5JQGF

An apo tubulin-rb-ttl complex structure used for side-by-side comparison
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
384
structure length
309
Chain Sequence
b'MYTFVVRDENSSVYAEVSRLLLATGQWKRLRKDNPRFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADKLCRKASLVKLIKTSPELSESCTWFPESYVIYPGNVWIAKSGILISSEAHVIQKYLEKPLLLEPGHRKFDIRSWVLVDHLYNIYLYREGVLRTSSEPYNSANFQDKTCHLTNHCIQKNYGRYEEGNEMFFEEFNQYLMDALNTTLENSILLQIKHIIRSCLMCIEPAISTKHLHYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDVAISSVFPLASIFIKLHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Pironetin reacts covalently with cysteine-316 of alpha-tubulin to destabilize microtubule
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 85
structure length 309
sequence length 384
ec nomenclature
pdb deposition date 2016-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03133 TTL Tubulin-tyrosine ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5jqgF02
3.40.50.11480 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jqgF01
2VR1A 2P0AA 2YRXA 1GGOA 4MV6A 5HV6A 4Y8VB 2R7MA 4O81A 2R87A 4O7RA 2W6ZA 4M9UA 1AUXA 1VBGA 4E4TA 4O4LF 3V4ZA 2PBZA 4FFMA 3DF7A 3GLKA 2XCLA 4O7SA 4O2AF 1OBDA 4O86A 1IOWA 2GQRA 3U54A 1BXRA 4ZHQF 4O7WA 2I80A 1JDBB 5CA0F 1C30A 4I55F 3VMMA 1W93A 2FPGB 1GSHA 1KJ8A 2PN1A 3WNZA 1Z2NX 3AX6A 4O7ZA 3KREA 1T36A 5JH7F 4IZOA 2GPSA 2W71A 3TINA 3TQTA 4YAKB 2DLNA 4MV9A 4YBZB 3G8DA 3E5NA 3R23A 2YRWA 5LXTF 5LP6F 4MV3A 4MV7A 4HR7A 2FB9A 5CA1F 2YZGA 1KJIA 4YJ3F 1KJJA 4XX0B 3WO0A 4DIMA 4TUYF 4IHJF 2HJWA 2DWCA 1EUCB 1CQIB 5BPHA 2HGSA 1OBGA 3UFXB 4EGJA 4QSHA 3R5HA 2V59A 4HQ6A 2R86A 2W6MA 3MJFA 3Q1KA 5GONF 2FP4B 2NU6B 2FPPB 4EGQA 3KAKA 4XYMB 2DIKA 3MWEA 3AW8A 3VPCA 3WO1A 3TIGA 4FFRA 4ZOLF 5IYZF 3KALA 3QFFA 2YYAA 2VPQA 1M0TA 1DV2A 4FFNA 4FGRA 1A48A 2R7NA 2QK4A 5C1OA 5CB4F 4YJ2F 2YS7A 5LYJF 3V4SA 4FE2A 2CNVA 2I87A 1KJ9A 1I7LA 4HNTA 4YB8B 2CNQA 2GLTA 4FU0A 3R5FA 1M0WA 3N6RA 2GQSA 1B6SA 3HBLA 2NU7B 4MV1A 1B6RA 2ZDHA 2CNUA 2WYOA 3ETJA 1A9XA 4HNUA 2GPWA 3JRXA 2YWVA 4O7VA 4FFOA 5BMVF 4IIJF 3JRWA 2ZDGA 1SCUB 4NYEA 4O7LA 4ME6A 1BNCA 3MWDA 4O84A 4MV4A 1Z2OX 2OLSA 2J9GA 4MV8A 5JQWA 1WR2A 4O4JF 3R5XA 1PX2A 3JZIA 2DZDA 5C8YF 2X0SA 2YZNA 3LP8A 4YAJB 3VA7A 1ULZA 5KKNB 4O4HF 5FNVF 3JZFA 3U9TA 3ETHA 1DIKA 4O4IF 3BG5A 1Z2PX 5HBRB 4I4TF 3N8DA 4C5AA 3K3PA 1CS0A 3K5IA 3Q2OA 2Z04A 1KC7A 2YZMA 4EG0A 3ORRA 2V58A 1C3OA 2R82A 1GSOA 5JVDF 1CE8A 1GSAA 2R7LA 4DLKA 4XZ3B 1EZ1A 2V5AA 2YL2A 2W6OA 5JVLA 3RFCA 2FPIB 2W6NA 2YW2A 4C5CA 3R9RA 2ZDQA 4XYLB 5H80A 4TV8F 4L1KA 4MA0A 4O2BF 2PVPA 5C1PA 5J2TF 5JQGF 1KUTA 2R85A 1VBHA 1KEEA 1CQJB 2I8CA 3G8CA 4MAMA 1IOVA 2IP4A 3TW6A 3VOTA 5D8DA 2YS6A 4C5BA 2QF7A 3I12A 4TV9F 3HB9A 3NUAA 3RV3A 2R7KA 5EZYF 1GLVA 1VKZA 3VPBA 2C00A 3OUZA 3ORQA 1E4EA 1KBLA 5KX5F 2YZLA 3RUPA 1DV1A 1EUDB 5DMXA 1JDEA 3HO8A 1W96A 2VQDA 1EHIA 4FFLA 2Z02A 4O7YA 3U55A 1KJQA 2NU9B 4HNVA 4O7NA 1JLLB 4I50F 3OUUA 2XD4A 2SCUB 2R84A 1E4EB 4ZQIA 1EYZA 1PK8A 4RZQA 4ZI7F 2W6PA 2W6QA 1I7NA 2NU8B 3U9SA 3RV4A 2NUAB 5BPFA 4FFPA 3SE7A 4WBNF 2CZGA 4O7TA 5LOVF 5CAEB 3K5HA 3TIIA 5J2UF 5LA6F 4MA5A 3GIDA 4O83A 2W70A 3KAJA 1JKJB 3LWBA 1AUVA 4O82A 1M6VA
chains in the Genus database with same CATH superfamily
3Q3VA 3D2AA 3WYDA 4C89A 5KOHB 1G2PA 3A25A 3EUWA 4KYUA 5E95A 2RKOA 5EIBD 4E5KA 1YZNA 1EKFA 3T0FA 1IEVA 1WKBA 3O4JA 1S0UA 3KOUA 2R7MA 1J70A 1FTWA 1U28C 3RTXA 3H4VA 3RG2A 3UQZA 1YA4A 1GZDA 3AHGA 1H6AA 1DBIA 2IXTA 3R6GA 3EEBA 5EXPA 1JMKC 1I0LA 4O7RA 3T9FA 4PONA 2COKA 4N3CA 3MIIA 3DLBA 1W7AA 2HLDD 4ZOEA 3GCDA 4KOAA 5C80A 4L73A 3CONA 1XJ5A 4FFMA 4RWEA 3SKXA 3D7SA 3LD9A 3T9EA 1X8JA 2PFGA 2WM9B 4UOZA 2FN3A 2F9LA 4UMDA 3FFTA 5GM1A 4EKDA 1R9MA 3VJLA 1USIA 2DBZA 2QTVA 3Q41A 3SHQA 3BMQA 3QIVA 5IVPA 3BHMA 1E6WA 2C29D 2FJPA 1KVQA 1OB2A 1EWYA 3H75A 5K01A 3N39C 3KSAC 5DHUA 4RULA 1FDSA 1JPVA 1LK0A 1TD9A 3ZI4A 4B73A 1PTKA 1SCKA 1GFWA 3P19A 3U0GA 3FYUC 4HDSB 4EL5A 2FY8A 4WL0A 2G8LA 4AJIA 5BSEA 4TMTA 5CD9A 1D2MA 3NM6B 4XYBA 1XZ8A 3OTGA 4M8KA 3WB2A 4PTLA 4AKEA 3TQQA 1H0SA 4G0NA 4AUNA 4G5HA 1FDRA 5TT0A 4E94A 1YJQA 2QYSA 4KXWA 4WTOA 3I42A 2DY1A 2D6FA 4Y2JA 5IPFA 3KZOA 3LWDA 1KMHB 4JUIA 3H9QA 1E2BA 1QK4A 3V46A 3LDGA 3V55A 2QBYB 4FOSA 4P3OA 4A8TA 3NHJA 4J0DA 4R3WA 5CH5A 1J1IA 3TDNA 1I4OA 1OFHA 3HY4A 4RQAA 2BCJQ 1FQKA 3FD8A 4OAQA 3T7EA 1QH1A 4CUKA 3FDZA 3RTGA 5FH9A 2XAUA 4TSFD 1N8NA 4E5MA 2VIIA 1EFRD 4FWBA 5BQPA 3M2PA 4IJWA 3WGHA 4BNXA 1WXEA 4BX0A 1P1HA 5K5EA 3WNVA 5E3IA 4DSUA 1XD2B 2Y1FA 3R23A 1MABA 1EVEA 1G8PA 2NZYA 1U7OA 3B20A 3HV0A 3C1AA 4IBOA 4TS3A 4RPCA 4C43A 1KMNA 1VCOA 4DNXA 1C7IA 3IAAA 4L5YA 1KS9A 4MRAA 2NVUB 1Q77A 3ILVA 1N2XA 4N65A 4Q1VA 1GNPA 4Q3OA 5GOTA 2RMKA 3OZUA 4V0LA 3RS0A 1WCIB 3LS2A 5E7QA 3WYEA 4C7JA 5EYPB 4GKJB 1XJWA 4KQ6A 4D46A 1IY9A 1A3GA 3RUHA 2AS0A 1GU0A 1J8DA 3CUEF 1BX1A 1ZOIA 3MW8A 4QU5A 4FEGA 5E4JA 3DBVO 3GQBB 1R50A 3S2IA 2CF5A 1U0LA 4O4LB 3DDOA 4RWZA 2FUG6 1C0KA 3AYZB 4RPIA 5F1PA 3AOGA 1D7OA 4QD3A 3QU5A 3I62A 2QN2A 4GOND 2JI7A 3CS3A 5KB3A 1JW9B 