5JP4A

Crystal structure of s. pombe dcp1 in complex with the decapping enhancer edc
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
EDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the SpEDC/Dcp1 complex
rcsb
source organism Schizosaccharomyces pombe
molecule tags Peptide binding protein
molecule keywords mRNA-decapping enzyme subunit 1
total genus 33
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5jp4A00
3ULCA 3TO1A 3OANA 1DDMA 1WI1A 3LJUX 3QWMA 3FSSA 2EJ8A 2P0HA 2ELBA 3D8DA 1XODA 4HAXB 2EMSA 2I5FA 4DXAB 1LB1A 4KHBB 4HATB 5J3YA 2UVMA 2YSZA 1N3HA 3PVWA 2KCJA 1XR0B 1WJMA 5DH9B 1XKEA 1WGUA 1Y19B 2AEHA 1I2HA 2GJYA 4CHMA 3HK0A 3U7DA 4A6HA 1EGXA 2ZPYA 1W1HA 2DYNA 5DHFB 2COFA 3ODXA 4K81A 2N0YA 2D10A 1Y5OA 4MY6A 2H7EA 5D3XA 2MKRA 4WJ7A 1KZGA 4Z2NA 4EMOA 2W2XD 4A6KA 5FI0A 5DHAB 1M7EA 1OY2A 4HB0B 1MK7B 3DXDA 3P6AA 3RCPA 4DX8A 1WVHA 5DIFB 4KAXB 2I1KA 1WJ1A 1NTYA 2K2UA 1UNRA 3GYOA 4HDQA 3N7CA 2YS1A 1NI2A 2KGXB 1DDWA 4GMXB 4XWXA 4CHJA 5CLQB 5JP4A 1X1GA 3QIJA 4HAYB 2D2QA 5D3YA 3MPXA 4GN1A 3PVLA 3SUZA 1MPHA 1SHCA 3ZDTA 3ML4A 3PP2A 5C16A 2YRYA 1I7AA 1X11A 4P7IA 1DYNA 4ZRIA 3BINA 4GPTB 4NY0A 2HE7A 2D11A 5C79A 1X1FA 2DX1A 2DFKA 2RVBB 4L6EA 4TKNA 2Z0OA 2GS0A 1ISNA 2I1JA 1NU2A 1FGYA 2OTXA 3GYPA 2I5CA 2Y7BA 4MK0A 3SYXA 4F7UP 2RUKB 1J0WA 4HDOA 2NZ8B 5HE2A 2K2JA 2GCJA 1NTVA 1RJ2A 4IFSA 2G35A 1U5FA 1K5GB 1J19A 4ZRKA 2R09A 1W1DA 3A8QA 1BWNA 1FB8A 2UZRA 3D8FA 5C5BB 5KQ4A 3KY9A 1RRPB 1U5EA 5HE0A 2M38A 5J3QA 4IOYX 5LOPB 1GC6A 3SNHA 2YS3A 2M14A 2Z0QA 5JLJB 2D4QA 3ZVRA 5J3TA 3FEHA 4HAUB 1DDVA 2P0DA 1W1GA 1ZM0A 1FHWA 1UPQA 3NSUA 4KHAA 4K2PA 2D9XA 1ZVRA 5D3WA 2YT1A 4KHOA 4HB3B 1B55A 2GCLA 1V88A 3KSYA 2V76A 4NSWA 1UNQA 2IYBA 3ODOA 1LW3A 3PEGA 4HAWB 1FHXA 5C6RA 1OQNA 3FM8C 3O96A 1SGHA 1V5MA 2DN6A 1U5DA 2DKPA 4PNKA 2J59M 2RNRB 1FGZA 4YONA 3M1IB 3CXBB 3HQCA 2DA0A 4A5KA 2PZ1A 1KI1B 2DKQA 5EFXA 2Q13A 1ZC4B 1X86A 2W2WA 2H7DA 4A6FB 4HB2B 3WYFB 2YF0A 2J0MA 1FOEA 3T06A 3KRXA 5HE1A 5D3VA 4KVGB 3A98B 3D8EA 4GZUA 1EF1A 4EKUA 4F7GA 2LOZA 1AWEA 2UZSA 4DBBA 2OQBA 2YT0A 3AU4A 4TYZA 1MAIA 1M7RA 2LG1A 4C0AA 1U2BA 3DXCA 4PQ0A 3ULBA 1MKEA 1UNPA 4CYEA 4WVFB 4Y94A 2IFSA 2X18A 1V5UA 3U8ZA 2N23A 3QBVB 1FHOA 3KRWA 5GOWB 1AQCA 1U29A 4GMVA 2RGNB 2L1CA 2CY5A 1U5GA 3V5WA 2DYQA 2COAA 1GG3A 4YL8A 3DXEA 1P6SA 3SO6A 2YS5A 1FAOA 5JHHA 1H4RA 1V89A 1PMSA 2CY4A 1TQZA 1P3RA 1H10A 4K17A 2Y8FA 5C5BA 1UPRA 1QQGA 2K00A 3ODWA 3KZ1A 4Z2MB 1DROA 4D0NB 2HTHB 3F0WA 3TVVA 4WSFA 2DHIA 4F7HA 1K5DB 5DI9B 1MIXA 3PG7A 2YVCA 2DTCA 2RLOA 1Z87A 1TXDA 5LONB 1MK9B 2NMBA 2W2XC 3CIKA 2ADZA 4HB4B 1V61A 3HW2B 2QKMA 5L81A 2LOXA 3A8PA 1BTNA 3PSCA 4GXBA 1MIZB 1E5WA 1TJ6A 1WGQA 2P0FA 1GC7A 1XX0A 1IRSA 4B6HA 2J0JA 3F5RA 2D9ZA 3P7ZA 3SV1A 1QC6A 3WA0A 3BJIA 2DLWA 1ZC3B 3AU5A 1PLSA 3MDBC 5D27A 2D9WA 2COCA 2D9VA 2E2XA 1BAKA 2CAYA 2J0KA 3IVFA 2ELAA 1PFJA 4HHVA 2CODA 3VIAA 1XD4A 2D9YA 1X05A 5CLLB 1V5PA 1EAZA 2MFQA 2LULA 5KCVA 4BBKA 2ROVA 2XQNM 3TFMA 1Q67A 2VSZA 1U27A 2MWNB 5KQ1A 2Z0PA 2L2IA 2MDXA 2ROZB 2EC1A 4ZRJA 1BTKA 3X23A 5FI1A 2DHJA 1P5TA 2DX5A 2JP2A 2BCJA 4DX90 3TW1A 4A6FA 2Y8GA 1WG7A 2VRWB 3G9WA 2EMTA 2DHKA 4EJNA 2LKOA 4MT7A 5HE3A 1ZSQA 1DBHA 1OMWA 2QKLA 2VKIA 5JHGA 2R0DA 3TCAA 2KUPA 3UZTA 4HAZB 4HAVB 1KZ7A 2FJLA 2AL6A 4IAPA 3AJ4A 2RSGA 3VOQA 1UEFA 2LYDA 1XCGA 2CRFA 3PVUA 2P8VA 1EVHA 3PZDA 4K2OA 4H8SA
