2HE7A 3P6AA 1B55A 3CIKA 1LB1A 2DHJA 3QBVB 5C16A 3KZ1A 5C5BA 5J3YA 3N7CA 2KCJA 1UPRA 1RJ2A 3P7ZA 1I2HA 5JLJB 1OMWA 3KSYA 2Z0PA 2AL6A 1M7RA 2Y8GA 4IAPA 4A6FB
chains in the Genus database with same CATH superfamily
3IVFA 3M1IB 2K2UA 1PMSA 2KUQA 4C0AA 2DFKA 5LONB 1Y19B 2LULA 1J19A 2UZSA 3D8FA 4GOUA 3NWAA 4K81A 4K2PA 1XD4A 2RRFA 1I7AA 4TYZA 4YL8A 3PVLA 1DBHA 1LW3A 2D4QA 2KIEA 1RRPB 2P8VA 4D6WA 3ULCA 4ZRJA 3A98B 4MK0A 2YT2A 3PVUA 4HDOA 5C79A 2ADZA 3UZTA 1NI2A 1UNRA 4L1RA 4MY6A 5DH9B 1V5UA 2IFSA 3T06A 2N23A 2Y7BA 5D27A 2K00A 1KZ7A 1NU2A 1X11A 2KIGA 2DA0A 3TFMA 1H4RA 1WJMA 2YS1A 2LG1A 5FI1A 5HE2A 4DX90 4F7HA 5DHAB 2J0MA 2DHKA 3RCPA 2RNRB 1V89A 2COAA 1PLSA 2VSZA 4KHBA 1BAKA 2M14A 2DTCA 3TVVA 1P5TA 5D3VA 4QJ3B 1ZC4B 1EAZA 3B77A 2R2YA 1K5GB 3ZDTA 4KHAA 3SV1A 1U27A 1WG7A 2D9ZA 1N3HA 3HW2B 4HAUB 3V5WA 2Z0QA 3DXEA 5KQ1A 2DKQA 2LKOA 3ODXA 1U2BA 4EKUA 4HB2B 4QJ5B 1MKEA 5J3QA 5EFXA 1U5FA 4XWXA 2YT1A 2COCA 4DIXA 4HAZB 2EC1A 4HATB 2EMSA 2RSGA 5L81A 1FHXA 3PSCA 5HE1A 4PNKA 2OTXA 2UZRA 4GMVA 1XODA 3U8ZA 2V76A 1UNPA 4HAWB 4KVGB 4NY0A 4CSQA 3NWDA 5KQ4A 1FB8A 2YRYA 2GUMA 1IRSA 1M7EA 2I5CA 2UVMA 3TCAA 3SUZA 2K2JA 2YSZA 1MK7B 4A6HA 2DLWA 2DHIA 1UNQA 2Z59A 3NSUA 4Z2MB 3A8QA 1W1HA 3HSAA 2RLOA 4KAXB 2I1JA 1FHWA 4NSWA 2R09A 1FHOA 4WJ7A 3CXBB 2DN6A 2HTHB 1MIXA 5KCVA 4HB4B 2N0YA 5HE3A 1BTNA 2KR0A 1W1DA 4A6FA 1WGUA 4TKNA 4Z2NA 3KY9A 2FJUB 2EJ8A 5CLQB 2D10A 1V61A 2J0KA 1EVHA 3SYXA 2QKMA 3QIJA 2D9WA 4GMXB 2Y8FA 5FI0A 2I5FA 2H7DA 2H7EA 1Q67A 3QWMA 1DYNA 5GOWB 1BWNA 3VIAA 3OANA 2P0FA 4Y94A 2MKRA 1TJ6A 3VOQA 2LOXA 1Y5OA 2XQNM 2Z4DA 3FM8C 3HK0A 2QKLA 4HB3B 2J59M 3BINA 1DDMA 1EF1A 3O96A 3ZVRA 4WVFB 2ZKMX 2W2XD 1XR0B 3WYFB 1BTKA 1FOEA 2Z14A 1TQZA 1XCGA 4YONA 2NZ8B 4HDQA 2D9VA 4OT1A 4K2OA 1P6SA 1MPHA 2JP2A 1TXDA 2OQBA 5D3XA 3D8EA 3ODWA 2GJYA 2YS3A 1FGZA 5I2SA 4K17A 5M4YB 4B6HA 3SNHA 1T77A 1KI1B 1SHCA 2CY4A 3A58A 2RUKB 4L6EA 1U5GA 1SGHA 1MK9B 4CHJA 5D3YA 4A5KA 5DI9B 1MI1A 3ODOA 4DX8A 1K5DB 3PG7A 1QQGA 3KRWA 4EJNA 2LYDA 3TW1A 2KGXB 2RGNB 2L2IA 3HQCA 4HHVA 1J0WA 5HE0A 3FVCA 5JHGA 2MFQA 3F5RA 3D8DA 3AJ4A 2NBVA 4HAYB 1X86A 3PEGA 5C5BB 2J0JA 3DXDA 1E5WA 2R0DA 1Z87A 4IFSA 1U29A 5LOPB 2ELAA 3LJUX 2LOZA 3MPXA 3GYPA 5JP4A 2Z0OA 2D2QA 4CYEA 1H10A 2YS5A 5DIFB 3NWFA 2P0DA 1ISNA 2VKIA 3NW8A 4IOYX 2FJLA 2DX1A 3FEHA 4GXBA 1GC7A 4D0NB 2MDXA 2YF0A 2D11A 3BJIA 1NTYA 1WGQA 2P0HA 2ROZB 1AQCA 2ZPYA 1DROA 3U12A 1X05A 5C6RA 1WJ1A 1GC6A 5DHFB 2W2XC 1WI1A 1X1FA 2EMTA 4F7UP 3KRXA 3AU5A 2W2WA 2IYBA 1GG3A 2MWNB 4DBBA 