5JPUA

Structure of limonene epoxide hydrolase mutant - h-2-h5 complex with (s,s)-cyclohexane-1,2-diol
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
118
structure length
118
Chain Sequence
b'STPDEKIVLEFMDALTSNDAAKLIDYFAEDTMYQNMPLPPAYGRDAVEQTLAGFFKVFSIDAVETFHIGSTKGLVYTERVDVLRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords limonene epoxide hydrolase
publication title Multi-Parameter Optimization in Directed Evolution: Engineering Thermostability, Enantioselectivity and Activity of an Epoxide Hydrolase
rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 34
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2016-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5jpuA00
1GY5A 2XR8B 3KSPA 1OUNA 3OXAA 3EBYA 3MYTA 1U5OA 6STDA 3CNXA 4HKVB 1DMQA 1TUHA 2OWPA 3G8ZA 1SJWA 2W2CA 1HKXA 1O7NB 3ROBA 3UNLA 3FLJA 1EA2A 4HVNA 4OUQA 1OF5B 3I0YA 3OWUA 5HGRA 5CLKA 2Z7AA 1EG9B 1QMAA 3F7XA 1W02A 2RGQA 4J9AA 3HX8A 3EQQB 5D81A 1IDPA 3NM2A 3Q90A 4XBXA 4WYKB 4WWUC 3A76A 4X2HA 3EN8A 2GXFA 2GBXB 1O7WB 4HM3B 1VZZA 4FCJA 1OH0A 4K1VA 5IG3A 2CKFB 2STDA 3JUNA 2IMJA 3HZPA 1DMNA 2HMOB 1JB5A 2I9WA 2HMJB 1S5AA 4H3UA 4HM4B 1A2KA 3IPTA 1O7GB 3NXJA 3CPOA 3GRDA 5AIGA 1JN5A 4ORLA 3KKGA 3CU3A 3GWRA 2R4IA 1OHOA 5D83A 3GZYB 1NDOB 3MG2A 3H3HA 2A15A 3GZXB 3S5CA 3JUOA 3EC9A 1OHSA 3SEDA 1JB4A 1JB2A 3GZBA 3CNMA 4HM2B 1E3RA 2GEYA 8CHOA 4HM1B 1W00A 4IIAA 4WP5A 3JUMA 3F8XA 2GBWB 1E97A 4HM5B 2QIYA 4XDVA 4Q53A 1O7PB 2PZVA 3KZTA 1UUWB 3K7CA 1BUQA 3MG3A 3T8NA 1UUVB 2QGUA 3DM8A 2Z77A 3MG1A 3E99A 4PEJA 4XB5A 4N3VA 1ISKA 3OWYA 3EJVA 3UJMA 5KP3A 5IEOA 3SOYA 2XRXB 2BMQB 3EN1B 3NHXA 1ULJB 4I4KA 7STDA 2RCDA 3KE7A 2CHCA 1ASKA 3FGYA 5JPUA 4LEHA 5CF2A 3F8HA 5EVHA 5AI1A 3OV4A 3G0KA 2HMNB 3F7SA 3G16A 3LYGA 3VGNA 3JUQA 1NU3A 5IEPA 4LGQA 4RZMA 1AR0A 1C7HA 2XSHB 2Z76A 4HM0B 3DUKA 4LMIA 2INXA 5TGNA 4XBYA 3HK4A 2HMLB 2F99A 2B24B 3NV0A 3MKIA 3RGAA 1CQSA 3FSDA 5IG5A 5IG4A 2K54A 3FKAA 3F14A 1OHPA 2YFJB 3D9RA 5IF6A 2XSOB 3MHEA 1OGXA 3B7CA 3B4OA 2RFRA 4XBTA 5DREA 3H51A 2B1XB 3BLZA 3EF8A 4GB5A 4X2OA 5AEUB 3DZLA 4OVMA 4J8TA 4R1KA 3NUVA 3FF2A 5DRVA 3STDA 1WQLB 2YFIB 3B4PA 5BXQA 3DXOA 4L8OA 5IG0A 2UX0A 5IENA 3NBRA 2BNGA 1JN5B 3DMCA 2GEXA 5STDA 4R9KA 3F9SA 1Q40A 3K0ZA 5AEWB 1Q42A 4XM4A 4HZ9B 5AIFA 3EHCA 1OCVA 2HMMB 1O7HB 3MSOA 3OWSA 1JKGA 1OPYA 3NV0B 3FF0A 4HM6B 3M8CA 5G2GA 5FW5A 4KVHA 3JUPA 3T8UA 1W01A 3FH1A 3FZWA 3RGRA 5JPPA 3SOAA 4HM8B 5KP4A 1W6YA 2YFLB 1GY6A 1OGZA 1ZX2A 3OX9A 2F86B 5CXOA 3F40A 4L8PA 4XDWA 1O7MB 2BMRB 1K41A 1STDA 1GYBA 5CF1A 1OF5A 4STDA 5AIIA 4CDLA 5AIHA 5BVBA 4FCMA 3WMDA 3B8LA 2JQ5A 3BB9A 4U13A 4HZBB 4HJLB 4K1UA 2F98A 1GY7A 1Q40B 4L7KA 1NWWA 1TP6A 3LZAA 1DMMA 4WYKA 3VSYA 4HM7B 3ECFA 1E3VA 2HMKB 2BMOB 5KP1A 5D82A 1Z1SA 1ULIB 4R9LA 4MJDA 3EBTA 3ER7A 3GZRA 1JKGB 1ZO2A 5IERA 1QJGA 1GS3A 5CK6A 3EX9A
chains in the Genus database with same CATH superfamily
1GY5A 2D1WA 2XR8B 1RJOA 1VQ53 1Q7Y4 2Y74A 3KSPA 1IVVA 1T2HA 2JDIH 1TFKA 3LTDA 3NQZA 1OUNA 4MMZB 2W56A 3OXAA 3EBYA 1RTUA 3MYTA 1U5OA 6STDA 2AADA 1RN4A 2BO9B 3CNXA 4HKVB 1DMQA 1UCIA 1TUHA 1BRJA 2OWPA 3LT8A 3ALAA 2KXGA 3AGNA 6GSPA 4LZIA 1TJDA 1YJ93 3G8ZA 1SJWA 1YGEA 3N9HA 1VQM3 1VQN3 1VQ63 2W2CA 4BU4A 1IVXA 1HKXA 1L5GB 3PXMA 1B2SA 3DGYA 3AHSA 1O7NB 3ROBA 1D6YA 1RDSA 3UNLA 1KD14 2W9PA 5AYSC 3FLJA 3GSPA 4K90B 4KZ1A 1FGQA 1EA2A 4HVNA 5FGOA 1GMRA 3AMOB 4OUQA 2RSXA 1OF5B 3I0YA 5ELJA 3LTCA 1TRQA 3OWUA 5HGRA 5CLKA 3CCJ3 3V99A 3AGOA 1N5PA 1EG9B 2Z7AA 3CCL3 1ROVA 1QMAA 1RNTA 3F7XA 3DGOA 1CYUA 1W02A 3UL6A 2WOFA 1GD3A 1LVNA 2RGQA 4H61A 1JV2B 4J9AA 3X3YA 2CG1A 1QVG2 3HX8A 2CFWA 3FG3A 1V74A 1UCKA 3EQQB 5D81A 1IDPA 1RCLA 4LYLB 3UL5A 3NM2A 3Q90A 4NPBA 3QRDA 4XBXA 3KFQC 4WYKB 5G1LA 3RDEA 4EV2A 1BRNL 2W6JH 3CC23 1Q814 4WWUC 1GMQA 1BSBA 1I2EA 2QA43 1G0TA 3A76A 4X2HA 1IV9A 1ZS7A 2P05A 1OACA 3EN8A 4AKYA 1YJW3 3DH2A 1G02A 2GXFA 3CC73 2GBXB 1J2BA 1O7WB 2W9QA 1BGSA 4HM3B 3CPW2 1VZZA 1DVCA 2H0IA 4FCJA 2CFDA 3S67A 1B27A 1OH0A 2LYXA 1RGKA 3D5IA 4K1VA 1W7CA 2Y73A 4N6OB 1TU5A 1I70A 2OTJ3 5LC7A 2XFTA 1STFI 5IG3A 1Q864 2CKFB 1EUIC 3FCSB 2F4YA 2STDA 1N9JA 1RRLA 3JUNA 2KF3A 2IMJA 1VQO3 1MWSA 4LSOA 2WGOA 1JRQA 1FZUA 1BIRA 3HZPA 1VQ93 3EB8A 2BU4A 1GMPA 3IMAB 1W4NA 1B2ZA 4BL2A 2KRTA 1DMNA 2HMOB 2KF6A 3IJEB 8RNTA 2W56B 1JB5A 1ZGXA 2I9WA 5JBSA 1LNHA 2HMJB 3T0UA 