5JPUA

Structure of limonene epoxide hydrolase mutant - h-2-h5 complex with (s,s)-cyclohexane-1,2-diol
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
118
structure length
118
Chain Sequence
STPDEKIVLEFMDALTSNDAAKLIDYFAEDTMYQNMPLPPAYGRDAVEQTLAGFFKVFSIDAVETFHIGSTKGLVYTERVDVLRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords limonene epoxide hydrolase
publication title Multi-Parameter Optimization in Directed Evolution: Engineering Thermostability, Enantioselectivity and Activity of an Epoxide Hydrolase
rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 34
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2016-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5jpuA00
3LZAA 1GY5A 3HX8A 1GY6A 4HZBB 1UUWB 1EA2A 1ASKA 2W2CA 2HMKB 3GZYB 1OHPA 3E99A 4HM4B 1QMAA 5KP4A 4PEJA 4RZMA 3S5CA 1JB2A 2XR8B 1OCVA 2BMQB 1UUVB 1O7MB 2YFLB 2HMJB 3H3HA 1Q40B 4ORLA 4K1UA 2JQ5A 3ROBA 5STDA 2RGQA 3I0YA 1GS3A 3EN1B 3FF2A 3KKGA 3HZPA 2K54A 2R4IA 3T8NA 2HMNB 2GEYA 5AIIA 2XRXB 1Q42A 3JUNA 3B4PA 1OUNA 7STDA 1STDA 4R1KA 1S5AA 3OWSA 2I9WA 2OWPA 3UNLA 5KP3A 3MSOA 4XBTA 1ZX2A 1EG9B 1WQLB 4XBYA 3F14A 4OVMA 3M8CA 3F8XA 5AIGA 5G2GA 3FSDA 1SJWA 3F40A 3MG1A 1C7HA 3GWRA 5AEWB 3K0ZA 3CPOA 4IIAA 1JKGA 4HM2B 2GEXA 4OUQA 4HM5B 1DMNA 2PZVA 1OF5B 2YFIB 4XDWA 2A15A 6STDA 5BVBA 4J8TA 3GZXB 3LYGA 4HM3B 2HMLB 1U5OA 3NUVA 4HM8B 3G16A 2HMMB 5JPUA 3CNXA 2RFRA 3FZWA 1HKXA 5CXOA 4GB5A 2BNGA 4XBXA 2XSOB 1W6YA 4MJDA 1ULJB 5IG4A 4CDLA 3NHXA 3T8UA 4FCMA 4HVNA 2Z76A 3NV0B 3FGYA 1Q40A 1BUQA 1JN5A 1AR0A 1O7PB 5AIHA 4WWUC 2IMJA 3MYTA 5AEUB 3BB9A 3KSPA 5IG5A 3F7SA 3EHCA 2HMOB 5JPPA 4HM1B 3NXJA 3OXAA 3EN8A 5CLKA 2RCDA 4LEHA 5EVHA 5DRVA 1K41A 4HJLB 2BMRB 3GZBA 3F8HA 5IEOA 4J9AA 3EC9A 3JUOA 5IEPA 2B1XB 3RGAA 2YFJB 4WP5A 5IERA 3A76A 3Q90A 4X2OA 1ISKA 3D9RA 1JB5A 4HZ9B 8CHOA 2UX0A 3KE7A 1O7HB 3EJVA 3K7CA 3UJMA 4LGQA 5DREA 3G8ZA 2F86B 1OGZA 1IDPA 3DXOA 3EF8A 4KVHA 4X2HA 5IG3A 3WMDA 3JUQA 1W02A 3DM8A 5CK6A 5HGRA 3DMCA 5AIFA 1JKGB 1W00A 1GYBA 3SOYA 1Z1SA 2Z7AA 2STDA 4WYKA 1A2KA 5IENA 2GXFA 4FCJA 1NDOB 3B4OA 3FH1A 1TP6A 4XM4A 4L8OA 3KZTA 2B24B 3MG2A 3CU3A 3ECFA 3NM2A 4K1VA 4L8PA 4HKVB 4HM6B 1NWWA 3BLZA 3STDA 5FW5A 2BMOB 1OH0A 3NV0A 3RGRA 4HM7B 4HM0B 4N3VA 1OGXA 5AI1A 3ER7A 3OWUA 1ZO2A 3EBTA 1JB4A 5D82A 1DMMA 3SOAA 1NU3A 1VZZA 2GBWB 3EBYA 3OWYA 5IG0A 2F99A 3GRDA 3MKIA 3DZLA 1JN5B 2CKFB 1OHSA 3GZRA 1ULIB 1OPYA 3FKAA 1O7WB 4H3UA 1E97A 1TUHA 5D83A 4STDA 5CF2A 3B7CA 1W01A 5IF6A 3VSYA 4U13A 2GBXB 3OV4A 3FLJA 2CHCA 1OHOA 3CNMA 4R9LA 3B8LA 3MG3A 5TGNA 5CF1A 3F9SA 3JUPA 5BXQA 2QGUA 3NBRA 1O7GB 3OX9A 1CQSA 3IPTA 3SEDA 1GY7A 1E3VA 3FF0A 3JUMA 4LMIA 3VGNA 1OF5A 5D81A 2F98A 1O7NB 3DUKA 4XB5A 3EX9A 2INXA 3G0KA 4I4KA 4L7KA 3EQQB 2XSHB 2Z77A 5KP1A 3MHEA 3HK4A 1DMQA 4R9KA 3H51A 1QJGA 4XDVA 4WYKB 1E3RA 2QIYA 3F7XA 4Q53A
chains in the Genus database with same CATH superfamily
2D1WA 3LZAA 2JDIH 2C10A 1GY5A 3HX8A 1VQN3 2F56A 1VQK3 1GY6A 5I97A 4HZBB 1UUWB 1YVBI 3X3XA 4AKYA 1BGSA 1EA2A 1ASKA 1BRSA 1X1YA 1V57A 1WNHA 2IA7A 2P0MA 2HMKB 2W2CA 3BU4A 3LTAA 1JV2B 3UL6A 3GZYB 4FMBA 3CXC2 1VQ83 3CCM3 1W5ZA 1OHPA 4MMZB 3E99A 2Y74A 4RNTA 3UL5A 1OACA 4HM4B 1VQP3 1QMAA 4BU4A 5KP4A 1YJN3 2OTL3 4PEJA 3AMOB 3LTDA 1DE3A 3IMAB 5M18A 2OCTA 1FGQA 4RZMA 1IQ8A 2FXTA 2GU1A 3BNCA 3PS8A 3S5CA 1Q7Y4 3PYJA 4GHOA 1JZDA 1JB2A 2XF3A 4RBNA 2XR8B 1OCVA 2BMQB 2MC8A 1IVVA 4BTWA 1UUVB 2KF5A 3HOHA 1O7MB 2YFLB 2HMJB 1RMSA 3D79A 1RGAA 1VQO3 3H3HA 1Q40B 4ORLA 5EQLA 4K1UA 1BSBA 1RCLA 2JQ5A 1BRHA 3DGOA 1B20A 4KFEA 3ROBA 5STDA 1BNGA 1GMPA 1X1XA 3CCJ3 2RGQA 1I2FA 3KSED 3I0YA 1GS3A 2P38A 3EN1B 1BU4A 3FF2A 1FYSA 3KKGA 4O8SA 3HZPA 2K54A 2R4IA 2KCDA 4N6LA 1FGMA 3T8NA 1W2ZA 2HMNB 1JNQA 2M7OA 2GEYA 5AIIA 1B3SA 1W7CA 1RDSA 2XRXB 1Q42A 2ML6A 3B4PA 1OUNA 3JUNA 4QWTA 7STDA 2CFWA 2RNTA 1STDA 1SIIA 4H61A 1EQKA 1RJOA 1S5AA 4R1KA 1AY7A 1ZS7A 3OWSA 2I9WA 3BIRA 3G6E3 1W4NA 2CWUA 1GD3A 1BNFA 2ZA4A 3EB8A 1UGHI 2OWPA 5AYSC 3SVAA 2XH9A 1FA3A 3UNLA 1TTOA 2E2UA 1ROAA 5KP3A 1KD14 1BNSA 4TX4A 4BTXA 1BSDA 4FCZA 3OW22 1LQMB 3MSOA 3WOEB 4XBTA 1ZX2A 1N9JA 1EG9B 1IQYA 1MOLA 2W56A 1X1WA 1KSIA 1KC84 2W9PA 1IVXA 3DGNA 1KQS2 1LOVA 2OQEA 2KF3A 2P05A 3PCSA 1WQLB 3X41A 1BNJA 4XBYA 3F14A 1STFI 1LOWA 3D5IA 4OVMA 3HIIA 3CCS3 3M8CA 3F8XA 1BRNL 4K61A 1YVSA 5AIGA 1GOUA 5G2GA 3FSDA 1SJWA 