chains in the Genus database with same CATH superfamily
3ULCA 3TO1A 3OANA 1DDMA 1WI1A 3LJUX 3QWMA 3FSSA 2EJ8A 2P0HA 3NW8A 2ELBA 2K49A 3D8DA 1XODA 4HAXB 2EMSA 2I5FA 4DXAB 1LB1A 4KHBB 4HATB 5J3YA 2UVMA 2YSZA 1N3HA 3PVWA 2KCJA 3DCXA 1XR0B 1WJMA 5DH9B 2Z4DA 1XKEA 4QJ4B 2Z13A 1WGUA 1Y19B 2AEHA 1I2HA 2GJYA 4CHMA 3HK0A 3U7DA 4A6HA 1EGXA 2NBVA 2ZPYA 1W1HA 2DYNA 4KHBA 2Z59A 5DHFB 2COFA 3ODXA 3NWAA 4K81A 2N0YA 2D10A 1Y5OA 4MY6A 1MI1A 2H7EA 5D3XA 2MKRA 4WJ7A 1KZGA 4Z2NA 4EMOA 2W2XD 4A6KA 5FI0A 5DHAB 1M7EA 1OY2A 5I2SA 4HB0B 1MK7B 3DXDA 3P6AA 3RCPA 4DX8A 1WVHA 5DIFB 4KAXB 2I1KA 1WJ1A 1NTYA 2RRFA 2K2UA 1UNRA 3GYOA 4HDQA 3N7CA 2YS1A 1NI2A 2KGXB 1DDWA 4GMXB 4XWXA 4CHJA 5CLQB 5JP4A 1X1GA 3QIJA 4HAYB 2D2QA 5D3YA 3MPXA 4GN1A 3PVLA 3SUZA 1MPHA 1SHCA 3ZDTA 3ML4A 3PP2A 5C16A 2YRYA 1I7AA 1X11A 4P7IA 1DYNA 4ZRIA 3BINA 4GPTB 4NY0A 2HE7A 2D11A 5C79A 1X1FA 2DX1A 2DFKA 2RVBB 4L6EA 4TKNA 5LG4B 2Z0OA 2R2YA 2GS0A 1ISNA 2I1JA 1NU2A 1FGYA 2OTXA 3GYPA 2I5CA 2Y7BA 4MK0A 3SYXA 4F7UP 2RUKB 1J0WA 5M4YB 4GNKB 4HDOA 2NZ8B 5HE2A 2K2JA 3B77A 2GCJA 1NTVA 1RJ2A 4IFSA 4CSQA 2G35A 1U5FA 1K5GB 1J19A 4ZRKA 2R09A 1W1DA 3A8QA 4OSNA 1BWNA 1FB8A 2UZRA 3D8FA 5C5BB 3OHMB 5KQ4A 3KY9A 1RRPB 1U5EA 5HE0A 2M38A 5J3QA 4L1RA 4QJ5B 4IOYX 5LOPB 1GC6A 3SNHA 3FVCA 2YS3A 2M14A 2Z0QA 5JLJB 2D4QA 3ZVRA 5J3TA 3FEHA 4HAUB 1DDVA 2P0DA 1W1GA 1ZM0A 1FHWA 1UPQA 3NSUA 5I2MA 4KHAA 4K2PA 2D9XA 1ZVRA 5D3WA 2YT1A 4KHOA 4HB3B 1B55A 2GCLA 1V88A 3KSYA 2V76A 4NSWA 1UNQA 2IYBA 3ODOA 1ZYIA 1LW3A 3PEGA 4HAWB 1FHXA 5C6RA 1OQNA 3FM8C 3O96A 1SGHA 1V5MA 2DN6A 1U5DA 2DKPA 4PNKA 2J59M 2RNRB 1FGZA 4YONA 3M1IB 3CXBB 3HQCA 2DA0A 4A5KA 2PZ1A 3U12A 1KI1B 2DKQA 5EFXA 2Q13A 1ZC4B 1X86A 2ZKMX 2W2WA 2H7DA 4A6FB 4HB2B 3WYFB 2YF0A 2J0MA 1FOEA 3T06A 3KRXA 5HE1A 5D3VA 2KIEA 4KVGB 3A98B 4OT1A 3D8EA 4GZUA 1EF1A 4EKUA 4F7GA 2LOZA 1AWEA 2UZSA 4DBBA 2OQBA 2YT0A 3AU4A 4TYZA 1MAIA 1M7RA 2LG1A 4C0AA 1U2BA 3DXCA 2FJUB 4PQ0A 3ULBA 1MKEA 1UNPA 4CYEA 3NWFA 4WVFB 4Y94A 2IFSA 2X18A 1V5UA 3U8ZA 4DIXA 2N23A 3QBVB 1FHOA 3KRWA 5GOWB 2K8EA 1AQCA 1U29A 4GMVA 2RGNB 2L1CA 2CY5A 1U5GA 3V5WA 2DYQA 2COAA 1GG3A 4YL8A 3DXEA 1P6SA 3SO6A 4D6WA 2YS5A 1FAOA 5JHHA 1H4RA 1V89A 1PMSA 1T77A 2CY4A 1TQZA 1P3RA 1H10A 4K17A 2Y8FA 2KUQA 5C5BA 1UPRA 1QQGA 2K00A 3ODWA 3KZ1A 4Z2MB 1DROA 4D0NB 2HTHB 2GUMA 3F0WA 3TVVA 4WSFA 2DHIA 4F7HA 1K5DB 5DI9B 1MIXA 3PG7A 3HSAA 2YVCA 2DTCA 2RLOA 1Z87A 1TXDA 5LONB 1MK9B 2NMBA 2W2XC 2Z14A 2ADZA 3CIKA 4HB4B 1V61A 3HW2B 2QKMA 5L81A 