2E2XA 1W1GA 2CY5A 2DYNA 2DYQA 2KUPA 1EGXA 2NMBA 1UEFA 4GZUA 2ELBA 4BBKA 2L1CA 4MT7A 4GN1A 4CHMA 4ZRKA 1ZM0A 5LG4B 2GCLA 1OY2A 1KZGA 2G35A 3WA0A 4KHOA 1QC6A 1V5MA 1ZYIA 2YVCA 1MAIA 4KHBB 1U5DA 5CLLB 4GNKB 5IRSA 5J3TA 3U7DA 3MDBC 2GS0A 2CRFA 3F0WA 2CODA 4HAVB 3A8PA 1XX0A 3ML4A 3DCXA 2D9XA 3TO1A 3PP2A 3X23A 1FGYA 4HAXB 2Q13A 4QJ4B 2YT0A 2K8EA 2COFA 2BCJA 1OQNA 1V5PA 2ROVA 1NTVA 2CAYA 1FAOA 1XKEA 3OHMB 1V88A 3GYOA 2X18A 2AEHA 2I1KA 1P3RA 2VRWB 1X1GA 3ULBA 1DDWA 1MIZB 3AU4A 1ZVRA 5D3WA 3PVWA 1ZC3B 4H8SA 4ZRIA 5I2MA 1DDVA 2DKPA 2M38A 3DXCA 4GPTB 4P7IA 2K49A 4HB0B 1PFJA 2PZ1A 4A6KA 3G9WA 1U5EA 2Z13A 4HSIA 3HIEA 2GCJA 1AWEA 3FSSA 4EMOA 3PZDA 5JHHA 4DXAB 2D9YA 1ZSQA 4WSFA 1WVHA 2RVBB 3SO6A 2DX5A 1UPQA 4PQ0A 4F7GA 4OSNA 2HE7A 3P6AA 1B55A 3CIKA 1LB1A 2DHJA 4QXAB 3QBVB 5C16A 3KZ1A 5C5BA 5J3YA 3N7CA 2KCJA 1UPRA 1RJ2A 3P7ZA 1I2HA 5JLJB 1OMWA 3KSYA 2Z0PA 2AL6A 1M7RA 2Y8GA 4IAPA 4A6FB
chains in the Genus database with same CATH topology
3IVFA 3M1IB 2K2UA 1PMSA 4C0AA 2DFKA 5LONB 1Y19B 2LULA 1J19A 2UZSA 3D8FA 4K81A 4K2PA 1XD4A 1I7AA 4TYZA 4YL8A 3PVLA 1DBHA 1LW3A 2D4QA 1RRPB 2P8VA 3ULCA 4ZRJA 3A98B 4MK0A 3PVUA 4HDOA 5C79A 2ADZA 3UZTA 1NI2A 1UNRA 4MY6A 5DH9B 1V5UA 2IFSA 3T06A 2N23A 2Y7BA 5D27A 2K00A 1KZ7A 1NU2A 1X11A 2DA0A 3TFMA 1H4RA 1WJMA 2YS1A 2LG1A 5FI1A 5HE2A 4DX90 4F7HA 5DHAB 2J0MA 2DHKA 3RCPA 2RNRB 1V89A 2COAA 1PLSA 2VSZA 1BAKA 2M14A 2DTCA 3TVVA 1P5TA 5D3VA 1ZC4B 1EAZA 1K5GB 3ZDTA 4KHAA 3SV1A 1U27A 1WG7A 2D9ZA 1N3HA 3HW2B 4HAUB 3V5WA 2Z0QA 3DXEA 5KQ1A 2DKQA 2LKOA 3ODXA 1U2BA 4EKUA 4HB2B 1MKEA 5J3QA 5EFXA 1U5FA 4XWXA 2YT1A 2COCA 4HAZB 2EC1A 4HATB 2EMSA 2RSGA 5L81A 1FHXA 3PSCA 5HE1A 4PNKA 2OTXA 2UZRA 4GMVA 1XODA 3U8ZA 2V76A 1UNPA 4HAWB 4KVGB 4NY0A 5KQ4A 1FB8A 2YRYA 1IRSA 1M7EA 2I5CA 2UVMA 3TCAA 3SUZA 2K2JA 2YSZA 1MK7B 4A6HA 2DLWA 2DHIA 1UNQA 3NSUA 4Z2MB 3A8QA 1W1HA 2RLOA 4KAXB 2I1JA 1FHWA 4NSWA 2R09A 1FHOA 4WJ7A 3CXBB 2DN6A 2HTHB 1MIXA 5KCVA 4HB4B 2N0YA 5HE3A 1BTNA 4A6FA 1W1DA 1WGUA 4TKNA 4Z2NA 3KY9A 2EJ8A 5CLQB 2D10A 1V61A 2J0KA 1EVHA 3SYXA 2QKMA 3QIJA 2D9WA 4GMXB 2Y8FA 5FI0A 2I5FA 2H7DA 2H7EA 1Q67A 3QWMA 1DYNA 5GOWB 1BWNA 3VIAA 3OANA 2P0FA 4Y94A 2MKRA 1TJ6A 3VOQA 2LOXA 1Y5OA 2XQNM 3FM8C 3HK0A 2QKLA 4HB3B 2J59M 3BINA 1DDMA 1EF1A 3O96A 3ZVRA 4WVFB 2W2XD 1XR0B 3WYFB 1BTKA 1FOEA 1TQZA 1XCGA 4YONA 2NZ8B 4HDQA 2D9VA 4K2OA 1P6SA 1MPHA 2JP2A 1TXDA 2OQBA 5D3XA 3D8EA 3ODWA 2GJYA 2YS3A 1FGZA 4K17A 4B6HA 3SNHA 1KI1B 1SHCA 2CY4A 2RUKB 4L6EA 1U5GA 1SGHA 1MK9B 4CHJA 5D3YA 4A5KA 