2SARA 1IV7A 1R4CA 1S5AA 4H3UA 4HM4B 1A2KA 3KIIA 1YI23 1BSDA 1GD4A 1NO3A 2C11A 3IPTA 1O7GB 3NXJA 4O8SA 3I553 4GHOA 4JRFA 1PU4A 1IVWA 2WO0A 3EE1A 4BTXA 3BU4A 3CPOA 1N5HA 1T3BA 3GRDA 5AIGA 1JN5A 1F8NA 4ORLA 1MWUA 1FA3A 3KSED 2V1LA 2ZA4A 2XH9A 1W6GA 2F56A 3WDGB 3PZWA 1KSIA 2QEX3 3KKGA 1VQ43 1BNIA 3CU3A 1RKYA 2R41A 1NB3I 1BNFA 3Q3FA 1VQ73 1CEWI 3BNBA 2CX0A 3GWRA 1Q9EA 2R4IA 3CME3 4N6NB 1OHOA 2CG0A 1RSNA 5HOHA 1GOYA 2RBIA 2MC8A 3CXC2 2WOHA 1JBTA 4GL6A 4NHFA 5D83A 4EXRA 1U8CB 3GZYB 1UCJA 4BTYA 4CCVA 4RBNA 1M1K4 2CX1A 3D79A 2KF4A 1NDOB 1M1XB 3X3ZA 3U97A 3MG2A 3S28A 1TTOA 4RNTA 3D5GA 3SVAA 2P0XA 3H3HA 2A15A 3HIIA 3GZXB 3S5CA 1NJI4 1IT7A 1SARA 3JUOA 3WOEB 3FG4A 2FNQA 3EC9A 2ML5A 3D3LA 3X42A 1T2IA 1OHSA 3SEDA 3KCHA 1IU7A 2CK3H 1JB4A 3MWZA 1JB2A 4EV5A 1GOUA 1S723 2CFLA 4DKIA 3LH4A 1IK3A 5BU4A 3GZBA 1A2VA 3HOHA 3X3XA 1BSAA 4HOHA 1BNJA 4EW5A 1FGOA 2AAEA 2J8XB 3CNMA 4K61A 4HM2B 1E3RA 2GEYA 8CHOA 2ML6A 3A5EA 4HM1B 1I8VA 1YIT3 1MGWA 1W00A 4IIAA 1KC84 2OQEC 4O2HA 4WP5A 3CCM3 4KT3B 4KFDA 2MF7A 3JUMA 2C4BA 1JBRA 1BUJA 3JVCA 1X1XA 3F8XA 3LTAA 1JJ22 2GBWB 2OCTA 1E97A 1RGCA 4HM5B 4N6TA 2QIYA 2UUGC 3LTBA 1B2MA 5LC6A 4XDVA 3WOFB 1MOLA 3K5TA 1PFPA 4Q53A 4FR9A 1O7PB 4MMXB 1UDII 2PZVA 1BNGA 4TX4A 3KZTA 2OQEA 2IUJA 1UUWB 1KWIA 1I0XA 1N9EA 2P0MA 3PYJA 3K7CA 1BUQA 3MG3A 3T8NA 1UUVB 2C10A 2QGUA 3DM8A 2CFGA 1AVLA 4ZM8A 3LT9A 2Z77A 3NM7A 3MG1A 1RGFA 4N6MA 3E99A 3SLUA 4PEJA 4XB5A 2K0MA 4N3VA 2HOHA 1ISKA 3OWYA 2RNTA 3VF1A 5BIRA 3EJVA 1JZDA 1ROAA 4N6LA 3UJMA 5KP3A 2UGIA 4KFEA 5IEOA 7GSPA 3SOYA 4OK0A 2O9UX 1RNBA 2WGQA 2CWUA 2XRXB 2BMQB 1K734 1BAOA 2M7OA 1YIJ3 3EN1B 3NHXA 3S29A 1ULJB 1JZOA 1BRIA 1X1YA 1IYYA 1T5YA 4I4KA 7STDA 1X1WA 2RCDA 1JNQA 1LOXA 5IW9A 3KE7A 2CHCA 1BNSA 1ASKA 3DGLA 5I97A 1HU9A 4R4KA 1SPUA 3FGYA 5JPUA 3Q2PA 4N6V0 1PYLA 2KCDA 2GU3A 1DETA 1QAFA 4LEHA 5CF2A 2XEPA 4O3VA 3F8HA 5EVHA 3SXXA 1FUWA 3DY5A 5AI1A 1UUGB 2E2TA 1N8QA 1RGAA 3NX0A 4CJNA 1NB5I 2XF3A 3NQYA 1W2ZA 1V57A 1CH0A 3OV4A 3G0KA 4MMYB 1HYFA 2HMNB 3F7SA 1NNVA 3G16A 1WMPA 3LYGA 3X40A 3VGNA 1B20A 1IQYA 1RN1A 3JUQA 1NU3A 3URPA 3WHOA 3QK9A 1IQXA 3G6E3 1VQP3 5IEPA 3SX1A 5GSPA 3G713 4LGQA 4RZMA 3BNEA 1AR0A 1C7HA 4BL3A 3Q1CA 4EBGA 4KFFA 1YJN3 1I3IA 1Q7HA 2XSHB 2Z76A 1AV4A 1GSPA 4G1MB 2CC3A 1UI7A 4CPKA 3PS8A 2CH9A 4AEQA 1I0VA 3RNTA 4AKZA 3BNDA 4HM0B 1DE3A 4RNYA 3DUKA 4LMIA 1FGTA 1AVKA 1RGEA 3L0RA 2INXA 1RMSA 1RN7A 2W0QA 2W04A 5TGNA 4XBYA 2CW9A 3HK4A 2HMLB 3OW22 2F99A 2P09A 2Z6BA 2B24B 1GOVA 1WTHA 1BRSA 1WMNA 2ZDJA 3NV0A 3MKIA 1IQ8A 4GSPA 3RGAA 1CQSA 1KQS2 1VQ83 1EKMA 2LQVA 1WMOA 3D4AA 1VQL3 3FSDA 5IG5A 2L1SA 5EQLA 3PCRA 2F5MA 5IG4A 5EEOA 2K54A 1UI8A 6RNTA 3FKAA 3F14A 3WA2X 1EQKA 1OHPA 1W6CA 2YFJB 3D9RA 5IF6A 1UGIA 3BIRA 3MPHA 4FMDA 2XSOB 3MHEA 2L4VA 1OGXA 3B7CA 1FYSA 3B4OA 1MNLA 2RFRA 1BNEA 3BNCA 4XBTA 1FW7A 3WA3A 3LXUX 3I563 1BRGA 1D6UA 5DREA 3V92A 2CIUA 2PNCA 3CCQ3 3H51A 2B1XB 3BLZA 4RNZA 1LOWA 2E2VA 3EF8A 4J5GA 4GB5A 4IPBA 4X2OA 2CWTA 1UW1A 5AEUB 3DZLA 3LMLA 5M18A 5RNTA 4OVMA 4MEIA 3HIGA 4J8TA 4R1KA 9RNTA 3NUVA 3NBJA 1QALA 2KF5A 3FF2A 5DRVA 3STDA 4FMBA 2K3DA 1WQLB 3N8BA 1W2B2 1MWTA 1K9M4 2YFIB 1Y4KA 3AHWA 3B4PA 5BXQA 4HAAA 1X1UA 3DXOA 4L8OA 4EYCA 2Q07A 5IG0A 2UX0A 5IENA 1YGWA 3S27A 3NBRA 1HZ1A 1BANA 1SIIA 2BNGA 1JN5B 1I2GA 2CFKA 1SQWA 1BSCA 4HBRA 4WFOA 3DMCA 1LRAA 4BTWA 2GEXA 5STDA 1QAKA 2YX9A 3F9SA 4R9KA 1WNHA 1RHLA 1Q40A 3K0ZA 5AEWB 1TIJA 1Q42A 4XM4A 1CYVA 2GU1A 3ZG5A 3CC43 4EC6A 4HZ9B 5AIFA 2BHMA 2GSPA 3EHCA 1OCVA 2SBLA 3CCR3 1M904 2HMMB 1BVIA 1M9GA 1O7HB 4I5QA 7RNTA 3WODG 3MSOA 3OWSA 1LOYA 1RGLA 5M19A 3NBBA 3CCE3 1LOVA 2IYJA 1DVDA 1JKGA 1OPYA 3NV0B 3FF0A 4NREA 1K28A 4HM6B 3M8CA 5G2GA 1A67A 1C54A 5AYRB 2D42A 5FW5A 1B3SA 1IT8A 2OOVC 1A2PA 4KVHA 2XGLA 1G96A 3JUPA 4HYZA 2H0HA 4WHAA 1W01A 3T8UA 3ZFZA 2XFSA 1BRKA 2IY2A 3J7Yd 3FH1A 3PCSA 3FZWA 1W5ZA 1FGRA 4R80A 3RGRA 5JPPA 3DGNA 1JBSA 1PY3A 2O3OA 2P38A 2ZHXB 3SOAA 1BSEA 1YVSA 3LOYA 4HM8B 1UGHI 1RCKA 5KP4A 1YHQ3 1FUSA 3CMA3 1MWRA 3O8YA 1W6YA 1B21A 3SYUA 1MGRA 2YFLB 1GY6A 1OGZA 4FMAA 1FGMA 2OOVA 3G4S3 2F5WA 3U1WA 3HI7A 1ZX2A 1VQQA 1UCLA 3OX9A 3DGMA 4IT7A 4N6UA 1D6ZA 3ZG0A 2F86B 5CXOA 3F40A 2KAAA 4L8PA 4XDWA 1QVF2 2FGTA 1TFOA 3K63A 4JF8A 1O7MB 3WR2A 3CD63 2BMRB 1K41A 5M1AA 3CCV3 3TDGA 1Q824 3AMOA 1STDA 3KN4A 1LNIA 1GYBA 5CF1A 1RLSA 1I3FA 2BT3A 1OF5A 4STDA 5ELUA 