1R1DA 2CCGA 3BXEA 2ZAYA 5CR9A 2DAAA 4DIMA 3NHMA 3ZGNA 5DNYB 5M04A 2R60A 1PR4A 1YQDA 1S4QA 2W9XA 3KR9A 1RBQA 3R40A 2F1KA 2HHCA 5ALZA 5K3EA 5LP6A 4OVKA 2O8DA 1AKRA 2FF5A 2YFQA 1XZDA 4Q34A 3RBAA 1ILEA 2A5JA 4HEA1 4CLRB 4QTTB 3ZN2A 3DVRX 1P2TA 5IFKA 2XBUA 1ID1A 1QVZA 4UOEA 1JA9A 1DB3A 1TJNA 1T5DX 2I34A 3RABA 5T4FA 1VHDA 2FWMX 4Z1OA 3DZDA 1BHO1 3O8OB 4B6OA 2F3PA 3G6WA 4S35A 1YQUA 1IN4A 2PH3A 1MXHA 2RBKA 2WF5A 1RYBA 2GPTA 2HI0A 2YX1A 3IEVA 1XSEA 1O95D 1QONA 5JMOA 1EP3B 2VK4A 2ABJA 1H6BA 1I4LD 1ZK4A 2GN6A 4MDYA 4PPQA 1UBHS 3HFJA 4W82A 4WY2A 5B2ZA 2JEZA 1U6JA 3KUKA 4B6GA 2FU5C 3OZWA 1RYNA 4LXXA 3UT6A 2V1XA 4N5NA 1JLRA 3KUUA 1LW7A 2XMDA 3D2CA 4FYPA 2OE2A 4JBHA 5DTMA 4DXHA 2XUDA 3B51X 4KDEA 4TQUS 4D4HA 2NN3C 4JC4A 1GT6A 4Q3AA 3ZWBA 1V7ZA 2MYPA 3RYIB 1SAYA 1SKUA 2VKTA 1SK9A 3V3TA 4CEJA 3SC3A 3CWZA 1OAAA 4E5PA 5EAIA 5AOVA 3STTA 1NC1A 3FPFA 1XK6A 3NI2A 2PH1A 3HUEA 2DIKA 2P3LA 2C5LA 3ESZA 3O03A 3KC2A 4HFMA 5E1MA 4DLVA 4LJ5A 5B4UA 1UPBA 5BWMA 5GADl 3NAQA 1A95A 1PO7A 1UDCA 2X5JO 3CLHA 4K86A 1G21A 2FWPA 3ER8A 2OHOA 1ZK0A 1EK0A 1A88A 4PQRA 3KHKA 3HUFA 4WA8A 3VKVA 3K8OE 1QO9A 4UULA 3T5MA 3GA5A 3CX4A 3DTNA 2J32A 2BZ0A 4OAOA 4CTNA 4ENQA 2SICE 5KC9A 2BGNA 5GONA 4E13A 4LY6A 1IXYA 1TLTA 1JR4A 1GFZA 2Y3IA 2NO9A 1YCGA 4DTCA 1II9A 3QOWA 2BHRA 4H3HB 1QTRA 1GZVA 1ZOPA 1L3IA 5D51S 3VC7A 5AW7A 1KHTA 3O4HA 4Q12A 3PD1A 4YJ3B 5EUCA 3BJZA 3U4MA 3P97A 2YMPA 3VUEA 1D1QA 5HF6A 4IUYA 4HX9A 1NYTA 2A0KA 1PKXA 4XUDA 4DLSA 4DUGA 4FILA 2EKDA 3B78A 4UM9D 5HJEA 2X6TA 3MJDA 1KI2A 2D1YA 4LK3A 4M0KA 1MRZA 1ZZGA 1FNMA 1HDGO 3D7KA 4RZ3A 2BZGA 5C4GB 1OXUA 3VU9B 1F0NA 2C97A 3UK1A 2AWOA 3AU8A 2I87A 1KJ9A 2KMLA 1XZMA 1JIJA 1TVKB 1WO8A 2AOTA 3A3OA 1H8ED 3LDFA 3LJKA 1TYZA 3NBQA 3PRHA 4HI0E 3VH2A 1J5EB 5KQGA 3NBYB 2YHAA 1LCIA 1Y3FE 3ZD6A 3K31A 5IT0A 2OG2A 2FOIA 2GQSA 1X74A 1AS3A 1J00A 3GFRA 4BVBA 1C3XA 2XA9A 4I7EA 4WHMA 4Y98A 5K8LA 3NBFA 3T3EA 3WGLA 4BY9E 1PI3A 1FB5A 2UYCA 3CUTA 4D25A 2BKLA 3ND9A 3L0ZA 2E4UA 1AUPA 5COAA 3FRIA 2AFHB 2ZWAA 3ISVA 2ZJFA 2EIHA 3KR0A 5A3SA 2JFYA 4OXXA 4WOJA 2C98A 2JAXA 2JC3A 2KBFA 1P80A 3CZPA 3KOWA 4LV8B 4XWYA 3ZTTA 1XMQB 1PN3A 3IQHX 1T0IA 4JFAA 1XQWA 2XT0A 2Y1CA 1VCNA 1Y80A 4P8RA 3MVEA 1NJGA 5BMVF 5JD3A 3AKZA 1GPUA 1J0DA 3RNOA 1I2LA 3H2BA 3GMDA 2VSYA 2HMWA 3C7KA 1PX0A 3HUDA 4JOCA 4A2CA 3ZQ4A 3WOVA 4FEYA 3C39A 1Z56C 5GV8A 3RKSA 3NHYA 2CXNA 2GTIA 2DX7A 3NBZC 1UODA 2X19A 3CH5A 5CMLA 1YE5A 3BA1A 5CT9A 3ZE6A 1JJBA 4ZV4A 3K16A 3RWBA 1H66A 1PS9A 2JF0A 2XW6A 4EKGA 4BNLA 3CLTD 4IX1A 1WQ3A 4LTDA 5F7JA 3DE5X 2QSYA 2P68A 1R6UA 1IU9A 3JAMA 1GQOA 1EZZA 3ZCTA 1O7JA 2AG5A 2QMUA 4FCWA 4ALJA 4C7BA 3T1OA 5IG2A 4IIJA 4DRFA 3KU1A 4NOLA 4QICA 4RTMA 3IVAA 1ECLA 3ACBA 4Q7KA 4AYWA 2Y4NA 3MJHA 5HZHA 1ZC3A 2B1RA 4RZ2A 1IB0A 1NBOA 3QXXA 1VS0A 4K6MA 2XH8A 4KLNA 4UEJA 3IQDB 2VAMA 1ZWLA 1EGVB 2RK4A 3RS4A 1R74A 5C34B 3ZW8A 4O4HF 1DJLA 4LJLA 1O08A 2HJ9A 3E9RA 4L0DA 2HNAA 4BQQA 4W4TA 4QNRA 2RGYA 3MUEA 4V39A 3KWMA 4A92A 1NASA 2R8EA 1L5HA 5AJYA 1BMDA 2JA2A 4M1EA 2PKCA 3IDZA 3IULA 4BLVA 1Z4OA 2HLNA 3IIJA 4RPJA 4WEOA 3AINA 1CY4A 1PNOA 1YDGA 3R2JA 4N82A 5HP4A 4WVLA 4D2IA 1EVIA 1W47A 4LXYA 2QNRA 3ZG6A 1BSVA 4M7RA 4DJDC 4EZIA 4Z4GA 2GI4A 2X86A 1J42A 4FYJA 5HBRB 3BBPA 1AS2A 3N6XA 4RA9B 2IUUA 3RTAA 4JL5A 3AEYA 3WHIA 1FK8A 1SR8A 2DUUA 2JGDA 3S5JA 1NE7A 2P6UA 2W2PA 3N8DA 3QWAA 3TW8B 5U9CA 1A8PA 1BMTA 3K3PA 2BIFA 5TNXA 4NV1A 1J33A 2XOEA 3NOXA 4HK4A 4Q4HA 2XB2A 3EASA 5EZYB 1RXCA 1SU6A 2PA0A 4KXQA 5HKOA 1HYQA 1OPRA 5EEHA 2EFGA 1EDOA 2B9VA 4KDFA 1E32A 1CPYA 1AXGA 1TM3E 1T3ZA 1Y4UA 3GH3A 4HRAA 4JLBA 2WUEA 1U8EA 1G2WA 1F8GA 4JYPA 4ER6A 3V1UA 2AMLA 5IN4A 4FMCB 4LV6A 4HLNA 2ZZNA 4XZ3B 3PUJA 2AFVA 4JJIA 3JQ7B 2IEZA 2JA1A 2O7RA 1K8QA 3PWSA 5KU7A 3H2HA 1P73A 2W2TA 1A5BB 3UWPA 4MIKA 2ZAMA 1G2IA 2RONA 1FF9A 2CBZA 5E9AA 3D2BA 3ZW9A 1UXIA 4QBHA 2FPIB 1MO2A 4M1QA 1VBFA 4KFUA 5A3VA 1MBZA 4CM7A 4FM9A 2ZBPA 2ROQA 4CMDA 1SCUA 1U2PA 4ZD6A 4D02A 4EKNB 1T8SA 3WK6A 3FZYA 4ZT2A 1NAIA 3WNCA 3ESQA 3GF4A 5K3OA 2AFHE 1VPLA 2EFJA 4RMJA 4L1KA 4IIVA 4BTEA 1O9BA 3KOXA 3PX3A 4DFDA 2YXBA 4QT0A 4I36A 1GKYA 3F5DA 3O4RA 4FOTA 1IEXA 3EFOA 1UC4B 1NQAO 1LV8A 2G82A 3UJ3X 4JI0B 2OUIA 1Z0UA 4J3JA 3S28A 1ZAYA 4NZNA 3RS3A 4UVEA 3CX3A 1MENA 1H0RA 3E1SA 2KSQA 1IXRC 1EDDA 1FP4A 1G18A 4WN3A 3D59A 3JD2A 3VR3D 4HXFB 5K0SA 3DF9A 3HB1A 4JWKA 3GLIA 1N5JA 4BO6A 3PLAE 3UPDA 5I3CA 3OTHA 3PJDA 2R4UA 4QTUB 1Y3AA 4OB6A 5TF0A 3FKQA 3LUFA 4D9KA 1ODLA 1I14A 3AV0B 3WYAA 1WU8A 5CLHA 5A62A 1R5JA 2H5JA 2RGEA 3FUWA 1Z22A 3KJFA 2YY5A 5K0ZA 1XTZA 4F12A 4HAVA 3ZU5A 4KE6A 1C5KA 2RBGA 5I5YA 1TA0A 1YC2A 1R5NA 2VVTA 5B1YA 1DEAA 4BYGA 5JTUA 2DFLA 2EJ2A 3UBMA 3IP5A 2FWIA 2HSGA 3ZWWA 3WLKX 4WBNB 4RS3A 5IDXA 4WA7A 3NGMA 3A6FA 1SULA 2NUPA 2QS9A 3PR2B 3RYFB 4V24A 5H02A 1YZYA 4MWTA 1QF6A 3GGSA 3R3ZA 4Q4AB 3UUWA 4KNVA 1W46A 1Q3TA 4F4CA 1FMLA 2QUZA 2HHAA 2IQ5A 2IT1A 2GILA 1RIFA 2RK6A 2J07A 5DM1A 1JDEA 2R8OA 1AGXA 3ZCUA 1FZQA 1J5XA 2ZAOA 4HNHA 4S05A 1HQYE 2O5RA 4QG3A 6PFKA 3CVVA 1TT5B 5DB4A 3LPMA 5I4KA 2ZS9A 1VG9B 4H16A 