5DI9B 3ODOA 4DX8A 1K5DB 3PG7A 1QQGA 3KRWA 4EJNA 2LYDA 3TW1A 2KGXB 2RGNB 2L2IA 3HQCA 4HHVA 1J0WA 5HE0A 5JHGA 2MFQA 3F5RA 3D8DA 3AJ4A 4HAYB 1X86A 3PEGA 5C5BB 2J0JA 3DXDA 1E5WA 2R0DA 1Z87A 4IFSA 1U29A 5LOPB 2ELAA 3LJUX 2LOZA 3MPXA 3GYPA 5JP4A 2Z0OA 2D2QA 4CYEA 1H10A 2YS5A 5DIFB 2P0DA 1ISNA 2VKIA 4IOYX 2FJLA 2DX1A 3FEHA 4GXBA 1GC7A 4D0NB 2MDXA 2YF0A 2D11A 3BJIA 1NTYA 1WGQA 2P0HA 2ROZB 1AQCA 2ZPYA 1DROA 1X05A 5C6RA 1WJ1A 1GC6A 5DHFB 2W2XC 1WI1A 1X1FA 2EMTA 4F7UP 3KRXA 3AU5A 2W2WA 2IYBA 1GG3A 2MWNB 4DBBA 2E2XA 1W1GA 2CY5A 2DYNA 2DYQA 2KUPA 1EGXA 2NMBA 1UEFA 4GZUA 2ELBA 4BBKA 2L1CA 4MT7A 4GN1A 4CHMA 4ZRKA 1ZM0A 2GCLA 1OY2A 1KZGA 2G35A 3WA0A 4KHOA 1QC6A 1V5MA 2YVCA 1MAIA 4KHBB 1U5DA 5CLLB 5J3TA 3U7DA 3MDBC 2GS0A 2CRFA 3F0WA 2CODA 4HAVB 3A8PA 1XX0A 3ML4A 2D9XA 3TO1A 3PP2A 3X23A 1FGYA 4HAXB 2Q13A 2YT0A 2COFA 2BCJA 1OQNA 1V5PA 2ROVA 1NTVA 2CAYA 1FAOA 1XKEA 1V88A 3GYOA 2X18A 2AEHA 2I1KA 1P3RA 2VRWB 1X1GA 3ULBA 1DDWA 1MIZB 3AU4A 1ZVRA 5D3WA 3PVWA 1ZC3B 4H8SA 4ZRIA 1DDVA 2DKPA 2M38A 3DXCA 4GPTB 4P7IA 4HB0B 1PFJA 2PZ1A 4A6KA 3G9WA 1U5EA 2GCJA 1AWEA 3FSSA 4EMOA 3PZDA 5JHHA 4DXAB 2D9YA 1ZSQA 4WSFA 1WVHA 2RVBB 3SO6A 2DX5A 1UPQA 4PQ0A 4F7GA 2HE7A 3P6AA 1B55A 3CIKA 1LB1A 2DHJA 3QBVB 5C16A 3KZ1A 5C5BA 5J3YA 3N7CA 2KCJA 1UPRA 1RJ2A 3P7ZA 1I2HA 5JLJB 1OMWA 3KSYA 2Z0PA 2AL6A 1M7RA 2Y8GA 4IAPA 4A6FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IVF A;  3M1I B;  2K2U A;  1PMS A;  4C0A A;  2DFK A;  5LON B;  1Y19 B;  2LUL A;  1J19 A;  2UZS A;  3D8F A;  4K81 A;  4K2P A;  1XD4 A;  1I7A A;  4TYZ A;  4YL8 A;  3PVL A;  1DBH A;  1LW3 A;  2D4Q A;  1RRP B;  2P8V A;  3ULC A;  4ZRJ A;  3A98 B;  4MK0 A;  3PVU A;  4HDO A;  5C79 A;  2ADZ A;  3UZT A;  1NI2 A;  1UNR A;  4MY6 A;  5DH9 B;  1V5U A;  2IFS A;  3T06 A;  2N23 A;  2Y7B A;  5D27 A;  2K00 A;  1KZ7 A;  1NU2 A;  1X11 A;  2DA0 A;  3TFM A;  1H4R A;  1WJM A;  2YS1 A;  2LG1 A;  5FI1 A;  5HE2 A;  4DX9 0;  4F7H A;  5DHA B;  2J0M A;  2DHK A;  3RCP A;  2RNR B;  1V89 A;  2COA A;  1PLS A;  2VSZ A;  1BAK A;  2M14 A;  2DTC A;  3TVV A;  1P5T A;  5D3V A;  1ZC4 B;  1EAZ A;  1K5G B;  3ZDT A;  4KHA A;  3SV1 A;  1U27 A;  1WG7 A;  2D9Z A;  1N3H A;  3HW2 B;  4HAU B;  3V5W A;  2Z0Q A;  3DXE A;  5KQ1 A;  2DKQ A;  2LKO A;  3ODX A;  1U2B A;  4EKU A;  4HB2 B;  1MKE A;  5J3Q A;  5EFX A;  1U5F A;  4XWX A;  2YT1 A;  2COC A;  4HAZ B;  2EC1 A;  4HAT B;  2EMS A;  2RSG A;  5L81 A;  1FHX A;  3PSC A;  5HE1 A;  4PNK A;  2OTX A;  2UZR A;  4GMV A;  1XOD A;  3U8Z A;  2V76 