1YHQ3 3X40A 2XGLA 3F40A 3MG1A 3ZG0A 1JZOA 3LTBA 1N9EA 1C7HA 2ZDJA 1RGEA 3GWRA 1BUJA 5AEWB 3K0ZA 1VQM3 2W9QA 3CPOA 1N5PA 3HI7A 3IJEB 4IIAA 3V99A 3J7Yd 1JBTA 5IW9A 4WHAA 1JKGA 1LNIA 2ML5A 2HOHA 4HM2B 1VQ93 3AHWA 1IT8A 1NNVA 2CX0A 1Q7HA 3LTCA 4CPKA 2R41A 2GEXA 4JF8A 3CCR3 4OUQA 2V1LA 3X3ZA 4J5GA 2BU4A 5BIRA 2OTJ3 4HM5B 3PXMA 1DMNA 2PZVA 1OF5B 2YFIB 2FNQA 4XDWA 2WGQA 2CH9A 2A15A 1B2SA 5AYRB 2PNCA 1UCKA 2XGNA 4K90B 3VF1A 1QVG2 6STDA 5BVBA 4J8TA 3GZXB 4BTYA 3LYGA 1GOYA 2YX9A 1RRHA 1I2EA 4NHFA 4HM3B 2HMLB 2XFSA 3K9MC 3S28A 5G1KA 1U5OA 4FMDA 5G1LA 4HAAA 1RNBA 3NUVA 4HM8B 3G16A 5M1AA 1BRIA 5GSPA 4N6NB 2HMMB 1QAKA 1WTHA 3CNXA 1UI8A 2RFRA 2UGIA 3K5TA 4FR9A 5JPUA 4MMYB 3ZFZA 4LZIA 3FZWA 1CH0A 1HKXA 3UB1A 5CXOA 4GB5A 3I563 1R4YA 2BNGA 1VQ53 4XBXA 1T5YA 2XSOB 4DKIA 1IVUA 2O9UX 1N8QA 1MWTA 5JBSA 4NPBA 3CCE3 1W6YA 2AAEA 4MJDA 3WHOA 1ULJB 3QRDA 1VQ43 3G713 4WFOA 1MWSA 4EW5A 1B21A 2LYXA 3WODG 5IG4A 3GAXA 1I0VA 3L0RA 4CDLA 1AQZA 3NHXA 1TU5A 2OOVA 3T8UA 2BT3A 4FCMA 4HVNA 3NQZA 2Z76A 1YGWA 3NV0B 1KWIA 3SXXA 1RHLA 1SQWA 1Q40A 1MWUA 3FGYA 4FMAA 1BUQA 1JN5A 1AR0A 1O7PB 5AIHA 3WDGB 4WWUC 2E2TA 1B2ZA 1VQ63 1UCJA 2IMJA 1GMRA 2CW9A 4RNZA 1BRKA 1SIHA 3LOYA 3MYTA 1US1A 3BNBA 3BB9A 4N6TA 3KSPA 1FGOA 3LT8A 5AEUB 3GSPA 1S723 2CX1A 2W04A 3U1WA 5IG5A 1IV9A 3F7SA 3EHCA 2HMOB 5JPPA 1DETA 1RLSA 2RBIA 4HM1B 2WO0A 3NXJA 4HYZA 7GSPA 4KT3B 1JRQA 1B2XA 1DYUA 2D42A 4HOHA 3FG3A 1TRPA 1RNTA 3OXAA 1MGWA 3EN8A 1FUSA 1V58A 1GOVA 1LXEA 2WOFA 1AV4A 3BNEA 4O3VA 1Q864 5CLKA 4IT7A 2RCDA 1AVKA 3S29A 2BO9B 4LEHA 1G96A 5EVHA 5RNTA 1RTUA 1WMPA 2O3OA 5DRVA 1K41A 3AGNA 1QVF2 4HJLB 1EUIC 2BMRB 3S27A 1VQL3 3CCV3 1A2VA 3GZBA 3F8HA 4N6OB 1I2GA 1UI7A 2Z6BA 1B2MA 3QK9A 2CFLA 1M9GA 1RGGA 4J9AA 3EC9A 5IEOA 3CPW2 3JUOA 5IEPA 1LRAA 4EYCA 1M1XB 2B1XB 3RGAA 2KF6A 2YFJB 3WOFB 4WP5A 5IERA 1Y4KA 1LNHA 3A76A 1RGHA 3Q3FA 1YIJ3 3CCL3 3Q90A 1TRQA 4CJNA 2LQVA 1Q814 4X2OA 1ISKA 3LMLA 3MPHA 1N5HA 3D9RA 3V98A 1JB5A 4HZ9B 3SX1A 1VQ73 1T2HA 8CHOA 2UX0A 2Q07A 1CEWI 1BNRA 1I3FA 3KE7A 1O7HB 3RDEA 3EJVA 4O2HA 1UCLA 3CC73 1ROVA 3K7CA 2GSPA 4CCVA 3UJMA 3BNDA 4LGQA 5DREA 2SBLA 1MWRA 3G8ZA 1UW1A 2F86B 2IY2A 3KN4A 2K0MA 4J5KA 1RRLA 3CC43 1OGZA 4KFFA 1IDPA 1RGFA 3MWZA 3KFQC 1N8R4 1BSEA 2CG0A 3DXOA 1BOXA 1BSAA 3D4AA 3EF8A 4KVHA 4X2HA 5IG3A 1IYYA 3CC23 1D6YA 3WMDA 2CK3H 2P09A 4N6UA 1MGRA 3JUQA 4IPBA 1W02A 3DGLA 1VQQA 2CIUA 3DM8A 5CK6A 3CD63 4OK0A 2ZL8A 5HGRA 3DMCA 1PY3A 3DGYA 1RGKA 1K28A 1BSCA 1LOYA 3A5EA 5AIFA 1FUTA 1DVDA 1JKGB 1PFPA 1D6UA 1W00A 4LYLB 1GYBA 3URPA 4MEIA 1Z1SA 2Z7AA 3SOYA 2STDA 1NB3I 2KRTA 1F8NA 3K63A 4WYKA 1YIT3 3HIGA 3SLUA 1YJW3 1A2KA 1FZUA 4KFDA 3FG4A 5IENA 4GL6A 1PU4A 2GXFA 2BIRA 4FCJA 3PZWA 1NDOB 3B4OA 3FG1A 2XEPA 5A0OB 1YNVX 2GU3A 3FH1A 6GSPA 1TP6A 1X1UA 4XM4A 5M19A 3CCQ3 1EEJA 3KZTA 2B24B 4L8OA 1GSPA 4KZ1A 2J8XB 3MG2A 3CU3A 3ECFA 3KCHA 3X42A 2MF7A 3NM2A 4EC6A 3CMA3 2FGTA 4K1VA 4HBRA 1HYFA 3X3YA 4O02B 4L8PA 4HKVB 1G0TA 1W2B2 4HM6B 1JJ22 1TJDA 1NWWA 1FGTA 1UGIA 2CWVA 2KXGA 3AMOA 3BLZA 1W6GA 1UCIA 5LC7A 3STDA 1WMOA 5BU4A 2C4BA 1I0XA 1AVLA 2SARA 3DGMA 5FW5A 2BMOB 2W03A 4BL2A 1OH0A 1DVCA 1WMNA 3LH4A 3NV0A 3RGRA 1J2BA 1C54A 2BHMA 4HM0B 4HM7B 4N3VA 1OGXA 5ELUA 1JBRA 3LXUX 5AI1A 2CG1A 1K9M4 3PGBA 4EXRA 3T0UA 3ER7A 3OWUA 2KF4A 4G1MB 3D3LA 1ZO2A 3EBTA 2IUJA 1SPUA 1SARA 3V92A 1JB4A 5D82A 1DMMA 3SOAA 1R4CA 3CCU3 1NU3A 1QALA 1BNIA 4AKZA 1TFKA 1VZZA 3N9HA 4EV2A 2GBWB 1M904 3EBYA 1CYUA 3OWYA 3SYUA 4BIRA 3WA3A 3O8YA 3AHSA 4GSPA 1RN4A 2F99A 5IG0A 3GRDA 3MKIA 3DZLA 4EBGA 2E2VA 1JN5B 2CKFB 2L1SA 3ZG5A 1OHSA 1UUGB 3GZRA 1YJ93 1ULIB 1L5GB 1OPYA 2CFGA 3EE1A 2CFKA 1CYVA 3Q2PA 3Q1CA 2OQEC 1FGRA 1TIJA 1YGEA 3DY5A 3FKAA 3PCRA 4LSOA 1QAFA 1RGCA 1BAOA 1O7WB 3NX0A 4H3UA 1E97A 1IT7A 1LOXA 2H0IA 3DH2A 4NREA 1TUHA 1BANA 5D83A 4STDA 5FGOA 5CF2A 1NO3A 5EEOA 3NBBA 3B7CA 1I3IA 2AADA 1A90A 3AGOA 1JBSA 1W01A 1A2PA 4EV5A 5IF6A 2W0QA 2L4VA 3VSYA 4U13A 2GBXB 3JVCA 4RNYA 1B2UA 1UDII 1M1K4 1G02A 3OV4A 1V74A 3FLJA 3NQYA 3RNTA 3I553 4FMCA 1Q824 1GD4A 1OHOA 2CHCA 2W56B 2Y73A 3CNMA 4R9LA 3WR2A 1RN1A 3B8LA 8RNTA 3MG3A 5TGNA 1MNLA 4AEQA 1K8A4 3CME3 5CF1A 3F9SA 2WOHA 3JUPA 4ZM8A 1RSNA 2QGUA 3D5GA 3NBRA 5LC6A 1O7GB 5BXQA 1W6CA 1IQXA 3OX9A 4I5QA 1A67A 1CQSA 1T2IA 3IPTA 3KIIA 3SEDA 1GY7A 2QA43 2CFDA 1RGLA 1E3VA 3FF0A 3JUMA 4LMIA 2CC3A 2RSXA 3VGNA 4BL3A 