3LYAA 4MAAA 3EAQA 1TLLA 4M76B 3SBDA 3KZ1E 2GTHA 1SZJG 4OQMA 2ZRMA 4C0QC 2OCAA 1B3RA 4AQ7A 4H4DA 3PUXA 4TVIA 1PQWA 3HXTA 3ZV4A 4NBSA 3FSGA 4IDBA 5B30A 1W1UA 2FZEA 5H83A 5FI5A 4YUYA 4G07A 5GZ3A 1EXNA 4PRYA 1JQKA 3LNTA 2GEJA 4BMYA 3SU8A 4TKUA 1E1QD 3FCSB 1G9SA 3PFNA 3H5WA 4WZ6A 4FE3A 3ZDXB 3NASA 1Y6FA 2HMAA 2QJFA 4X1YA 2ZYVX 5T8KC 2J1LA 4M1SA 2E49A 2ZM6B 4OXNA 2VJCA 4GKAA 1BKSB 1WKCA 3FZQA 3C6BA 3AUYA 2ZXEA 2PMEA 1M0SA 4MR7B 2VOJA 4O6VA 3N0TA 3VZBA 1SZCA 3RS9A 3NHPA 3P45A 4UU0A 1EM8A 4Z0TA 4BNKA 3PHGA 1NJ8A 1AGRA 1DGQA 3IP1A 2MHCA 4ZI7F 2OY0A 1Z16A 3C24A 3DR3A 1YQXA 4Q6BA 3VH1A 4EY6A 2I4OA 3LX4A 4XCXA 1X2BA 4EVSA 2JLUA 3Q10A 2QW0X 3PG5A 5CEJA 4CLOA 5HJ7A 3W77A 5AVKA 1QX4A 1U0HC 1X3LA 1Z0AA 2GJ9A 1QC5B 3EFHA 3QVTA 2O7QA 5SYNA 3UWDA 5HG0A 4YACA 1HNWB 3NZEA 3FSJX 3GHYA 1Y7IA 3IUPA 4WZBB 4B6RA 1XZHA 1EVLA 1CJUC 1Y81A 3BMCB 1ZINA 3ZY5A 1P44A 2GASA 2DP4E 3H5IA 5DW3A 4QXOA 1E6CA 1KKUA 2WF7A 4UTNA 3M6IA 4P22A 2Q5HA 3CF0A 1GTZA 1VJDA 2P40A 2X1MA 4DKJA 3ZVRA 2ZM5A 4O82A 1NQWA 1YUNA 3D7MA 1UC8A 5ANRB 5IKXA 2I2XB 2WKWA 2PGJA 3BD7A 3HZOA 3X1KA 1GAXA 2QL7A 1JGTA 1IHOA 3LUPA 1ZQ9A 2J31A 1XDWA 2UYOA 2ZG6A 3LXXA 5LZ4A 2HM7A 2J9FA 3EVAA 2A1UB 1M1XB 2GUWA 1QZZA 2ZIZA 3A3YA 3ZD8A 5BSKA 2ZIXB 4M4SA 4C4ZA 5CX1A 4JLUA 2BGJA 1BX3A 3BMNB 4RVCA 4D26A 2G1JA 3T1YB 3HDHA 3UWMA 2BKXA 2GFQA 3N0WA 3NDIA 4F96A 2H2DA 3ROPA 3L1HA 4PGMA 4WECA 2I2FA 3JR3A 3VPDA 1WABA 4FI3F 3TW0A 3ZWVA 4JBLA 4EVQA 5E6RA 4CHIA 3OESA 1RBYA 4PWYA 3F73A 4LXGA 3AY3A 4KO3S 4ZVRA 1Q0ZA 5CTAA 4M6WA 4JXXA 3W3AA 3SQWA 3PNYA 3EWIA 3ZWAA 1GL9B 1PP4A 5JO0A 4DV6B 3I2IA 1Y33E 3ZHUA 3GW8A 2DCMA 2IBTA 3RRXA 1G59A 3KX2A 2E18A 2QOEA 5KJ1A 2ILTA 3OOEA 2FRVA 13PKA 4M7WA 2JHPA 5DI9A 4OYHA 3EG5A 3CTMA 4GPD1 1CR1A 4OEHA 4RC9A 2WF8A 2XY4A 1U90A 3EA5A 2IH2A 1QX3A 4DRXA 4JR2A 1U4SA 1AN9A 3OF3A 4TTAA 4AZ0A 3PWKA 1FFDA 4ZTBA 4J1NA 5DT9A 1SUDA 2HLDA 3D5TA 2Q1SA 3TS1A 2AI1A 2GPSA 2ZULA 3WZMA 4AMUA 4QX6A 4KGVA 4N7RA 3ZNOA 2CFMA 5KNDH 4CFSA 1SOAA 3N53A 2NO4A 3NHLA 1IBLB 4NR0A 3SC2B 4OJYA 3NLLA 5EC8A 5CA0A 2O14A 3OEYA 2E1PA 3OTQA 5BNZA 1L7VC 5LA6B 3R9IA 4XW2A 1E2DA 4KAAA 3DNPA 3MFQA 5G0TA 5D84A 4R9SA 3W8FA 5HMLA 1JEAA 5LUBA 2A9PA 3HS3A 3U9LA 5LYJA 5JAPA 1T4MA 1N25A 1P7ZA 1B42A 2QXUA 1CUAA 3AEQA 2HXGA 1YS7A 2OCLA 5EHIA 2ODAA 4LE2A 1OA1A 3BABA 1AXEA 3BA6A 1Y3BE 5K0JA 3GY0A 4YCBA 4MUXA 1B8OA 1ESNA 5I4CA 1MG5A 1NMSA 1Q7TA 3Q6NA 3DXFA 6LDHA 1NU8A 4L15A 4OI1A 2IYEA 4XD2A 1CUEA 2BFDB 2F43A 4IIXA 5FLYA 4D0RA 1JEDA 1P4SA 4ZYVA 4BP9A 1YZGA 3EZXA 1RW4A 3IBFA 4UBLA 1B0UA 1ZSVA 2ZR7A 3HI4A 5C9ZA 3WGOA 1AZWA 2EKQA 3NETA 1EHCA 5CK5A 4UCOA 4CN8A 4OMUA 4GQIA 1SUFA 4KRFA 4PCLA 3QNUA 3VKWA 5A4JA 5U1PA 1AQJA 1UZMA 1ECPA 1JH8A 3OFJA 2QW1A 2CLCX 3B6IA 3UG6A 2QM3A 2AFIE 2IY8A 1BDIA 3EK2A 5LYYA 3U26A 1MF7A 4AN0A 1IK4A 5KNCH 5ECGC 4JXUA 1SVNA 2HJGA 2W6JD 5DSZA 4S04A 3KD3A 3WMRA 3BJIC 2R1UA 1E3IA 4JEUA 5E6SB 2R6R1 2IK8A 3JQBA 1DAIA 4KC0A 4PCUA 3GG9A 2OILA 4D9EA 4Z9YA 4H27A 3EUFA 1PQYA 3IUMA 4K6FA 2GM3A 1PJZA 1ZR2A 4IDCA 5ELMA 1OT3A 5A4FS 3A1FA 4LZAA 1ZC4A 5KREA 1AQUA 3ZS8A 1M1UA 2XAAA 2B34A 2RARA 5FR2A 2X7XA 3E2MA 4HZUB 2Q8QA 2BKAA 4XLLA 3G82C 5DXAA 5DIFA 3WYNA 5LLTA 1TAUA 1PSWA 1V5EA 1ECGA 1MGPA 4HNAA 1O9HA 1T8TA 1QUEA 3QH4A 2P6RA 3Q6IA 1HQCA 3W1WA 3CRVA 2OO7A 4HVAA 3CSDA 2DXIA 2G9UA 1YDEA 3MJFA 1N2SA 4ZCRA 1CF2O 3PEEA 2FP4B 1A1SA 4XDZA 2WA2A 4V0SA 3ZKWA 4KYIB 3R7SA 2MINA 1ZCZA 2Y99A 3AF3A 4RMIA 3T95A 4ZICA 1AX9A 1TC1A 4JFRA 3VX4A 3ZJ5A 4EKEA 1Z34A 1ZD3A 1X8KA 1NXSA 1OWLA 2X8JA 4XYMB 2C7RA 2HW8A 2ISCA 3O75A 3DKKA 1UBOS 3Q0IA 4C7VA 5F9MA 4ENUA 3W9SA 1DC7A 3N6VA 1LLDA 3TRHA 1LK7A 1UWKA 5HYVA 1B2LA 2H5EA 4R68A 3BGIA 1E18A 3H8WA 3PE4A 3K20A 4FMPA 4UD6A 1UBTS 2D59A 2RI1A 3EHDA 4MVJF 4PNZA 1LLQA 1TAQA 4L0CA 4DN6A 1GZ4A 4CTMA 1A0GA 1OH7A 5IYZF 4JLMA 1O95A 4G37A 5CYGA 2GVDC 1D07A 1EDBA 2A14A 2CL5A 4DR2B 5HE9A 5BR1A 2AV6A 1X0XA 3H16A 1G19A 4BB5A 1ZOSA 2MSCB 4NE2A 3C6ZA 4ZALA 4YAUA 3ELUA 3ZJUA 3H9GA 3I34X 3FLBA 1P2VA 3UN1A 4RUKA 4W5NA 2WVGA 1I7DA 1GY8A 3TY5A 1GILA 1ZIPA 3ZHVA 3I2YX 4GGOA 3T3PB 1OGJA 1TM5E 5DHSA 2I8LA 1SEVA 3HJHA 5LQJA 5FA6A 2XV1A 3WNDA 3NIDB 5KYUB 2F1RA 3AEUA 4BFCA 3F2IA 4HNTA 3EAGA 3PSAA 3FA2A 4BQEA 3LBNA 4WNYA 3ZE8A 2X5XA 1E2MA 3FPSA 2CJWA 1E8DA 2AUTA 5AI6A 5GGXA 1SD1A 4Q4LA 1GNSA 2QIPA 4MQLA 4PX5A 3R0VA 4DEVA 1G3RA 2R8ZA 3QU7A 3MD9A 4HKTA 4Z7QB 5BXQC 4URUR 1K5GA 1X0VA 5FTJA 1E20A 5TPWB 4AIRA 4GD3Q 1LZKA 4JLOA 2PDAA 3TFOA 2PLNA 3LP5A 1S3SA 3O73A 2B5VA 2ON6A 1GQFA 2Q6OA 1E79D 1VRVA 1E6KA 1U0FA 5IHXA 3U7HB 1YUBA 2OCKA 3L4BC 4EUHA 2Q5EA 4O7VA 1ZJ5A 3HRIA 1G8KA 1HEYA 1ZPDA 4GYKA 4MVJE 3W1VA 4LJKA 5EEGA 4BTLA 1L7OA 1NF8A 2D1QA 4MA4A 3JQAB 3PK0A 3U3KA 5JASA 1CKEA 4IWYA 1Z5ZA 1XIVA 4NYEA 1UDRA 3QBEA 5ICSA 1R0BA 1H8EA 1MO5A 2I55A 1II8A 2VTBB 4F6RB 2VRCD 1GQ2A 4LFBB 5A5DA 2K4MA 2ZI5A 3IKTA 1MQSA 4JZYA 2FZVA 4RKWA 2OLSA 1YS9A 1YGPA 3C8DA 3I2GA 1GAJA 2WAMA 3LYHA 4OB8A 2VLIA 3ZJYA 5T4BA 4H4CA 2C9BA 5FQNA 4LJ9A 1I9CA 3ROMA 3P2OA 4GMGA 3W5UA 4C0LA 2PRYA 1ORHA 2EGHA 4WVFA 3MS7A 2ZJ2A 