2LOXA 3A8PA 1BTNA 3PSCA 4GXBA 1MIZB 2YT2A 1E5WA 1TJ6A 1WGQA 2P0FA 1GC7A 1XX0A 1IRSA 4B6HA 2J0JA 3F5RA 5IRSA 2D9ZA 3P7ZA 3SV1A 3A58A 1QC6A 3WA0A 3BJIA 2DLWA 1ZC3B 3AU5A 1PLSA 3MDBC 5D27A 4QJ3B 2D9WA 2COCA 2D9VA 2E2XA 1BAKA 2CAYA 2J0KA 3IVFA 2ELAA 1PFJA 4HHVA 2CODA 2KIGA 3VIAA 1XD4A 2D9YA 4QXAB 1X05A 5CLLB 1V5PA 1EAZA 2MFQA 2LULA 5KCVA 4BBKA 2ROVA 2XQNM 3TFMA 1Q67A 2VSZA 1U27A 2MWNB 5KQ1A 2Z0PA 2L2IA 2MDXA 2ROZB 2EC1A 4ZRJA 1BTKA 3X23A 5FI1A 2DHJA 1P5TA 2DX5A 2JP2A 2BCJA 4DX90 3TW1A 4A6FA 2Y8GA 1WG7A 2VRWB 3G9WA 2EMTA 2DHKA 4EJNA 2LKOA 4MT7A 5HE3A 1ZSQA 1DBHA 1OMWA 2QKLA 2VKIA 3NWDA 5JHGA 2KR0A 2R0DA 4HSIA 3TCAA 2KUPA 3UZTA 4HAZB 4HAVB 1KZ7A 4GOUA 2FJLA 2AL6A 4IAPA 3AJ4A 2RSGA 3VOQA 1UEFA 2LYDA 1XCGA 2CRFA 3PVUA 2P8VA 1EVHA 3PZDA 4K2OA 4H8SA 3HIEA
chains in the Genus database with same CATH topology
3ULCA 3TO1A 3OANA 1DDMA 1WI1A 3LJUX 3QWMA 3FSSA 2EJ8A 2P0HA 2ELBA 3D8DA 1XODA 4HAXB 2EMSA 2I5FA 4DXAB 1LB1A 4KHBB 4HATB 5J3YA 2UVMA 2YSZA 1N3HA 3PVWA 2KCJA 1XR0B 1WJMA 5DH9B 1XKEA 1WGUA 1Y19B 2AEHA 1I2HA 2GJYA 4CHMA 3HK0A 3U7DA 4A6HA 1EGXA 2ZPYA 1W1HA 2DYNA 5DHFB 2COFA 3ODXA 4K81A 2N0YA 2D10A 1Y5OA 4MY6A 2H7EA 5D3XA 2MKRA 4WJ7A 1KZGA 4Z2NA 4EMOA 2W2XD 4A6KA 5FI0A 5DHAB 1M7EA 1OY2A 4HB0B 1MK7B 3DXDA 3P6AA 3RCPA 4DX8A 1WVHA 5DIFB 4KAXB 2I1KA 1WJ1A 1NTYA 2K2UA 1UNRA 3GYOA 4HDQA 3N7CA 2YS1A 1NI2A 2KGXB 1DDWA 4GMXB 4XWXA 4CHJA 5CLQB 5JP4A 1X1GA 3QIJA 4HAYB 2D2QA 5D3YA 3MPXA 4GN1A 3PVLA 3SUZA 1MPHA 1SHCA 3ZDTA 3ML4A 3PP2A 5C16A 2YRYA 1I7AA 1X11A 4P7IA 1DYNA 4ZRIA 3BINA 4GPTB 4NY0A 2HE7A 2D11A 5C79A 1X1FA 2DX1A 2DFKA 2RVBB 4L6EA 4TKNA 2Z0OA 2GS0A 1ISNA 2I1JA 1NU2A 1FGYA 2OTXA 3GYPA 2I5CA 2Y7BA 4MK0A 3SYXA 4F7UP 2RUKB 1J0WA 4HDOA 2NZ8B 5HE2A 2K2JA 2GCJA 1NTVA 1RJ2A 4IFSA 2G35A 1U5FA 1K5GB 1J19A 4ZRKA 2R09A 1W1DA 3A8QA 1BWNA 1FB8A 2UZRA 3D8FA 5C5BB 5KQ4A 3KY9A 1RRPB 1U5EA 5HE0A 2M38A 5J3QA 4IOYX 5LOPB 1GC6A 3SNHA 2YS3A 2M14A 2Z0QA 5JLJB 2D4QA 3ZVRA 5J3TA 3FEHA 4HAUB 1DDVA 2P0DA 1W1GA 1ZM0A 1FHWA 1UPQA 3NSUA 4KHAA 4K2PA 2D9XA 1ZVRA 5D3WA 2YT1A 4KHOA 4HB3B 1B55A 2GCLA 1V88A 3KSYA 2V76A 4NSWA 1UNQA 2IYBA 3ODOA 1LW3A 3PEGA 4HAWB 1FHXA 5C6RA 1OQNA 3FM8C 3O96A 1SGHA 1V5MA 2DN6A 1U5DA 2DKPA 4PNKA 2J59M 2RNRB 1FGZA 4YONA 3M1IB 3CXBB 3HQCA 2DA0A 4A5KA 2PZ1A 1KI1B 2DKQA 5EFXA 2Q13A 1ZC4B 1X86A 2W2WA 2H7DA 4A6FB 4HB2B 3WYFB 2YF0A 2J0MA 1FOEA 3T06A 3KRXA 5HE1A 5D3VA 4KVGB 3A98B 3D8EA 4GZUA 1EF1A 4EKUA 4F7GA 2LOZA 1AWEA 2UZSA 4DBBA 2OQBA 2YT0A 3AU4A 4TYZA 1MAIA 1M7RA 2LG1A 4C0AA 1U2BA 3DXCA 4PQ0A 3ULBA 1MKEA 1UNPA 4CYEA 4WVFB 4Y94A 2IFSA 2X18A 1V5UA 3U8ZA 2N23A 3QBVB 1FHOA 3KRWA 5GOWB 1AQCA 1U29A 4GMVA 2RGNB 2L1CA 2CY5A 1U5GA 3V5WA 2DYQA 2COAA 1GG3A 4YL8A 3DXEA 1P6SA 3SO6A 2YS5A 1FAOA 5JHHA 1H4RA 1V89A 1PMSA 2CY4A 1TQZA 1P3RA 1H10A 4K17A 2Y8FA 5C5BA 1UPRA 1QQGA 2K00A 3ODWA 3KZ1A 4Z2MB 1DROA 4D0NB 2HTHB 3F0WA 3TVVA 4WSFA 2DHIA 4F7HA 1K5DB 5DI9B 1MIXA 