5JP4A

Crystal structure of s. pombe dcp1 in complex with the decapping enhancer edc
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
b'EDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA-decapping enzyme subunit 1
publication title Structure of the SpEDC/Dcp1 complex
rcsb
source organism Schizosaccharomyces pombe
molecule tags Peptide binding protein
total genus 33
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5jp4A00
1XKEA 2J0MA 1PMSA 5D3YA 5KQ1A 4K2OA 1UPQA 3M1IB 1GG3A 1X1FA 2IYBA 1P5TA 1BTNA 1KI1B 2P8VA 4A6HA 3LJUX 2LOXA 3ML4A 3ULCA 4DX8A 3SO6A 2UZSA 1Y5OA 2YS1A 3GYPA 4F7GA 1WVHA 2I1KA 4TYZA 1IRSA 2H7DA 3D8EA 1NU2A 1WG7A 3FEHA 2J59M 4A6FB 4HHVA 1NTVA 3VOQA 2DKQA 5EFXA 4ZRJA 1MKEA 4Z2NA 2D9ZA 2MDXA 4HAZB 4H8SA 1E5WA 4A5KA 4CHMA 3HQCA 2P0FA 3G9WA 2PZ1A 3SYXA 4BBKA 3KRWA 4HAUB 3TW1A 2D9VA 3MPXA 4L6EA 2W2WA 3PP2A 1UNQA 5JP4A 4KHBB 4HB0B 5D3WA 5C16A 4HDQA 4A6KA 2D9WA 2YT1A 2ROZB 3PVLA 2DLWA 1J19A 2DX5A 3SUZA 2M14A 1XR0B 3HK0A 1W1DA 2GCJA 4IFSA 2FJLA 1V61A 2EMTA 5DHFB 5FI1A 1BAKA 3SNHA 1FHWA 2W2XD 4ZRIA 5DI9B 2XQNM 3AU4A 3ODXA 4KHAA 5KCVA 1ZC4B 2L1CA 3FSSA 2DHJA 1X86A 2I5CA 2K2UA 1ZVRA 3A8PA 1X05A 5JHGA 1Q67A 1WGUA 4IAPA 3O96A 3QWMA 2Z0PA 3PEGA 2DX1A 4YL8A 1QC6A 2COCA 5L81A 1RRPB 3DXCA 5FI0A 3ZVRA 2N0YA 3U7DA 2Z0QA 1AQCA 4ZRKA 3T06A 1ZM0A 4HB4B 1ISNA 1UPRA 4YONA 2RVBB 2DFKA 1X11A 3OANA 2Y8GA 3ODWA 2OTXA 2AEHA 4EJNA 3PG7A 3HW2B 3ULBA 1H4RA 4HAYB 1PFJA 5D27A 2IFSA 2W2XC 4K2PA 2ROVA 2X18A 1U5FA 5HE0A 2EC1A 1U27A 1EF1A 2D9YA 1MIXA 2HE7A 4GMVA 2ELAA 5C5BB 1MPHA 2ZPYA 5DIFB 1EGXA 4F7HA 4EKUA 1WGQA 4WSFA 4D0NB 2GJYA 2LOZA 2DN6A 2NZ8B 2EJ8A 5J3QA 1SHCA 3FM8C 1I7AA 4HB2B 4C0AA 3P6AA 2RSGA 3PVUA 3ZDTA 2CY4A 2MFQA 1ZSQA 1UNRA 1QQGA 3PSCA 1J0WA 2COFA 1XODA 1U2BA 1FGZA 1U5DA 1B55A 4A6FA 1P6SA 2VRWB 2P0DA 4HAWB 4B6HA 2DYQA 3KRXA 4NY0A 1Z87A 5J3TA 3GYOA 1M7EA 1RJ2A 1OMWA 2YS3A 1OQNA 3ODOA 1M7RA 2CRFA 3KZ1A 2JP2A 2RLOA 2CAYA 4XWXA 1DDMA 2VSZA 1V5UA 1MIZB 3TCAA 3AU5A 3CIKA 1TXDA 1GC6A 3BINA 3CXBB 5LONB 1V89A 4EMOA 5HE2A 2Y7BA 2D10A 4DXAB 1I2HA 2KUPA 2I1JA 1XD4A 2V76A 1Y19B 1P3RA 1GC7A 1H10A 3U8ZA 4DBBA 4MY6A 2Z0OA 2D2QA 5J3YA 3AJ4A 4WVFB 3PZDA 1NI2A 3P7ZA 1BWNA 4Z2MB 2QKMA 2YT0A 2Y8FA 1ZC3B 1SGHA 2KGXB 1NTYA 1WJ1A 2DHIA 5LOPB 2EMSA 4MK0A 2N23A 1U5EA 1V88A 2J0KA 5KQ4A 2M38A 3DXEA 1XX0A 2H7EA 2J0JA 2K2JA 4HB3B 5C79A 3SV1A 3F5RA 1FGYA 5CLLB 4PQ0A 1X1GA 3PVWA 1N3HA 2DA0A 3QIJA 2MWNB 1UEFA 4F7UP 2CODA 3QBVB 2LULA 1TJ6A 4HDOA 3F0WA 4NSWA 3UZTA 2DKPA 1DDVA 4GMXB 2I5FA 5D3XA 1KZGA 4HAXB 1LW3A 3A8QA 3IVFA 2YRYA 1LB1A 1WI1A 4HATB 5D3VA 2D9XA 5C5BA 1XCGA 1TQZA 3D8FA 1DROA 1W1GA 1KZ7A 2Q13A 5CLQB 1EVHA 4K81A 2P0HA 3V5WA 2QKLA 2L2IA 2UVMA 2LKOA 2HTHB 5DH9B 2YSZA 2UZRA 1EAZA 5C6RA 1DYNA 2GCLA 1PLSA 3VIAA 1DBHA 1MK7B 4CYEA 1MAIA 1U29A 5HE3A 4GZUA 2MKRA 5GOWB 1MK9B 3MDBC 4KVGB 5JHHA 2D11A 2YS5A 4DX90 2D4QA 2GS0A 2DHKA 3WA0A 2CY5A 2VKIA 3BJIA 