3SGLA 5A06A 1CNEA 3TECE 4CL2A 2C1EA 3IKVA 2OYCA 3RWMB 1K5PA 2H1RA 4LX8A 4MWSA 2GO7A 1OFIA 3G89A 4F85A 4IG9A 4X60A 1AZTA 4OREX 1G4UR 1XDSA 2H2IA 3Q3HA 4DIEA 2AX4A 1KA9H 3KU4A 4JR1A 4MW1A 1W8DA 3TD6A 1MHPA 2QUIA 2WTAA 3CR3C 4I50B 4UDOA 3KLNA 1N92A 1F2UA 1MB3A 1Q0HA 2HCFA 3NEAA 4M0FA 4NYMR 4PYRA 4TTJA 4Y9SA 2ZUTA 4RHFA 1DRUA 2DFKB 2H7YA 4NTZA 5DHRA 1V8FA 4NBLA 1U2EA 1Y4SA 1JZQA 1A5ZA 4J0EA 4EHJA 3U9TA 4QELA 3KQLA 2PXCA 1P61B 1SXQA 2DPHA 4WV3A 3BRQA 3UO8B 4H6WA 2V96A 4FEEA 1FA9A 1NN1A 4J7AA 1XN4A 2JCBA 2YN0A 4L57A 2GEKA 2LBPA 2PR7A 2O2XA 2VUUA 3MQFA 3Q2IA 3BE8A 1IXSB 5F2NA 5JYDA 4C04A 4KQ9A 3RCBA 2G0AA 4HV4A 3CVYA 3AZPA 4XYLA 3WB0A 1HE1C 4I4TF 5BV7A 1RM0A 3VVMA 2CXRA 1ZH2A 3EMKA 2HA5A 4UCSA 4WZAA 5THQA 3V9PA 4O1HA 4JP5A 1SQ5A 1JFFA 3JATA 1UM9B 3C6XA 1YR3A 3AFHA 5JJBA 2ZYRA 5IP5A 3CWQA 2JJ2D 4CCYB 4BVGA 1N2CB 4EUNA 1QVVA 4MEJA 2FPMA 3FMOB 2ATEA 1FVXA 2ZTMA 4IUCS 1FVOA 5BV8A 4HUQA 2XZPA 4LDRA 4UHEA 1IXZA 2NU7A 4NEQA 1DIHA 3PF9A 2ZRLA 1EZ1A 4P36A 4DIUA 2V5AA 1FNDA 1C81A 3TQSA 4WINA 5EJIA 2FW6A 3HSKA 3M34A 1PBNA 3OJWA 4X63A 5SY9A 1TTPB 4ROTA 3CEBA 1G7TA 1TJYA 1MO4A 4QM7A 1KTVA 2QM0A 3OWHA 1RKVA 1XFAA 1YZ3A 1ESZA 4G24A 1CX9B 1P5JA 2A9RA 3BE6A 4J2OA 4G4GA 2BEWA 3PN1A 2GOYA 4QOGA 4REQA 5C3UA 3Q8MA 3R1IA 3A1UA 4O2BF 1EJ2A 3DWGA 1AT1A 1KMIY 5ITZB 4E4RA 1P62B 3WYCA 2DKNA 1F5NA 1M9NA 2HU8A 1GDHA 1WXXA 4BFTA 3IEIA 1RPTA 3ONEA 2HF7A 2QDXA 3AL0C 1KEEA 2ZRIA 1P5ZB 1C29B 4X3OA 2XUHA 3HI6A 4HN9A 3PXUA 1CZHA 2B4KA 2HO5A 2TS1A 3FFBA 3UXMA 1Z4JA 1T8RA 3HLTA 4BNWA 4FB5A 2AC7A 5JFOA 5HWSA 5TEVA 2WDZA 5LJLA 2ACVA 2UYYA 4IZ6A 4HLUA 5H4HA 1ZONA 1KK1A 4YJGA 3I12A 4KLRA 3ITNA 3B1FA 4KV7A 4Q9NA 1ORWA 2Q5JA 2B1IA 4MV5A 3JASA 1QG4A 2ZTUA 1AY0A 1RXIA 3Q7QA 1MX5A 5CXXA 1JUDA 3H6KA 1FDOA 1E3MA 1KWKA 2AZXA 2WD9A 2VRBA 2WPNA 2VPZA 4MKGA 1VKZA 2IL1A 2O2YA 3MGAA 3BREA 3PFFA 4MDHA 2VAWA 2QYTA 3VVLA 4BV2A 4B45A 4ABTA 2RAFA 5F1OA 5AMXA 1G5RA 2VZEA 4Y6LA 4UNPA 1FYDA 4RFVA 3E35A 3AI3A 1XQVA 3GRPA 2BELA 1EGQA 3L92A 3NUZA 4KI7A 5LQUA 2K5UA 3UT5B 2WSLA 1G60A 4BV3A 2FR1A 3EPKA 4P5EA 3DHNA 2YDXA 5CAEA 3AI1A 1CJSA 1KTIA 1ZP6A 2E85A 2UUPA 4GLFA 3ZKAA 1O5TA 2OFOA 3C3AA 4OX9B 3TJMA 1Y1SA 2GCNA 1HE5A 4TLLB 4XWWA 5A9TA 3DGEC 4DCTA 4KWTA 3EIQA 2I6UA 1TK2A 2Y27A 4Q4CA 3E9EA 3M9WA 3ZH2A 1ZJ6A 2CLLB 2OA0A 4D7AA 3EEOA 5TJHA 2ECOA 3OICA 3FH0A 4PZ0A 4QDJA 4UVHA 4KCGA 4G65A 1LRLA 5JD5A 3LSTA 3JALB 2BMAA 1NY6A 3V8QA 2IXDA 1LFDB 4CIXA 1JBKA 1ZRSA 2PUJA 2WTEA 1T9ZA 1JR3D 3DOJA 5AKEA 3UB4A 1XTTA 3DUFB 4XLTA 3LTNC 4PC1A 3QM1A 3Q12A 3T12A 3ICOA 3CF6R 4JL6A 4EEKA 3AVPA 3S70A 1N2CE 1BJRE 4R9VA 2F3TA 4C07A 1IOZA 4WAUA 3WOHA 3I04M 3HPRA 1MIOA 1ZGJA 4ZT6A 4DA8A 5C31A 4MPRA 4L2IA 3ILYA 4BBPA 1KH3A 1S2OA 2WB4A 2VHXA 3SZGA 2VDNB 4A3SA 5KDDA 5K0LA 3LG2A 4DA7A 1YKSA 3M1LA 4F91B 3NYWA 3CE6A 3OT1B 4JC0A 3FIUA 3WK9A 1NVEA 5AVTA 4JJGA 3FM9A 4E2FA 3RV4A 3KYCA 4ESVA 3CNOA 3GBPA 1M1NA 2JI6A 2JIPA 1YBMA 4DA0A 1JLSA 1IE3A 3HZZA 3LECA 1YNOA 1ZMTA 4EJFA 1PV1A 2H5IA 3M4NA 4CEIB 4DIDA 3T8YA 3C8UA 2J7KA 1CLUA 1HEIA 4OGGA 3BWBA 3D4PA 3TUJC 3PXBA 3THSA 4YMVA 3EF1A 4XWKA 1RJDA 1W5SA 1EGAA 3S8MA 4AK9A 1JU4A 3HWSA 1NR5A 2ZZKA 2EIYA 5CW1A 5BR8B 2HRQA 2FW7A 4LMBA 5EUMA 4L7VA 5AK0A 1Q0LA 2IGTA 1O95C 1FFYA 3NBZB 1JR6A 2YNMD 2HYDA 3BFVA 5EZQA 4UM8B 4FWTA 5EZ5A 4S0XA 4PRKA 4CR6A 1EVJA 5AI5A 4AF6A 1CXZA 1KARA 1TZBA 2W0MA 4QU8A 3WGKA 4V03A 2QUJA 4C2AA 2F8MA 1M83A 3DXZA 4OF4A 2RKBA 1ANKA 4P82A 2OXEA 3LY8A 3PGLA 3W5IA 2P5TB 3CURA 4BN0A 5J2UA 2Q3LA 3SNKA 1QFYA 4D4IA 1OLUA 1JDNA 1KORA 2R1TA 5KS8A 4PHCA 1NJ1A 4FZVA 3CO0S 4HTFB 2A86A 1BEZA 4L9SA 4B4VA 1L7NA 4II3A 4O4LF 3V4ZA 4QFCA 4ZU6X 1TK9A 3R09A 2PNJA 2CLSA 4C30A 4OHPA 3UOWA 4YT4A 3MD0A 4XCQA 1I2CA 1XTKA 2AF3C 3AH8A 4HQNA 5IAOA 5JRZA 3T7TA 1OTXA 4LBZA 2FHPA 2QTWB 3NIWA 3HCFA 5JDIA 1KQFA 2JFQA 2PV7A 2SNIE 4NCNA 4ZEOA 4LYJA 1BCRB 1Q16A 1P17A 1O1YA 4ETNA 1MOQA 3U19A 2JLXA 2QLNA 1NP7A 2OHGA 2O5EA 4M87A 3W2FA 1H94A 2XNCA 3EWSA 4ILEA 3NANA 4IG4A 1Y9JA 2CVZA 2CHUA 2C9OA 4YWJA 5HFAA 1KZ4A 4B17A 2EW1A 3JQGB 4YRFA 1DIBA 3MMSA 2B61A 1V0JA 2Z6VA 3NBXX 4HBZA 4JQYA 4LHVA 2DY0A 1GSHA 2VP3A 1UH5A 4KKVA 5IF3A 1QIKA 4FHGA 4I6JA 4OHVA 1NLMA 4EJ0A 1J9GA 4LYAA 3B7GA 3PFHA 5MN5A 3HKDA 3WGQA 4J3NA 1WSBA 4LMPA 4EEZA 2XRFA 3FSRA 4Z4IA 5AQEA 1NQ5A 3C8ZA 3HVHA 1MOSA 3IQGX 1OAKA 1OI2A 2WFLA 3KKMA 3PA6A 1FRVA 2RGRA 3LUKA 3BJRA 4KXVA 1Z26A 3ECSA 2BEVA 3QLJA 1U5CA 3WLOA 5BUQA 3TINA 4MSUA 3SJBA 1WD5A 3WRYA 1OPXA 4GZLA 3ZYCA 3CYFA 2P5UA 4QQNA 4DGQA 3PUHA 4ZCIA 4UTOA 4Z0PA 1BS2A 2CXOA 1CY6A 4F84A 1R0LA 2A1IA 2OOSA 2W2LD 3O9VA 4R31A 4Z3KA 2NUAA 1EMDA 3PD7A 4W7SA 4R2HA 3IPRA 4QUDA 5DNEA 5FXMA 4EW1A 4CETA 4EARA 1AHNA 3W2EA 2XE8A 2HU5A 2QTVB 1QO0D 1AKVA 2DQ4A 3O91A 4HX5A 5EIFA 4DWVA 3TB4A 3BMQB 2C7QA 1DT3A 5JHGB 1K4YA 3TL3A 3GRYA 1GNTA 4CMGA 5C4IA 4OHRA 5FUVA 4MV7A 4D6YA 3Q3EA 4E46A 3E8XA 5BSHA 1PNQA 1C7FA 2HY7A 1SG6A 1JS1X 2AGVA 3ZLTA 2D5BA 1W1IA 4X3PA 4LUCA 1CKNA 1ELOA 1P2SA 3NGXA 4QYIA 4BMOB 2HSDA 3L1KA 4ZI5A 2EZUA 1SKYB 5LBIA 2P4HX 3FCCA 2J0QA 1UBEA 5DWVA 4BNNA 