4JRFA 1LVNA 1OF5A 2IYJA 7RNTA 2F5WA 4R4KA 6RNTA 1BRGA 1B27A 3N8BA 5D81A 1HU9A 1IVWA 4ILFA 1Q9EA 1FUWA 2XFTA 2F98A 1RCKA 1IV7A 3NM7A 5ELJA 1O7NB 3DUKA 1NB5I 4XB5A 2KAAA 3EX9A 3FCSB 1PYLA 1TFOA 1YI23 2INXA 3N54B 3G0KA 1K734 1BVIA 1BNEA 4I4KA 4L7KA 4MMXB 1ZGXA 3EQQB 2XSHB 5HOHA 4R80A 4N6MA 2CWTA 2Z77A 5KP1A 1I8VA 2H0GA 2F5MA 1I70A 1GMQA 1D6ZA 3LT9A 3MHEA 2IUKA 1HZ1A 3WA2X 9RNTA 2P0XA 1U8CB 3HK4A 3G4S3 1DMQA 3NBJA 1T3BA 2K3DA 4R9KA 3U97A 2W6JH 2H0HA 4N6V0 3S67A 3H51A 1BIRA 2C11A 2OOVC 1IU7A 1LQGC 1QJGA 1RN7A 2WGOA 1EKMA 3ALAA 4XDVA 1RKYA 2ZHXB 4WYKB 1E3RA 3TDGA 1IK3A 2QIYA 2F4YA 2UUGC 2QEX3 3F7XA 1FW7A 1NJI4 4Q53A 1BRJA
chains in the Genus database with same CATH topology
2D1WA 3LZAA 2JDIH 2C10A 1GY5A 3HX8A 1VQN3 1VQK3 1GY6A 5I97A 4HZBB 1UUWB 1YVBI 3X3XA 4AKYA 1EA2A 1WNHA 1ASKA 2IA7A 2P0MA 2W2CA 4OK0A 2QEX3 2HMKB 3UL6A 3LTAA 1JV2B 3GZYB 4FMBA 3CXC2 1VQ83 3CCM3 1W5ZA 1OHPA 4MMZB 3E99A 2Y74A 3UL5A 1OACA 4HM4B 1VQP3 1QMAA 1YJN3 5KP4A 2OTL3 4PEJA 3AMOB 3LTDA 3IMAB 2OCTA 1FGQA 4RZMA 1IQ8A 2FXTA 2GU1A 3BNCA 3PS8A 3S5CA 1Q7Y4 3PYJA 1JB2A 2XF3A 4RBNA 2XR8B 1OCVA 2BMQB 2MC8A 1IVVA 4BTWA 1UUVB 1O7MB 2YFLB 2HMJB 1VQO3 3H3HA 1Q40B 4ORLA 5EQLA 4K1UA 2JQ5A 3ROBA 3DGOA 4KFEA 5STDA 3CCJ3 2RGQA 3KSED 3I0YA 1GS3A 2P38A 3EN1B 3FF2A 4O8SA 3KKGA 3HZPA 2K54A 2R4IA 2KCDA 4N6LA 1FGMA 3T8NA 1W2ZA 2HMNB 1JNQA 2M7OA 2GEYA 5AIIA 1W7CA 2XRXB 1Q42A 2ML6A 3B4PA 1OUNA 3JUNA 4QWTA 7STDA 2CFWA 1STDA 1SIIA 4H61A 1EQKA 1RJOA 1S5AA 4R1KA 3OWSA 2I9WA 3G6E3 1W4NA 2CWUA 1GD3A 3EB8A 5AYSC 3SVAA 2OWPA 1FA3A 2XH9A 3UNLA 2E2UA 1ROAA 5KP3A 1KD14 4TX4A 4BTXA 4FCZA 3OW22 3MSOA 3WOEB 4XBTA 1ZX2A 1N9JA 1EG9B 1IQYA 1MOLA 2W56A 1KSIA 1KC84 2W9PA 1IVXA 3DGNA 1KQS2 2OQEA 2P05A 3PCSA 1WQLB 3X41A 4XBYA 3F14A 1STFI 4OVMA 3HIIA 3CCS3 3M8CA 3F8XA 4K61A 5AIGA 5G2GA 3FSDA 1SJWA 1YHQ3 3X40A 2XGLA 3F40A 3MG1A 3LTBA 1N9EA 1C7HA 2ZDJA 3GWRA 5AEWB 3K0ZA 2W9QA 3CPOA 1N5PA 3HI7A 3IJEB 4IIAA 3V99A 3J7Yd 5IW9A 4WHAA 1JKGA 2ML5A 4HM2B 1VQ93 1IT8A 3LTCA 3CCR3 4JF8A 2GEXA 4OUQA 2V1LA 3X3ZA 2OTJ3 4HM5B 3PXMA 1DMNA 2PZVA 1OF5B 2YFIB 2FNQA 4XDWA 2WGQA 2CH9A 2A15A 5AYRB 2PNCA 2XGNA 4K90B 3VF1A 1QVG2 6STDA 5BVBA 4J8TA 3GZXB 4BTYA 3LYGA 2YX9A 1RRHA 4NHFA 4HM3B 2HMLB 2XFSA 3K9MC 3S28A 1U5OA 4FMDA 3NUVA 4HM8B 3G16A 4N6NB 2HMMB 1QAKA 1WTHA 3CNXA 1UI8A 2RFRA 4FR9A 3K5TA 5JPUA 4MMYB 4LZIA 3FZWA 1HKXA 3UB1A 5CXOA 4GB5A 3I563 2BNGA 1VQ53 4XBXA 1T5YA 2XSOB 1IVUA 2O9UX 1N8QA 5JBSA 3CCE3 1W6YA 4MJDA 1ULJB 3QRDA 1VQ43 3G713 4WFOA 5IG4A 2LYXA 3WODG 3GAXA 4CDLA 3L0RA 3NHXA 1TU5A 2OOVA 3T8UA 2BT3A 4FCMA 4HVNA 3NQZA 2Z76A 3NV0B 3SXXA 1KWIA 1SQWA 1Q40A 3FGYA 4FMAA 1BUQA 1JN5A 1AR0A 1O7PB 5AIHA 3WDGB 4WWUC 2E2TA 1VQ63 2IMJA 2CW9A 4RNZA 3LOYA 1SIHA 4N6TA 3MYTA 1US1A 3BNBA 3BB9A 5AEUB 3KSPA 1FGOA 3LT8A 1S723 2W04A 3U1WA 5IG5A 1IV9A 3F7SA 3EHCA 2HMOB 5JPPA 4HM1B 2WO0A 3NXJA 4HYZA 1JRQA 1DYUA 2D42A 3FG3A 3OXAA 3EN8A 2WOFA 1LXEA 1Q864 1AV4A 3BNEA 4O3VA 5CLKA 4IT7A 2RCDA 1AVKA 3S29A 2BO9B 4LEHA 1G96A 5EVHA 1WMPA 2O3OA 5DRVA 1K41A 1QVF2 4HJLB 2BMRB 1VQL3 3S27A 3CCV3 1A2VA 3GZBA 3F8HA 4N6OB 1UI7A 2Z6BA 3QK9A 2CFLA 1M9GA 4J9AA 5IEOA 3EC9A 3CPW2 3JUOA 5IEPA 4EYCA 1M1XB 2B1XB 3RGAA 2YFJB 3WOFB 4WP5A 5IERA 1Y4KA 1LNHA 3A76A 1YIJ3 3CCL3 3Q90A 2LQVA 1Q814 4X2OA 1ISKA 3LMLA 3MPHA 1N5HA 3D9RA 3V98A 1JB5A 4HZ9B 3SX1A 1VQ73 8CHOA 2UX0A 2Q07A 1CEWI 3KE7A 1O7HB 3RDEA 3EJVA 4O2HA 3CC73 1ROVA 3K7CA 4CCVA 3UJMA 3BNDA 4LGQA 5DREA 2SBLA 3G8ZA 1UW1A 2F86B 3KN4A 2K0MA 1RRLA 3CC43 1OGZA 4KFFA 1IDPA 1N8R4 3MWZA 3KFQC 2CG0A 3DXOA 3EF8A 4KVHA 4X2HA 5IG3A 3CC23 1D6YA 3WMDA 2CK3H 2P09A 4N6UA 3JUQA 4IPBA 1W02A 3DGLA 2CIUA 3DM8A 5CK6A 3CD63 2ZL8A 5HGRA 3DMCA 1K28A 5AIFA 1DVDA 1JKGB 1PFPA 1D6UA 1W00A 1GYBA 4MEIA 1Z1SA 2Z7AA 3SOYA 2STDA 1NB3I 2KRTA 1F8NA 3K63A 4WYKA 1YIT3 3HIGA 3SLUA 1YJW3 1A2KA 4KFDA 3FG4A 5IENA 4GL6A 1PU4A 2GXFA 4FCJA 3PZWA 1NDOB 3B4OA 3FG1A 2XEPA 5A0OB 2GU3A 3FH1A 1TP6A 4XM4A 3CCQ3 4L8OA 3KZTA 2B24B 4KZ1A 3MG2A 3CU3A 3ECFA 3X42A 2MF7A 3NM2A 4EC6A 3CMA3 2FGTA 4K1VA 4HBRA 3X3YA 4O02B 4L8PA 4HKVB 1W2B2 4HM6B 1JJ22 2CWVA 1NWWA 1FGTA 2KXGA 3AMOA 3BLZA 5LC7A 3STDA 1W6GA 1VQM3 1A90A 1WMOA 1AVLA 3DGMA 5FW5A 2BMOB 2W03A 1OH0A 1DVCA 1WMNA 3LH4A 3NV0A 3RGRA 1J2BA 2BHMA 4HM0B 4HM7B 4N3VA 1OGXA 5ELUA 3LXUX 5AI1A 2CG1A 1K9M4 3PGBA 4EXRA 3T0UA 3ER7A 3OWUA 