A;  1UNP A;  4HAW B;  4KVG B;  4NY0 A;  5KQ4 A;  1FB8 A;  2YRY A;  1IRS A;  1M7E A;  2I5C A;  2UVM A;  3TCA A;  3SUZ A;  2K2J A;  2YSZ A;  1MK7 B;  4A6H A;  2DLW A;  2DHI A;  1UNQ A;  3NSU A;  4Z2M B;  3A8Q A;  1W1H A;  2RLO A;  4KAX B;  2I1J A;  1FHW A;  4NSW A;  2R09 A;  1FHO A;  4WJ7 A;  3CXB B;  2DN6 A;  2HTH B;  1MIX A;  5KCV A;  4HB4 B;  2N0Y A;  5HE3 A;  1BTN A;  4A6F A;  1W1D A;  1WGU A;  4TKN A;  4Z2N A;  3KY9 A;  2EJ8 A;  5CLQ B;  2D10 A;  1V61 A;  2J0K A;  1EVH A;  3SYX A;  2QKM A;  3QIJ A;  2D9W A;  4GMX B;  2Y8F A;  5FI0 A;  2I5F A;  2H7D A;  2H7E A;  1Q67 A;  3QWM A;  1DYN A;  5GOW B;  1BWN A;  3VIA A;  3OAN A;  2P0F A;  4Y94 A;  2MKR A;  1TJ6 A;  3VOQ A;  2LOX A;  1Y5O A;  2XQN M;  3FM8 C;  3HK0 A;  2QKL A;  4HB3 B;  2J59 M;  3BIN A;  1DDM A;  1EF1 A;  3O96 A;  3ZVR A;  4WVF B;  2W2X D;  1XR0 B;  3WYF B;  1BTK A;  1FOE A;  1TQZ A;  1XCG A;  4YON A;  2NZ8 B;  4HDQ A;  2D9V A;  4K2O A;  1P6S A;  1MPH A;  2JP2 A;  1TXD A;  2OQB A;  5D3X A;  3D8E A;  3ODW A;  2GJY A;  2YS3 A;  1FGZ A;  4K17 A;  4B6H A;  3SNH A;  1KI1 B;  1SHC A;  2CY4 A;  2RUK B;  4L6E A;  1U5G A;  1SGH A;  1MK9 B;  4CHJ A;  5D3Y A;  4A5K A;  5DI9 B;  3ODO A;  4DX8 A;  1K5D B;  3PG7 A;  1QQG A;  3KRW A;  4EJN A;  2LYD A;  3TW1 A;  2KGX B;  2RGN B;  2L2I A;  3HQC A;  4HHV A;  1J0W A;  5HE0 A;  5JHG A;  2MFQ A;  3F5R A;  3D8D A;  3AJ4 A;  4HAY B;  1X86 A;  3PEG A;  5C5B B;  2J0J A;  3DXD A;  1E5W A;  2R0D A;  1Z87 A;  4IFS A;  1U29 A;  5LOP B;  2ELA A;  3LJU X;  2LOZ A;  3MPX A;  3GYP A;  5JP4 A;  2Z0O A;  2D2Q A;  4CYE A;  1H10 A;  2YS5 A;  5DIF B;  2P0D A;  1ISN A;  2VKI A;  4IOY X;  2FJL A;  2DX1 A;  3FEH A;  4GXB A;  1GC7 A;  4D0N B;  2MDX A;  2YF0 A;  2D11 A;  3BJI A;  1NTY A;  1WGQ A;  2P0H A;  2ROZ B;  1AQC A;  2ZPY A;  1DRO A;  1X05 A;  5C6R A;  1WJ1 A;  1GC6 A;  5DHF B;  2W2X C;  1WI1 A;  1X1F A;  2EMT A;  4F7U P;  3KRX A;  3AU5 A;  2W2W A;  2IYB A;  1GG3 A;  2MWN B;  4DBB A;  2E2X A;  1W1G A;  2CY5 A;  2DYN A;  2DYQ A;  2KUP A;  1EGX A;  2NMB A;  1UEF A;  4GZU A;  2ELB A;  4BBK A;  2L1C A;  4MT7 A;  4GN1 A;  4CHM A;  4ZRK A;  1ZM0 A;  2GCL A;  1OY2 A;  1KZG A;  2G35 A;  3WA0 A;  4KHO A;  1QC6 A;  1V5M A;  2YVC A;  1MAI A;  4KHB B;  1U5D A;  5CLL B;  5J3T A;  3U7D A;  3MDB C;  2GS0 A;  2CRF A;  3F0W A;  2COD A;  4HAV B;  3A8P A;  1XX0 A;  3ML4 A;  2D9X A;  3TO1 A;  3PP2 A;  3X23 A;  1FGY A;  4HAX B;  2Q13 A;  2YT0 A;  2COF A;  2BCJ A;  1OQN A;  1V5P A;  2ROV A;  1NTV