1BNRA 5AIIA 4CDLA 2E2UA 5AIHA 5BVBA 1VQK3 1V58A 1US1A 3N54B 2W03A 4FCMA 1R4YA 3WMDA 3UB1A 1LXEA 3B8LA 2ZL8A 4O02B 2JQ5A 5A0OB 3BB9A 4U13A 2BIRA 4HZBB 1LQMB 4HJLB 4J5KA 1EEJA 2F98A 4K1UA 1GY7A 1Q40B 3X41A 4L7KA 1BOXA 3PGBA 1IVUA 1NWWA 1TP6A 4FCZA 4QWTA 3LZAA 1DMMA 4WYKA 3VSYA 4HM7B 3ECFA 1E3VA 3GAXA 2HMKB 2BMOB 2IUKA 1SIHA 1K8A4 2OTL3 2CWVA 2FXTA 5KP1A 5D82A 4BIRA 1B2UA 3V98A 2IA7A 1Z1SA 1YNVX 1AY7A 1I2FA 2H0GA 5G1KA 1ULIB 1TRPA 1A90A 4R9LA 4MJDA 3EBTA 3FG1A 4ILFA 3ER7A 3GZRA 1JKGB 1RGHA 1ZO2A 1YVBI 5IERA 1BRHA 2XGNA 1LQGC 3CCU3 3CCS3 1B2XA 3K9MC 1RGGA 1QJGA 1AQZA 1RRHA 1BU4A 4FMCA 1GS3A 1DYUA 5CK6A 1FUTA 3EX9A 1N8R4
chains in the Genus database with same CATH topology
1GY5A 2D1WA 2XR8B 1RJOA 1VQ53 1Q7Y4 2Y74A 3KSPA 1IVVA 3LTDA 2JDIH 1TFKA 4MMZB 3NQZA 1OUNA 2W56A 3OXAA 3EBYA 3MYTA 1U5OA 6STDA 3CNXA 2BO9B 4HKVB 1DMQA 1TUHA 3LT8A 2OWPA 3ALAA 2KXGA 4LZIA 1YJ93 3G8ZA 1SJWA 1YGEA 3N9HA 1VQM3 1VQN3 1VQ63 2W2CA 1IVXA 1HKXA 1L5GB 3PXMA 1O7NB 3ROBA 1D6YA 3UNLA 1KD14 2W9PA 5AYSC 3FLJA 4K90B 4KZ1A 1FGQA 1EA2A 4HVNA 5FGOA 3AMOB 4OUQA 2RSXA 1OF5B 3I0YA 5ELJA 3LTCA 3OWUA 5HGRA 5CLKA 3CCJ3 3V99A 1N5PA 1EG9B 2Z7AA 3CCL3 1ROVA 1QMAA 3F7XA 3DGOA 1CYUA 1W02A 3UL6A 2WOFA 1GD3A 1LVNA 2RGQA 4H61A 1JV2B 4J9AA 3X3YA 2CG1A 1QVG2 3HX8A 2CFWA 3FG3A 1V74A 3EQQB 5D81A 1IDPA 3UL5A 3NM2A 3Q90A 4XBXA 3QRDA 3KFQC 4WYKB 3RDEA 4EV2A 2W6JH 3CC23 1Q814 4WWUC 2QA43 3A76A 4X2HA 1IV9A 2P05A 1OACA 3EN8A 4AKYA 1YJW3 2GXFA 3CC73 2GBXB 1J2BA 1O7WB 2W9QA 4HM3B 3CPW2 1VZZA 1DVCA 4FCJA 2CFDA 3S67A 1OH0A 2LYXA 4K1VA 1W7CA 2Y73A 1TU5A 2OTJ3 5LC7A 2XFTA 1STFI 5IG3A 1Q864 2CKFB 3FCSB 2STDA 1N9JA 1RRLA 3JUNA 2IMJA 1VQO3 4LSOA 2WGOA 1JRQA 3HZPA 1VQ93 3EB8A 3IMAB 1W4NA 2KRTA 1DMNA 2HMOB 3IJEB 2W56B 1JB5A 2I9WA 5JBSA 1LNHA 2HMJB 3T0UA 1IV7A 1R4CA 1S5AA 4H3UA 4HM4B 1A2KA 3KIIA 1YI23 1GD4A 1NO3A 2C11A 3IPTA 1O7GB 3NXJA 4O8SA 3I553 4JRFA 1PU4A 1IVWA 2WO0A 3EE1A 4BTXA 3CPOA 1N5HA 3GRDA 5AIGA 1JN5A 1F8NA 4ORLA 1FA3A 3KSED 2V1LA 2XH9A 1W6GA 3WDGB 3PZWA 1KSIA 2QEX3 3KKGA 1VQ43 3CU3A 1RKYA 1NB3I 1VQ73 1CEWI 3BNBA 3GWRA 2R4IA 3CME3 4N6NB 1OHOA 2CG0A 2MC8A 3CXC2 2WOHA 4GL6A 4NHFA 5D83A 4EXRA 1U8CB 3GZYB 4BTYA 1M1K4 4RBNA 1NDOB 1M1XB 3X3ZA 3U97A 3MG2A 3S28A 3SVAA 2P0XA 3H3HA 2A15A 3HIIA 3GZXB 3S5CA 1NJI4 1IT7A 3JUOA 3WOEB 3FG4A 2FNQA 3EC9A 2ML5A 3D3LA 3X42A 1OHSA 3SEDA 4EV5A 1IU7A 2CK3H 1JB4A 3MWZA 1JB2A 1S723 2CFLA 3LH4A 1IK3A 3GZBA 1A2VA 3X3XA 1FGOA 3CNMA 4K61A 4HM2B 1E3RA 2GEYA 8CHOA 2ML6A 4HM1B 1YIT3 1W00A 4IIAA 1KC84 2OQEC 4O2HA 4WP5A 3CCM3 4KFDA 2MF7A 3JUMA 3JVCA 3F8XA 3LTAA 1JJ22 2GBWB 2OCTA 1E97A 4HM5B 4N6TA 2QIYA 3LTBA 5LC6A 4XDVA 3WOFB 1MOLA 3K5TA 1PFPA 4Q53A 4FR9A 1O7PB 4MMXB 2PZVA 4TX4A 3KZTA 2OQEA 2IUJA 1UUWB 1KWIA 1N9EA 2P0MA 3PYJA 3K7CA 1BUQA 3MG3A 3T8NA 1UUVB 2C10A 2QGUA 3DM8A 2CFGA 1AVLA 4ZM8A 3LT9A 2Z77A 3NM7A 3MG1A 4N6MA 3E99A 3SLUA 4PEJA 4XB5A 2K0MA 4N3VA 1ISKA 3OWYA 3VF1A 3EJVA 1ROAA 4N6LA 3UJMA 5KP3A 4KFEA 5IEOA 3SOYA 4OK0A 2O9UX 2WGQA 2CWUA 2XRXB 2BMQB 1K734 2M7OA 1YIJ3 3EN1B 3NHXA 1ULJB 1T5YA 4I4KA 7STDA 2RCDA 1JNQA 1LOXA 5IW9A 3KE7A 2CHCA 1ASKA 3DGLA 5I97A 1HU9A 4R4KA 1SPUA 3FGYA 5JPUA 3Q2PA 4N6V0 2KCDA 2GU3A 1QAFA 4LEHA 5CF2A 2XEPA 4O3VA 3F8HA 5EVHA 3SXXA 1FUWA 3DY5A 5AI1A 2E2TA 1N8QA 1NB5I 3NX0A 2XF3A 3NQYA 1W2ZA 3OV4A 3G0KA 4MMYB 2HMNB 3F7SA 3G16A 3LYGA 1WMPA 3X40A 3VGNA 1IQYA 3JUQA 1NU3A 1VQP3 3QK9A 1IQXA 3G6E3 5IEPA 3SX1A 3G713 4LGQA 4RZMA 3BNEA 1AR0A 1C7HA 3Q1CA 4EBGA 4KFFA 1YJN3 2XSHB 2Z76A 1AV4A 4G1MB 2CC3A 1UI7A 3PS8A 2CH9A 4AEQA 4AKZA 3BNDA 4HM0B 4RNYA 3DUKA 4LMIA 1FGTA 1AVKA 3L0RA 2INXA 1RN7A 2W0QA 2W04A 5TGNA 4XBYA 2CW9A 3HK4A 2HMLB 3OW22 2F99A 2P09A 2Z6BA 2B24B 1WTHA 1WMNA 2ZDJA 3NV0A 3MKIA 1IQ8A 3RGAA 1KQS2 1CQSA 1VQ83 1VQL3 1EKMA 2LQVA 1WMOA 1QVF2 3FSDA 5IG5A 5EQLA 3PCRA 5IG4A 5EEOA 2K54A 1UI8A 3FKAA 3F14A 3WA2X 1EQKA 1OHPA 1W6CA 2YFJB 3D9RA 5IF6A 4FMDA 3MPHA 2XSOB 3MHEA 2L4VA 1OGXA 3B7CA 4N6OB 3B4OA 1MNLA 2RFRA 3BNCA 4XBTA 3WA3A 3LXUX 3I563 1D6UA 5DREA 3V92A 2CIUA 2PNCA 3CCQ3 3H51A 2B1XB 3BLZA 4RNZA 2E2VA 3EF8A 4GB5A 4IPBA 4X2OA 2CWTA 1UW1A 5AEUB 3DZLA 3LMLA 4OVMA 4MEIA 3HIGA 4J8TA 4R1KA 3NUVA 3NBJA 1QALA 3FF2A 5DRVA 3STDA 4FMBA 1WQLB 3N8BA 1W2B2 1K9M4 2YFIB 1Y4KA 3B4PA 5BXQA 3DXOA 4L8OA 4EYCA 2Q07A 5IG0A 2UX0A 5IENA 3S27A 3NBRA 1SIIA 4CCVA 2BNGA 4HBRA 