4G1MB 3D3LA 1ZO2A 3EBTA 2IUJA 1SPUA 3V92A 1JB4A 5D82A 1DMMA 3SOAA 1R4CA 3CCU3 1NU3A 1QALA 4AKZA 1TFKA 1VZZA 3N9HA 4EV2A 2GBWB 1M904 3EBYA 1CYUA 3OWYA 3WA3A 3O8YA 5IG0A 2F99A 3GRDA 3MKIA 3DZLA 4EBGA 2E2VA 1JN5B 2CKFB 1OHSA 3GZRA 1YJ93 1ULIB 1L5GB 1OPYA 2CFGA 3EE1A 2CFKA 1CYVA 3Q2PA 3Q1CA 2OQEC 1FGRA 1TIJA 1YGEA 3DY5A 3FKAA 3PCRA 4LSOA 1QAFA 1O7WB 3NX0A 4H3UA 1E97A 1IT7A 1LOXA 4NREA 1TUHA 5D83A 4STDA 5FGOA 5CF2A 1NO3A 5EEOA 3NBBA 3B7CA 1W01A 4EV5A 5IF6A 2W0QA 2L4VA 3VSYA 4U13A 2GBXB 3JVCA 4RNYA 1M1K4 3OV4A 1V74A 3FLJA 3NQYA 3I553 4FMCA 1Q824 1GD4A 1OHOA 2CHCA 2W56B 2Y73A 3CNMA 4R9LA 3B8LA 3MG3A 5TGNA 1MNLA 4AEQA 1K8A4 3CME3 5CF1A 3F9SA 2WOHA 3JUPA 4ZM8A 2QGUA 5LC6A 3NBRA 5BXQA 1A67A 1O7GB 1W6CA 1IQXA 3OX9A 1CQSA 3KIIA 3IPTA 3SEDA 1GY7A 2QA43 2CFDA 1E3VA 3FF0A 3JUMA 4LMIA 2CC3A 2RSXA 3VGNA 4JRFA 1LVNA 1OF5A 4R4KA 3N8BA 5D81A 1HU9A 1IVWA 1FUWA 2XFTA 2F98A 1IV7A 3NM7A 5ELJA 1O7NB 3DUKA 1NB5I 4XB5A 3EX9A 3FCSB 1TFOA 1YI23 2INXA 3N54B 3G0KA 1K734 4I4KA 4L7KA 4MMXB 3EQQB 2XSHB 4R80A 4N6MA 2CWTA 2Z77A 5KP1A 1D6ZA 3LT9A 3MHEA 2IUKA 3WA2X 2P0XA 1U8CB 3HK4A 3G4S3 1DMQA 3NBJA 3U97A 4R9KA 2W6JH 4N6V0 3S67A 3H51A 2C11A 2OOVC 1IU7A 1QJGA 1RN7A 2WGOA 3ALAA 1EKMA 4XDVA 1RKYA 4WYKB 1E3RA 3TDGA 1IK3A 2QIYA 3F7XA 1NJI4 4Q53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZA A;  1GY5 A;  3HX8 A;  1GY6 A;  4HZB B;  1UUW B;  1EA2 A;  1ASK A;  2W2C A;  2HMK B;  3GZY B;  1OHP A;  3E99 A;  4HM4 B;  1QMA A;  5KP4 A;  4PEJ A;  4RZM A;  3S5C A;  1JB2 A;  2XR8 B;  1OCV A;  2BMQ B;  1UUV B;  1O7M B;  2YFL B;  2HMJ B;  3H3H A;  1Q40 B;  4ORL A;  4K1U A;  2JQ5 A;  3ROB A;  5STD A;  2RGQ A;  3I0Y A;  1GS3 A;  3EN1 B;  3FF2 A;  3KKG A;  3HZP A;  2K54 A;  2R4I A;  3T8N A;  2HMN B;  2GEY A;  5AII A;  2XRX B;  1Q42 A;  3JUN A;  3B4P A;  1OUN A;  7STD A;  1STD A;  4R1K A;  1S5A A;  3OWS A;  2I9W A;  2OWP A;  3UNL A;  5KP3 A;  3MSO A;  4XBT A;  1ZX2 A;  1EG9 B;  1WQL B;  4XBY A;  3F14 A;  4OVM A;  3M8C A;  3F8X A;  5AIG A;  5G2G A;  3FSD A;  1SJW A;  3F40 A;  3MG1 A;  1C7H A;  3GWR A;  5AEW B;  3K0Z A;  3CPO A;  4IIA A;  1JKG A;  4HM2 B;  2GEX A;  4OUQ A;  4HM5 B;  1DMN A;  2PZV A;  1OF5 B;  2YFI B;  4XDW A;  2A15 A;  6STD A;  5BVB A;  4J8T A;  3GZX B;  3LYG A;  4HM3 B;  2HML B;  1U5O A;  3NUV A;  4HM8 B;  3G16 A;  2HMM B;  5JPU A;  3CNX A;  2RFR A;  3FZW A;  1HKX A;  5CXO A;  4GB5 A;  2BNG A;  4XBX A;  2XSO B;  1W6Y A;  4MJD A;  1ULJ B;  5IG4 A;  4CDL A;  3NHX A;  3T8U A;  4FCM A;  4HVN A;  2Z76 A;  3NV0 B;  3FGY A;  1Q40 A;  1BUQ A;  1JN5 A;  1AR0 A;  1O7P B;  5AIH A;  4WWU C;  2IMJ A;  3MYT A;  5AEU B;  3BB9 A;  3KSP A;  5IG5 A;  3F7S A;  3EHC A;  2HMO B;  5JPP A;  4HM1 B;  3NXJ A;  3OXA A;  3EN8 A;  5CLK A;  2RCD A;  4LEH A;  5EVH A;  5DRV A;  1K41 A;  4HJL B;  2BMR B;  3GZB A;  3F8H A;  5IEO A;  4J9A A;  3EC9 A;  3JUO A;  5IEP A;  2B1X B;  3RGA A;  2YFJ B;  4WP5 A;  5IER A;  3A76 A;  3Q90 A;  4X2O A;  1ISK A;  3D9R A;  1JB5 A;  4HZ9 B;  8CHO A;  2UX0 A;  3KE7 A;  1O7H B;  3EJV A;  3K7C A;  3UJM A;  4LGQ A;  5DRE A;  3G8Z A;  2F86 B;  1OGZ A;  1IDP A;  3DXO A;  3EF8 A;  4KVH A;  4X2H A;  5IG3 A;  3WMD A;  3JUQ A;  1W02 A;  3DM8 A;  5CK6 A;  5HGR A;  3DMC A;  5AIF A;  1JKG B;  1W00 A;  1GYB A;  3SOY A;  1Z1S A;  2Z7A A;  2STD A;  4WYK A;  1A2K A;  5IEN A;  2GXF A;  4FCJ A;  1NDO B;  3B4O A;  3FH1 A;  1TP6 A;  4XM4 A;  4L8O A;  3KZT A;  2B24 B;  3MG2 A;  3CU3 A;  3ECF A;  3NM2 A;  4K1V A;  4L8P A;  4HKV B;  4HM6 B;  1NWW A;  3BLZ A;  3STD A;  5FW5 A;  2BMO B;  1OH0 A;  3NV0 A;  3RGR A;  4HM7 B;  4HM0 B;  4N3V A;  1OGX A;  5AI1 A;  3ER7 A;  3OWU A;  1ZO2 A;  3EBT A;  1JB4 A;  5D82 A;  1DMM A;  3SOA A;  1NU3 A;  1VZZ A;  2GBW B;  3EBY A;  3OWY A;  5IG0 A;  2F99 A;  3GRD A;  3MKI A;  3DZL A;  1JN5 B;  2CKF B;  1OHS A;  3GZR A;  1ULI B;  1OPY A;  3FKA A;  1O7W B;  4H3U A;  1E97 A;  1TUH A;  5D83 A;  4STD A;  5CF2 A;  3B7C A;  1W01 A;  5IF6 A;  3VSY A;  4U13 A;  2GBX B;  3OV4 A;  3FLJ A;  2CHC A;  1OHO A;  3CNM A;  4R9L A;  3B8L A;  3MG3 A;  5TGN A;  5CF1 A;  3F9S A;  3JUP A;  5BXQ A;  2QGU A;  3NBR A;  1O7G B;  3OX9 A;  1CQS A;  3IPT A;  3SED A;  1GY7 A;  1E3V A;  3FF0 A;  3JUM A;  4LMI A;  3VGN A;  1OF5 A;  5D81 A;  2F98 A;  1O7N B;  3DUK A;  4XB5 A;  3EX9 A;  2INX A;  3G0K A;  4I4K A;  4L7K A;  3EQQ B;  2XSH B;  2Z77 A;  5KP1 A;  3MHE A;  3HK4 A;  1DMQ A;  4R9K A;  3H51 A;  1QJG A;  4XDV A;  4WYK B;  1E3R A;  2QIY A;  3F7X A;  4Q53 A; 