4OBWA 1EBFA 2FFBA 3EVNA 3A3KA 4X7BA 4RJTA 3PV0A 3PQCA 4YJ3F 3O84A 5THKA 1U9YA 3CMMA 1WDKA 2XE7A 4TZ0A 5BR4A 1Q3HA 3EX7C 3ZXUB 1D4AA 1GLGA 1GRRA 4NBVA 3WSTA 2LKCA 1PL6A 4NNJA 1V1MA 3PSHA 4MJXA 3GAZA 4KIUA 1AKTA 2G83A 4AZ3A 4Q9KA 4BDSA 4OXIA 5T64A 2W4QA 1CQIB 2C2OA 2Q8NA 2W6CX 5LQKA 1X7WA 4KFTA 2QQ0A 1D4ZA 1YFKA 1WVMA 2F3UA 1S2NA 3D3WB 1M67A 2AOXA 5D5PA 4FLMA 4W6QA 5D7NA 1IRXA 4JAVC 3A32A 5CGQB 4B3IA 3FI9A 4TRMA 3ADCA 3ND8A 4XOIA 1CC1S 1D6SA 1QV9A 1P9LA 4LOAA 5D01A 4ZAGA 1ZYUA 3BCSA 5MN4A 1KSFX 2Y6UA 2NYVA 3VVBA 4D0GA 3RSCA 4CGYA 3DS8A 3LT5A 3LPCA 4YK7A 3ABIA 3H5OA 3NBUA 1NKTA 4RK7A 3RASA 4PYJA 4ZK6A 2VJDA 4TTTS 3RAGA 3UUFA 1G5FA 3BWCA 4JGBA 4DHWA 4ZKEA 1CY1A 2YN2A 3HCDA 1AB6A 3AB8A 4GT1A 5E4YA 3TJZA 2ZXUA 3ZLJA 3H1EA 5K03A 2FUNB 3WGIA 3R0QA 1XQ6A 2ZJ7A 1HDYA 1USGA 4U2FA 2VDRB 1KO1A 3MRVA 3GJ4A 4DR7B 2W6JA 3BCHA 2HT6A 4YRIA 1WG8A 4KJZA 2QT1A 1R4NA 3M6XA 4A03A 4U02A 4JELA 1PK7A 1NT4A 1AKYA 2C84A 1RQGA 1UT8A 1E99A 1W581 1V6SA 4CG1A 2D1RA 5AW4A 4CMKA 2W2NA 3GPLA 4BATA 3AR2A 5LXTB 4B4WA 1OF1A 3HP7A 1WSAA 4Q02A 1VLZA 5EHZA 2O8DB 2RKWA 4R5MA 4NC9A 5FFMA 4GOKA 3K1JA 4Y1EA 2FEXA 1JB1A 2GYUA 2YRFA 2V7XA 4IMJB 1MFPA 2YYAA 2YN4A 4YBZA 4YQFA 4I1UA 1DCFA 3KBOA 4KMOA 4FGRA 1QZUA 1Y8AA 3H2JA 2CC2A 1JVBA 1L3CA 1MR3F 1KEUA 2XDWA 3F9IA 1SOVA 3D4NA 4MVJH 5FR1A 1CNMA 2B0JA 2P9CA 3DJYA 4K28A 4MUMA 1WXHA 1RAEA 2C82A 1UP4A 3AU9A 4OI2A 4HLUC 4EQZA 1OXXK 1U2TA 2QUAA 4RHUA 2FFAA 1RBZA 1MQAA 3FPEA 4K6GA 3WL3A 3AEZA 2E9SA 2Y2VA 3PNSA 3A70A 4WESA 2VO1A 4BKQA 3MPUA 1KOFA 3AIOA 1ZN2A 4KK4A 4Y6PA 5ES4B 1KZ7B 4JYZA 1OCEA 2L82A 2DKFA 5B3LA 2CB9A 3ZX5A 2C2KA 3F7TA 5I5EA 4C0WA 2Q3JA 1CUJA 4F6LA 5A5FA 3BGDA 5ILOA 3FHOA 3IUEA 3NHUA 3WKDA 1CS0B 1F1JA 5A6VA 1TK3A 3SHFA 4Z3DA 3V2HA 1V9SA 5BSFA 3CEJA 4NCKA 3EVBA 1BXKA 1IDN1 3WWCA 4DAAA 1AK2A 1T5LA 3SXUA 1SVUA 1SKYE 4G25A 3SKYA 3G2QA 3HBLA 1WKVA 1CUGA 4ZMRA 4CV3A 4FYXA 3KHUA 3NV9A 2O52A 3RU3A 4PO1A 5KJ6A 5B55A 1NE2A 2PXXA 3B2EA 1QHXA 5AP9A 2NNLD 1D6NA 4C0AC 2P9JA 3REOA 2Q49A 3AG6A 4NBWA 4TKZA 5GONB 5TEWA 3L5KA 2VATA 4LC9A 4G85A 3H2IA 1XZAA 4LNAA 5ALFA 4LNUB 4NJEA 4MWCA 5L45A 1FDIA 3DCJA 2BKEA 3OJ0A 1VJ5A 2FR8A 1NP3A 3W1GA 1GEEA 3BIXA 3I58A 4WXEA 3LFTA 4ARAA 4LIPD 1Z2CA 5JBQA 2AJTA 3DPIA 2MT9A 5H82A 4GE0A 2GZ2A 4KYTA 3VI4B 3VZPA 4DIBA 1V7PC 4DSTA 1KYTA 3PGXA 2B4AA 1QYCA 4DQVA 3H9EO 3VR4H 3ELYA 5IM4A 4KLCA 4YRZA 4BGDA 3RC8A 1FYVA 5EMNA 3RSFA 4ACBA 2CKDA 2HREA 1ACLA 4N8EA 3U60B 2FSHA 4OV6B 3TTTA 5HRUA 4US1R 1T1RA 3G59A 4MP3A 4KO4S 4NL4H 3RYTC 4PX9A 4CTKA 4AULA 2GR9A 4HGYA 2OBYA 3TDMA 4BEBA 2LDXA 1H2BA 3GFBA 3PR3A 1R0KA 5F1KA 3R75A 5LMCA 1M7HA 1JG6A 3USES 5J5VA 2HVQA 3G2HA 1X1AA 1ISIA 2IA5A 1JR2A 3MWJA 3TEJA 4ZYYA 5JJKA 1E1NA 2IZZA 4MCJA 1RRPA 4NPAA 3TMYA 1R8XA 1UEXC 3U7QA 1YVEI 2X0SA 3ORYA 2DMRA 3K2BA 4FT2A 5BUSA 3FTEA 1WUHS 1G8MA 2C58A 2IQIA 1X1SA 2WWWA 5DGHA 1QFXA 1GKKA 3BXGA 3GLHA 3HADA 5JIBA 2X9LA 4MIYA 4IGEA 1QNFA 3UCXA 4X3CA 2ERXA 3IILA 3C1UA 4QDTA 2WTBA 2CLDX 1JDBC 3F78A 3WHKA 4J03A 1T9AA 3A4IA 3OLCX 1RZVA 4KZPA 2VRCA 3ZC3A 1LKZA 2ORVA 4U4AA 4XVQA 3LMKA 4PQFA 1GXSA 1T1SA 1HI9A 2X2OA 1DEOA 2H2FA 5DSXA 3SEAA 4DF3A 4CVNA 3AETA 4U7DA 3OQMA 3PDIA 1VA4A 1UPCA 4WDRA 4WPGA 4D3FA 3F6RA 5TV2A 2E5FA 3ZGZA 4QWMA 1JT9A 3PRYA 3UQ8A 1GV1A 2OBBA 2Z5LA 3BUSA 4UCVA 3N2YA 1E9CA 3EXIA 5E2AA 1HE3A 4LFAB 4M1OA 3NVDA 5B58T 4AROA 2AOWA 2GAOA 3K5PA 1HO3A 3B53X 3M8KA 4Y1FA 1GFIA 2G9NA 3ICCA 4E51A 2HDHA 5JY1A 4JVNA 2YUIA 1BROA 5KJFA 5L51A 3M4ZA 2BGLA 1I6LA 1Z6GA 5FORA 1JTVA 4K9NA 1XTBA 1Y3IA 3WGVA 4JEMA 4ZANA 3JS5A 3RREA 4EW2A 1XZKA 2XIJA 5JT1A 1CE8A 1G5QA 4B74A 4YLYA 3COWA 1U0GA 4INJA 2XXBA 2F8LA 3VNNA 3GHHA 1GA1A 1IH8A 5NULA 1DQZA 4RA6A 4B7XA 1JBQA 4EF5A 1QJCA 4OTZA 3ASVA 1FC0A 4TKMA 1LFAA 4R8MA 1JV2B 3C7CB 5JDIC 2P75A 4HDMA 3AHEA 4B85A 1GRVA 2FXVA 1MB2A 4BVHA 1FL9A 3P9XA 3VR0A 1DUVG 1DIGA 1KO7A 3W5OA 2KHZA 4J2TA 4X6XA 5IBQA 1DTWA 3OZVA 2JAQA 1QHEA 1QZXA 3N2NA 1MW9X 3KYDA 1OXBB 4AZTA 3ZDEA 3W0LB 4UXIA 2QL5A 1G6Q1 3EVZA 3G1UA 2PVPA 3QE4A 1JP7A 4DA6A 2Z6AA 3WB1A 3NM5A 4O8CA 1ZKDA 2TMGA 1QYWA 4AJ9A 3O1IC 4P9NA 4F3KA 2JJ2A 1BXGB 2JGDB 2R85A 2PGXA 1P60A 4I4CA 2H2AA 3ZY6A 3WHLA 2FE1A 4DB2A 2PZKA 3QX8A 2COGA 1TO2E 3G8CA 4NYMQ 4DLYA 1WLSA 4XH9B 4CKBB 5EIAA 2QN8A 2IHKA 4Q4HB 1O2DA 1IZYA 4RVOA 3OPYA 1M1YB 3B5IA 2Q3DA 1WV0A 2WIKA 4C5BA 3DWEX 1TKCA 5DBFA 3WRYC 4BYMA 5FYDA 4EPTA 1JYSA 3EAFA 4YRGA 3E3OA 2QSUA 4Q9AA 3CA8A 3HCAA 1RRFA 2NTEA 2JH8A 4JDPA 4IGFA 4N3NA 4DMUB 1UKEA 2X6RA 3UJ9A 5JQGA 4JB2A 3PJEA 2C8LA 2EX1A 1JDPA 2A84A 2EL7A 1TEHA 1Q6ZA 4PYMA 1W29A 1YSCA 3L0CA 4IJVA 5I5SA 2JGFA 4XX1A 2PZFA 1DZIA 2R6CA 1YTUA 2VCEA 1QOZA 3R3SA 2C00A 1THZA 2GF9A 2O1XA 5TXGA 1USUA 5CJJA 1R4ZA 3KCQA 5AVSA 3MWKA 1O0SA 3JQRA 3KE8A 3LL4A 2ZYIA 3QVWA 3TXYA 1PVVA 1QQ6A 4JJ6A 5J1SB 1U9JA 3T3HA 3AM5A 3MA0A 3ZVMA 2NYAA 2JAPA 1QRUA 4UCRA 4MWGA 3L8GA 4ITRC 5L8VA 3MTEA 4M1WA 4WLNA 4FFLA 3KQNA 4ZO7A 4X62B 3EIHA 2VLBA 4C6RA 1M2KA 4QATA 4URYR 5AI4A 5BV1A 3C6MA 2RG7A 4MKXA 5AYVA 4MLCA 2D2VA 2QLMA 3F5SA 3U1BA 4CV0A 1E5QA 