1JN5B 2CFKA 4WFOA 1SQWA 3DMCA 4BTWA 2GEXA 5STDA 1QAKA 2YX9A 3F9SA 4R9KA 1WNHA 1Q40A 3K0ZA 5AEWB 1TIJA 1Q42A 4XM4A 2GU1A 1CYVA 3CC43 4EC6A 4HZ9B 5AIFA 2BHMA 3EHCA 1OCVA 2SBLA 3CCR3 1M904 2HMMB 1M9GA 1O7HB 3WODG 3MSOA 3OWSA 3NBBA 3CCE3 1DVDA 1JKGA 1OPYA 3NV0B 3FF0A 4NREA 1K28A 4HM6B 3M8CA 5G2GA 1A67A 5AYRB 2D42A 5FW5A 1IT8A 2OOVC 4KVHA 2XGLA 1G96A 3JUPA 4HYZA 4WHAA 3T8UA 1W01A 2XFSA 3J7Yd 3FH1A 3PCSA 3FZWA 1W5ZA 1FGRA 4R80A 3RGRA 5JPPA 3DGNA 2O3OA 2P38A 3SOAA 3LOYA 4HM8B 5KP4A 1YHQ3 3CMA3 3O8YA 1W6YA 2YFLB 1GY6A 1OGZA 4FMAA 1FGMA 2OOVA 3G4S3 3U1WA 3HI7A 1ZX2A 3OX9A 3DGMA 4IT7A 4N6UA 1D6ZA 2F86B 5CXOA 3F40A 4L8PA 4XDWA 2FGTA 1TFOA 3K63A 4JF8A 1O7MB 3CD63 2BMRB 1K41A 3CCV3 3TDGA 1Q824 3AMOA 1STDA 3KN4A 1GYBA 5CF1A 2BT3A 1OF5A 4STDA 5ELUA 5AIIA 4CDLA 2E2UA 5AIHA 5BVBA 1VQK3 1US1A 3N54B 2W03A 4FCMA 3WMDA 3UB1A 1LXEA 3B8LA 2ZL8A 4O02B 2JQ5A 5A0OB 3BB9A 4U13A 4HZBB 4HJLB 4K1UA 2F98A 1GY7A 1Q40B 3X41A 4L7KA 3PGBA 1IVUA 1NWWA 1TP6A 4FCZA 4QWTA 3LZAA 1DMMA 4WYKA 3VSYA 4HM7B 3ECFA 1E3VA 3GAXA 2HMKB 2BMOB 2IUKA 1SIHA 1K8A4 2OTL3 2CWVA 2FXTA 5KP1A 5D82A 3V98A 2IA7A 1Z1SA 1ULIB 1A90A 4R9LA 4MJDA 3EBTA 3FG1A 3ER7A 3GZRA 1JKGB 1ZO2A 1YVBI 5IERA 2XGNA 3CCU3 3CCS3 3K9MC 1QJGA 1RRHA 4FMCA 1GS3A 1DYUA 5CK6A 3S29A 3EX9A 1N8R4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GY5 A;  2XR8 B;  3KSP A;  1OUN A;  3OXA A;  3EBY A;  3MYT A;  1U5O A;  6STD A;  3CNX A;  4HKV B;  1DMQ A;  1TUH A;  2OWP A;  3G8Z A;  1SJW A;  2W2C A;  1HKX A;  1O7N B;  3ROB A;  3UNL A;  3FLJ A;  1EA2 A;  4HVN A;  4OUQ A;  1OF5 B;  3I0Y A;  3OWU A;  5HGR A;  5CLK A;  2Z7A A;  1EG9 B;  1QMA A;  3F7X A;  1W02 A;  2RGQ A;  4J9A A;  3HX8 A;  3EQQ B;  5D81 A;  1IDP A;  3NM2 A;  3Q90 A;  4XBX A;  4WYK B;  4WWU C;  3A76 A;  4X2H A;  3EN8 A;  2GXF A;  2GBX B;  1O7W B;  4HM3 B;  1VZZ A;  4FCJ A;  1OH0 A;  4K1V A;  5IG3 A;  2CKF B;  2STD A;  3JUN A;  2IMJ A;  3HZP A;  1DMN A;  2HMO B;  1JB5 A;  2I9W A;  2HMJ B;  1S5A A;  4H3U A;  4HM4 B;  1A2K A;  3IPT A;  1O7G B;  3NXJ A;  3CPO A;  3GRD A;  5AIG A;  1JN5 A;  4ORL A;  3KKG A;  3CU3 A;  3GWR A;  2R4I A;  1OHO A;  5D83 A;  3GZY B;  1NDO B;  3MG2 A;  3H3H A;  2A15 A;  3GZX B;  3S5C A;  3JUO A;  3EC9 A;  1OHS A;  3SED A;  1JB4 A;  1JB2 A;  3GZB A;  3CNM A;  4HM2 B;  1E3R A;  2GEY A;  8CHO A;  4HM1 B;  1W00 A;  4IIA A;  4WP5 A;  3JUM A;  3F8X A;  2GBW B;  1E97 A;  4HM5 B;  2QIY A;  4XDV A;  4Q53 A;  1O7P B;  2PZV A;  3KZT A;  1UUW B;  3K7C A;  1BUQ A;  3MG3 A;  3T8N A;  1UUV B;  2QGU A;  3DM8 A;  2Z77 A;  3MG1 A;  3E99 A;  4PEJ A;  4XB5 A;  4N3V A;  1ISK A;  3OWY A;  3EJV A;  3UJM A;  5KP3 A;  5IEO A;  3SOY A;  2XRX B;  2BMQ B;  3EN1 B;  3NHX A;  1ULJ B;  4I4K A;  7STD A;  2RCD A;  3KE7 A;  2CHC A;  1ASK A;  3FGY A;  5JPU A;  4LEH A;  5CF2 A;  3F8H A;  5EVH A;  5AI1 A;  3OV4 A;  3G0K A;  2HMN B;  3F7S A;  3G16 A;  3LYG A;  3VGN A;  3JUQ A;  1NU3 A;  5IEP A;  4LGQ A;  4RZM A;  1AR0 A;  1C7H A;  2XSH B;  2Z76 A;  4HM0 B;  3DUK A;  4LMI A;  2INX A;  5TGN A;  4XBY A;  3HK4 A;  2HML B;  2F99 A;  2B24 B;  3NV0 A;  3MKI A;  3RGA A;  1CQS A;  3FSD A;  5IG5 A;  5IG4 A;  2K54 A;  3FKA A;  3F14 A;  1OHP A;  2YFJ B;  3D9R A;  5IF6 A;  2XSO B;  3MHE A;  1OGX A;  3B7C A;  3B4O A;  2RFR A;  4XBT A;  5DRE A;  3H51 A;  2B1X B;  3BLZ A;  3EF8 A;  4GB5 A;  4X2O A;  5AEU B;  3DZL A;  4OVM A;  4J8T A;  4R1K A;  3NUV A;  3FF2 A;  5DRV A;  3STD A;  1WQL B;  2YFI B;  3B4P A;  5BXQ A;  3DXO A;  4L8O A;  5IG0 A;  2UX0 A;  5IEN A;  3NBR A;  2BNG A;  1JN5 B;  3DMC A;  2GEX A;  5STD A;  4R9K A;  3F9S A;  1Q40 A;  3K0Z A;  5AEW B;  1Q42 A;  4XM4 A;  4HZ9 B;  5AIF A;  3EHC A;  1OCV A;  2HMM B;  1O7H B;  3MSO A;  3OWS A;  1JKG A;  1OPY A;  3NV0 B;  3FF0 A;  4HM6 B;  3M8C A;  5G2G A;  5FW5 A;  4KVH A;  3JUP A;  3T8U A;  1W01 A;  3FH1 A;  3FZW A;  3RGR A;  5JPP A;  3SOA A;  4HM8 B;  5KP4 A;  1W6Y A;  2YFL B;  1GY6 A;  1OGZ A;  1ZX2 A;  3OX9 A;  2F86 B;  5CXO A;  3F40 A;  4L8P A;  4XDW A;  1O7M B;  2BMR B;  1K41 A;  1STD A;  1GYB A;  5CF1 A;  1OF5 A;  4STD A;  5AII A;  4CDL A;  5AIH A;  5BVB A;  4FCM A;  3WMD A;  3B8L A;  2JQ5 A;  3BB9 A;  4U13 A;  4HZB B;  4HJL B;  4K1U A;  2F98 A;  1GY7 A;  1Q40 B;  4L7K A;  1NWW A;  1TP6 A;  3LZA A;  1DMM A;  4WYK A;  3VSY A;  4HM7 B;  3ECF A;  1E3V A;  2HMK B;  2BMO B;  5KP1 A;  5D82 A;  1Z1S A;  1ULI B;  4R9L A;  4MJD A;  3EBT A;  3ER7 A;  3GZR A;  1JKG B;  1ZO2 A;  5IER A;  1QJG A;  1GS3 A;  5CK6 A;  3EX9 A; 