#chains in the Genus database with same CATH topology
 2D1W A;  3LZA A;  2JDI H;  2C10 A;  1GY5 A;  3HX8 A;  1VQN 3;  2F56 A;  1VQK 3;  1GY6 A;  5I97 A;  4HZB B;  1UUW B;  1YVB I;  3X3X A;  4AKY A;  1BGS A;  1EA2 A;  1ASK A;  1BRS A;  1X1Y A;  1V57 A;  1WNH A;  2IA7 A;  2P0M A;  2HMK B;  2W2C A;  3BU4 A;  3LTA A;  1JV2 B;  3UL6 A;  3GZY B;  4FMB A;  3CXC 2;  1VQ8 3;  3CCM 3;  1W5Z A;  1OHP A;  4MMZ B;  3E99 A;  2Y74 A;  4RNT A;  3UL5 A;  1OAC A;  4HM4 B;  1VQP 3;  1QMA A;  4BU4 A;  5KP4 A;  1YJN 3;  2OTL 3;  4PEJ A;  3AMO B;  3LTD A;  1DE3 A;  3IMA B;  5M18 A;  2OCT A;  1FGQ A;  4RZM A;  1IQ8 A;  2FXT A;  2GU1 A;  3BNC A;  3PS8 A;  3S5C A;  1Q7Y 4;  3PYJ A;  4GHO A;  1JZD A;  1JB2 A;  2XF3 A;  4RBN A;  2XR8 B;  1OCV A;  2BMQ B;  2MC8 A;  1IVV A;  4BTW A;  1UUV B;  2KF5 A;  3HOH A;  1O7M B;  2YFL B;  2HMJ B;  1RMS A;  3D79 A;  1RGA A;  1VQO 3;  3H3H A;  1Q40 B;  4ORL A;  5EQL A;  4K1U A;  1BSB A;  1RCL A;  2JQ5 A;  1BRH A;  3DGO A;  1B20 A;  4KFE A;  3ROB A;  5STD A;  1BNG A;  1GMP A;  1X1X A;  3CCJ 3;  2RGQ A;  1I2F A;  3KSE D;  3I0Y A;  1GS3 A;  2P38 A;  3EN1 B;  1BU4 A;  3FF2 A;  1FYS A;  3KKG A;  4O8S A;  3HZP A;  2K54 A;  2R4I A;  2KCD A;  4N6L A;  1FGM A;  3T8N A;  1W2Z A;  2HMN B;  1JNQ A;  2M7O A;  2GEY A;  5AII A;  1B3S A;  1W7C A;  1RDS A;  2XRX B;  1Q42 A;  2ML6 A;  3B4P A;  1OUN A;  3JUN A;  4QWT A;  7STD A;  2CFW A;  2RNT A;  1STD A;  1SII A;  4H61 A;  1EQK A;  1RJO A;  1S5A A;  4R1K A;  1AY7 A;  1ZS7 A;  3OWS A;  2I9W A;  3BIR A;  3G6E 3;  1W4N A;  2CWU A;  1GD3 A;  1BNF A;  2ZA4 A;  3EB8 A;  1UGH I;  2OWP A;  5AYS C;  3SVA A;  2XH9 A;  1FA3 A;  3UNL A;  1TTO A;  2E2U A;  1ROA A;  5KP3 A;  1KD1 4;  1BNS A;  4TX4 A;  4BTX A;  1BSD A;  4FCZ A;  3OW2 2;  1LQM B;  3MSO A;  3WOE B;  4XBT A;  1ZX2 A;  1N9J A;  1EG9 B;  1IQY A;  1MOL A;  2W56 A;  1X1W A;  1KSI A;  1KC8 4;  2W9P A;  1IVX A;  3DGN A;  1KQS 2;  1LOV A;  2OQE A;  2KF3 A;  2P05 A;  3PCS A;  1WQL B;  3X41 A;  1BNJ A;  4XBY A;  3F14 A;  1STF I;  1LOW A;  3D5I A;  4OVM A;  3HII A;  3CCS 3;  3M8C A;  3F8X A;  1BRN L;  4K61 A;  1YVS A;  5AIG A;  1GOU A;  5G2G A;  3FSD A;  1SJW A;  1YHQ 3;  3X40 A;  2XGL A;  3F40 A;  3MG1 A;  3ZG0 A;  1JZO A;  3LTB A;  1N9E A;  1C7H A;  2ZDJ A;  1RGE A;  3GWR A;  1BUJ A;  5AEW B;  3K0Z A;  1VQM 3;  2W9Q A;  3CPO A;  1N5P A;  3HI7 A;  3IJE B;  4IIA A;  3V99 A;  3J7Y d;  1JBT A;  5IW9 A;  4WHA A;  1JKG A;  1LNI A;  2ML5 A;  2HOH A;  4HM2 B;  1VQ9 3;  3AHW A;  1IT8 A;  1NNV A;  2CX0 A;  1Q7H A;  3LTC A;  4CPK A;  2R41 A;  2GEX A;  4JF8 A;  3CCR 3;  4OUQ A;  2V1L A;  3X3Z A;  4J5G A;  2BU4 A;  5BIR A;  2OTJ 3;  4HM5 B;  3PXM A;  1DMN A;  2PZV A;  1OF5 B;  2YFI B;  2FNQ A;  4XDW A;  2WGQ A;  2CH9 A;  2A15 A;  1B2S A;  5AYR B;  2PNC A;  1UCK A;  2XGN A;  4K90 B;  3VF1 A;  1QVG 2;  6STD A;  5BVB A;  4J8T A;  3GZX B;  4BTY A;  3LYG A;  1GOY A;  2YX9 A;  1RRH A;  1I2E A;  4NHF A;  4HM3 B;  2HML B;  2XFS A;  3K9M C;  3S28 A;  5G1K A;  1U5O A;  4FMD A;  5G1L A;  4HAA A;  1RNB A;  3NUV A;  4HM8 B;  3G16 A;  5M1A A;  1BRI A;  5GSP A;  4N6N B;  2HMM B;  1QAK A;  1WTH A;  3CNX A;  1UI8 A;  2RFR A;  2UGI A;  3K5T A;  4FR9 A;  5JPU A;  4MMY B;  3ZFZ A;  4LZI A;  3FZW A;  1CH0 A;  1HKX A;  3UB1 A;  5CXO A;  4GB5 A;  3I56 3;  1R4Y A;  2BNG A;  1VQ5 3;  4XBX A;  1T5Y A;  2XSO B;  4DKI A;  1IVU A;  2O9U X;  1N8Q A;  1MWT A;  5JBS A;  4NPB A;  3CCE 3;  1W6Y A;  2AAE A;  4MJD A;  3WHO A;  1ULJ B;  3QRD A;  1VQ4 3;  3G71 3;  4WFO A;  1MWS A;  4EW5 A;  1B21 A;  2LYX A;  3WOD G;  5IG4 A;  3GAX A;  1I0V A;  3L0R A;  4CDL A;  1AQZ A;  3NHX A;  1TU5 A;  2OOV A;  3T8U A;  2BT3 A;  4FCM A;  4HVN A;  3NQZ A;  2Z76 A;  1YGW A;  3NV0 B;  1KWI A;  3SXX A;  1RHL A;  1SQW A;  1Q40 A;  1MWU A;  3FGY A;  4FMA A;  1BUQ A;  1JN5 A;  1AR0 A;  1O7P B;  5AIH A;  3WDG B;  4WWU C;  2E2T A;  1B2Z A;  1VQ6 3;  1UCJ A;  2IMJ A;  1GMR A;  2CW9 A;  4RNZ A;  1BRK A;  1SIH A;  3LOY A;  3MYT A;  1US1 A;  3BNB A;  3BB9 A;  4N6T A;  3KSP A;  1FGO A;  3LT8 A;  5AEU B;  3GSP A;  1S72 3;  2CX1 A;  2W04 A;  3U1W A;  5IG5 A;  