1V5PA 2RNRB 2R0DA 5JLJB 4P7IA 4TKNA 2E2XA 3DXDA 4HAVB 4GPTB 2BCJA 3KY9A 3TFMA 3X23A 5HE1A 4K17A 4GXBA 1DDWA 2R09A 2DTCA 4Y94A 1U5GA 3RCPA 2RGNB 4MT7A 3N7CA 1AWEA 3A98B 2DYNA 4CHJA 2ADZA 1FAOA 2ELBA 2G35A 1UNPA 3TVVA 1K5GB 2K00A 2LYDA 1K5DB 3TO1A 4IOYX 1FHOA 1FOEA 1W1HA 4KHOA 2YF0A 3WYFB 2LG1A 2YVCA 1WJMA 3D8DA 1BTKA 2COAA 1FB8A 4GN1A 4KAXB 5DHAB 1FHXA 1OY2A 4WJ7A 4PNKA 2AL6A 2NMBA 2OQBA 2RUKB 3NSUA 2KCJA 3KSYA 1V5MA
chains in the Genus database with same CATH superfamily
1XKEA 2J0MA 1PMSA 5D3YA 5KQ1A 4K2OA 1UPQA 3M1IB 1GG3A 1X1FA 2IYBA 1P5TA 1BTNA 1KI1B 2R2YA 2P8VA 4A6HA 3LJUX 2LOXA 2YT2A 3ML4A 3ULCA 4DX8A 3SO6A 2UZSA 1Y5OA 2YS1A 3GYPA 4F7GA 1WVHA 2I1KA 4TYZA 1IRSA 2H7DA 3DCXA 3D8EA 1NU2A 1WG7A 3FEHA 2J59M 4A6FB 4HHVA 1NTVA 1MI1A 3VOQA 2DKQA 5EFXA 4ZRJA 1MKEA 4Z2NA 2FJUB 2D9ZA 2MDXA 5M4YB 4HAZB 4H8SA 1E5WA 4A5KA 4CHMA 3HQCA 2P0FA 3G9WA 2PZ1A 3SYXA 4BBKA 3KRWA 2KR0A 4HAUB 3NWFA 2D9VA 3TW1A 3MPXA 4L6EA 2W2WA 3PP2A 1UNQA 5JP4A 4KHBB 4HB0B 5D3WA 5C16A 4HDQA 4A6KA 2D9WA 2YT1A 2ROZB 3PVLA 2DLWA 1J19A 4QXAB 2DX5A 3SUZA 2M14A 2RRFA 1XR0B 3HK0A 3FVCA 1W1DA 2GCJA 4IFSA 2FJLA 1V61A 3NW8A 2EMTA 5DHFB 5FI1A 1BAKA 3SNHA 1FHWA 2W2XD 4ZRIA 5DI9B 2XQNM 3AU4A 3ODXA 4KHAA 5KCVA 1ZC4B 2L1CA 2KIGA 3FSSA 2DHJA 1X86A 2I5CA 2K2UA 1ZVRA 3A8PA 4D6WA 1X05A 5JHGA 1Q67A 1WGUA 4IAPA 3O96A 3QWMA 1ZYIA 2Z59A 2Z0PA 2NBVA 3PEGA 2DX1A 4YL8A 1QC6A 2COCA 5L81A 1RRPB 3DXCA 5FI0A 3ZVRA 2N0YA 3U7DA 2Z0QA 1AQCA 4ZRKA 3T06A 1ZM0A 4HB4B 1ISNA 1UPRA 4YONA 4QJ4B 2RVBB 2DFKA 1X11A 3OANA 2Y8GA 3ODWA 2OTXA 2AEHA 4EJNA 3PG7A 3HW2B 3ULBA 1H4RA 4HAYB 1PFJA 5D27A 2IFSA 2W2XC 4K2PA 2ROVA 2X18A 1U5FA 5HE0A 2EC1A 1U27A 1EF1A 2D9YA 1MIXA 2HE7A 4GMVA 2ELAA 3NWAA 5C5BB 1MPHA 2ZPYA 3HIEA 5DIFB 1EGXA 4F7HA 4EKUA 1WGQA 4WSFA 4D0NB 2GJYA 2LOZA 2DN6A 2NZ8B 3OHMB 2EJ8A 5J3QA 1SHCA 3FM8C 1I7AA 4HB2B 4C0AA 3P6AA 2RSGA 3PVUA 3ZDTA 2CY4A 2MFQA 1ZSQA 2Z4DA 5IRSA 1UNRA 1QQGA 3PSCA 1J0WA 2COFA 1XODA 1U2BA 1FGZA 1U5DA 1B55A 4A6FA 1P6SA 2VRWB 2P0DA 4HAWB 4B6HA 2DYQA 2KUQA 3KRXA 4NY0A 1Z87A 5J3TA 4OT1A 3GYOA 1M7EA 1RJ2A 3A58A 1OMWA 2YS3A 1OQNA 3ODOA 1M7RA 2CRFA 3KZ1A 4L1RA 2JP2A 2RLOA 2CAYA 4XWXA 1DDMA 2VSZA 1V5UA 1MIZB 3TCAA 3AU5A 4KHBA 3CIKA 1TXDA 1GC6A 4GNKB 4CSQA 3BINA 3CXBB 5LONB 1V89A 4EMOA 5HE2A 5I2MA 2Y7BA 4HSIA 2D10A 4DXAB 4QJ5B 1I2HA 2KUPA 2I1JA 1XD4A 2V76A 1Y19B 1P3RA 1GC7A 2GUMA 1H10A 3U8ZA 3HSAA 4DBBA 4MY6A 4OSNA 2Z0OA 2D2QA 5J3YA 2KIEA 3AJ4A 4WVFB 3PZDA 1NI2A 3P7ZA 1BWNA 4Z2MB 2QKMA 2YT0A 2Y8FA 1ZC3B 1SGHA 2KGXB 1NTYA 1WJ1A 2DHIA 5LOPB 2EMSA 4MK0A 2N23A 1U5EA 1V88A 2J0KA 5KQ4A 2M38A 3DXEA 1XX0A 4GOUA 3B77A 2H7EA 2J0JA 2K2JA 4HB3B 5C79A 3SV1A 3U12A 3F5RA 1FGYA 5CLLB 4PQ0A 1X1GA 3PVWA 1N3HA 2DA0A 3QIJA 2MWNB 1UEFA 4F7UP 2CODA 2Z14A 3QBVB 2LULA 1TJ6A 4HDOA 3F0WA 4NSWA 4QJ3B 3UZTA 2DKPA 1DDVA 4GMXB 2I5FA 1T77A 5D3XA 3NWDA 5LG4B 1KZGA 4HAXB 1LW3A 3A8QA 3IVFA 2YRYA 1LB1A 1WI1A 4HATB 