#chains in the Genus database with same CATH topology
 1GY5 A;  2D1W A;  2XR8 B;  1RJO A;  1VQ5 3;  1Q7Y 4;  2Y74 A;  3KSP A;  1IVV A;  1T2H A;  2JDI H;  1TFK A;  3LTD A;  3NQZ A;  1OUN A;  4MMZ B;  2W56 A;  3OXA A;  3EBY A;  1RTU A;  3MYT A;  1U5O A;  6STD A;  2AAD A;  1RN4 A;  2BO9 B;  3CNX A;  4HKV B;  1DMQ A;  1UCI A;  1TUH A;  1BRJ A;  2OWP A;  3LT8 A;  3ALA A;  2KXG A;  3AGN A;  6GSP A;  4LZI A;  1TJD A;  1YJ9 3;  3G8Z A;  1SJW A;  1YGE A;  3N9H A;  1VQM 3;  1VQN 3;  1VQ6 3;  2W2C A;  4BU4 A;  1IVX A;  1HKX A;  1L5G B;  3PXM A;  1B2S A;  3DGY A;  3AHS A;  1O7N B;  3ROB A;  1D6Y A;  1RDS A;  3UNL A;  1KD1 4;  2W9P A;  5AYS C;  3FLJ A;  3GSP A;  4K90 B;  4KZ1 A;  1FGQ A;  1EA2 A;  4HVN A;  5FGO A;  1GMR A;  3AMO B;  4OUQ A;  2RSX A;  1OF5 B;  3I0Y A;  5ELJ A;  3LTC A;  1TRQ A;  3OWU A;  5HGR A;  5CLK A;  3CCJ 3;  3V99 A;  3AGO A;  1N5P A;  1EG9 B;  2Z7A A;  3CCL 3;  1ROV A;  1QMA A;  1RNT A;  3F7X A;  3DGO A;  1CYU A;  1W02 A;  3UL6 A;  2WOF A;  1GD3 A;  1LVN A;  2RGQ A;  4H61 A;  1JV2 B;  4J9A A;  3X3Y A;  2CG1 A;  1QVG 2;  3HX8 A;  2CFW A;  3FG3 A;  1V74 A;  1UCK A;  3EQQ B;  5D81 A;  1IDP A;  1RCL A;  4LYL B;  3UL5 A;  3NM2 A;  3Q90 A;  4NPB A;  3QRD A;  4XBX A;  3KFQ C;  4WYK B;  5G1L A;  3RDE A;  4EV2 A;  1BRN L;  2W6J H;  3CC2 3;  1Q81 4;  4WWU C;  1GMQ A;  1BSB A;  1I2E A;  2QA4 3;  1G0T A;  3A76 A;  4X2H A;  1IV9 A;  1ZS7 A;  2P05 A;  1OAC A;  3EN8 A;  4AKY A;  1YJW 3;  3DH2 A;  1G02 A;  2GXF A;  3CC7 3;  2GBX B;  1J2B A;  1O7W B;  2W9Q A;  1BGS A;  4HM3 B;  3CPW 2;  1VZZ A;  1DVC A;  2H0I A;  4FCJ A;  2CFD A;  3S67 A;  1B27 A;  1OH0 A;  2LYX A;  1RGK A;  3D5I A;  4K1V A;  1W7C A;  2Y73 A;  4N6O B;  1TU5 A;  1I70 A;  2OTJ 3;  5LC7 A;  2XFT A;  1STF I;  5IG3 A;  1Q86 4;  2CKF B;  1EUI C;  3FCS B;  2F4Y A;  2STD A;  1N9J A;  1RRL A;  3JUN A;  2KF3 A;  2IMJ A;  1VQO 3;  1MWS A;  4LSO A;  2WGO A;  1JRQ A;  1FZU A;  1BIR A;  3HZP A;  1VQ9 3;  3EB8 A;  2BU4 A;  1GMP A;  3IMA B;  1W4N A;  1B2Z A;  4BL2 A;  2KRT A;  1DMN A;  2HMO B;  2KF6 A;  3IJE B;  8RNT A;  2W56 B;  1JB5 A;  1ZGX A;  2I9W A;  5JBS A;  1LNH A;  2HMJ B;  3T0U A;  2SAR A;  1IV7 A;  1R4C A;  1S5A A;  4H3U A;  4HM4 B;  1A2K A;  3KII A;  1YI2 3;  1BSD A;  1GD4 A;  1NO3 A;  2C11 A;  3IPT A;  1O7G B;  3NXJ A;  4O8S A;  3I55 3;  4GHO A;  4JRF A;  1PU4 A;  1IVW A;  2WO0 A;  3EE1 A;  4BTX A;  3BU4 A;  3CPO A;  1N5H A;  1T3B A;  3GRD A;  5AIG A;  1JN5 A;  1F8N A;  4ORL A;  1MWU A;  1FA3 A;  3KSE D;  2V1L A;  2ZA4 A;  2XH9 A;  1W6G A;  2F56 A;  3WDG B;  3PZW A;  1KSI A;  2QEX 3;  3KKG A;  1VQ4 3;  1BNI A;  3CU3 A;  1RKY A;  2R41 A;  1NB3 I;  1BNF A;  3Q3F A;  1VQ7 3;  1CEW I;  3BNB A;  2CX0 A;  3GWR A;  1Q9E A;  2R4I A;  3CME 3;  4N6N B;  1OHO A;  2CG0 A;  1RSN A;  5HOH A;  1GOY A;  2RBI A;  2MC8 A;  3CXC 2;  2WOH A;  1JBT A;  4GL6 A;  4NHF A;  5D83 A;  4EXR A;  1U8C B;  3GZY B;  1UCJ A;  4BTY A;  4CCV A;  4RBN A;  1M1K 4;  2CX1 A;  3D79 A;  2KF4 A;  1NDO B;  1M1X B;  3X3Z A;  3U97 A;  3MG2 A;  3S28 A;  1TTO A;  4RNT A;  3D5G A;  3SVA A;  2P0X A;  3H3H A;  2A15 A;  3HII A;  3GZX B;  3S5C A;  1NJI 4;  1IT7 A;  1SAR A;  3JUO A;  3WOE B;  3FG4 A;  2FNQ A;  3EC9 A;  2ML5 A;  3D3L A;  3X42 A;  1T2I A;  1OHS A;  3SED A;  3KCH A;  1IU7 A;  2CK3 H;  1JB4 A;  3MWZ A;  1JB2 A;  4EV5 A;  1GOU A;  1S72 3;  2CFL A;  4DKI A;  3LH4 A;  1IK3 A;  5BU4 A;  3GZB A;  1A2V A;  3HOH A;  3X3X A;  1BSA A;  4HOH A;  1BNJ A;  4EW5 A;  1FGO A;  2AAE A;  2J8X B;  3CNM A;  4K61 A;  4HM2 B;  1E3R A;  2GEY A;  8CHO A;  2ML6 A;  3A5E A;  4HM1 B;  1I8V A;  1YIT 3;  1MGW A;  1W00 A;  4IIA A;  1KC8 4;  2OQE C;  4O2H A;  4WP5 A;  3CCM 3;  4KT3 B;  4KFD A;  2MF7 A;  3JUM A;  2C4B A;  1JBR A;  1BUJ A;  3JVC A;  1X1X A;  3F8X A;  3LTA A;  1JJ2 2;  2GBW B;  2OCT A;  1E97 A;  1RGC A;  4HM5 B;  4N6T A;  2QIY A;  2UUG C;  3LTB A;  1B2M A;  5LC6 A;  4XDV A;  3WOF B;  1MOL A;  3K5T A;  1PFP A;  4Q53 A;  4FR9 A;  1O7P B;  4MMX B;  1UDI I;  2PZV A;  1BNG A;  4TX4 A;  3KZT A;  2OQE A;  2IUJ A;  1UUW B;  1KWI A;  1I0X A;  1N9E A;  2P0M A;  3PYJ A;  