2HWUA 4MWBA 3O31A 2NLOA 2PWYA 2HSWA 3CY6A 4Q7QA 5IVKA 1M3SA 1JX6A 1PSDA 5FAXA 2JCVA 1GCGA 2NV0A 4JMPA 4NY1A 1EJ0A 1F0YA 1V71A 5M5BA 2V6JA 2O3RA 1GFSA 1XT6A 4HZIA 4IZHA 3LUHA 3OECA 5J1TB 5SYAA 2IPXA 2J85A 1DFIA 2IUEA 4WE3A 4DRYA 1HA3A 1TD1A 1E6MA 4WCFA 5ED0A 4CNQA 5HKKA 2XD4A 5JISA 4GBGA 1XKLA 2B5OA 1CFJA 5C0OE 1EK6A 1KI3A 2H1CA 1IMOA 5IJZA 1L4GA 2GM9A 2NUPB 1LXCA 1Q7EA 3U17A 4F11A 4FDUA 3WA6A 3QEAZ 4Q9IA 1O97D 3HO6A 3LGAA 2HV8A 3IBSA 3MJCA 4MGKR 1QM5A 5LBUA 3VHLB 3B36A 4EGAA 5EJ7A 1KDZA 1UPXA 3CXUA 3H7IA 4GI5A 3VAYA 5I4BA 1Y6QA 5JS8A 4JL8A 1THMA 3PWTA 1UFVA 4IGKA 3TLKA 1OOEA 1UK8A 3O94A 2D1SA 4I50A 4XVRA 5H9WA 4FFPA 2XT6A 2W2VA 3N2GA 3IP8A 4R6XA 4UHDA 3BQ9A 4TZTA 1KDYA 3EF3A 4UATA 4X61A 4CM1A 2WJYA 4RACA 3D1VA 5AUNB 1IN5A 2GB4A 5LA6F 3G1TA 2BI4A 2XA2A 3UMBA 1MIHA 2JFGA 2ODWA 1JR3A 3VR5D 5MFPA 4PZLA 4OLHA 1VL6A 3I9KA 4HMPA 5LMNB 3UH0A 1H65A 1TJPB 3BAFA 1LSJA 2XDYA 1UZUA 3DP7A 5A5EA 1Q1QA 2Q29A 4N5MA 4Q00A 4R2JA 4TRRA 4UAGA 3FWKA 5EQDA 1X8LA 2Y93A 4LJ8A 4EW6A 2PRJA 4A8HA 3VV2A 4DR4B 4D4KA 1K3FA 1F8YA 2O4UX 4WNAA 3SY8A 3PUYA 3EXEA 3FKJA 2R6JA 3VC3A 4DCCA 1PL7A 3UYYA 5JARA 1EE1A 1ZBQA 2CBGA 2QQGA 1M1YE 3IUYA 4LXIA 2H1VA 3RAJA 3KAQA 3LIIA 1Q0TA 2I5PO 1IVYA 4OK3A 3CLVA 1EP9A 3NFRA 3CEMA 1EM8B 1K89A 3UTCA 1F17A 1T6YA 1Y34E 1GQRA 1UAYA 1QB8A 1C50A 3GFPA 3NH9A 2FPLA 3TKLA 2BHSA 3WLEA 1Z0SA 2JHCA 3GLKA 1RWXA 4N01A 4QYSA 2JHFA 4UKDA 4CLOB 4I1YA 1P19A 1FFWA 1GL7A 2RB4A 2GQRA 1W4BA 2CLKB 4KQFA 3S6JA 2GLXA 2H3EA 2OZPA 3VUFA 4GBMA 4CQJA 1SPBS 1U0EA 4RCZA 3E9MA 5JI2E 1VRCA 2C7PA 2I2DA 1EKXA 1GO2A 1T2UA 5DTIA 2XOKA 1WU7A 3ME5A 3DOCA 4ON9A 2YNMA 4G3XA 1WSWA 2Y8EA 1PLJA 3RUIA 3RAEC 2F67A 5H7XA 2O07A 4NQZA 1WNFA 5TSDA 3SBXA 1WEHA 1ZIDA 3GPDG 2ZT7A 3LF1A 3UAOA 3VV3A 1WBDA 4R0NA 2HK6A 3LWNA 2P2SA 5HCNA 4UE2A 3VNAA 4BDTA 4K9MA 3G68A 2PSFA 2WHPB 3BWYA 1VIYA 2WR8A 1MRSA 4O2AA 4AC9A 2FN7A 5CTJA 1F20A 2VH2A 4GICA 2J9FB 4BO9A 3MJTA 2BE7A 4RETA 2X22A 3CR8A 1FJ2A 1Q0UA 3TG2A 2FR8C 1TCBA 1SIWA 3G2KA 4KDRA 5E4TA 2PX8A 4BECA 1EFUA 2XQFA 4G56A 3OHPA 4DMCA 1BWPA 4RE5A 2Q62A 4DV3B 4O8ZA 5F21A 2I67A 1K3UB 3TQTA 5EZSA 2QL9A 4KX5A 3QP9A 2QQFA 4F38A 2AB0A 2D0DA 3QSGA 5HF9A 1H2EA 1RWPA 2OTCA 3NT4A 4PBRA 3DHEA 2R5WA 5E6RB 5H16A 1NVFA 4LSGA 4AKTA 1FJGB 1O89A 2YTZA 4QEKA 4LF8B 1JHOA 4R40A 4CHGA 3A6DA 3BIWA 4PXYA 4WXMA 2NP7A 4NBUA 2VZ0A 3WIUA 4ZVQA 2OXRA 3O8RA 2QM8A 3DZHA 4DC1A 1ONNA 2NV6A 2ZTVA 2R8YA 5FTKA 2WE8A 3DEIA 4FYHA 4XQGA 1ZLYA 1OC4A 1BE0A 4HR7A 1PGOA 2QRLA 1GCOA 2X0JA 3N2KB 5TMDA 3RSQA 1PR5A 4DIOA 2M98A 4UPDA 4IFIA 4N3BA 2GCGA 2IYPA 4YREA 4K2HA 2BFFA 5DFAA 4AUMA 4QOJA 4DRXB 3AUSA 4WK6A 3V6LA 1Z0ZA 4AZ0B 2ONCA 5I5UA 3KHTA 4WLEA 1THGA 3I9V1 3DFMA 1E9VA 2GEVA 1LF5A 3BFXA 3BRWA 5E6UA 5FFFA 4BGUA 2BR4A 5IAAA 1RHUA 1L4MA 4JOQA 3RT9A 4JX8A 1JB9A 3SFVA 2CFRA 1LS1A 2H51A 2W2LA 2WC1A 1LTHR 1N1DA 2ZU0C 4PLWA 2WWYA 4ZRMA 5CA0B 3K7EA 3VOAA 2A5LA 1O77A 1LWNA 2YFKA 3LXRA 4M9XA 4EG6A 4E3WA 1QO0A 2DABA 2QQ5A 3BORA 2VDQB 3H5RA 4LHEA 3MTBA 2V7BA 5IXJA 3H2GA 5LYJB 1UIRA 1W4AA 2MYNA 4FBLA 2AJDA 3T3GA 3H5AA 4G97A 5AJTA 3AEQB 4Z5XA 4US0R 3ASUA 1BQ4A 2DKOA 3D7LA 3SHVA 2F17A 4J43A 4BZZA 4EK9A 4JC5A 5IMSA 3WLHA 4YP0A 2D4AA 4MKFA 2QENA 3ZQKA 3H2YA 1M2OB 1H6DA 4FQ8A 1SUBA 3IV7A 4FJ0A 1U98A 2HHFB 2G6BA 4FMDB 4YAEA 3D6VA 5IKOA 4E5YA 2BBTA 2EEZA 3B1ZA 3KYHC 2R86A 2WNIA 2F43B 3AFNA 3E7PA 1EDZA 2OD2A 3HWRA 3OMXA 1EAYA 3IKLA 2J7PD 2A4MA 2JFVA 4TUYA 5AI0A 4DLTA 2BGWA 1ZM4A 1I51A 3KPYA 3MXTA 1I2DA 5G1PA 2NADA 3RB8A 4P4TA 2OCDA 3DTFA 3DLCA 2PS9A 4UJ5A 2CUKA 5DWDA 4KNYA 4ANFA 3P4UA 3SICE 3T5CA 4B47A 4GPZA 2CXTA 2XUKA 3KAKA 4UUMA 4W63A 1BJTA 2FQWA 4RGYA 5DJ5A 1GGFA 3TLAA 2AMVA 1IPFA 4JI6B 1YQQA 5WRFA 4WUVA 3N0VA 2H48A 2H18A 3KZCA 1JZTA 2YJTD 1MXFA 3AI2A 4YUZA 2W5UA 3W9YA 4C4PA 3ZS9A 3GWZA 3HQ4O 1EI9A 4KYVA 1P33A 3H2ZA 3Q87B 4RQBA 2ZK7A 1RCTE 5KAMA 1F3OA 3T0IA 3NTUA 4JJKA 3G0BA 3GD7A 4PFJA 1AHIA 3QEMA 3UHAA 4CCSA 4CIAA 3KSBC 5C8VA 4H7IA 4EJ6A 2VPQA 4ER0A 5HA5A 1NBEA 3DONA 3AJ8A 3N07A 4F1JA 1ECFA 3FF4A 1T9GS 1TEVA 1P2GA 1Y5RA 4FZJA 2ONJA 5IS2A 1EFHA 4ZAZA 4K05A 5FT9A 2FVYA 1ZR4A 2JFNA 4UDXX 4IKEA 4H1TA 4PYIA 3I8OA 3CJQA 3W7BA 3WL6A 3QFRA 4HNAB 4RIEA 1ADGA 4BO4A 1Q74A 4R98A 4POOA 4AS3A 1FZTA 4BFLA 1AE1A 1H3FA 1OBOA 3PQ5A 4ZOLA 5B12A 2Y9MB 1GR1A 4QUBA 5DULA 4ONEA 3ZKWB 3DVQX 2MINB 3A3NA 3LULA 1NULA 3PZRA 4ZCSA 1XJCA 3V7YA 1D2CA 2IDJA 2NUTB 4PHGA 1GGKA 3S24A 4ZVLA 2X8JB 2Q6KA 5JG7A 2IC5A 2QD1A 2WNHA 4XSVA 5K8IA 2W6ID 1KO4A 4LXUA 5HQTA 1K7XB 2WQZA 3MS2A 5IWAB 3G7UA 3IT1A 3CVWA 4R4JA 1P7PA 3DMHA 4MQFA 1F8UA 4LS3A 1H4VB 3IBCA 1ZD8A 1FLDA 2AUNA 3T1TA 4MUAA 2BEUA 4PO3X 4C7XA 3H7AA 1BAPA 4HNUA 3AF5A 5BV2P 1K9SA 4CG0A 4M1MA 4YGYA 4QASA 4ZEWA 1P5RA 2QP3A 2OUKA 2ZSEA 1RFLA 4HLQB 2PGAA 1P6UA 3H2SA 1MOPA 4O7LA 2LR0A 3EOZA 3TPFA 5C5IA 4HH3C 1ZL0A 3U6BA 2QRUA 5IZCC 3DL2A 5E0OA 5TMEA 5EWLA 2QRVA 5JS1A 1VJGA 3NWEA 3VMFA 5KIAA 2YQ4A 1A7UA 3EZGA 3GDEA 3BD8A 4HDOB 2J5XA 5TS2A 4CIWA 4RV4A 2PCLA 1E9AA 4ABYA 4D8XA 2PUEA 1F4PA 4G0VA 4YMLA 1P4HA 1D2NA 3ICQB 1QIGA 3AEUB 