5D3VA 2D9XA 5C5BA 2Z13A 1XCGA 1TQZA 3D8FA 1DROA 1W1GA 1KZ7A 2K8EA 2Q13A 5CLQB 1EVHA 4K81A 2P0HA 3V5WA 2QKLA 2L2IA 2UVMA 2LKOA 2HTHB 5DH9B 2YSZA 2UZRA 1EAZA 5C6RA 1DYNA 2GCLA 1PLSA 3VIAA 1DBHA 1MK7B 4CYEA 1MAIA 1U29A 5HE3A 4GZUA 2MKRA 5GOWB 1MK9B 3MDBC 4KVGB 5JHHA 2D11A 2K49A 2YS5A 4DX90 2D4QA 2GS0A 2DHKA 3WA0A 2CY5A 2VKIA 3BJIA 1V5PA 2RNRB 2R0DA 5JLJB 4P7IA 4TKNA 2E2XA 3DXDA 4HAVB 4GPTB 2BCJA 3KY9A 3TFMA 3X23A 5HE1A 4K17A 4GXBA 1DDWA 2R09A 2DTCA 4Y94A 4DIXA 1U5GA 3RCPA 2RGNB 2ZKMX 4MT7A 3N7CA 1AWEA 3A98B 2DYNA 4CHJA 2ADZA 1FAOA 2ELBA 2G35A 1UNPA 3TVVA 1K5GB 2K00A 2LYDA 1K5DB 3TO1A 4IOYX 1FHOA 1FOEA 1W1HA 4KHOA 2YF0A 3WYFB 2LG1A 2YVCA 1WJMA 3D8DA 1BTKA 2COAA 1FB8A 4GN1A 4KAXB 5DHAB 1FHXA 1OY2A 4WJ7A 4PNKA 2AL6A 2NMBA 2OQBA 2RUKB 5I2SA 3NSUA 2KCJA 3KSYA 1V5MA
chains in the Genus database with same CATH topology
1XKEA 2J0MA 1PMSA 5D3YA 5KQ1A 4K2OA 1UPQA 3M1IB 1GG3A 1X1FA 2IYBA 1P5TA 1BTNA 1KI1B 2P8VA 4A6HA 3LJUX 2LOXA 3ML4A 3ULCA 4DX8A 3SO6A 2UZSA 1Y5OA 2YS1A 3GYPA 4F7GA 1WVHA 2I1KA 4TYZA 1IRSA 2H7DA 3D8EA 1NU2A 1WG7A 3FEHA 2J59M 4A6FB 4HHVA 1NTVA 3VOQA 2DKQA 5EFXA 4ZRJA 1MKEA 4Z2NA 2D9ZA 2MDXA 4HAZB 4H8SA 1E5WA 4A5KA 4CHMA 3HQCA 2P0FA 3G9WA 2PZ1A 3SYXA 4BBKA 3KRWA 4HAUB 3TW1A 2D9VA 3MPXA 4L6EA 2W2WA 3PP2A 1UNQA 5JP4A 4KHBB 4HB0B 5D3WA 5C16A 4HDQA 4A6KA 2D9WA 2YT1A 2ROZB 3PVLA 2DLWA 1J19A 2DX5A 3SUZA 2M14A 1XR0B 3HK0A 1W1DA 2GCJA 4IFSA 2FJLA 1V61A 2EMTA 5DHFB 5FI1A 1BAKA 3SNHA 1FHWA 2W2XD 4ZRIA 5DI9B 2XQNM 3AU4A 3ODXA 4KHAA 5KCVA 1ZC4B 2L1CA 3FSSA 2DHJA 1X86A 2I5CA 2K2UA 1ZVRA 3A8PA 1X05A 5JHGA 1Q67A 1WGUA 4IAPA 3O96A 3QWMA 2Z0PA 3PEGA 2DX1A 4YL8A 1QC6A 2COCA 5L81A 1RRPB 3DXCA 5FI0A 3ZVRA 2N0YA 3U7DA 2Z0QA 1AQCA 4ZRKA 3T06A 1ZM0A 4HB4B 1ISNA 1UPRA 4YONA 2RVBB 2DFKA 1X11A 3OANA 2Y8GA 3ODWA 2OTXA 2AEHA 4EJNA 3PG7A 3HW2B 3ULBA 1H4RA 4HAYB 1PFJA 5D27A 2IFSA 2W2XC 4K2PA 2ROVA 2X18A 1U5FA 5HE0A 2EC1A 1U27A 1EF1A 2D9YA 1MIXA 2HE7A 4GMVA 2ELAA 5C5BB 1MPHA 2ZPYA 5DIFB 1EGXA 4F7HA 4EKUA 1WGQA 4WSFA 4D0NB 2GJYA 2LOZA 2DN6A 2NZ8B 2EJ8A 5J3QA 1SHCA 3FM8C 1I7AA 4HB2B 4C0AA 3P6AA 2RSGA 3PVUA 3ZDTA 2CY4A 2MFQA 1ZSQA 1UNRA 1QQGA 3PSCA 1J0WA 2COFA 1XODA 1U2BA 1FGZA 1U5DA 1B55A 4A6FA 1P6SA 2VRWB 2P0DA 4HAWB 4B6HA 2DYQA 3KRXA 4NY0A 1Z87A 5J3TA 3GYOA 1M7EA 1RJ2A 1OMWA 2YS3A 1OQNA 3ODOA 1M7RA 2CRFA 3KZ1A 2JP2A 2RLOA 2CAYA 4XWXA 1DDMA 2VSZA 1V5UA 1MIZB 3TCAA 3AU5A 3CIKA 1TXDA 1GC6A 3BINA 3CXBB 5LONB 1V89A 4EMOA 5HE2A 2Y7BA 2D10A 4DXAB 1I2HA 2KUPA 2I1JA 1XD4A 2V76A 1Y19B 1P3RA 1GC7A 1H10A 3U8ZA 4DBBA 4MY6A 2Z0OA 2D2QA 5J3YA 3AJ4A 4WVFB 3PZDA 1NI2A 3P7ZA 1BWNA 4Z2MB 2QKMA 2YT0A 2Y8FA 1ZC3B 1SGHA 2KGXB 1NTYA 1WJ1A 2DHIA 5LOPB 2EMSA 4MK0A 2N23A 1U5EA 1V88A 2J0KA 5KQ4A 2M38A 3DXEA 1XX0A 2H7EA 2J0JA 2K2JA 4HB3B 5C79A 3SV1A 3F5RA 1FGYA 5CLLB 4PQ0A 1X1GA 3PVWA 1N3HA 2DA0A 3QIJA 2MWNB 1UEFA 4F7UP 2CODA 3QBVB 2LULA 1TJ6A 4HDOA 3F0WA 4NSWA 3UZTA 2DKPA 1DDVA 4GMXB 