A;  2CAY A;  1FAO A;  1XKE A;  1V88 A;  3GYO A;  2X18 A;  2AEH A;  2I1K A;  1P3R A;  2VRW B;  1X1G A;  3ULB A;  1DDW A;  1MIZ B;  3AU4 A;  1ZVR A;  5D3W A;  3PVW A;  1ZC3 B;  4H8S A;  4ZRI A;  1DDV A;  2DKP A;  2M38 A;  3DXC A;  4GPT B;  4P7I A;  4HB0 B;  1PFJ A;  2PZ1 A;  4A6K A;  3G9W A;  1U5E A;  2GCJ A;  1AWE A;  3FSS A;  4EMO A;  3PZD A;  5JHH A;  4DXA B;  2D9Y A;  1ZSQ A;  4WSF A;  1WVH A;  2RVB B;  3SO6 A;  2DX5 A;  1UPQ A;  4PQ0 A;  4F7G A;  2HE7 A;  3P6A A;  1B55 A;  3CIK A;  1LB1 A;  2DHJ A;  3QBV B;  5C16 A;  3KZ1 A;  5C5B A;  5J3Y A;  3N7C A;  2KCJ A;  1UPR A;  1RJ2 A;  3P7Z A;  1I2H A;  5JLJ B;  1OMW A;  3KSY A;  2Z0P A;  2AL6 A;  1M7R A;  2Y8G A;  4IAP A;  4A6F B; 
#chains in the Genus database with same CATH topology
 3IVF A;  3M1I B;  2K2U A;  1PMS A;  2KUQ A;  4C0A A;  2DFK A;  5LON B;  1Y19 B;  2LUL A;  1J19 A;  2UZS A;  3D8F A;  4GOU A;  3NWA A;  4K81 A;  4K2P A;  1XD4 A;  2RRF A;  1I7A A;  4TYZ A;  4YL8 A;  3PVL A;  1DBH A;  1LW3 A;  2D4Q A;  2KIE A;  1RRP B;  2P8V A;  4D6W A;  3ULC A;  4ZRJ A;  3A98 B;  4MK0 A;  2YT2 A;  3PVU A;  4HDO A;  5C79 A;  2ADZ A;  3UZT A;  1NI2 A;  1UNR A;  4L1R A;  4MY6 A;  5DH9 B;  1V5U A;  2IFS A;  3T06 A;  2N23 A;  2Y7B A;  5D27 A;  2K00 A;  1KZ7 A;  1NU2 A;  1X11 A;  2KIG A;  2DA0 A;  3TFM A;  1H4R A;  1WJM A;  2YS1 A;  2LG1 A;  5FI1 A;  5HE2 A;  4DX9 0;  4F7H A;  5DHA B;  2J0M A;  2DHK A;  3RCP A;  2RNR B;  1V89 A;  2COA A;  1PLS A;  2VSZ A;  4KHB A;  1BAK A;  2M14 A;  2DTC A;  3TVV A;  1P5T A;  5D3V A;  4QJ3 B;  1ZC4 B;  1EAZ A;  3B77 A;  2R2Y A;  1K5G B;  3ZDT A;  4KHA A;  3SV1 A;  1U27 A;  1WG7 A;  2D9Z A;  1N3H A;  3HW2 B;  4HAU B;  3V5W A;  2Z0Q A;  3DXE A;  5KQ1 A;  2DKQ A;  2LKO A;  3ODX A;  1U2B A;  4EKU A;  4HB2 B;  4QJ5 B;  1MKE A;  5J3Q A;  5EFX A;  1U5F A;  4XWX A;  2YT1 A;  2COC A;  4DIX A;  4HAZ B;  2EC1 A;  4HAT B;  2EMS A;  2RSG A;  5L81 A;  1FHX A;  3PSC A;  5HE1 A;  4PNK A;  2OTX A;  2UZR A;  4GMV A;  1XOD A;  3U8Z A;  2V76 A;  1UNP A;  4HAW B;  4KVG B;  4NY0 A;  4CSQ A;  3NWD A;  5KQ4 A;  1FB8 A;  2YRY A;  2GUM A;  1IRS A;  1M7E A;  2I5C A;  2UVM A;  3TCA A;  3SUZ A;  2K2J A;  2YSZ A;  1MK7 B;  4A6H A;  2DLW A;  2DHI A;  1UNQ A;  2Z59 A;  3NSU A;  4Z2M B;  3A8Q A;  1W1H A;  3HSA A;  2RLO A;  4KAX B;  2I1J A;  1FHW A;  4NSW A;  2R09 A;  1FHO A;  4WJ7 A;  3CXB B;  2DN6 A;  2HTH B;  1MIX A;  5KCV A;  4HB4 B;  2N0Y A;  5HE3 A;  1BTN A;  2KR0 A;  1W1D A;  4A6F A;  1WGU A;  4TKN A;  