1ZUHA 3E61A 3KLBA 4K8OA 4PAOA 1X15A 4WY5A 5DYIA 1VP9A 1V8OA 1A7AA 3BZUA 2CJWB 2PO5A 2RG1A 3HL4A 3MRSA 2SKCA 1T2CA 4AY4A 3RFFA 5HIIA 2JIOA 3O90A 4BLOA 1QG2A 2UYQA 4YRJA 5KBYA 2OYRA 4DTIA 3IIIA 1VHQA 2BFWA 3G02A 1QLWA 4ZPXA 2VH1A 2XXAB 4IWNA 2JRLA 4TV8B 1WW3A 4OHZA 4PX3A 3TZCA 3ZUGA 1IDOA 1J7KA 5IJ0A 2C9CA 4FFVA 1QQBA 1R6XA 4YMSA 1GCIA 4MICA 4RF5A 3OD1A 1IN1A 3C3CA 3IODA 3DWIA 4P3XA 5IMBA 3FAZA 4UCUA 4M86A 3W2IA 3ZXSA 5HHTA 1J1UA 1H3NA 4IV0A 2WUFA 4DLWA 4UM9B 3ZWDA 3NAZA 5P8WA 3ER6A 3G0IA 3DXYA 2QX6A 3ETHA 2AKEA 3U09A 2ZBVA 1SC6A 1XNHA 1AMOA 3AVQA 3T9DA 3KT6A 5BSVA 1HURA 4PF1A 2ZSJA 4FJ1A 3OM9A 1Q1NA 1FBNA 1II8B 1Z62A 3V2GA 1FRNA 2H54A 2R4TA 2AEJA 3D6NB 4G23A 1YI0A 5C8YA 1JL3A 4G0OA 4BMCA 4G1MB 4EH1A 2HPAA 4XGRA 1BCSA 4I0WB 4J0QA 2VBCA 1HKUA 3BHNA 4JROA 3UHOA 5G1OA 3WDKA 4NENA 4QKQA 3EARA 5NLLA 5L9AA 4MCHA 2VSFA 3GROA 2DLCX 3L18A 2JARA 4QUEA 4EYGA 4WWHA 2WZDA 2Z04A 2I1QA 3E9DA 4PZEA 3ZIAA 3DQPA 4RVNA 5DGDA 1OV6A 4IIHA 3P8ZA 4U1RA 4WOPA 4YY3B 4GLWA 2D2XA 2JCYA 2P4QA 2Y77A 4FGZA 4HF7A 4K3UA 3V4RA 3ED5A 4ZU3A 1DRWA 3OPXA 3PGKA 3V8MA 4OMCA 1GNVA 1C4WA 1CRLA 1ZD1A 4MJLA 1FYFA 4G9GA 4AT1A 5B1HA 1F2UB 4YQZA 3HHPA 3RUCA 2G71A 1GNRA 1YK0A 1QKIA 1E9RA 4BWYA 1YO6A 4NE9A 3GCZA 2OMKA 2QPAA 4H08A 2H1HA 4HH1A 5DX0A 3RHSA 2XEDA 4R2IA 3HE3A 1XQXA 3V8BA 5BVHB 5K6AA 3ZXIA 3QLVA 4EA8A 4U2CA 2YNMC 1I2ZA 1P9RA 1XI2A 2KI5A 1NVBA 2HCRA 1SCDA 3BILA 3F49S 3K8YA 3QPWA 4K6OA 4OKNA 3VNBA 5H80A 3QYPA 4DJJA 1QUFA 2PSSA 1VTKA 1H3EA 1IQPA 3DC2A 3DW3X 2YWBA 4Q3LA 1XL0A 4XE5A 4DC9A 1XQ1A 4UUQA 5KVSA 1IZ7A 4NMHA 5HZGA 3C4JA 5ULLA 3L7AA 1C8KA 4CI9A 2QTNA 2YWJA 5FUYA 2WNSA 4UZFA 1JRLA 1NJFA 3I3SR 3TBHA 4EGFA 2F64A 1CF4A 1K6XA 5ALNA 3BZBA 1EZ4A 2Z8XA 1O96A 2VF8A 4JUBA 3DCYA 2OG1A 4LDJA 1QR6A 1XKQA 2F00A 3F6PA 4H35A 5LDGA 5KKCA 3QYJA 4X97A 2C42A 3IESA 1UKYA 3ZTWA 4FYVA 1TYEB 3IA7A 4PC7A 3ROQA 2KB0A 4RY9A 4XTCS 4GX5A 2RFLA 4CQNA 1HTWA 5JD4A 2G5GX 3MN1A 3KFXA 1WPXA 1NXQA 2GN2A 3DDNA 1RC0A 3LE8A 3F0TA 3BFJA 5EE5B 3RD5A 3NDRA 1VQ1A 2JGNA 3P4XA 4IPTA 3ZV7A 3DAAA 4UCXA 4BQPA 4DBLC 3A1EA 1GNQA 2I1LA 3E84A 1SVLA 2ISQA 3RS5A 1Z6PA 3ORQA 4M3NA 3RS8A 3CZCA 4IDOA 1WDMA 4J4BA 1Y5MA 1Q50A 3CB4A 4EJMA 2JKYA 1DV1A 5KAPA 3TZ6A 2AG6A 2PA3A 3OOJA 4ZDJA 1I1MA 2BEWB 2D7DA 2IY7A 1LEHA 4UQLA 1IJFA 4REQB 2XYQA 1KI1A 4G4IA 1N6OA 2VOEA 4MUKA 2O8BA 1HT3A 2OXCA 3KVNA 4E33A 3M6AA 2W8ZA 1NMQA 3A04A 1E7RA 2MTBA 3BKWA 2IUFA 5HKLA 4C1BA 1XDUA 1ZI8A 2JGLA 3IEMA 4TN5A 3I01A 1KEEB 4CWAA 1Y5NA 1CK4A 5EERA 2QHXA 4FLFA 4NFSA 4B4KA 1U2DA 3MCAA 2X41A 5IW8A 5I7VA 5JWRA 1KEKA 3TW4A 4D9HA 1E3QA 2UZ0A 2ZB2A 4JI2B 2AN1A 2Z4TA 5BRNA 1P81A 5FTMA 4A6DA 3O8CA 3DV9A 1PD0A 1PS0A 5HS6A 8AT1A 4BJHB 3HBJA 4XJTA 4GOXA 4ER7A 3SKVA 2R8PA 2PE5A 1GUFA 1E69A 1ZQ1A 2ZOSA 4NV0A 4UNSA 5T6BA 5KOIA 2RDMA 3F98A 1RJ9A 1UDBA 2D3TA 4DSZA 2RH9B 4X94A 2B8JA 4PSCA 2O8CB 4LYGA 4QUGA 1K8YB 5FJIA 1BRMA 3PT5A 5C1BA 4OQDA 1TGVA 1YZTA 5JNWA 2F9FA 5ALEA 1QXSA 2HIMA 2IHJA 2ZIUB 3C3BA 1A97A 5FBZA 5FPHA 3SS9X 3TOVA 3HDVA 2ZIGA 1EK1A 3UCEA 3VR6H 3E4DA 1SWVA 4P84A 4YROA 4JI7B 3G5UA 2QJRA 1PK9A 3EFEA 1QNLA 2LIPA 2NO7A 3D02A 2ZWOA 3IERA 2NZ8A 1I8TA 2W6QA 3JAWA 2Q4DA 3M1AA 5DLQC 2YV4A 5B7GA 5F3WB 1I80A 2ZGVA 3PIIA 1JQAA 4MVJM 2HN9A 3EDOA 1BHSA 3MJ4A 5E9JA 2SKEA 4F3RA 5JNUA 3ANYB 1HT0A 2CZGA 3PXAA 5AHXA 5CAEB 1NPYA 3K6KA 3E7WA 3HB7A 2J5QA 3CQ9A 1SC1A 1X3SA 5JH7B 2ID8A 5SYMA 1NC3A 3GAFA 1RYZA 3BAZA 2CF6A 1P77A 3IA2A 3B38A 1MA3A 4K9RA 5HIKA 1JAHA 4C21A 5IDQA 2V6GA 2X3UA 4EELA 1XV5A 2ERCA 1T3SA 3L8EA 4NH4A 1K6EA 1YB1A 2O0JA 5IT4A 2FEOA 1I32A 1CUUA 4I99A 4EX6A 1RFGE 1M34E 4WKGA 1ZZEA 1DINA 1E66A 5JCXA 2P0AA 2NO5A 3C7TA 4QOFA 1RAHA 5CHEA 3B3GA 1KXJA 2CMHA 2A2ZA 2DH5A 3KFVA 4EYOA 2P79A 2WU0A 4LQDA 3ZTYA 2V1UA 1MIOB 2WD8A 3FROA 5L3QA 5FYQA 2IYLD 4L2IB 5ALQA 4PAMA 5CFRA 4TLCA 4BB9A 3LHDA 5CXQA 2WF6A 2PD3A 1P3DA 2YC4C 1YHNA 2B37A 3FDFA 3UMCA 2DQZA 3E82A 5SZIA 5DHAA 4IM7A 4E03A 2DRIA 2VF5X 4Y2TA 1KQNA 1XLWA 5B64A 2AD5A 4QPNA 3MAGA 1ZNQO 4R71A 3KYCB 1ZRHA 2Y68A 3UBTA 4QDOA 3VR5A 2F48A 1QF7A 1VHJA 3GR6A 1OZAA 1G8HA 2ZBDA 2I99A 5C81A 1EJBA 4UUBA 5ALIA 2JAOA 1PV4A 4N76A 4OM7A 2GYWA 1FP7A 5E1DA 1JDBB 3EOBI 2IYXA 2XZTA 4YHHB 5AH0A 3TOSA 1C3LA 4E6EA 1C30A 4RTKA 1F60A 2E5WA 4P7KA 5KHLB 5AOCA 4ZFNA 1W0JD 5HZKA 3TTYA 1SO8A 5E2IA 4G5FA 4MIOA 3SYNA 3OOSA 4RHEA 1PF7E 2WVAA 3VBEA 4CN9A 4PZ9A 2CXSA 4MB2A 2PN1A 1DP4A 3A1CA 2RH8A 4MULA 2Y71A 8ATCA 4BU0A 3IT3A 2X5KO 3RHFA 2QRZA 1IAVA 3NH6A 4BNZA 1RE0A 1F0PA 1G8AA 1N0VC 1X9IA 2CJFA 2QXYA 3EDRA 3QBTA 1UC9A 1OBVA 4XX0A 1SCQA 3HA5A 2VP6A 4H77A 4D81A 4U5XA 2DFNA 2EV9A 1EH5A 2PWZA 3MJSA 4V2UA 1OT5A 4WKBA 4KPUA 4BUCA 4C78A 3LKDA 1OLUB 2R1TB 2WAYA 3ZHYA 1T2FA 4R2XA 1XLUA 5EMKA 5BOVA 5BYBA 1HY3A 4F2PA 1S01A 5K3SA 4NXNB 4B4UA 1PT8A 1RWOA 2OPHA 4J9UE 4OLFA 4ND8A 4B3FX 3GJ5A 2NQ2C 2ZUUA 4U2KA 4PZUA 5D1HA 2V9CA 1M2VA 1Q6YA 2YICA 4LRWA 4PTZA 1HMYA 1W5TA 1QCZA 2WFMA 3IC5A 3WI7A 3X1WA 5FB3A 4ZVNA 4B0OA 3T5GA 1EINA 2ZTLA 3AW9A 4ADSG 2IYYA 4OXKA 1KBQA 2VXBA 1WPQA 5IT5A 3ZD7A 4V0OA 1IN8A 