1IV9 A;  3F7S A;  3EHC A;  2HMO B;  5JPP A;  1DET A;  1RLS A;  2RBI A;  4HM1 B;  2WO0 A;  3NXJ A;  4HYZ A;  7GSP A;  4KT3 B;  1JRQ A;  1B2X A;  1DYU A;  2D42 A;  4HOH A;  3FG3 A;  1TRP A;  1RNT A;  3OXA A;  1MGW A;  3EN8 A;  1FUS A;  1V58 A;  1GOV A;  1LXE A;  2WOF A;  1AV4 A;  3BNE A;  4O3V A;  1Q86 4;  5CLK A;  4IT7 A;  2RCD A;  1AVK A;  3S29 A;  2BO9 B;  4LEH A;  1G96 A;  5EVH A;  5RNT A;  1RTU A;  1WMP A;  2O3O A;  5DRV A;  1K41 A;  3AGN A;  1QVF 2;  4HJL B;  1EUI C;  2BMR B;  3S27 A;  1VQL 3;  3CCV 3;  1A2V A;  3GZB A;  3F8H A;  4N6O B;  1I2G A;  1UI7 A;  2Z6B A;  1B2M A;  3QK9 A;  2CFL A;  1M9G A;  1RGG A;  4J9A A;  3EC9 A;  5IEO A;  3CPW 2;  3JUO A;  5IEP A;  1LRA A;  4EYC A;  1M1X B;  2B1X B;  3RGA A;  2KF6 A;  2YFJ B;  3WOF B;  4WP5 A;  5IER A;  1Y4K A;  1LNH A;  3A76 A;  1RGH A;  3Q3F A;  1YIJ 3;  3CCL 3;  3Q90 A;  1TRQ A;  4CJN A;  2LQV A;  1Q81 4;  4X2O A;  1ISK A;  3LML A;  3MPH A;  1N5H A;  3D9R A;  3V98 A;  1JB5 A;  4HZ9 B;  3SX1 A;  1VQ7 3;  1T2H A;  8CHO A;  2UX0 A;  2Q07 A;  1CEW I;  1BNR A;  1I3F A;  3KE7 A;  1O7H B;  3RDE A;  3EJV A;  4O2H A;  1UCL A;  3CC7 3;  1ROV A;  3K7C A;  2GSP A;  4CCV A;  3UJM A;  3BND A;  4LGQ A;  5DRE A;  2SBL A;  1MWR A;  3G8Z A;  1UW1 A;  2F86 B;  2IY2 A;  3KN4 A;  2K0M A;  4J5K A;  1RRL A;  3CC4 3;  1OGZ A;  4KFF A;  1IDP A;  1RGF A;  3MWZ A;  3KFQ C;  1N8R 4;  1BSE A;  2CG0 A;  3DXO A;  1BOX A;  1BSA A;  3D4A A;  3EF8 A;  4KVH A;  4X2H A;  5IG3 A;  1IYY A;  3CC2 3;  1D6Y A;  3WMD A;  2CK3 H;  2P09 A;  4N6U A;  1MGR A;  3JUQ A;  4IPB A;  1W02 A;  3DGL A;  1VQQ A;  2CIU A;  3DM8 A;  5CK6 A;  3CD6 3;  4OK0 A;  2ZL8 A;  5HGR A;  3DMC A;  1PY3 A;  3DGY A;  1RGK A;  1K28 A;  1BSC A;  1LOY A;  3A5E A;  5AIF A;  1FUT A;  1DVD A;  1JKG B;  1PFP A;  1D6U A;  1W00 A;  4LYL B;  1GYB A;  3URP A;  4MEI A;  1Z1S A;  2Z7A A;  3SOY A;  2STD A;  1NB3 I;  2KRT A;  1F8N A;  3K63 A;  4WYK A;  1YIT 3;  3HIG A;  3SLU A;  1YJW 3;  1A2K A;  1FZU A;  4KFD A;  3FG4 A;  5IEN A;  4GL6 A;  1PU4 A;  2GXF A;  2BIR A;  4FCJ A;  3PZW A;  1NDO B;  3B4O A;  3FG1 A;  2XEP A;  5A0O B;  1YNV X;  2GU3 A;  3FH1 A;  6GSP A;  1TP6 A;  1X1U A;  4XM4 A;  5M19 A;  3CCQ 3;  1EEJ A;  3KZT A;  2B24 B;  4L8O A;  1GSP A;  4KZ1 A;  2J8X B;  3MG2 A;  3CU3 A;  3ECF A;  3KCH A;  3X42 A;  2MF7 A;  3NM2 A;  4EC6 A;  3CMA 3;  2FGT A;  4K1V A;  4HBR A;  1HYF A;  3X3Y A;  4O02 B;  4L8P A;  4HKV B;  1G0T A;  1W2B 2;  4HM6 B;  1JJ2 2;  1TJD A;  1NWW A;  1FGT A;  1UGI A;  2CWV A;  2KXG A;  3AMO A;  3BLZ A;  1W6G A;  1UCI A;  5LC7 A;  3STD A;  1WMO A;  5BU4 A;  2C4B A;  1I0X A;  1AVL A;  2SAR A;  3DGM A;  5FW5 A;  2BMO B;  2W03 A;  4BL2 A;  1OH0 A;  1DVC A;  1WMN A;  3LH4 A;  3NV0 A;  3RGR A;  1J2B A;  1C54 A;  2BHM A;  4HM0 B;  4HM7 B;  4N3V A;  1OGX A;  5ELU A;  1JBR A;  3LXU X;  5AI1 A;  2CG1 A;  1K9M 4;  3PGB A;  4EXR A;  3T0U A;  3ER7 A;  3OWU A;  2KF4 A;  4G1M B;  3D3L A;  1ZO2 A;  3EBT A;  2IUJ A;  1SPU A;  1SAR A;  3V92 A;  1JB4 A;  5D82 A;  1DMM A;  3SOA A;  1R4C A;  3CCU 3;  1NU3 A;  1QAL A;  1BNI A;  4AKZ A;  1TFK A;  1VZZ A;  3N9H A;  4EV2 A;  2GBW B;  1M90 4;  3EBY A;  1CYU A;  3OWY A;  3SYU A;  4BIR A;  3WA3 A;  3O8Y A;  3AHS A;  4GSP A;  1RN4 A;  2F99 A;  5IG0 A;  3GRD A;  3MKI A;  3DZL A;  4EBG A;  2E2V A;  1JN5 B;  2CKF B;  2L1S A;  3ZG5 A;  1OHS A;  1UUG B;  3GZR A;  1YJ9 3;  1ULI B;  1L5G B;  1OPY A;  2CFG A;  3EE1 A;  2CFK A;  1CYV A;  3Q2P A;  3Q1C A;  2OQE C;  1FGR A;  1TIJ A;  1YGE A;  3DY5 A;  3FKA A;  3PCR A;  4LSO A;  1QAF A;  1RGC A;  1BAO A;  1O7W B;  3NX0 A;  4H3U A;  1E97 A;  1IT7 A;  1LOX A;  2H0I A;  3DH2 A;  4NRE A;  1TUH A;  1BAN A;  5D83 A;  4STD A;  5FGO A;  5CF2 A;  1NO3 A;  5EEO A;  3NBB A;  3B7C A;  1I3I A;  2AAD A;  1A90 A;  3AGO A;  1JBS A;  1W01 A;  1A2P A;  4EV5 A;  5IF6 A;  2W0Q A;  2L4V A;  3VSY A;  4U13 A;  2GBX B;  3JVC A;  4RNY A;  1B2U A;  1UDI I;  1M1K 4;  1G02 A;  3OV4 A;  1V74 A;  3FLJ A;  3NQY A;  3RNT A;  3I55 3;  4FMC A;  1Q82 4;  1GD4 A;  1OHO A;  2CHC A;  2W56 B;  2Y73 A;  3CNM A;  4R9L A;  3WR2 A;  1RN1 A;  3B8L A;  8RNT A;  3MG3 A;  5TGN A;  1MNL A;  4AEQ A;  1K8A 4;  3CME 3;  5CF1 A;  3F9S A;  2WOH A;  3JUP A;  4ZM8 A;  1RSN A;  2QGU A;  3D5G A;  3NBR A;  5LC6 A;  1O7G B;  5BXQ A;  1W6C