3PG7A 2YVCA 2DTCA 2RLOA 1Z87A 1TXDA 5LONB 1MK9B 2NMBA 2W2XC 3CIKA 2ADZA 4HB4B 1V61A 3HW2B 2QKMA 5L81A 2LOXA 3A8PA 1BTNA 3PSCA 4GXBA 1MIZB 1E5WA 1TJ6A 1WGQA 2P0FA 1GC7A 1XX0A 1IRSA 4B6HA 2J0JA 3F5RA 2D9ZA 3P7ZA 3SV1A 1QC6A 3WA0A 3BJIA 2DLWA 1ZC3B 3AU5A 1PLSA 3MDBC 5D27A 2D9WA 2COCA 2D9VA 2E2XA 1BAKA 2CAYA 2J0KA 3IVFA 2ELAA 1PFJA 4HHVA 2CODA 3VIAA 1XD4A 2D9YA 1X05A 5CLLB 1V5PA 1EAZA 2MFQA 2LULA 5KCVA 4BBKA 2ROVA 2XQNM 3TFMA 1Q67A 2VSZA 1U27A 2MWNB 5KQ1A 2Z0PA 2L2IA 2MDXA 2ROZB 2EC1A 4ZRJA 1BTKA 3X23A 5FI1A 2DHJA 1P5TA 2DX5A 2JP2A 2BCJA 4DX90 3TW1A 4A6FA 2Y8GA 1WG7A 2VRWB 3G9WA 2EMTA 2DHKA 4EJNA 2LKOA 4MT7A 5HE3A 1ZSQA 1DBHA 1OMWA 2QKLA 2VKIA 5JHGA 2R0DA 3TCAA 2KUPA 3UZTA 4HAZB 4HAVB 1KZ7A 2FJLA 2AL6A 4IAPA 3AJ4A 2RSGA 3VOQA 1UEFA 2LYDA 1XCGA 2CRFA 3PVUA 2P8VA 1EVHA 3PZDA 4K2OA 4H8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULC A;  3TO1 A;  3OAN A;  1DDM A;  1WI1 A;  3LJU X;  3QWM A;  3FSS A;  2EJ8 A;  2P0H A;  2ELB A;  3D8D A;  1XOD A;  4HAX B;  2EMS A;  2I5F A;  4DXA B;  1LB1 A;  4KHB B;  4HAT B;  5J3Y A;  2UVM A;  2YSZ A;  1N3H A;  3PVW A;  2KCJ A;  1XR0 B;  1WJM A;  5DH9 B;  1XKE A;  1WGU A;  1Y19 B;  2AEH A;  1I2H A;  2GJY A;  4CHM A;  3HK0 A;  3U7D A;  4A6H A;  1EGX A;  2ZPY A;  1W1H A;  2DYN A;  5DHF B;  2COF A;  3ODX A;  4K81 A;  2N0Y A;  2D10 A;  1Y5O A;  4MY6 A;  2H7E A;  5D3X A;  2MKR A;  4WJ7 A;  1KZG A;  4Z2N A;  4EMO A;  2W2X D;  4A6K A;  5FI0 A;  5DHA B;  1M7E A;  1OY2 A;  4HB0 B;  1MK7 B;  3DXD A;  3P6A A;  3RCP A;  4DX8 A;  1WVH A;  5DIF B;  4KAX B;  2I1K A;  1WJ1 A;  1NTY A;  2K2U A;  1UNR A;  3GYO A;  4HDQ A;  3N7C A;  2YS1 A;  1NI2 A;  2KGX B;  1DDW A;  4GMX B;  4XWX A;  4CHJ A;  5CLQ B;  5JP4 A;  1X1G A;  3QIJ A;  4HAY B;  2D2Q A;  5D3Y A;  3MPX A;  4GN1 A;  3PVL A;  3SUZ A;  1MPH A;  1SHC A;  3ZDT A;  3ML4 A;  3PP2 A;  5C16 A;  2YRY A;  1I7A A;  1X11 A;  4P7I A;  1DYN A;  4ZRI A;  3BIN A;  4GPT B;  4NY0 A;  2HE7 A;  2D11 A;  5C79 A;  1X1F A;  2DX1 A;  2DFK A;  2RVB B;  4L6E A;  4TKN A;  2Z0O A;  2GS0 A;  1ISN A;  2I1J A;  1NU2 A;  1FGY A;  2OTX A;  3GYP A;  2I5C A;  2Y7B A;  4MK0 A;  3SYX A;  4F7U P;  2RUK B;  1J0W A;  4HDO A;  2NZ8 B;  5HE2 A;  2K2J A;  2GCJ A;  1NTV A;  1RJ2 A;  4IFS A;  2G35 A;  1U5F A;  1K5G B;  1J19 A;  4ZRK A;  2R09 A;  1W1D A;  3A8Q A;  1BWN A;  1FB8 A;  2UZR A;  3D8F A;  5C5B B;  5KQ4 A;  3KY9 A;  1RRP B;  1U5E A;  5HE0 A;  2M38 A;  5J3Q A;  4IOY X;  5LOP B;  1GC6 A;  3SNH A;  2YS3 A;  2M14 A;  2Z0Q A;  5JLJ B;  2D4Q A;  3ZVR A;  5J3T A;  3FEH A;  4HAU B;  1DDV A;  2P0D A;  1W1G A;  1ZM0 A;  1FHW A;  1UPQ A;  3NSU A;  4KHA A;  4K2P A;  2D9X A;  1ZVR A;  5D3W A;  2YT1 A;  4KHO A;  4HB3 B;  1B55 A;  2GCL A;  1V88 A;  3KSY A;  2V76 A;  4NSW A;  1UNQ A;  2IYB A;  3ODO A;  1LW3 A;  3PEG A;  4HAW B;  1FHX A;  5C6R A;  1OQN A;  3FM8 C;  3O96 A;  1SGH A;  1V5M A;  2DN6 A;  1U5D