2I5FA 5D3XA 1KZGA 4HAXB 1LW3A 3A8QA 3IVFA 2YRYA 1LB1A 1WI1A 4HATB 5D3VA 2D9XA 5C5BA 1XCGA 1TQZA 3D8FA 1DROA 1W1GA 1KZ7A 2Q13A 5CLQB 1EVHA 4K81A 2P0HA 3V5WA 2QKLA 2L2IA 2UVMA 2LKOA 2HTHB 5DH9B 2YSZA 2UZRA 1EAZA 5C6RA 1DYNA 2GCLA 1PLSA 3VIAA 1DBHA 1MK7B 4CYEA 1MAIA 1U29A 5HE3A 4GZUA 2MKRA 5GOWB 1MK9B 3MDBC 4KVGB 5JHHA 2D11A 2YS5A 4DX90 2D4QA 2GS0A 2DHKA 3WA0A 2CY5A 2VKIA 3BJIA 1V5PA 2RNRB 2R0DA 5JLJB 4P7IA 4TKNA 2E2XA 3DXDA 4HAVB 4GPTB 2BCJA 3KY9A 3TFMA 3X23A 5HE1A 4K17A 4GXBA 1DDWA 2R09A 2DTCA 4Y94A 1U5GA 3RCPA 2RGNB 4MT7A 3N7CA 1AWEA 3A98B 2DYNA 4CHJA 2ADZA 1FAOA 2ELBA 2G35A 1UNPA 3TVVA 1K5GB 2K00A 2LYDA 1K5DB 3TO1A 4IOYX 1FHOA 1FOEA 1W1HA 4KHOA 2YF0A 3WYFB 2LG1A 2YVCA 1WJMA 3D8DA 1BTKA 2COAA 1FB8A 4GN1A 4KAXB 5DHAB 1FHXA 1OY2A 4WJ7A 4PNKA 2AL6A 2NMBA 2OQBA 2RUKB 3NSUA 2KCJA 3KSYA 1V5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XKE A;  2J0M A;  1PMS A;  5D3Y A;  5KQ1 A;  4K2O A;  1UPQ A;  3M1I B;  1GG3 A;  1X1F A;  2IYB A;  1P5T A;  1BTN A;  1KI1 B;  2P8V A;  4A6H A;  3LJU X;  2LOX A;  3ML4 A;  3ULC A;  4DX8 A;  3SO6 A;  2UZS A;  1Y5O A;  2YS1 A;  3GYP A;  4F7G A;  1WVH A;  2I1K A;  4TYZ A;  1IRS A;  2H7D A;  3D8E A;  1NU2 A;  1WG7 A;  3FEH A;  2J59 M;  4A6F B;  4HHV A;  1NTV A;  3VOQ A;  2DKQ A;  5EFX A;  4ZRJ A;  1MKE A;  4Z2N A;  2D9Z A;  2MDX A;  4HAZ B;  4H8S A;  1E5W A;  4A5K A;  4CHM A;  3HQC A;  2P0F A;  3G9W A;  2PZ1 A;  3SYX A;  4BBK A;  3KRW A;  4HAU B;  3TW1 A;  2D9V A;  3MPX A;  4L6E A;  2W2W A;  3PP2 A;  1UNQ A;  5JP4 A;  4KHB B;  4HB0 B;  5D3W A;  5C16 A;  4HDQ A;  4A6K A;  2D9W A;  2YT1 A;  2ROZ B;  3PVL A;  2DLW A;  1J19 A;  2DX5 A;  3SUZ A;  2M14 A;  1XR0 B;  3HK0 A;  1W1D A;  2GCJ A;  4IFS A;  2FJL A;  1V61 A;  2EMT A;  5DHF B;  5FI1 A;  1BAK A;  3SNH A;  1FHW A;  2W2X D;  4ZRI A;  5DI9 B;  2XQN M;  3AU4 A;  3ODX A;  4KHA A;  5KCV A;  1ZC4 B;  2L1C A;  3FSS A;  2DHJ A;  1X86 A;  2I5C A;  2K2U A;  1ZVR A;  3A8P A;  1X05 A;  5JHG A;  1Q67 A;  1WGU A;  4IAP A;  3O96 A;  3QWM A;  2Z0P A;  3PEG A;  2DX1 A;  4YL8 A;  1QC6 A;  2COC A;  5L81 A;  1RRP B;  3DXC A;  5FI0 A;  3ZVR A;  2N0Y A;  3U7D A;  2Z0Q A;  1AQC A;  4ZRK A;  3T06 A;  1ZM0 A;  4HB4 B;  1ISN A;  1UPR A;  4YON A;  2RVB B;  2DFK A;  1X11 A;  3OAN A;  2Y8G A;  3ODW A;  2OTX A;  2AEH A;  4EJN A;  3PG7 A;  3HW2 B;  3ULB A;  1H4R A;  4HAY B;  1PFJ A;  5D27 A;  2IFS A;  2W2X C;  4K2P A;  2ROV A;  2X18 A;  1U5F A;  5HE0 A;  2EC1 A;  1U27 A;  1EF1 A;  2D9Y A;  1MIX A;  2HE7 A;  4GMV A;  2ELA A;  5C5B B;  1MPH A;  2ZPY A;  5DIF B;  1EGX A;  4F7H A;  4EKU A;  1WGQ A;  4WSF A;  4D0N B;  2GJY A;  2LOZ A;  2DN6 A;  2NZ8 B;  2EJ8 A;  5J3Q A;  1SHC A;  3FM8 C;  1I7A A;  4HB2 B;  4C0A A;  3P6A A;  2RSG A;  3PVU A;  3ZDT A;  2CY4 A;  2MFQ A;  1ZSQ A;  1UNR A;  1QQG A;  3PSC A;  1J0W A;  2COF A;  1XOD A;  1U2B A;  1FGZ A;  1U5D A;  1B55 A;  4A6F A;  1P6S