A;  1IQX A;  3OX9 A;  4I5Q A;  1A67 A;  1CQS A;  1T2I A;  3IPT A;  3KII A;  3SED A;  1GY7 A;  2QA4 3;  2CFD A;  1RGL A;  1E3V A;  3FF0 A;  3JUM A;  4LMI A;  2CC3 A;  2RSX A;  3VGN A;  4BL3 A;  4JRF A;  1LVN A;  1OF5 A;  2IYJ A;  7RNT A;  2F5W A;  4R4K A;  6RNT A;  1BRG A;  1B27 A;  3N8B A;  5D81 A;  1HU9 A;  1IVW A;  4ILF A;  1Q9E A;  1FUW A;  2XFT A;  2F98 A;  1RCK A;  1IV7 A;  3NM7 A;  5ELJ A;  1O7N B;  3DUK A;  1NB5 I;  4XB5 A;  2KAA A;  3EX9 A;  3FCS B;  1PYL A;  1TFO A;  1YI2 3;  2INX A;  3N54 B;  3G0K A;  1K73 4;  1BVI A;  1BNE A;  4I4K A;  4L7K A;  4MMX B;  1ZGX A;  3EQQ B;  2XSH B;  5HOH A;  4R80 A;  4N6M A;  2CWT A;  2Z77 A;  5KP1 A;  1I8V A;  2H0G A;  2F5M A;  1I70 A;  1GMQ A;  1D6Z A;  3LT9 A;  3MHE A;  2IUK A;  1HZ1 A;  3WA2 X;  9RNT A;  2P0X A;  1U8C B;  3HK4 A;  3G4S 3;  1DMQ A;  3NBJ A;  1T3B A;  2K3D A;  4R9K A;  3U97 A;  2W6J H;  2H0H A;  4N6V 0;  3S67 A;  3H51 A;  1BIR A;  2C11 A;  2OOV C;  1IU7 A;  1LQG C;  1QJG A;  1RN7 A;  2WGO A;  1EKM A;  3ALA A;  4XDV A;  1RKY A;  2ZHX B;  4WYK B;  1E3R A;  3TDG A;  1IK3 A;  2QIY A;  2F4Y A;  2UUG C;  2QEX 3;  3F7X A;  1FW7 A;  1NJI 4;  4Q53 A;  1BRJ A; 
#chains in the Genus database with same CATH homology
 2D1W A;  3LZA A;  2JDI H;  2C10 A;  1GY5 A;  3HX8 A;  1VQN 3;  1VQK 3;  1GY6 A;  5I97 A;  4HZB B;  1UUW B;  1YVB I;  3X3X A;  4AKY A;  1EA2 A;  1WNH A;  1ASK A;  2IA7 A;  2P0M A;  2W2C A;  4OK0 A;  2QEX 3;  2HMK B;  3UL6 A;  3LTA A;  1JV2 B;  3GZY B;  4FMB A;  3CXC 2;  1VQ8 3;  3CCM 3;  1W5Z A;  1OHP A;  4MMZ B;  3E99 A;  2Y74 A;  3UL5 A;  1OAC A;  4HM4 B;  1VQP 3;  1QMA A;  1YJN 3;  5KP4 A;  2OTL 3;  4PEJ A;  3AMO B;  3LTD A;  3IMA B;  2OCT A;  1FGQ A;  4RZM A;  1IQ8 A;  2FXT A;  2GU1 A;  3BNC A;  3PS8 A;  3S5C A;  1Q7Y 4;  3PYJ A;  1JB2 A;  2XF3 A;  4RBN A;  2XR8 B;  1OCV A;  2BMQ B;  2MC8 A;  1IVV A;  4BTW A;  1UUV B;  1O7M B;  2YFL B;  2HMJ B;  1VQO 3;  3H3H A;  1Q40 B;  4ORL A;  5EQL A;  4K1U A;  2JQ5 A;  3ROB A;  3DGO A;  4KFE A;  5STD A;  3CCJ 3;  2RGQ A;  3KSE D;  3I0Y A;  1GS3 A;  2P38 A;  3EN1 B;  3FF2 A;  4O8S A;  3KKG A;  3HZP A;  2K54 A;  2R4I A;  2KCD A;  4N6L A;  1FGM A;  3T8N A;  1W2Z A;  2HMN B;  1JNQ A;  2M7O A;  2GEY A;  5AII A;  1W7C A;  2XRX B;  1Q42 A;  2ML6 A;  3B4P A;  1OUN A;  3JUN A;  4QWT A;  7STD A;  2CFW A;  1STD A;  1SII A;  4H61 A;  1EQK A;  1RJO A;  1S5A A;  4R1K A;  3OWS A;  2I9W A;  3G6E 3;  1W4N A;  2CWU A;  1GD3 A;  3EB8 A;  5AYS C;  3SVA A;  2OWP A;  1FA3 A;  2XH9 A;  3UNL A;  2E2U A;  1ROA A;  5KP3 A;  1KD1 4;  4TX4 A;  4BTX A;  4FCZ A;  3OW2 2;  3MSO A;  3WOE B;  4XBT A;  1ZX2 A;  1N9J A;  1EG9 B;  1IQY A;  1MOL A;  2W56 A;  1KSI A;  1KC8 4;  2W9P A;  1IVX A;  3DGN A;  1KQS 2;  2OQE A;  2P05 A;  3PCS A;  1WQL B;  3X41 A;  4XBY A;  3F14 A;  1STF I;  4OVM A;  3HII A;  3CCS 3;  3M8C A;  3F8X A;  4K61 A;  5AIG A;  5G2G A;  3FSD A;  1SJW A;  1YHQ 3;  3X40 A;  2XGL A;  3F40 A;  3MG1 A;  3LTB A;  1N9E A;  1C7H A;  2ZDJ A;  3GWR A;  5AEW B;  3K0Z A;  2W9Q A;  3CPO A;  1N5P A;  3HI7 A;  3IJE B;  4IIA A;  3V99 A;  3J7Y d;  5IW9 A;  4WHA A;  1JKG A;  2ML5 A;  4HM2 B;  1VQ9 3;  1IT8 A;  3LTC A;  3CCR 3;  4JF8 A;  2GEX A;  4OUQ A;  2V1L A;  3X3Z A;  2OTJ 3;  4HM5 B;  3PXM A;  1DMN A;  2PZV A;  1OF5 B;  2YFI B;  2FNQ A;  4XDW A;  2WGQ A;  2CH9 A;  2A15 A;  5AYR B;  2PNC A;  2XGN A;  4K90 B;  3VF1 A;  1QVG 2;  6STD A;  5BVB A;  4J8T A;  3GZX B;  4BTY A;  3LYG A;  2YX9 A;  1RRH A;  4NHF A;  4HM3 B;  2HML B;  2XFS A;  3K9M C;  3S28 A;  1U5O A;  4FMD A;  3NUV A;  4HM8 B;  3G16 A;  4N6N B;  2HMM B;  1QAK A;  1WTH A;  3CNX A;  1UI8 A;  2RFR A;  4FR9 A;  3K5T A;  5JPU A;  4MMY B;  4LZI A;  3FZW A;  1HKX A;  3UB1 A;  5CXO A;  4GB5 A;  3I56 3;  2BNG A;  1VQ5 3;  4XBX A;  1T5Y A;  2XSO B;  1IVU A;  2O9U X;  1N8Q A;  5JBS A;  3CCE 3;  1W6Y A;  4MJD A;  1ULJ B;  3QRD A;  1VQ4 3;  3G71 3;  4WFO A;  5IG4 A;  2LYX A;  3WOD G;  3GAX A;  4CDL A;  3L0R A;  3NHX A;  1TU5 A;  2OOV A;  3T8U A;  2BT3 A;  4FCM A;  4HVN A;  3NQZ A;  2Z76 A;  3NV0 B;  3SXX A;  1KWI A;  1SQW A;  1Q40 A;  3FGY A;  4FMA A;  1BUQ A;  1JN5 A;  1AR0 A;  1O7P B;  5AIH A;  3WDG B;  4WWU C;  2E2T A;  1VQ6 3;  2IMJ A;  2CW9 A;  4RNZ A;  3LOY A;  1SIH A;  4N6T A;  3MYT A;  1US1 A;  3BNB A;  3BB9 