A;  2DKP A;  4PNK A;  2J59 M;  2RNR B;  1FGZ A;  4YON A;  3M1I B;  3CXB B;  3HQC A;  2DA0 A;  4A5K A;  2PZ1 A;  1KI1 B;  2DKQ A;  5EFX A;  2Q13 A;  1ZC4 B;  1X86 A;  2W2W A;  2H7D A;  4A6F B;  4HB2 B;  3WYF B;  2YF0 A;  2J0M A;  1FOE A;  3T06 A;  3KRX A;  5HE1 A;  5D3V A;  4KVG B;  3A98 B;  3D8E A;  4GZU A;  1EF1 A;  4EKU A;  4F7G A;  2LOZ A;  1AWE A;  2UZS A;  4DBB A;  2OQB A;  2YT0 A;  3AU4 A;  4TYZ A;  1MAI A;  1M7R A;  2LG1 A;  4C0A A;  1U2B A;  3DXC A;  4PQ0 A;  3ULB A;  1MKE A;  1UNP A;  4CYE A;  4WVF B;  4Y94 A;  2IFS A;  2X18 A;  1V5U A;  3U8Z A;  2N23 A;  3QBV B;  1FHO A;  3KRW A;  5GOW B;  1AQC A;  1U29 A;  4GMV A;  2RGN B;  2L1C A;  2CY5 A;  1U5G A;  3V5W A;  2DYQ A;  2COA A;  1GG3 A;  4YL8 A;  3DXE A;  1P6S A;  3SO6 A;  2YS5 A;  1FAO A;  5JHH A;  1H4R A;  1V89 A;  1PMS A;  2CY4 A;  1TQZ A;  1P3R A;  1H10 A;  4K17 A;  2Y8F A;  5C5B A;  1UPR A;  1QQG A;  2K00 A;  3ODW A;  3KZ1 A;  4Z2M B;  1DRO A;  4D0N B;  2HTH B;  3F0W A;  3TVV A;  4WSF A;  2DHI A;  4F7H A;  1K5D B;  5DI9 B;  1MIX A;  3PG7 A;  2YVC A;  2DTC A;  2RLO A;  1Z87 A;  1TXD A;  5LON B;  1MK9 B;  2NMB A;  2W2X C;  3CIK A;  2ADZ A;  4HB4 B;  1V61 A;  3HW2 B;  2QKM A;  5L81 A;  2LOX A;  3A8P A;  1BTN A;  3PSC A;  4GXB A;  1MIZ B;  1E5W A;  1TJ6 A;  1WGQ A;  2P0F A;  1GC7 A;  1XX0 A;  1IRS A;  4B6H A;  2J0J A;  3F5R A;  2D9Z A;  3P7Z A;  3SV1 A;  1QC6 A;  3WA0 A;  3BJI A;  2DLW A;  1ZC3 B;  3AU5 A;  1PLS A;  3MDB C;  5D27 A;  2D9W A;  2COC A;  2D9V A;  2E2X A;  1BAK A;  2CAY A;  2J0K A;  3IVF A;  2ELA A;  1PFJ A;  4HHV A;  2COD A;  3VIA A;  1XD4 A;  2D9Y A;  1X05 A;  5CLL B;  1V5P A;  1EAZ A;  2MFQ A;  2LUL A;  5KCV A;  4BBK A;  2ROV A;  2XQN M;  3TFM A;  1Q67 A;  2VSZ A;  1U27 A;  2MWN B;  5KQ1 A;  2Z0P A;  2L2I A;  2MDX A;  2ROZ B;  2EC1 A;  4ZRJ A;  1BTK A;  3X23 A;  5FI1 A;  2DHJ A;  1P5T A;  2DX5 A;  2JP2 A;  2BCJ A;  4DX9 0;  3TW1 A;  4A6F A;  2Y8G A;  1WG7 A;  2VRW B;  3G9W A;  2EMT A;  2DHK A;  4EJN A;  2LKO A;  4MT7 A;  5HE3 A;  1ZSQ A;  1DBH A;  1OMW A;  2QKL A;  2VKI A;  5JHG A;  2R0D A;  3TCA A;  2KUP A;  3UZT A;  4HAZ B;  4HAV B;  1KZ7 A;  2FJL A;  2AL6 A;  4IAP A;  3AJ4 A;  2RSG A;  3VOQ A;  1UEF A;  2LYD A;  1XCG A;  2CRF A;  3PVU A;  2P8V A;  1EVH A;  3PZD A;  4K2O A;  4H8S A; 
#chains in the Genus database with same CATH topology
 3ULC A;  3TO1 A;  3OAN A;  1DDM A;  1WI1 A;  3LJU X;  3QWM A;  3FSS A;  2EJ8 A;  2P0H A;  3NW8 A;  2ELB A;  2K49 A;  3D8D A;  1XOD A;  4HAX B;  2EMS A;  2I5F A;  4DXA B;  1LB1 A;  4KHB B;  4HAT B;  5J3Y A;  2UVM A;  2YSZ A;  1N3H A;  3PVW A;  2KCJ A;  3DCX A;  1XR0 B;  1WJM A;  5DH9 B;  2Z4D A;  1XKE A;  4QJ4 B;  2Z13 A;  1WGU A;  1Y19 B;  2AEH A;  1I2H A;  2GJY A;  4CHM A;  3HK0 A;  3U7D A;  4A6H A;  1EGX A;  2NBV A;  2ZPY A;  1W1H A;  2DYN A;  4KHB A;  2Z59 A;  5DHF B;  2COF A;  3ODX A;  3NWA A;  4K81 A;  