A;  2VRW B;  2P0D A;  4HAW B;  4B6H A;  2DYQ A;  3KRX A;  4NY0 A;  1Z87 A;  5J3T A;  3GYO A;  1M7E A;  1RJ2 A;  1OMW A;  2YS3 A;  1OQN A;  3ODO A;  1M7R A;  2CRF A;  3KZ1 A;  2JP2 A;  2RLO A;  2CAY A;  4XWX A;  1DDM A;  2VSZ A;  1V5U A;  1MIZ B;  3TCA A;  3AU5 A;  3CIK A;  1TXD A;  1GC6 A;  3BIN A;  3CXB B;  5LON B;  1V89 A;  4EMO A;  5HE2 A;  2Y7B A;  2D10 A;  4DXA B;  1I2H A;  2KUP A;  2I1J A;  1XD4 A;  2V76 A;  1Y19 B;  1P3R A;  1GC7 A;  1H10 A;  3U8Z A;  4DBB A;  4MY6 A;  2Z0O A;  2D2Q A;  5J3Y A;  3AJ4 A;  4WVF B;  3PZD A;  1NI2 A;  3P7Z A;  1BWN A;  4Z2M B;  2QKM A;  2YT0 A;  2Y8F A;  1ZC3 B;  1SGH A;  2KGX B;  1NTY A;  1WJ1 A;  2DHI A;  5LOP B;  2EMS A;  4MK0 A;  2N23 A;  1U5E A;  1V88 A;  2J0K A;  5KQ4 A;  2M38 A;  3DXE A;  1XX0 A;  2H7E A;  2J0J A;  2K2J A;  4HB3 B;  5C79 A;  3SV1 A;  3F5R A;  1FGY A;  5CLL B;  4PQ0 A;  1X1G A;  3PVW A;  1N3H A;  2DA0 A;  3QIJ A;  2MWN B;  1UEF A;  4F7U P;  2COD A;  3QBV B;  2LUL A;  1TJ6 A;  4HDO A;  3F0W A;  4NSW A;  3UZT A;  2DKP A;  1DDV A;  4GMX B;  2I5F A;  5D3X A;  1KZG A;  4HAX B;  1LW3 A;  3A8Q A;  3IVF A;  2YRY A;  1LB1 A;  1WI1 A;  4HAT B;  5D3V A;  2D9X A;  5C5B A;  1XCG A;  1TQZ A;  3D8F A;  1DRO A;  1W1G A;  1KZ7 A;  2Q13 A;  5CLQ B;  1EVH A;  4K81 A;  2P0H A;  3V5W A;  2QKL A;  2L2I A;  2UVM A;  2LKO A;  2HTH B;  5DH9 B;  2YSZ A;  2UZR A;  1EAZ A;  5C6R A;  1DYN A;  2GCL A;  1PLS A;  3VIA A;  1DBH A;  1MK7 B;  4CYE A;  1MAI A;  1U29 A;  5HE3 A;  4GZU A;  2MKR A;  5GOW B;  1MK9 B;  3MDB C;  4KVG B;  5JHH A;  2D11 A;  2YS5 A;  4DX9 0;  2D4Q A;  2GS0 A;  2DHK A;  3WA0 A;  2CY5 A;  2VKI A;  3BJI A;  1V5P A;  2RNR B;  2R0D A;  5JLJ B;  4P7I A;  4TKN A;  2E2X A;  3DXD A;  4HAV B;  4GPT B;  2BCJ A;  3KY9 A;  3TFM A;  3X23 A;  5HE1 A;  4K17 A;  4GXB A;  1DDW A;  2R09 A;  2DTC A;  4Y94 A;  1U5G A;  3RCP A;  2RGN B;  4MT7 A;  3N7C A;  1AWE A;  3A98 B;  2DYN A;  4CHJ A;  2ADZ A;  1FAO A;  2ELB A;  2G35 A;  1UNP A;  3TVV A;  1K5G B;  2K00 A;  2LYD A;  1K5D B;  3TO1 A;  4IOY X;  1FHO A;  1FOE A;  1W1H A;  4KHO A;  2YF0 A;  3WYF B;  2LG1 A;  2YVC A;  1WJM A;  3D8D A;  1BTK A;  2COA A;  1FB8 A;  4GN1 A;  4KAX B;  5DHA B;  1FHX A;  1OY2 A;  4WJ7 A;  4PNK A;  2AL6 A;  2NMB A;  2OQB A;  2RUK B;  3NSU A;  2KCJ A;  3KSY A;  1V5M A; 
#chains in the Genus database with same CATH topology
 1XKE A;  2J0M A;  1PMS A;  5D3Y A;  5KQ1 A;  4K2O A;  1UPQ A;  3M1I B;  1GG3 A;  1X1F A;  2IYB A;  1P5T A;  1BTN A;  1KI1 B;  2R2Y A;  2P8V A;  4A6H A;  3LJU X;  2LOX A;  2YT2 A;  3ML4 A;  3ULC A;  4DX8 A;  3SO6 A;  2UZS A;  1Y5O A;  2YS1 A;  3GYP A;  4F7G A;  1WVH A;  2I1K A;  4TYZ A;  1IRS A;  2H7D A;  3DCX A;  3D8E A;  1NU2 A;  1WG7 A;  3FEH A;  2J59 M;  4A6F B;  4HHV A;  1NTV A;  1MI1 A;  3VOQ A;  2DKQ A;  5EFX A;  4ZRJ A;  1MKE A;  4Z2N A;  2FJU B;  2D9Z A;  2MDX A;  5M4Y B;  4HAZ B;  4H8S A;  1E5W