4Z2N A;  3KY9 A;  2FJU B;  2EJ8 A;  5CLQ B;  2D10 A;  1V61 A;  2J0K A;  1EVH A;  3SYX A;  2QKM A;  3QIJ A;  2D9W A;  4GMX B;  2Y8F A;  5FI0 A;  2I5F A;  2H7D A;  2H7E A;  1Q67 A;  3QWM A;  1DYN A;  5GOW B;  1BWN A;  3VIA A;  3OAN A;  2P0F A;  4Y94 A;  2MKR A;  1TJ6 A;  3VOQ A;  2LOX A;  1Y5O A;  2XQN M;  2Z4D A;  3FM8 C;  3HK0 A;  2QKL A;  4HB3 B;  2J59 M;  3BIN A;  1DDM A;  1EF1 A;  3O96 A;  3ZVR A;  4WVF B;  2ZKM X;  2W2X D;  1XR0 B;  3WYF B;  1BTK A;  1FOE A;  2Z14 A;  1TQZ A;  1XCG A;  4YON A;  2NZ8 B;  4HDQ A;  2D9V A;  4OT1 A;  4K2O A;  1P6S A;  1MPH A;  2JP2 A;  1TXD A;  2OQB A;  5D3X A;  3D8E A;  3ODW A;  2GJY A;  2YS3 A;  1FGZ A;  5I2S A;  4K17 A;  5M4Y B;  4B6H A;  3SNH A;  1T77 A;  1KI1 B;  1SHC A;  2CY4 A;  3A58 A;  2RUK B;  4L6E A;  1U5G A;  1SGH A;  1MK9 B;  4CHJ A;  5D3Y A;  4A5K A;  5DI9 B;  1MI1 A;  3ODO A;  4DX8 A;  1K5D B;  3PG7 A;  1QQG A;  3KRW A;  4EJN A;  2LYD A;  3TW1 A;  2KGX B;  2RGN B;  2L2I A;  3HQC A;  4HHV A;  1J0W A;  5HE0 A;  3FVC A;  5JHG A;  2MFQ A;  3F5R A;  3D8D A;  3AJ4 A;  2NBV A;  4HAY B;  1X86 A;  3PEG A;  5C5B B;  2J0J A;  3DXD A;  1E5W A;  2R0D A;  1Z87 A;  4IFS A;  1U29 A;  5LOP B;  2ELA A;  3LJU X;  2LOZ A;  3MPX A;  3GYP A;  5JP4 A;  2Z0O A;  2D2Q A;  4CYE A;  1H10 A;  2YS5 A;  5DIF B;  3NWF A;  2P0D A;  1ISN A;  2VKI A;  3NW8 A;  4IOY X;  2FJL A;  2DX1 A;  3FEH A;  4GXB A;  1GC7 A;  4D0N B;  2MDX A;  2YF0 A;  2D11 A;  3BJI A;  1NTY A;  1WGQ A;  2P0H A;  2ROZ B;  1AQC A;  2ZPY A;  1DRO A;  3U12 A;  1X05 A;  5C6R A;  1WJ1 A;  1GC6 A;  5DHF B;  2W2X C;  1WI1 A;  1X1F A;  2EMT A;  4F7U P;  3KRX A;  3AU5 A;  2W2W A;  2IYB A;  1GG3 A;  2MWN B;  4DBB A;  2E2X A;  1W1G A;  2CY5 A;  2DYN A;  2DYQ A;  2KUP A;  1EGX A;  2NMB A;  1UEF A;  4GZU A;  2ELB A;  4BBK A;  2L1C A;  4MT7 A;  4GN1 A;  4CHM A;  4ZRK A;  1ZM0 A;  5LG4 B;  2GCL A;  1OY2 A;  1KZG A;  2G35 A;  3WA0 A;  4KHO A;  1QC6 A;  1V5M A;  1ZYI A;  2YVC A;  1MAI A;  4KHB B;  1U5D A;  5CLL B;  4GNK B;  5IRS A;  5J3T A;  3U7D A;  3MDB C;  2GS0 A;  2CRF A;  3F0W A;  2COD A;  4HAV B;  3A8P A;  1XX0 A;  3ML4 A;  3DCX A;  2D9X A;  3TO1 A;  3PP2 A;  3X23 A;  1FGY A;  4HAX B;  2Q13 A;  4QJ4 B;  2YT0 A;  2K8E A;  2COF A;  2BCJ A;  1OQN A;  1V5P A;  2ROV A;  1NTV A;  2CAY A;  1FAO A;  1XKE A;  3OHM B;  1V88 A;  3GYO A;  2X18 A;  2AEH A;  2I1K A;  1P3R A;  2VRW B;  1X1G A;  3ULB A;  1DDW A;  1MIZ B;  3AU4 A;  1ZVR A;  5D3W A;  3PVW A;  1ZC3 B;  4H8S A;  4ZRI A;  5I2M A;  