2N0Y A;  2D10 A;  1Y5O A;  4MY6 A;  1MI1 A;  2H7E A;  5D3X A;  2MKR A;  4WJ7 A;  1KZG A;  4Z2N A;  4EMO A;  2W2X D;  4A6K A;  5FI0 A;  5DHA B;  1M7E A;  1OY2 A;  5I2S A;  4HB0 B;  1MK7 B;  3DXD A;  3P6A A;  3RCP A;  4DX8 A;  1WVH A;  5DIF B;  4KAX B;  2I1K A;  1WJ1 A;  1NTY A;  2RRF A;  2K2U A;  1UNR A;  3GYO A;  4HDQ A;  3N7C A;  2YS1 A;  1NI2 A;  2KGX B;  1DDW A;  4GMX B;  4XWX A;  4CHJ A;  5CLQ B;  5JP4 A;  1X1G A;  3QIJ A;  4HAY B;  2D2Q A;  5D3Y A;  3MPX A;  4GN1 A;  3PVL A;  3SUZ A;  1MPH A;  1SHC A;  3ZDT A;  3ML4 A;  3PP2 A;  5C16 A;  2YRY A;  1I7A A;  1X11 A;  4P7I A;  1DYN A;  4ZRI A;  3BIN A;  4GPT B;  4NY0 A;  2HE7 A;  2D11 A;  5C79 A;  1X1F A;  2DX1 A;  2DFK A;  2RVB B;  4L6E A;  4TKN A;  5LG4 B;  2Z0O A;  2R2Y A;  2GS0 A;  1ISN A;  2I1J A;  1NU2 A;  1FGY A;  2OTX A;  3GYP A;  2I5C A;  2Y7B A;  4MK0 A;  3SYX A;  4F7U P;  2RUK B;  1J0W A;  5M4Y B;  4GNK B;  4HDO A;  2NZ8 B;  5HE2 A;  2K2J A;  3B77 A;  2GCJ A;  1NTV A;  1RJ2 A;  4IFS A;  4CSQ A;  2G35 A;  1U5F A;  1K5G B;  1J19 A;  4ZRK A;  2R09 A;  1W1D A;  3A8Q A;  4OSN A;  1BWN A;  1FB8 A;  2UZR A;  3D8F A;  5C5B B;  3OHM B;  5KQ4 A;  3KY9 A;  1RRP B;  1U5E A;  5HE0 A;  2M38 A;  5J3Q A;  4L1R A;  4QJ5 B;  4IOY X;  5LOP B;  1GC6 A;  3SNH A;  3FVC A;  2YS3 A;  2M14 A;  2Z0Q A;  5JLJ B;  2D4Q A;  3ZVR A;  5J3T A;  3FEH A;  4HAU B;  1DDV A;  2P0D A;  1W1G A;  1ZM0 A;  1FHW A;  1UPQ A;  3NSU A;  5I2M A;  4KHA A;  4K2P A;  2D9X A;  1ZVR A;  5D3W A;  2YT1 A;  4KHO A;  4HB3 B;  1B55 A;  2GCL A;  1V88 A;  3KSY A;  2V76 A;  4NSW A;  1UNQ A;  2IYB A;  3ODO A;  1ZYI A;  1LW3 A;  3PEG A;  4HAW B;  1FHX A;  5C6R A;  1OQN A;  3FM8 C;  3O96 A;  1SGH A;  1V5M A;  2DN6 A;  1U5D A;  2DKP A;  4PNK A;  2J59 M;  2RNR B;  1FGZ A;  4YON A;  3M1I B;  3CXB B;  3HQC A;  2DA0 A;  4A5K A;  2PZ1 A;  3U12 A;  1KI1 B;  2DKQ A;  5EFX A;  2Q13 A;  1ZC4 B;  1X86 A;  2ZKM X;  2W2W A;  2H7D A;  4A6F B;  4HB2 B;  3WYF B;  2YF0 A;  2J0M A;  1FOE A;  3T06 A;  3KRX A;  5HE1 A;  5D3V A;  2KIE A;  4KVG B;  3A98 B;  4OT1 A;  3D8E A;  4GZU A;  1EF1 A;  4EKU A;  4F7G A;  2LOZ A;  1AWE A;  2UZS A;  4DBB A;  2OQB A;  2YT0 A;  3AU4 A;  4TYZ A;  1MAI A;  1M7R A;  2LG1 A;  4C0A A;  1U2B A;  3DXC A;  2FJU B;  4PQ0 A;  3ULB A;  1MKE A;  1UNP A;  4CYE A;  3NWF A;  4WVF B;  4Y94 A;  2IFS A;  2X18 A;  1V5U A;  3U8Z A;  4DIX A;  2N23 A;  3QBV B;  1FHO A;  3KRW A;  5GOW B;  2K8E A;  1AQC A;  1U29 A;  4GMV A;  2RGN B;  2L1C A;  2CY5 A;  1U5G A;  3V5W A;  2DYQ A;  2COA A;  1GG3 A;  4YL8 A;  3DXE A;  1P6S A;  3SO6 A;  4D6W A;  2YS5 A;  1FAO A;  5JHH A;  1H4R A;  1V89 A;  1PMS A;  1T77 A;  2CY4 A;  1TQZ A;  1P3R A;  1H10 A;  4K17 A;  2Y8F A;  2KUQ A;  5C5B A;  1UPR A;  1QQG A;  2K00 A;  3ODW A;  3KZ1 A;  4Z2M B;  1DRO A;  4D0N B;  2HTH B;  2GUM A;  3F0W A;  3TVV A;  4WSF A;  2DHI A;  4F7H A;  1K5D B;  5DI9 B;  1MIX A;  