A;  4A5K A;  4CHM A;  3HQC A;  2P0F A;  3G9W A;  2PZ1 A;  3SYX A;  4BBK A;  3KRW A;  2KR0 A;  4HAU B;  3NWF A;  2D9V A;  3TW1 A;  3MPX A;  4L6E A;  2W2W A;  3PP2 A;  1UNQ A;  5JP4 A;  4KHB B;  4HB0 B;  5D3W A;  5C16 A;  4HDQ A;  4A6K A;  2D9W A;  2YT1 A;  2ROZ B;  3PVL A;  2DLW A;  1J19 A;  4QXA B;  2DX5 A;  3SUZ A;  2M14 A;  2RRF A;  1XR0 B;  3HK0 A;  3FVC A;  1W1D A;  2GCJ A;  4IFS A;  2FJL A;  1V61 A;  3NW8 A;  2EMT A;  5DHF B;  5FI1 A;  1BAK A;  3SNH A;  1FHW A;  2W2X D;  4ZRI A;  5DI9 B;  2XQN M;  3AU4 A;  3ODX A;  4KHA A;  5KCV A;  1ZC4 B;  2L1C A;  2KIG A;  3FSS A;  2DHJ A;  1X86 A;  2I5C A;  2K2U A;  1ZVR A;  3A8P A;  4D6W A;  1X05 A;  5JHG A;  1Q67 A;  1WGU A;  4IAP A;  3O96 A;  3QWM A;  1ZYI A;  2Z59 A;  2Z0P A;  2NBV A;  3PEG A;  2DX1 A;  4YL8 A;  1QC6 A;  2COC A;  5L81 A;  1RRP B;  3DXC A;  5FI0 A;  3ZVR A;  2N0Y A;  3U7D A;  2Z0Q A;  1AQC A;  4ZRK A;  3T06 A;  1ZM0 A;  4HB4 B;  1ISN A;  1UPR A;  4YON A;  4QJ4 B;  2RVB B;  2DFK A;  1X11 A;  3OAN A;  2Y8G A;  3ODW A;  2OTX A;  2AEH A;  4EJN A;  3PG7 A;  3HW2 B;  3ULB A;  1H4R A;  4HAY B;  1PFJ A;  5D27 A;  2IFS A;  2W2X C;  4K2P A;  2ROV A;  2X18 A;  1U5F A;  5HE0 A;  2EC1 A;  1U27 A;  1EF1 A;  2D9Y A;  1MIX A;  2HE7 A;  4GMV A;  2ELA A;  3NWA A;  5C5B B;  1MPH A;  2ZPY A;  3HIE A;  5DIF B;  1EGX A;  4F7H A;  4EKU A;  1WGQ A;  4WSF A;  4D0N B;  2GJY A;  2LOZ A;  2DN6 A;  2NZ8 B;  3OHM B;  2EJ8 A;  5J3Q A;  1SHC A;  3FM8 C;  1I7A A;  4HB2 B;  4C0A A;  3P6A A;  2RSG A;  3PVU A;  3ZDT A;  2CY4 A;  2MFQ A;  1ZSQ A;  2Z4D A;  5IRS A;  1UNR A;  1QQG A;  3PSC A;  1J0W A;  2COF A;  1XOD A;  1U2B A;  1FGZ A;  1U5D A;  1B55 A;  4A6F A;  1P6S A;  2VRW B;  2P0D A;  4HAW B;  4B6H A;  2DYQ A;  2KUQ A;  3KRX A;  4NY0 A;  1Z87 A;  5J3T A;  4OT1 A;  3GYO A;  1M7E A;  1RJ2 A;  3A58 A;  1OMW A;  2YS3 A;  1OQN A;  3ODO A;  1M7R A;  2CRF A;  3KZ1 A;  4L1R A;  2JP2 A;  2RLO A;  2CAY A;  4XWX A;  1DDM A;  2VSZ A;  1V5U A;  1MIZ B;  3TCA A;  3AU5 A;  4KHB A;  3CIK A;  1TXD A;  1GC6 A;  4GNK B;  4CSQ A;  3BIN A;  3CXB B;  5LON B;  1V89 A;  4EMO A;  5HE2 A;  5I2M A;  2Y7B A;  4HSI A;  2D10 A;  4DXA B;  4QJ5 B;  1I2H A;  2KUP A;  2I1J A;  1XD4 A;  2V76 A;  1Y19 B;  1P3R A;  1GC7 A;  2GUM A;  1H10 A;  3U8Z A;  3HSA A;  4DBB A;  4MY6 A;  4OSN A;  2Z0O A;  2D2Q A;  5J3Y A;  2KIE A;  3AJ4 A;  4WVF B;  3PZD A;  1NI2 A;  3P7Z A;  1BWN A;  4Z2M B;  2QKM A;  2YT0 A;  2Y8F A;  1ZC3 B;  1SGH A;  2KGX B;  1NTY A;  1WJ1 A;  2DHI A;  5LOP B;  2EMS A;  4MK0 A;  2N23 A;  1U5E A;  1V88 A;  2J0K A;  5KQ4 A;  2M38 A;  3DXE A;  1XX0 A;  4GOU A;  3B77 A;  2H7E A;  2J0J A;  2K2J A;  4HB3 B;  5C79 A;  3SV1 A;  3U12 A;  3F5R A;  1FGY A;  5CLL B;  4PQ0 A;  1X1G A;  3PVW A;  1N3H A;  2DA0 A;  3QIJ A;  2MWN B;  1UEF A;  4F7U P;  2COD A;  2Z14 A;  3QBV B;  2LUL A;  1TJ6 A;  4HDO A;  3F0W A;  4NSW A;  4QJ3 B;  3UZT A;  2DKP A;  1DDV A;  4GMX B;  2I5F A;  1T77 A;  5D3X A;  3NWD A;  5LG4 B;  1KZG A;  4HAX B;  1LW3 A;  3A8Q A;  3IVF A;  2YRY A;  1LB1 A;  1WI1 A;  4HAT B;  5D3V A;  2D9X A;  5C5B A;  2Z13 A;  1XCG A;  1TQZ A;  3D8F A;  1DRO A;  1W1G A;  1KZ7 A;  2K8E A;  2Q13 A;  5CLQ B;  1EVH A;  4K81 A;  2P0H A;  3V5W A;  2QKL A;  2L2I A;  2UVM A;  2LKO A;  2HTH B;  5DH9 B;  2YSZ A;  2UZR A;  1EAZ A;  5C6R A;  1DYN A;  2GCL A;  1PLS A;  3VIA A;  1DBH A;  1MK7 B;  4CYE A;  1MAI A;  1U29 A;  5HE3 A;  4GZU A;  2MKR A;  5GOW B;  1MK9 B;  3MDB C;  4KVG B;  5JHH A;  2D11 A;  2K49 A;  2YS5 A;  4DX9 0;  2D4Q A;  2GS0 A;  2DHK A;  3WA0 A;  2CY5 A;  2VKI A;  3BJI A;  1V5P A;  2RNR B;  2R0D A;  5JLJ B;  4P7I A;  4TKN A;  2E2X A;  3DXD A;  4HAV B;  4GPT B;  2BCJ A;  3KY9 A;  3TFM A;  3X23 A;  5HE1 A;  4K17 A;  4GXB A;  1DDW A;  2R09 A;  2DTC A;  4Y94 A;  4DIX A;  1U5G A;  3RCP A;  2RGN B;  2ZKM X;  4MT7 A;  3N7C A;  1AWE A;  3A98 B;  2DYN A;  4CHJ A;  2ADZ A;  1FAO A;  2ELB A;  2G35 A;  1UNP A;  3TVV A;  1K5G B;  2K00 A;  2LYD A;  1K5D B;  3TO1 A;  4IOY X;  1FHO A;  1FOE A;  1W1H A;  4KHO A;  2YF0 A;  3WYF B;  2LG1 A;  2YVC A;  1WJM A;  3D8D A;  1BTK A;  2COA A;  1FB8 A;  4GN1 A;  4KAX B;  5DHA B;  1FHX A;  1OY2 A;  4WJ7 A;  4PNK A;  2AL6 A;  2NMB A;  2OQB A;  2RUK B;  5I2S A;  3NSU A;  2KCJ A;  3KSY A;  1V5M A; 
#chains in the Genus database with same CATH homology
 1XKE A;  2J0M A;  1PMS A;  5D3Y A;  5KQ1 A;  4K2O A;  1UPQ A;  3M1I B;  1GG3 A;  1X1F A;  2IYB A;  1P5T A;  1BTN A;  1KI1 B;  2P8V A;  4A6H A;  3LJU X;  2LOX A;  3ML4 A;  3ULC A;  4DX8 A;  3SO6 A;  2UZS A;  1Y5O A;  2YS1 A;  3GYP A;  4F7G A;  1WVH A;  2I1K A;  4TYZ A;  1IRS A;  2H7D A;  3D8E A;  1NU2 A;  1WG7 A;  3FEH A;  2J59 M;  4A6F B;  4HHV A;  1NTV A;  3VOQ A;  2DKQ A;  5EFX A;  4ZRJ A;  1MKE A;  4Z2N A;  2D9Z A;  2MDX A;  4HAZ B;  4H8S A;  1E5W A;  4A5K A;  4CHM A;  3HQC A;  2P0F A;  3G9W A;  2PZ1 A;  3SYX A;  4BBK A;  3KRW A;  4HAU B;  3TW1 A;  2D9V A;  3MPX A;  4L6E A;  2W2W A;  3PP2 A;  1UNQ A;  5JP4 A;  4KHB B;  4HB0 B;  5D3W A;  5C16 A;  4HDQ A;  4A6K A;  2D9W A;  2YT1 A;  2ROZ B;  3PVL A;  2DLW A;  1J19 A;  2DX5 A;  3SUZ A;  2M14 A;  1XR0 B;  3HK0 A;  1W1D A;  2GCJ A;  4IFS A;  2FJL A;  1V61 A;  2EMT A;  5DHF B;  5FI1 A;  1BAK A;  3SNH A;  1FHW A;  2W2X D;  4ZRI A;  5DI9 B;  2XQN M;  3AU4 A;  3ODX A;  4KHA A;  5KCV A;  1ZC4 B;  2L1C A;  3FSS A;  2DHJ A;  1X86 A;  2I5C A;  2K2U A;  1ZVR A;  3A8P A;  1X05 A;  5JHG A;  1Q67 A;  1WGU A;  4IAP A;  3O96 A;  3QWM A;  2Z0P A;  3PEG A;  2DX1 A;  4YL8 A;  1QC6 A;  2COC A;  5L81 A;  1RRP B;  3DXC A;  5FI0 A;  3ZVR A;  2N0Y A;  3U7D A;  2Z0Q A;  1AQC A;  4ZRK A;  3T06 A;  1ZM0 A;  4HB4 B;  1ISN A;  1UPR A;  4YON A;  2RVB B;  2DFK A;  1X11 A;  3OAN A;  2Y8G A;  3ODW A;  2OTX A;  2AEH A;  4EJN A;  3PG7 A;  3HW2 B;  3ULB A;  1H4R A;  4HAY