3K7C A;  1BUQ A;  3MG3 A;  3T8N A;  1UUV B;  2C10 A;  2QGU A;  3DM8 A;  2CFG A;  1AVL A;  4ZM8 A;  3LT9 A;  2Z77 A;  3NM7 A;  3MG1 A;  1RGF A;  4N6M A;  3E99 A;  3SLU A;  4PEJ A;  4XB5 A;  2K0M A;  4N3V A;  2HOH A;  1ISK A;  3OWY A;  2RNT A;  3VF1 A;  5BIR A;  3EJV A;  1JZD A;  1ROA A;  4N6L A;  3UJM A;  5KP3 A;  2UGI A;  4KFE A;  5IEO A;  7GSP A;  3SOY A;  4OK0 A;  2O9U X;  1RNB A;  2WGQ A;  2CWU A;  2XRX B;  2BMQ B;  1K73 4;  1BAO A;  2M7O A;  1YIJ 3;  3EN1 B;  3NHX A;  3S29 A;  1ULJ B;  1JZO A;  1BRI A;  1X1Y A;  1IYY A;  1T5Y A;  4I4K A;  7STD A;  1X1W A;  2RCD A;  1JNQ A;  1LOX A;  5IW9 A;  3KE7 A;  2CHC A;  1BNS A;  1ASK A;  3DGL A;  5I97 A;  1HU9 A;  4R4K A;  1SPU A;  3FGY A;  5JPU A;  3Q2P A;  4N6V 0;  1PYL A;  2KCD A;  2GU3 A;  1DET A;  1QAF A;  4LEH A;  5CF2 A;  2XEP A;  4O3V A;  3F8H A;  5EVH A;  3SXX A;  1FUW A;  3DY5 A;  5AI1 A;  1UUG B;  2E2T A;  1N8Q A;  1RGA A;  3NX0 A;  4CJN A;  1NB5 I;  2XF3 A;  3NQY A;  1W2Z A;  1V57 A;  1CH0 A;  3OV4 A;  3G0K A;  4MMY B;  1HYF A;  2HMN B;  3F7S A;  1NNV A;  3G16 A;  1WMP A;  3LYG A;  3X40 A;  3VGN A;  1B20 A;  1IQY A;  1RN1 A;  3JUQ A;  1NU3 A;  3URP A;  3WHO A;  3QK9 A;  1IQX A;  3G6E 3;  1VQP 3;  5IEP A;  3SX1 A;  5GSP A;  3G71 3;  4LGQ A;  4RZM A;  3BNE A;  1AR0 A;  1C7H A;  4BL3 A;  3Q1C A;  4EBG A;  4KFF A;  1YJN 3;  1I3I A;  1Q7H A;  2XSH B;  2Z76 A;  1AV4 A;  1GSP A;  4G1M B;  2CC3 A;  1UI7 A;  4CPK A;  3PS8 A;  2CH9 A;  4AEQ A;  1I0V A;  3RNT A;  4AKZ A;  3BND A;  4HM0 B;  1DE3 A;  4RNY A;  3DUK A;  4LMI A;  1FGT A;  1AVK A;  1RGE A;  3L0R A;  2INX A;  1RMS A;  1RN7 A;  2W0Q A;  2W04 A;  5TGN A;  4XBY A;  2CW9 A;  3HK4 A;  2HML B;  3OW2 2;  2F99 A;  2P09 A;  2Z6B A;  2B24 B;  1GOV A;  1WTH A;  1BRS A;  1WMN A;  2ZDJ A;  3NV0 A;  3MKI A;  1IQ8 A;  4GSP A;  3RGA A;  1CQS A;  1KQS 2;  1VQ8 3;  1EKM A;  2LQV A;  1WMO A;  3D4A A;  1VQL 3;  3FSD A;  5IG5 A;  2L1S A;  5EQL A;  3PCR A;  2F5M A;  5IG4 A;  5EEO A;  2K54 A;  1UI8 A;  6RNT A;  3FKA A;  3F14 A;  3WA2 X;  1EQK A;  1OHP A;  1W6C A;  2YFJ B;  3D9R A;  5IF6 A;  1UGI A;  3BIR A;  3MPH A;  4FMD A;  2XSO B;  3MHE A;  2L4V A;  1OGX A;  3B7C A;  1FYS A;  3B4O A;  1MNL A;  2RFR A;  1BNE A;  3BNC A;  4XBT A;  1FW7 A;  3WA3 A;  3LXU X;  3I56 3;  1BRG A;  1D6U A;  5DRE A;  3V92 A;  2CIU A;  2PNC A;  3CCQ 3;  3H51 A;  2B1X B;  3BLZ A;  4RNZ A;  1LOW A;  2E2V A;  3EF8 A;  4J5G A;  4GB5 A;  4IPB A;  4X2O A;  2CWT A;  1UW1 A;  5AEU B;  3DZL A;  3LML A;  5M18 A;  5RNT A;  4OVM A;  4MEI A;  3HIG A;  4J8T A;  4R1K A;  9RNT A;  3NUV A;  3NBJ A;  1QAL A;  2KF5 A;  3FF2 A;  5DRV A;  3STD A;  4FMB A;  2K3D A;  1WQL B;  3N8B A;  1W2B 2;  1MWT A;  1K9M 4;  2YFI B;  1Y4K A;  3AHW A;  3B4P A;  5BXQ A;  4HAA A;  1X1U A;  3DXO A;  4L8O A;  4EYC A;  2Q07 A;  5IG0 A;  2UX0 A;  5IEN A;  1YGW A;  3S27 A;  3NBR A;  1HZ1 A;  1BAN A;  1SII A;  2BNG A;  1JN5 B;  1I2G A;  2CFK A;  1SQW A;  1BSC A;  4HBR A;  4WFO A;  3DMC A;  1LRA A;  4BTW A;  2GEX A;  5STD A;  1QAK A;  2YX9 A;  3F9S A;  4R9K A;  1WNH A;  1RHL A;  1Q40 A;  3K0Z A;  5AEW B;  1TIJ A;  1Q42 A;  4XM4 A;  1CYV A;  2GU1 A;  3ZG5 A;  3CC4 3;  4EC6 A;  4HZ9 B;  5AIF A;  2BHM A;  2GSP A;  3EHC A;  1OCV A;  2SBL A;  3CCR 3;  1M90 4;  2HMM B;  1BVI A;  1M9G A;  1O7H B;  4I5Q A;  7RNT A;  3WOD G;  3MSO A;  3OWS A;  1LOY A;  1RGL A;  5M19 A;  3NBB A;  3CCE 3;  1LOV A;  2IYJ A;  1DVD A;  1JKG A;  1OPY A;  3NV0 B;  3FF0 A;  4NRE A;  1K28 A;  4HM6 B;  3M8C A;  5G2G A;  1A67 A;  1C54 A;  5AYR B;  2D42 A;  5FW5 A;  1B3S A;  1IT8 A;  2OOV C;  1A2P A;  4KVH A;  2XGL A;  1G96 A;  3JUP A;  4HYZ A;  2H0H A;  4WHA A;  1W01 A;  3T8U A;  3ZFZ A;  2XFS A;  1BRK A;  2IY2 A;  3J7Y d;  3FH1 A;  3PCS A;  3FZW A;  1W5Z A;  1FGR A;  4R80 A;  3RGR A;  5JPP A;  3DGN A;  1JBS A;  1PY3 A;  2O3O A;  2P38 A;  2ZHX B;  3SOA A;  1BSE A;  1YVS A;  3LOY A;  4HM8 B;  1UGH I;  1RCK A;  5KP4 A;  1YHQ 3;  1FUS A;  3CMA 3;  1MWR A;  3O8Y A;  1W6Y A;  1B21 A;  3SYU A;  1MGR A;  2YFL B;  1GY6 A;  1OGZ A;  4FMA A;  1FGM A;  2OOV A;  3G4S 3;  2F5W A;  3U1W A;  3HI7 A;  1ZX2 A;  1VQQ A;  1UCL A;  3OX9 A;  3DGM A;  4IT7 A;  4N6U A;  1D6Z A;  3ZG0 A;  2F86 B;  5CXO A;  3F40 A;  2KAA A;  4L8P A;  4XDW A;  1QVF 2;  2FGT A;  1TFO A;  3K63 A;  4JF8 