3PG7 A;  3HSA A;  2YVC A;  2DTC A;  2RLO A;  1Z87 A;  1TXD A;  5LON B;  1MK9 B;  2NMB A;  2W2X C;  2Z14 A;  2ADZ A;  3CIK A;  4HB4 B;  1V61 A;  3HW2 B;  2QKM A;  5L81 A;  2LOX A;  3A8P A;  1BTN A;  3PSC A;  4GXB A;  1MIZ B;  2YT2 A;  1E5W A;  1TJ6 A;  1WGQ A;  2P0F A;  1GC7 A;  1XX0 A;  1IRS A;  4B6H A;  2J0J A;  3F5R A;  5IRS A;  2D9Z A;  3P7Z A;  3SV1 A;  3A58 A;  1QC6 A;  3WA0 A;  3BJI A;  2DLW A;  1ZC3 B;  3AU5 A;  1PLS A;  3MDB C;  5D27 A;  4QJ3 B;  2D9W A;  2COC A;  2D9V A;  2E2X A;  1BAK A;  2CAY A;  2J0K A;  3IVF A;  2ELA A;  1PFJ A;  4HHV A;  2COD A;  2KIG A;  3VIA A;  1XD4 A;  2D9Y A;  4QXA B;  1X05 A;  5CLL B;  1V5P A;  1EAZ A;  2MFQ A;  2LUL A;  5KCV A;  4BBK A;  2ROV A;  2XQN M;  3TFM A;  1Q67 A;  2VSZ A;  1U27 A;  2MWN B;  5KQ1 A;  2Z0P A;  2L2I A;  2MDX A;  2ROZ B;  2EC1 A;  4ZRJ A;  1BTK A;  3X23 A;  5FI1 A;  2DHJ A;  1P5T A;  2DX5 A;  2JP2 A;  2BCJ A;  4DX9 0;  3TW1 A;  4A6F A;  2Y8G A;  1WG7 A;  2VRW B;  3G9W A;  2EMT A;  2DHK A;  4EJN A;  2LKO A;  4MT7 A;  5HE3 A;  1ZSQ A;  1DBH A;  1OMW A;  2QKL A;  2VKI A;  3NWD A;  5JHG A;  2KR0 A;  2R0D A;  4HSI A;  3TCA A;  2KUP A;  3UZT A;  4HAZ B;  4HAV B;  1KZ7 A;  4GOU A;  2FJL A;  2AL6 A;  4IAP A;  3AJ4 A;  2RSG A;  3VOQ A;  1UEF A;  2LYD A;  1XCG A;  2CRF A;  3PVU A;  2P8V A;  1EVH A;  3PZD A;  4K2O A;  4H8S A;  3HIE A; 
#chains in the Genus database with same CATH homology
 3ULC A;  3TO1 A;  3OAN A;  1DDM A;  1WI1 A;  3LJU X;  3QWM A;  3FSS A;  2EJ8 A;  2P0H A;  2ELB A;  3D8D A;  1XOD A;  4HAX B;  2EMS A;  2I5F A;  4DXA B;  1LB1 A;  4KHB B;  4HAT B;  5J3Y A;  2UVM A;  2YSZ A;  1N3H A;  3PVW A;  2KCJ A;  1XR0 B;  1WJM A;  5DH9 B;  1XKE A;  1WGU A;  1Y19 B;  2AEH A;  1I2H A;  2GJY A;  4CHM A;  3HK0 A;  3U7D A;  4A6H A;  1EGX A;  2ZPY A;  1W1H A;  2DYN A;  5DHF B;  2COF A;  3ODX A;  4K81 A;  2N0Y A;  2D10 A;  1Y5O A;  4MY6 A;  2H7E A;  5D3X A;  2MKR A;  4WJ7 A;  1KZG A;  4Z2N A;  4EMO A;  2W2X D;  4A6K A;  5FI0 A;  5DHA B;  1M7E A;  1OY2 A;  4HB0 B;  1MK7 B;  3DXD A;  3P6A A;  3RCP A;  4DX8 A;  1WVH A;  5DIF B;  4KAX B;  2I1K A;  1WJ1 A;  1NTY A;  2K2U A;  1UNR A;  3GYO A;  4HDQ A;  3N7C A;  2YS1 A;  1NI2 A;  2KGX B;  1DDW A;  4GMX B;  4XWX A;  4CHJ A;  5CLQ B;  5JP4 A;  1X1G A;  3QIJ A;  4HAY B;  2D2Q A;  5D3Y A;  3MPX A;  4GN1 A;  3PVL A;  3SUZ A;  1MPH A;  1SHC A;  3ZDT A;  3ML4 A;  3PP2 A;  5C16 A;  2YRY A;  1I7A A;  1X11 A;  4P7I A;  1DYN A;  4ZRI A;  3BIN A;  4GPT B;  4NY0 A;  2HE7 A;  2D11 A;  5C79 A;  1X1F A;  2DX1 A;  2DFK A;  2RVB B;  4L6E A;  4TKN A;  2Z0O A;  2GS0 A;  1ISN A;  2I1J A;  1NU2 A;  1FGY A;  2OTX A;  3GYP A;  2I5C A;  2Y7B A;  4MK0 A;  3SYX A;  4F7U P;  2RUK B;  1J0W A;  4HDO A;  2NZ8 B;  5HE2 A;  2K2J A;  2GCJ A;  1NTV A;  1RJ2 A;  4IFS A;  2G35 A;  1U5F A;  1K5G B;  1J19 A;  4ZRK A;  2R09 A;  1W1D A;  3A8Q A;  1BWN A;  1FB8 A;  2UZR