1DDV A;  2DKP A;  2M38 A;  3DXC A;  4GPT B;  4P7I A;  2K49 A;  4HB0 B;  1PFJ A;  2PZ1 A;  4A6K A;  3G9W A;  1U5E A;  2Z13 A;  4HSI A;  3HIE A;  2GCJ A;  1AWE A;  3FSS A;  4EMO A;  3PZD A;  5JHH A;  4DXA B;  2D9Y A;  1ZSQ A;  4WSF A;  1WVH A;  2RVB B;  3SO6 A;  2DX5 A;  1UPQ A;  4PQ0 A;  4F7G A;  4OSN A;  2HE7 A;  3P6A A;  1B55 A;  3CIK A;  1LB1 A;  2DHJ A;  4QXA B;  3QBV B;  5C16 A;  3KZ1 A;  5C5B A;  5J3Y A;  3N7C A;  2KCJ A;  1UPR A;  1RJ2 A;  3P7Z A;  1I2H A;  5JLJ B;  1OMW A;  3KSY A;  2Z0P A;  2AL6 A;  1M7R A;  2Y8G A;  4IAP A;  4A6F B; 
#chains in the Genus database with same CATH homology
 3IVF A;  3M1I B;  2K2U A;  1PMS A;  4C0A A;  2DFK A;  5LON B;  1Y19 B;  2LUL A;  1J19 A;  2UZS A;  3D8F A;  4K81 A;  4K2P A;  1XD4 A;  1I7A A;  4TYZ A;  4YL8 A;  3PVL A;  1DBH A;  1LW3 A;  2D4Q A;  1RRP B;  2P8V A;  3ULC A;  4ZRJ A;  3A98 B;  4MK0 A;  3PVU A;  4HDO A;  5C79 A;  2ADZ A;  3UZT A;  1NI2 A;  1UNR A;  4MY6 A;  5DH9 B;  1V5U A;  2IFS A;  3T06 A;  2N23 A;  2Y7B A;  5D27 A;  2K00 A;  1KZ7 A;  1NU2 A;  1X11 A;  2DA0 A;  3TFM A;  1H4R A;  1WJM A;  2YS1 A;  2LG1 A;  5FI1 A;  5HE2 A;  4DX9 0;  4F7H A;  5DHA B;  2J0M A;  2DHK A;  3RCP A;  2RNR B;  1V89 A;  2COA A;  1PLS A;  2VSZ A;  1BAK A;  2M14 A;  2DTC A;  3TVV A;  1P5T A;  5D3V A;  1ZC4 B;  1EAZ A;  1K5G B;  3ZDT A;  4KHA A;  3SV1 A;  1U27 A;  1WG7 A;  2D9Z A;  1N3H A;  3HW2 B;  4HAU B;  3V5W A;  2Z0Q A;  3DXE A;  5KQ1 A;  2DKQ A;  2LKO A;  3ODX A;  1U2B A;  4EKU A;  4HB2 B;  1MKE A;  5J3Q A;  5EFX A;  1U5F A;  4XWX A;  2YT1 A;  2COC A;  4HAZ B;  2EC1 A;  4HAT B;  2EMS A;  2RSG A;  5L81 A;  1FHX A;  3PSC A;  5HE1 A;  4PNK A;  2OTX A;  2UZR A;  4GMV A;  1XOD A;  3U8Z A;  2V76 A;  1UNP A;  4HAW B;  4KVG B;  4NY0 A;  5KQ4 A;  1FB8 A;  2YRY A;  1IRS A;  1M7E A;  2I5C A;  2UVM A;  3TCA A;  3SUZ A;  2K2J A;  2YSZ A;  1MK7 B;  4A6H A;  2DLW A;  2DHI A;  1UNQ A;  3NSU A;  4Z2M B;  3A8Q A;  1W1H A;  2RLO A;  4KAX B;  2I1J A;  1FHW A;  4NSW A;  2R09 A;  1FHO A;  4WJ7 A;  3CXB B;  2DN6 A;  2HTH B;  1MIX A;  5KCV A;  4HB4 B;  2N0Y A;  5HE3 A;  1BTN A;  4A6F A;  1W1D A;  1WGU A;  4TKN A;  4Z2N A;  3KY9 A;  2EJ8 A;  5CLQ B;  2D10 A;  1V61 A;  2J0K A;  1EVH A;  3SYX A;  2QKM A;  3QIJ A;  2D9W A;  4GMX B;  2Y8F A;  5FI0 A;  2I5F A;  2H7D A;  2H7E A;  1Q67 A;  3QWM A;  1DYN A;  5GOW B;  1BWN A;  3VIA A;  3OAN A;  2P0F A;  4Y94 A;  2MKR A;  1TJ6 A;  3VOQ A;  2LOX A;  1Y5O A;  2XQN M;  3FM8 C;  3HK0 A;  2QKL A;  4HB3 B;  