B;  1PFJ A;  5D27 A;  2IFS A;  2W2X C;  4K2P A;  2ROV A;  2X18 A;  1U5F A;  5HE0 A;  2EC1 A;  1U27 A;  1EF1 A;  2D9Y A;  1MIX A;  2HE7 A;  4GMV A;  2ELA A;  5C5B B;  1MPH A;  2ZPY A;  5DIF B;  1EGX A;  4F7H A;  4EKU A;  1WGQ A;  4WSF A;  4D0N B;  2GJY A;  2LOZ A;  2DN6 A;  2NZ8 B;  2EJ8 A;  5J3Q A;  1SHC A;  3FM8 C;  1I7A A;  4HB2 B;  4C0A A;  3P6A A;  2RSG A;  3PVU A;  3ZDT A;  2CY4 A;  2MFQ A;  1ZSQ A;  1UNR A;  1QQG A;  3PSC A;  1J0W A;  2COF A;  1XOD A;  1U2B A;  1FGZ A;  1U5D A;  1B55 A;  4A6F A;  1P6S A;  2VRW B;  2P0D A;  4HAW B;  4B6H A;  2DYQ A;  3KRX A;  4NY0 A;  1Z87 A;  5J3T A;  3GYO A;  1M7E A;  1RJ2 A;  1OMW A;  2YS3 A;  1OQN A;  3ODO A;  1M7R A;  2CRF A;  3KZ1 A;  2JP2 A;  2RLO A;  2CAY A;  4XWX A;  1DDM A;  2VSZ A;  1V5U A;  1MIZ B;  3TCA A;  3AU5 A;  3CIK A;  1TXD A;  1GC6 A;  3BIN A;  3CXB B;  5LON B;  1V89 A;  4EMO A;  5HE2 A;  2Y7B A;  2D10 A;  4DXA B;  1I2H A;  2KUP A;  2I1J A;  1XD4 A;  2V76 A;  1Y19 B;  1P3R A;  1GC7 A;  1H10 A;  3U8Z A;  4DBB A;  4MY6 A;  2Z0O A;  2D2Q A;  5J3Y A;  3AJ4 A;  4WVF B;  3PZD A;  1NI2 A;  3P7Z A;  1BWN A;  4Z2M B;  2QKM A;  2YT0 A;  2Y8F A;  1ZC3 B;  1SGH A;  2KGX B;  1NTY A;  1WJ1 A;  2DHI A;  5LOP B;  2EMS A;  4MK0 A;  2N23 A;  1U5E A;  1V88 A;  2J0K A;  5KQ4 A;  2M38 A;  3DXE A;  1XX0 A;  2H7E A;  2J0J A;  2K2J A;  4HB3 B;  5C79 A;  3SV1 A;  3F5R A;  1FGY A;  5CLL B;  4PQ0 A;  1X1G A;  3PVW A;  1N3H A;  2DA0 A;  3QIJ A;  2MWN B;  1UEF A;  4F7U P;  2COD A;  3QBV B;  2LUL A;  1TJ6 A;  4HDO A;  3F0W A;  4NSW A;  3UZT A;  2DKP A;  1DDV A;  4GMX B;  2I5F A;  5D3X A;  1KZG A;  4HAX B;  1LW3 A;  3A8Q A;  3IVF A;  2YRY A;  1LB1 A;  1WI1 A;  4HAT B;  5D3V A;  2D9X A;  5C5B A;  1XCG A;  1TQZ A;  3D8F A;  1DRO A;  1W1G A;  1KZ7 A;  2Q13 A;  5CLQ B;  1EVH A;  4K81 A;  2P0H A;  3V5W A;  2QKL A;  2L2I A;  2UVM A;  2LKO A;  2HTH B;  5DH9 B;  2YSZ A;  2UZR A;  1EAZ A;  5C6R A;  1DYN A;  2GCL A;  1PLS A;  3VIA A;  1DBH A;  1MK7 B;  4CYE A;  1MAI A;  1U29 A;  5HE3 A;  4GZU A;  2MKR A;  5GOW B;  1MK9 B;  3MDB C;  4KVG B;  5JHH A;  2D11 A;  2YS5 A;  4DX9 0;  2D4Q A;  2GS0 A;  2DHK A;  3WA0 A;  2CY5 A;  2VKI A;  3BJI A;  1V5P A;  2RNR B;  2R0D A;  5JLJ B;  4P7I A;  4TKN A;  2E2X A;  3DXD A;  4HAV B;  4GPT B;  2BCJ A;  3KY9 A;  3TFM A;  3X23 A;  5HE1 A;  4K17 A;  4GXB A;  1DDW A;  2R09 A;  2DTC A;  4Y94 A;  1U5G A;  3RCP A;  2RGN B;  4MT7 A;  3N7C A;  1AWE A;  3A98 B;  2DYN A;  4CHJ A;  2ADZ A;  1FAO A;  2ELB A;  2G35 A;  1UNP A;  3TVV A;  1K5G B;  2K00 A;  2LYD A;  1K5D B;  3TO1 A;  4IOY X;  1FHO A;  1FOE A;  1W1H A;  4KHO A;  2YF0 A;  3WYF B;  2LG1 A;  2YVC A;  1WJM A;  3D8D A;  1BTK A;  2COA A;  1FB8 A;  4GN1 A;  4KAX B;  5DHA B;  1FHX A;  1OY2 A;  4WJ7 A;  4PNK A;  2AL6 A;  2NMB A;  2OQB A;  2RUK B;  3NSU A;  2KCJ A;  3KSY A;  1V5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...