A;  3D8F A;  5C5B B;  5KQ4 A;  3KY9 A;  1RRP B;  1U5E A;  5HE0 A;  2M38 A;  5J3Q A;  4IOY X;  5LOP B;  1GC6 A;  3SNH A;  2YS3 A;  2M14 A;  2Z0Q A;  5JLJ B;  2D4Q A;  3ZVR A;  5J3T A;  3FEH A;  4HAU B;  1DDV A;  2P0D A;  1W1G A;  1ZM0 A;  1FHW A;  1UPQ A;  3NSU A;  4KHA A;  4K2P A;  2D9X A;  1ZVR A;  5D3W A;  2YT1 A;  4KHO A;  4HB3 B;  1B55 A;  2GCL A;  1V88 A;  3KSY A;  2V76 A;  4NSW A;  1UNQ A;  2IYB A;  3ODO A;  1LW3 A;  3PEG A;  4HAW B;  1FHX A;  5C6R A;  1OQN A;  3FM8 C;  3O96 A;  1SGH A;  1V5M A;  2DN6 A;  1U5D A;  2DKP A;  4PNK A;  2J59 M;  2RNR B;  1FGZ A;  4YON A;  3M1I B;  3CXB B;  3HQC A;  2DA0 A;  4A5K A;  2PZ1 A;  1KI1 B;  2DKQ A;  5EFX A;  2Q13 A;  1ZC4 B;  1X86 A;  2W2W A;  2H7D A;  4A6F B;  4HB2 B;  3WYF B;  2YF0 A;  2J0M A;  1FOE A;  3T06 A;  3KRX A;  5HE1 A;  5D3V A;  4KVG B;  3A98 B;  3D8E A;  4GZU A;  1EF1 A;  4EKU A;  4F7G A;  2LOZ A;  1AWE A;  2UZS A;  4DBB A;  2OQB A;  2YT0 A;  3AU4 A;  4TYZ A;  1MAI A;  1M7R A;  2LG1 A;  4C0A A;  1U2B A;  3DXC A;  4PQ0 A;  3ULB A;  1MKE A;  1UNP A;  4CYE A;  4WVF B;  4Y94 A;  2IFS A;  2X18 A;  1V5U A;  3U8Z A;  2N23 A;  3QBV B;  1FHO A;  3KRW A;  5GOW B;  1AQC A;  1U29 A;  4GMV A;  2RGN B;  2L1C A;  2CY5 A;  1U5G A;  3V5W A;  2DYQ A;  2COA A;  1GG3 A;  4YL8 A;  3DXE A;  1P6S A;  3SO6 A;  2YS5 A;  1FAO A;  5JHH A;  1H4R A;  1V89 A;  1PMS A;  2CY4 A;  1TQZ A;  1P3R A;  1H10 A;  4K17 A;  2Y8F A;  5C5B A;  1UPR A;  1QQG A;  2K00 A;  3ODW A;  3KZ1 A;  4Z2M B;  1DRO A;  4D0N B;  2HTH B;  3F0W A;  3TVV A;  4WSF A;  2DHI A;  4F7H A;  1K5D B;  5DI9 B;  1MIX A;  3PG7 A;  2YVC A;  2DTC A;  2RLO A;  1Z87 A;  1TXD A;  5LON B;  1MK9 B;  2NMB A;  2W2X C;  3CIK A;  2ADZ A;  4HB4 B;  1V61 A;  3HW2 B;  2QKM A;  5L81 A;  2LOX A;  3A8P A;  1BTN A;  3PSC A;  4GXB A;  1MIZ B;  1E5W A;  1TJ6 A;  1WGQ A;  2P0F A;  1GC7 A;  1XX0 A;  1IRS A;  4B6H A;  2J0J A;  3F5R A;  2D9Z A;  3P7Z A;  3SV1 A;  1QC6 A;  3WA0 A;  3BJI A;  2DLW A;  1ZC3 B;  3AU5 A;  1PLS A;  3MDB C;  5D27 A;  2D9W A;  2COC A;  2D9V A;  2E2X A;  1BAK A;  2CAY A;  2J0K A;  3IVF A;  2ELA A;  1PFJ A;  4HHV A;  2COD A;  3VIA A;  1XD4 A;  2D9Y A;  1X05 A;  5CLL B;  1V5P A;  1EAZ A;  2MFQ A;  2LUL A;  5KCV A;  4BBK A;  2ROV A;  2XQN M;  3TFM A;  1Q67 A;  2VSZ A;  1U27 A;  2MWN B;  5KQ1 A;  2Z0P A;  2L2I A;  2MDX A;  2ROZ B;  2EC1 A;  4ZRJ A;  1BTK A;  3X23 A;  5FI1 A;  2DHJ A;  1P5T A;  2DX5 A;  2JP2 A;  2BCJ A;  4DX9 0;  3TW1 A;  4A6F A;  2Y8G A;  1WG7 A;  2VRW B;  3G9W A;  2EMT A;  2DHK A;  4EJN A;  2LKO A;  4MT7 A;  5HE3 A;  1ZSQ A;  1DBH A;  1OMW A;  2QKL A;  2VKI A;  5JHG A;  2R0D A;  3TCA A;  2KUP A;  3UZT A;  4HAZ B;  4HAV B;  1KZ7 A;  2FJL A;  2AL6 A;  4IAP A;  3AJ4 A;  2RSG A;  3VOQ A;  1UEF A;  2LYD A;  1XCG A;  2CRF A;  3PVU A;  2P8V A;  1EVH A;  3PZD A;  4K2O A;  4H8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...