2J59 M;  3BIN A;  1DDM A;  1EF1 A;  3O96 A;  3ZVR A;  4WVF B;  2W2X D;  1XR0 B;  3WYF B;  1BTK A;  1FOE A;  1TQZ A;  1XCG A;  4YON A;  2NZ8 B;  4HDQ A;  2D9V A;  4K2O A;  1P6S A;  1MPH A;  2JP2 A;  1TXD A;  2OQB A;  5D3X A;  3D8E A;  3ODW A;  2GJY A;  2YS3 A;  1FGZ A;  4K17 A;  4B6H A;  3SNH A;  1KI1 B;  1SHC A;  2CY4 A;  2RUK B;  4L6E A;  1U5G A;  1SGH A;  1MK9 B;  4CHJ A;  5D3Y A;  4A5K A;  5DI9 B;  3ODO A;  4DX8 A;  1K5D B;  3PG7 A;  1QQG A;  3KRW A;  4EJN A;  2LYD A;  3TW1 A;  2KGX B;  2RGN B;  2L2I A;  3HQC A;  4HHV A;  1J0W A;  5HE0 A;  5JHG A;  2MFQ A;  3F5R A;  3D8D A;  3AJ4 A;  4HAY B;  1X86 A;  3PEG A;  5C5B B;  2J0J A;  3DXD A;  1E5W A;  2R0D A;  1Z87 A;  4IFS A;  1U29 A;  5LOP B;  2ELA A;  3LJU X;  2LOZ A;  3MPX A;  3GYP A;  5JP4 A;  2Z0O A;  2D2Q A;  4CYE A;  1H10 A;  2YS5 A;  5DIF B;  2P0D A;  1ISN A;  2VKI A;  4IOY X;  2FJL A;  2DX1 A;  3FEH A;  4GXB A;  1GC7 A;  4D0N B;  2MDX A;  2YF0 A;  2D11 A;  3BJI A;  1NTY A;  1WGQ A;  2P0H A;  2ROZ B;  1AQC A;  2ZPY A;  1DRO A;  1X05 A;  5C6R A;  1WJ1 A;  1GC6 A;  5DHF B;  2W2X C;  1WI1 A;  1X1F A;  2EMT A;  4F7U P;  3KRX A;  3AU5 A;  2W2W A;  2IYB A;  1GG3 A;  2MWN B;  4DBB A;  2E2X A;  1W1G A;  2CY5 A;  2DYN A;  2DYQ A;  2KUP A;  1EGX A;  2NMB A;  1UEF A;  4GZU A;  2ELB A;  4BBK A;  2L1C A;  4MT7 A;  4GN1 A;  4CHM A;  4ZRK A;  1ZM0 A;  2GCL A;  1OY2 A;  1KZG A;  2G35 A;  3WA0 A;  4KHO A;  1QC6 A;  1V5M A;  2YVC A;  1MAI A;  4KHB B;  1U5D A;  5CLL B;  5J3T A;  3U7D A;  3MDB C;  2GS0 A;  2CRF A;  3F0W A;  2COD A;  4HAV B;  3A8P A;  1XX0 A;  3ML4 A;  2D9X A;  3TO1 A;  3PP2 A;  3X23 A;  1FGY A;  4HAX B;  2Q13 A;  2YT0 A;  2COF A;  2BCJ A;  1OQN A;  1V5P A;  2ROV A;  1NTV A;  2CAY A;  1FAO A;  1XKE A;  1V88 A;  3GYO A;  2X18 A;  2AEH A;  2I1K A;  1P3R A;  2VRW B;  1X1G A;  3ULB A;  1DDW A;  1MIZ B;  3AU4 A;  1ZVR A;  5D3W A;  3PVW A;  1ZC3 B;  4H8S A;  4ZRI A;  1DDV A;  2DKP A;  2M38 A;  3DXC A;  4GPT B;  4P7I A;  4HB0 B;  1PFJ A;  2PZ1 A;  4A6K A;  3G9W A;  1U5E A;  2GCJ A;  1AWE A;  3FSS A;  4EMO A;  3PZD A;  5JHH A;  4DXA B;  2D9Y A;  1ZSQ A;  4WSF A;  1WVH A;  2RVB B;  3SO6 A;  2DX5 A;  1UPQ A;  4PQ0 A;  4F7G A;  2HE7 A;  3P6A A;  1B55 A;  3CIK A;  1LB1 A;  2DHJ A;  3QBV B;  5C16 A;  3KZ1 A;  5C5B A;  5J3Y A;  3N7C A;  2KCJ A;  1UPR A;  1RJ2 A;  3P7Z A;  1I2H A;  5JLJ B;  1OMW A;  3KSY A;  2Z0P A;  2AL6 A;  1M7R A;  2Y8G A;  4IAP A;  4A6F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...