A;  5AEU B;  3KSP A;  1FGO A;  3LT8 A;  1S72 3;  2W04 A;  3U1W A;  5IG5 A;  1IV9 A;  3F7S A;  3EHC A;  2HMO B;  5JPP A;  4HM1 B;  2WO0 A;  3NXJ A;  4HYZ A;  1JRQ A;  1DYU A;  2D42 A;  3FG3 A;  3OXA A;  3EN8 A;  2WOF A;  1LXE A;  1Q86 4;  1AV4 A;  3BNE A;  4O3V A;  5CLK A;  4IT7 A;  2RCD A;  1AVK A;  3S29 A;  2BO9 B;  4LEH A;  1G96 A;  5EVH A;  1WMP A;  2O3O A;  5DRV A;  1K41 A;  1QVF 2;  4HJL B;  2BMR B;  1VQL 3;  3S27 A;  3CCV 3;  1A2V A;  3GZB A;  3F8H A;  4N6O B;  1UI7 A;  2Z6B A;  3QK9 A;  2CFL A;  1M9G A;  4J9A A;  5IEO A;  3EC9 A;  3CPW 2;  3JUO A;  5IEP A;  4EYC A;  1M1X B;  2B1X B;  3RGA A;  2YFJ B;  3WOF B;  4WP5 A;  5IER A;  1Y4K A;  1LNH A;  3A76 A;  1YIJ 3;  3CCL 3;  3Q90 A;  2LQV A;  1Q81 4;  4X2O A;  1ISK A;  3LML A;  3MPH A;  1N5H A;  3D9R A;  3V98 A;  1JB5 A;  4HZ9 B;  3SX1 A;  1VQ7 3;  8CHO A;  2UX0 A;  2Q07 A;  1CEW I;  3KE7 A;  1O7H B;  3RDE A;  3EJV A;  4O2H A;  3CC7 3;  1ROV A;  3K7C A;  4CCV A;  3UJM A;  3BND A;  4LGQ A;  5DRE A;  2SBL A;  3G8Z A;  1UW1 A;  2F86 B;  3KN4 A;  2K0M A;  1RRL A;  3CC4 3;  1OGZ A;  4KFF A;  1IDP A;  1N8R 4;  3MWZ A;  3KFQ C;  2CG0 A;  3DXO A;  3EF8 A;  4KVH A;  4X2H A;  5IG3 A;  3CC2 3;  1D6Y A;  3WMD A;  2CK3 H;  2P09 A;  4N6U A;  3JUQ A;  4IPB A;  1W02 A;  3DGL A;  2CIU A;  3DM8 A;  5CK6 A;  3CD6 3;  2ZL8 A;  5HGR A;  3DMC A;  1K28 A;  5AIF A;  1DVD A;  1JKG B;  1PFP A;  1D6U A;  1W00 A;  1GYB A;  4MEI A;  1Z1S A;  2Z7A A;  3SOY A;  2STD A;  1NB3 I;  2KRT A;  1F8N A;  3K63 A;  4WYK A;  1YIT 3;  3HIG A;  3SLU A;  1YJW 3;  1A2K A;  4KFD A;  3FG4 A;  5IEN A;  4GL6 A;  1PU4 A;  2GXF A;  4FCJ A;  3PZW A;  1NDO B;  3B4O A;  3FG1 A;  2XEP A;  5A0O B;  2GU3 A;  3FH1 A;  1TP6 A;  4XM4 A;  3CCQ 3;  4L8O A;  3KZT A;  2B24 B;  4KZ1 A;  3MG2 A;  3CU3 A;  3ECF A;  3X42 A;  2MF7 A;  3NM2 A;  4EC6 A;  3CMA 3;  2FGT A;  4K1V A;  4HBR A;  3X3Y A;  4O02 B;  4L8P A;  4HKV B;  1W2B 2;  4HM6 B;  1JJ2 2;  2CWV A;  1NWW A;  1FGT A;  2KXG A;  3AMO A;  3BLZ A;  5LC7 A;  3STD A;  1W6G A;  1VQM 3;  1A90 A;  1WMO A;  1AVL A;  3DGM A;  5FW5 A;  2BMO B;  2W03 A;  1OH0 A;  1DVC A;  1WMN A;  3LH4 A;  3NV0 A;  3RGR A;  1J2B A;  2BHM A;  4HM0 B;  4HM7 B;  4N3V A;  1OGX A;  5ELU A;  3LXU X;  5AI1 A;  2CG1 A;  1K9M 4;  3PGB A;  4EXR A;  3T0U A;  3ER7 A;  3OWU A;  4G1M B;  3D3L A;  1ZO2 A;  3EBT A;  2IUJ A;  1SPU A;  3V92 A;  1JB4 A;  5D82 A;  1DMM A;  3SOA A;  1R4C A;  3CCU 3;  1NU3 A;  1QAL A;  4AKZ A;  1TFK A;  1VZZ A;  3N9H A;  4EV2 A;  2GBW B;  1M90 4;  3EBY A;  1CYU A;  3OWY A;  3WA3 A;  3O8Y A;  5IG0 A;  2F99 A;  3GRD A;  3MKI A;  3DZL A;  4EBG A;  2E2V A;  1JN5 B;  2CKF B;  1OHS A;  3GZR A;  1YJ9 3;  1ULI B;  1L5G B;  1OPY A;  2CFG A;  3EE1 A;  2CFK A;  1CYV A;  3Q2P A;  3Q1C A;  2OQE C;  1FGR A;  1TIJ A;  1YGE A;  3DY5 A;  3FKA A;  3PCR A;  4LSO A;  1QAF A;  1O7W B;  3NX0 A;  4H3U A;  1E97 A;  1IT7 A;  1LOX A;  4NRE A;  1TUH A;  5D83 A;  4STD A;  5FGO A;  5CF2 A;  1NO3 A;  5EEO A;  3NBB A;  3B7C A;  1W01 A;  4EV5 A;  5IF6 A;  2W0Q A;  2L4V A;  3VSY A;  4U13 A;  2GBX B;  3JVC A;  4RNY A;  1M1K 4;  3OV4 A;  1V74 A;  3FLJ A;  3NQY A;  3I55 3;  4FMC A;  1Q82 4;  1GD4 A;  1OHO A;  2CHC A;  2W56 B;  2Y73 A;  3CNM A;  4R9L A;  3B8L A;  3MG3 A;  5TGN A;  1MNL A;  4AEQ A;  1K8A 4;  3CME 3;  5CF1 A;  3F9S A;  2WOH A;  3JUP A;  4ZM8 A;  2QGU A;  5LC6 A;  3NBR A;  5BXQ A;  1A67 A;  1O7G B;  1W6C A;  1IQX A;  3OX9 A;  1CQS A;  3KII A;  3IPT A;  3SED A;  1GY7 A;  2QA4 3;  2CFD A;  1E3V A;  3FF0 A;  3JUM A;  4LMI A;  2CC3 A;  2RSX A;  3VGN A;  4JRF A;  1LVN A;  1OF5 A;  4R4K A;  3N8B A;  5D81 A;  1HU9 A;  1IVW A;  1FUW A;  2XFT A;  2F98 A;  1IV7 A;  3NM7 A;  5ELJ A;  1O7N B;  3DUK A;  1NB5 I;  4XB5 A;  3EX9 A;  3FCS B;  1TFO A;  1YI2 3;  2INX A;  3N54 B;  3G0K A;  1K73 4;  4I4K A;  4L7K A;  4MMX B;  3EQQ B;  2XSH B;  4R80 A;  4N6M A;  2CWT A;  2Z77 A;  5KP1 A;  1D6Z A;  3LT9 A;  3MHE A;  2IUK A;  3WA2 X;  2P0X A;  1U8C B;  3HK4 A;  3G4S 3;  1DMQ A;  3NBJ A;  3U97 A;  4R9K A;  2W6J H;  4N6V 0;  3S67 A;  3H51 A;  2C11 A;  2OOV C;  1IU7 A;  1QJG A;  1RN7 A;  2WGO A;  3ALA A;  1EKM A;  4XDV A;  1RKY A;  4WYK B;  1E3R A;  3TDG A;  1IK3 A;  2QIY A;  3F7X A;  1NJI 4;  4Q53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...