A;  1O7M B;  3WR2 A;  3CD6 3;  2BMR B;  1K41 A;  5M1A A;  3CCV 3;  3TDG A;  1Q82 4;  3AMO A;  1STD A;  3KN4 A;  1LNI A;  1GYB A;  5CF1 A;  1RLS A;  1I3F A;  2BT3 A;  1OF5 A;  4STD A;  5ELU A;  1BNR A;  5AII A;  4CDL A;  2E2U A;  5AIH A;  5BVB A;  1VQK 3;  1V58 A;  1US1 A;  3N54 B;  2W03 A;  4FCM A;  1R4Y A;  3WMD A;  3UB1 A;  1LXE A;  3B8L A;  2ZL8 A;  4O02 B;  2JQ5 A;  5A0O B;  3BB9 A;  4U13 A;  2BIR A;  4HZB B;  1LQM B;  4HJL B;  4J5K A;  1EEJ A;  2F98 A;  4K1U A;  1GY7 A;  1Q40 B;  3X41 A;  4L7K A;  1BOX A;  3PGB A;  1IVU A;  1NWW A;  1TP6 A;  4FCZ A;  4QWT A;  3LZA A;  1DMM A;  4WYK A;  3VSY A;  4HM7 B;  3ECF A;  1E3V A;  3GAX A;  2HMK B;  2BMO B;  2IUK A;  1SIH A;  1K8A 4;  2OTL 3;  2CWV A;  2FXT A;  5KP1 A;  5D82 A;  4BIR A;  1B2U A;  3V98 A;  2IA7 A;  1Z1S A;  1YNV X;  1AY7 A;  1I2F A;  2H0G A;  5G1K A;  1ULI B;  1TRP A;  1A90 A;  4R9L A;  4MJD A;  3EBT A;  3FG1 A;  4ILF A;  3ER7 A;  3GZR A;  1JKG B;  1RGH A;  1ZO2 A;  1YVB I;  5IER A;  1BRH A;  2XGN A;  1LQG C;  3CCU 3;  3CCS 3;  1B2X A;  3K9M C;  1RGG A;  1QJG A;  1AQZ A;  1RRH A;  1BU4 A;  4FMC A;  1GS3 A;  1DYU A;  5CK6 A;  1FUT A;  3EX9 A;  1N8R 4; 
#chains in the Genus database with same CATH homology
 1GY5 A;  2D1W A;  2XR8 B;  1RJO A;  1VQ5 3;  1Q7Y 4;  2Y74 A;  3KSP A;  1IVV A;  3LTD A;  2JDI H;  1TFK A;  4MMZ B;  3NQZ A;  1OUN A;  2W56 A;  3OXA A;  3EBY A;  3MYT A;  1U5O A;  6STD A;  3CNX A;  2BO9 B;  4HKV B;  1DMQ A;  1TUH A;  3LT8 A;  2OWP A;  3ALA A;  2KXG A;  4LZI A;  1YJ9 3;  3G8Z A;  1SJW A;  1YGE A;  3N9H A;  1VQM 3;  1VQN 3;  1VQ6 3;  2W2C A;  1IVX A;  1HKX A;  1L5G B;  3PXM A;  1O7N B;  3ROB A;  1D6Y A;  3UNL A;  1KD1 4;  2W9P A;  5AYS C;  3FLJ A;  4K90 B;  4KZ1 A;  1FGQ A;  1EA2 A;  4HVN A;  5FGO A;  3AMO B;  4OUQ A;  2RSX A;  1OF5 B;  3I0Y A;  5ELJ A;  3LTC A;  3OWU A;  5HGR A;  5CLK A;  3CCJ 3;  3V99 A;  1N5P A;  1EG9 B;  2Z7A A;  3CCL 3;  1ROV A;  1QMA A;  3F7X A;  3DGO A;  1CYU A;  1W02 A;  3UL6 A;  2WOF A;  1GD3 A;  1LVN A;  2RGQ A;  4H61 A;  1JV2 B;  4J9A A;  3X3Y A;  2CG1 A;  1QVG 2;  3HX8 A;  2CFW A;  3FG3 A;  1V74 A;  3EQQ B;  5D81 A;  1IDP A;  3UL5 A;  3NM2 A;  3Q90 A;  4XBX A;  3QRD A;  3KFQ C;  4WYK B;  3RDE A;  4EV2 A;  2W6J H;  3CC2 3;  1Q81 4;  4WWU C;  2QA4 3;  3A76 A;  4X2H A;  1IV9 A;  2P05 A;  1OAC A;  3EN8 A;  4AKY A;  1YJW 3;  2GXF A;  3CC7 3;  2GBX B;  1J2B A;  1O7W B;  2W9Q A;  4HM3 B;  3CPW 2;  1VZZ A;  1DVC A;  4FCJ A;  2CFD A;  3S67 A;  1OH0 A;  2LYX A;  4K1V A;  1W7C A;  2Y73 A;  1TU5 A;  2OTJ 3;  5LC7 A;  2XFT A;  1STF I;  5IG3 A;  1Q86 4;  2CKF B;  3FCS B;  2STD A;  1N9J A;  1RRL A;  3JUN A;  2IMJ A;  1VQO 3;  4LSO A;  2WGO A;  1JRQ A;  3HZP A;  1VQ9 3;  3EB8 A;  3IMA B;  1W4N A;  2KRT A;  1DMN A;  2HMO B;  3IJE B;  2W56 B;  1JB5 A;  2I9W A;  5JBS A;  1LNH A;  2HMJ B;  3T0U A;  1IV7 A;  1R4C A;  1S5A A;  4H3U A;  4HM4 B;  1A2K A;  3KII A;  1YI2 3;  1GD4 A;  1NO3 A;  2C11 A;  3IPT A;  1O7G B;  3NXJ A;  4O8S A;  3I55 3;  4JRF A;  1PU4 A;  1IVW A;  2WO0 A;  3EE1 A;  4BTX A;  3CPO A;  1N5H A;  3GRD A;  5AIG A;  1JN5 A;  1F8N A;  4ORL A;  1FA3 A;  3KSE D;  2V1L A;  2XH9 A;  1W6G A;  3WDG B;  3PZW A;  1KSI A;  2QEX 3;  3KKG A;  1VQ4 3;  3CU3 A;  1RKY A;  1NB3 I;  1VQ7 3;  1CEW I;  3BNB A;  3GWR A;  2R4I A;  3CME 3;  4N6N B;  1OHO A;  2CG0 A;  2MC8 A;  3CXC 2;  2WOH A;  4GL6 A;  4NHF A;  5D83 A;  4EXR A;  1U8C B;  3GZY B;  4BTY A;  1M1K 4;  4RBN A;  1NDO B;  1M1X B;  3X3Z A;  3U97 A;  3MG2 A;  3S28 A;  3SVA A;  2P0X A;  3H3H A;  2A15 A;  3HII A;  3GZX B;  3S5C A;  1NJI 4;  1IT7 A;  3JUO A;  3WOE B;  3FG4 A;  2FNQ A;  3EC9 A;  2ML5 A;  3D3L A;  3X42 A;  1OHS A;  3SED A;  4EV5 A;  1IU7 A;  2CK3 H;  1JB4 A;  3MWZ A;  1JB2 A;  1S72 3;  2CFL A;  3LH4 A;  1IK3 A;  3GZB A;  1A2V A;  3X3X A;  1FGO A;  3CNM A;  4K61 A;  4HM2 B;  1E3R A;  2GEY A;  8CHO A;  2ML6 A;  4HM1 B;  1YIT 3;  1W00 A;  4IIA A;  1KC8 4;  2OQE C;  4O2H A;  4WP5 A;  3CCM 3;  4KFD A;  2MF7 A;  3JUM A;  3JVC A;  3F8X A;  3LTA A;  1JJ2 2;  2GBW B;  2OCT A;  1E97 A;  4HM5 B;  4N6T A;  2QIY A;  3LTB A;  5LC6 A;  4XDV A;  3WOF B;  1MOL A;  3K5T A;  1PFP A;  4Q53 A;  4FR9 A;  1O7P B;  4MMX B;  2PZV A;  4TX4 A;  3KZT A;  2OQE A;  2IUJ A;  1UUW B;  1KWI A;  1N9E A;  2P0M A;  3PYJ A;  3K7C A;  1BUQ A;  3MG3 A;  3T8N A;  1UUV B;  2C10 A;  2QGU A;  3DM8 A;  2CFG A;  1AVL A;  4ZM8 A;  3LT9 A;  2Z77 A;  3NM7 A;  3MG1 A;  4N6M A;  3E99 A;  3SLU A;  4PEJ A;  4XB5 A;  2K0M A;  4N3V A;  1ISK A;  3OWY A;  3VF1 A;  3EJV A;  1ROA A;  4N6L A;  3UJM A;  5KP3 A;  4KFE A;  5IEO A;  3SOY A;  4OK0 A;  2O9U X;  2WGQ A;  2CWU A;  2XRX B;  2BMQ B;  1K73 4;  2M7O A;  1YIJ 3;  3EN1 B;  3NHX A;  1ULJ B;  1T5Y A;  4I4K A;  7STD A;  2RCD A;  1JNQ A;  1LOX A;  5IW9 A;  3KE7 A;  2CHC A;  1ASK A;  3DGL A;  5I97 A;  1HU9 A;  4R4K A;  1SPU A;  3FGY A;  5JPU A;  3Q2P A;  4N6V 0;  2KCD A;  2GU3 A;  1QAF A;  4LEH A;  5CF2 A;  2XEP A;  4O3V A;  3F8H A;  5EVH A;  3SXX A;  1FUW A;  3DY5 A;  5AI1 A;  2E2T A;  1N8Q A;  1NB5 I;  3NX0 A;  2XF3 A;  3NQY A;  1W2Z A;  3OV4 A;  3G0K A;  4MMY B;  2HMN B;  3F7S A;  3G16 A;  3LYG A;  1WMP A;  3X40 A;  3VGN A;  1IQY A;  3JUQ A;  1NU3 A;  1VQP 3;  3QK9 A;  1IQX A;  3G6E 3;  5IEP A;  3SX1 A;  3G71 3;  4LGQ A;  4RZM A;  3BNE A;  1AR0 A;  1C7H A;  3Q1C A;  4EBG A;  4KFF A;  1YJN 3;  2XSH B;  2Z76 A;  1AV4 A;  4G1M B;  2CC3 A;  1UI7 A;  3PS8 A;  2CH9 A;  4AEQ A;  4AKZ A;  3BND A;  4HM0 B;  4RNY A;  3DUK A;  4LMI A;  1FGT A;  1AVK A;  3L0R A;  2INX A;  1RN7 A;  2W0Q A;  2W04 A;  5TGN A;  4XBY A;  2CW9 A;  3HK4 A;  2HML B;  3OW2 2;  2F99 A;  2P09 A;  2Z6B A;  2B24 B;  1WTH A;  1WMN A;  2ZDJ A;  3NV0 A;  3MKI A;  1IQ8 A;  3RGA A;  1KQS 2;  1CQS A;  1VQ8 3;  1VQL 3;  1EKM A;  2LQV A;  1WMO A;  1QVF 2;  3FSD A;  5IG5 A;  5EQL A;  3PCR A;  5IG4 A;  5EEO A;  2K54 A;  1UI8 A;  3FKA A;  3F14 A;  3WA2 X;  1EQK A;  1OHP A;  1W6C A;  2YFJ B;  3D9R A;  5IF6 A;  4FMD A;  3MPH A;  2XSO B;  3MHE A;  2L4V A;  1OGX A;  3B7C A;  4N6O B;  3B4O A;  1MNL A;  2RFR A;  3BNC A;  4XBT A;  3WA3 A;  3LXU X;  3I56 3;  1D6U A;  5DRE A;  3V92 A;  2CIU A;  2PNC A;  3CCQ 3;  3H51 A;  2B1X B;  3BLZ A;  4RNZ A;  2E2V A;  3EF8 A;  4GB5 A;  4IPB A;  4X2O A;  2CWT A;  1UW1 A;  5AEU B;  3DZL A;  3LML A;  4OVM A;  4MEI A;  3HIG A;  4J8T A;  4R1K A;  3NUV A;  3NBJ A;  1QAL A;  3FF2 A;  5DRV A;  3STD A;  4FMB A;  1WQL B;  3N8B A;  1W2B 2;  1K9M 4;  2YFI B;  1Y4K A;  3B4P A;  5BXQ A;  3DXO A;  4L8O A;  4EYC A;  2Q07 A;  5IG0 A;  2UX0 A;  5IEN A;  3S27 A;  3NBR A;  1SII A;  4CCV A;  2BNG A;  4HBR A;  1JN5 B;  2CFK A;  4WFO A;  1SQW A;  3DMC A;  4BTW A;  2GEX A;  5STD A;  1QAK A;  2YX9 A;  3F9S A;  4R9K A;  1WNH A;  1Q40 A;  3K0Z A;  5AEW B;  1TIJ A;  1Q42 A;  4XM4 A;  2GU1 A;  1CYV A;  3CC4 3;  4EC6 A;  4HZ9 B;  5AIF A;  2BHM A;  3EHC A;  1OCV A;  2SBL A;  3CCR 3;  1M90 4;  2HMM B;  1M9G A;  1O7H B;  3WOD G;  3MSO A;  3OWS A;  3NBB A;  3CCE 3;  1DVD A;  1JKG A;  1OPY A;  3NV0 B;  3FF0 A;  4NRE A;  1K28 A;  4HM6 B;  3M8C A;  5G2G A;  1A67 A;  5AYR B;  2D42 A;  5FW5 A;  1IT8 A;  2OOV C;  4KVH A;  2XGL A;  1G96 A;  3JUP A;  4HYZ A;  4WHA A;  3T8U A;  1W01 A;  2XFS A;  3J7Y d;  3FH1 A;  3PCS A;  3FZW A;  1W5Z A;  1FGR A;  4R80 A;  3RGR A;  5JPP A;  3DGN A;  2O3O A;  2P38 A;  3SOA A;  3LOY A;  4HM8 B;  5KP4 A;  1YHQ 3;  3CMA 3;  3O8Y A;  1W6Y A;  2YFL B;  1GY6 A;  1OGZ A;  4FMA A;  1FGM A;  2OOV A;  3G4S 3;  3U1W A;  3HI7 A;  1ZX2 A;  3OX9 A;  3DGM A;  4IT7 A;  4N6U A;  1D6Z A;  2F86 B;  5CXO A;  3F40 A;  4L8P A;  4XDW A;  2FGT A;  1TFO A;  3K63 A;  4JF8 A;  1O7M B;  3CD6 3;  2BMR B;  1K41 A;  3CCV 3;  3TDG A;  1Q82 4;  3AMO A;  1STD A;  3KN4 A;  1GYB A;  5CF1 A;  2BT3 A;  1OF5 A;  4STD A;  5ELU A;  5AII A;  4CDL A;  2E2U A;  5AIH A;  5BVB A;  1VQK 3;  1US1 A;  3N54 B;  2W03 A;  4FCM A;  3WMD A;  3UB1 A;  1LXE A;  3B8L A;  2ZL8 A;  4O02 B;  2JQ5 A;  5A0O B;  3BB9 A;  4U13 A;  4HZB B;  4HJL B;  4K1U A;  2F98 A;  1GY7 A;  1Q40 B;  3X41 A;  4L7K A;  3PGB A;  1IVU A;  1NWW A;  1TP6 A;  4FCZ A;  4QWT A;  3LZA A;  1DMM A;  4WYK A;  3VSY A;  4HM7 B;  3ECF A;  1E3V A;  3GAX A;  2HMK B;  2BMO B;  2IUK A;  1SIH A;  1K8A 4;  2OTL 3;  2CWV A;  2FXT A;  5KP1 A;  5D82 A;  3V98 A;  2IA7 A;  1Z1S A;  1ULI B;  1A90 A;  4R9L A;  4MJD A;  3EBT A;  3FG1 A;  3ER7 A;  3GZR A;  1JKG B;  1ZO2 A;  1YVB I;  5IER A;  2XGN A;  3CCU 3;  3CCS 3;  3K9M C;  1QJG A;  1RRH A;  4FMC A;  1GS3 A;  1DYU A;  5CK6 A;  3S29 A;  3EX9 A;  1N8R 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...