1GU7A 1XVUA 2LXNA 4C6SA 1GZ3A 2WUDA 2DBVO 2VPXA 5LXTF 5LP6F 1ZVQA 2XGMA 1JG2A 3A9SA 2WWXA 3PE3A 5IKPA 3MPOA 2W58A 1PWHA 1L7XA 3PF8A 2QRQA 3GEEA 2WJPA 5B4TA 4O0MA 4DMMA 4QFBA 1N36B 3I5XA 4DILA 1XTJA 1UOPA 2RE8A 1KEWA 2PU5A 2GJSA 4OHOA 4J16A 1DELA 3HXQA 1JKXA 3EH1A 1KJNA 2FPPA 3EIEA 5ITWA 5JYBA 1ZFNA 3IKJA 1L5YA 1B1CA 1MV8A 3RSLA 2W83A 3HKDB 2C8VA 2PRZA 2X40A 1Y1RA 2UUAB 2QPTA 2RJNA 1B8VA 1W73A 2I3AA 1TE2A 4V1CI 4I9GA 5IANA 2DWQA 3NJRA 3Q72A 3S68A 3TIFA 2VXYA 3MMPA 3GLUA 4KTVE 4BV9A 4KP7A 1P45A 2WFLB 3HB0A 1KAMA 2XXJA 2YZKA 3UV6A 4JJAA 1L4NA 5JDCA 1IZ8A 3MT0A 1CRQA 1E2PA 2BEVB 2YQ5A 3F4BA 4FOLA 4HDRB 4GZ3A 2PX5A 4TKLA 2G76A 4W9NC 2R8XA 5FI3A 1ESEA 5HRCA 1NBMA 2QUHA 2UVPA 3QWFA 1A9ZA 5EL0A 3UJNA 3WBFA 5AHRA 1Q84A 2NQ8A 4URWR 1HDXA 1SUEA 3PX7A 621PA 121PA 4YT2A 4CF4A 2A0YA 5SY4A 1C8VB 3ZCPA 4F4IA 4JI4B 2DUMA 4FYMA 3GA0A 3AI7A 1D6JA 1VMEA 2E7ZA 3P4YA 3HDJA 2B8WA 1T4BA 4MWEA 5EE9A 2V5VA 3T0GA 2K6GA 3IJRA 1J06A 1OU4A 2ICAA 4MHOA 5E7JA 4ZU1X 4DPLA 2P9FA 5L4LA 3I8XA 3P32A 3AIMA 2GZDA 1U8AA 3KELA 4HDQB 3T41A 1UFRA 1XTVA 4XQEA 1TCAA 3LZ6A 5KWJA 1CKNB 1F6BA 4QYIB 2WHRA 3IMKA 4HB3A 5GONF 3VHRA 1ORDA 4TT3A 1WXGA 2VHEA 2WKSA 1L5KA 3A58B 4IEFB 4FHCA 4MV0A 1AXRA 4YB8A 3ZDQA 1Z63A 2AG1A 2C1ZA 5FOWA 5E9QA 1KVSA 1QHNA 4EEXA 1FUUA 2BGTA 3AHIA 3KT3A 3B1JA 2I91A 1DXOA 2IUYA 3N2IA 4YI5A 4JCOA 1OYVA 1M5TA 1RXYA 4J49A 1C14A 4XI9A 1DBRA 3ABRB 3PS9A 3QKWA 2IEYA 3GB8B 1XP5A 3QLVC 4M2LA 1I4WA 4XOUA 5C35A 3LPAA 5K6AC 2E4AA 2B3TA 3SYKA 3FCUB 2GEUA 4KVFA 3WO1A 4TN1A 3UM9A 2N46A 4E09A 5CFMA 1QU2A 1V1MB 4P0PB 3Q85A 2CLFB 1E4YA 2ZE6A 1BMQA 3OX3A 1Z6TA 3WGZA 1MH9A 4JX9A 4EYKA 1KC3A 3KYIB 1ULAA 2MSWA 4O2RA 4UUOA 3RRYA 4PAGA 1KRHA 2PUVA 1BKYA 3NR2A 1OJ7A 4DY4A 1X7WB 4DA4A 3D7RA 5IVDA 1YDHA 3A2NA 4IQFA 4MDFA 2R8RA 4D5GA 5A4DA 1GPH1 4TKVA 3OQBA 5EJFA 3IR6A 1JAYA 1HUQA 4OD0A 3ODGA 4R2WA 2J7PA 1PYOA 3OY2A 4N5LA 4F2HA 4MUBA 2LZ0A 2ZREA 2VJBA 4INPA 2CSUA 2VSQA 1E7QA 1V9LA 1IY2A 3DTYA 5CNJA 4YAIA 4IOKA 4KQMA 2YS7A 1G6KA 1B0PA 2C2XA 4HGOA 2WU1A 2VBGA 2VZ9A 2EOAA 5DKFA 1WETA 4YGXB 2J0EA 5HFJA 2GNOA 1T9CA 5LJIA 2C2HA 2OLKA 1TRHA 4YP5A 4GXRA 3RC7A 2XECA 4NWIA 4JI1B 4YMUA 3ZCVA 5BYKA 2ZRHA 2CNQA 4JUDX 4XA8A 2GLTA 4TYQA 5FUMA 3EXFA 1IJBA 1KWGA 1E60A 1I1OA 2PT7A 4NH0A 4BP1A 4BV8A 4X71A 1M7GA 5AXAA 1XMSA 5ALHA 3VYSB 2GKSA 2CL7X 5C7IO 1JWBB 2FW0A 4FT4A 3P71T 4MEAA 5H5JA 5CIWA 5IUKC 2FA9A 1QCYA 2CEKA 2FH5B 3IS3A 3WZLA 1RRMA 5A9RA 4DXAA 1C3OB 2K7FA 4IDFA 4OIFA 1FVIA 5CB4A 4YJ2A 1U1DA 2QRJA 4ACAA 1KYYA 3LLVA 1Z35A 4RTOA 1VXRA 1S8FA 2BHNA 4GAEA 3STHA 4GR9A 4JT2A 3AVUA 4Y0NA 3L4SO 3PHIA 3DYBA 3ROKA 2X4DA 3ZU2A 8ADHA 2IIQA 5MDHA 1MLDA 4DDTA 2XI4A 1T15A 3YASA 3ANMA 5AKGA 4FONA 4PM4A 4ZJZA 1CYDA 1S7CA 1VMDA 2H92A 4UBJA 1E1CA 3ETEA 3G2PA 3A6LA 5AFSA 4IIJF 3T4EA 4OQEA 2O20A 2BHTA 4HEA6 4MVCA 2PSEA 3H9CA 5IM5A 3RBXA 5AHWA 1GN8A 3W6PA 4C4AA 2II6A 5I7AA 3WLAA 4I1OA 2OB1A 2VC2B 4BJ5A 5CFZA 5K7SA 4M9RA 5HS4A 2WZCA 4IJUA 3SMVA 4MV4A 1QK3A 3NBMA 1QQ7A 5TY0A 4ENRA 5GZ6A 4NSNA 1KZGB 1XCPA 3ML1A 1PR2A 2F2TA 3V80A 2W6IA 4C2BA 2GXAA 1DAAA 1KAQA 2XQKA 3LSYA 3AHDA 4JSRA 5I7UA 3C43A 3EN0A 4U7TB 3THXA 3T4XA 1QRTA 1LBHA 2HH9A 4QOEA 3H19A 5FRDA 1CIPA 2I3BA 3OURA 3CHYA 4KR7A 2PR2A 4G1BA 2JRCA 1K06A 1DAFA 4TVOA 3RK4A 5JCOA 2C8JA 2QUKA 4LHYA 4BNTA 5IJ9A 2RHCA 1NTRA 2J3IA 3T7AA 2BMEA 3SXUB 1JHRA 3QUAA 1TW2A 4QRDA 4A5SA 4WOKA 2DZDA 1DOHA 1L7EA 3LQKA 4MMXB 2OHFA 3WA7A 3M3DA 4WI1A 4AUKA 1VSTA 4CV1A 4B75A 1H2XA 1QYDA 3OZTA 4UZEA 1EXVA 1ZIYA 2R6FA 1VBNA 3TOCA 2HHJA 2HV9A 4I08A 1R66A 4KXFB 3UMSA 2BP7B 3DMTA 4EG7A 1WRBA 3PHCA 3UC5A 2CYAA 1HDCA 1G8SA 2QMQA 2IXBA 2M6RA 2QZJA 5DGIA 3B3QA 4LNHA 3WWDA 1SB9A 2CNOA 2FRDA 4XIIA 3L04A 3RC1A 3VQTA 5A9SA 4JN6B 1ZHOA 3I1JA 3OM1A 2R4QA 3C3XA 3VJKA 3V2UA 3IDSA 2ZEJA 1N0HA 4R7GA 4H6PA 1N9KA 2PG3A 3DW1X 1G6OA 2EZTA 3CLUC 4QBFA 4WEQA 1K08A 1ZW1A 2FHSA 3AF2A 3R3UA 4U2BA 5CH8A 1I2AA 2QROA 2RIRA 2HSEA 2CLEB 1X70A 3FWPA 3KJGA 4PYKA 3TDKA 4GNRA 1LX6A 4L8FA 9LDTA 3D8TA 4CM8A 1TUGA 1VCHA 2LCQA 4AJ1A 5B57C 3ZY4A 1CVLA 3CKKA 3HM2A 3WLJA 2E4ZA 4CMAA 2WB2A 1U7PA 4MVWA 1IYZA 1KZ1A 5FAKA 4F8JA 3LWZA 4D8UA 4UUGA 4OSOA 5DF1A 5KVCA 4M99A 4DLKA 1ULUA 1EBUA 3U7QB 3VSDA 2IEBA 5ALJA 1QGYA 2BTEA 2XJ9A 1N8SA 4N0QA 3T38A 1O57A 3GMSA 1NNI1 3GLHB 4D74A 4ZO9A 3QTTA 2GCOA 2NZ2A 3I04A 4KQCA 2KJQA 2POQX 4TLMB 2BN4A 2ESRA 2VWGA 3ONNA 5KYTA 3E2PA 1OXTA 5FPKA 2D13A 1FFGA 3M4XA 2PSJA 4XYLB 1EUDA 1GXSB 1PEKE 4Z1MA 2PV0A 2WT8A 3AETB 3D4BA 2VDMB 2FN4A 1Z6AA 3ELWA 3PL1A 3TTSA 3PDIB 3WIOA 3MLEA 2VNIA 1X1RA 2MOKA 4IR7A 2EGGA 3V1TC 2PUHA 2ATXA 4KGDA 3GH1A 4B3SB 4OUKX 4TL7A 1KUTA 1YOVB 5D5QA 1XVVA 5JV5A 1U9ZA 5DASA 1FUIA 4QULA 2RGNC 2A5YB 3KB6A 5CCBA 2ZZMA 3H87A 4RW0A 2VJLA 4MAMA 3ICPA 1YRBA 2D2IA 2Q1XA 1O0CA 3GGPA 1UJ2A 2ZJBA 3TW6A 3VOTA 1COWD 3L6CA 4RMGA 3X1ZA 1W88B 4BO3A 4YYZA 3ZYZA 5JR3A 2AEFA 2XPCA 3E5HA 2NMVA 1CYEA 3MCWA 1ZSNA 4G2TA 5G0WA 4GX2A 4I5DA 2X0EA 3CLSD 3ZCQA 2XADA 4MZDA 5HQJA 2CHQA 1YQEA 1CE8B 1GAEO 3LGXA 1A77A 5AHKA 3IIKA 2HWXA 1CJVC 2WW8A 2H6EA 1FNBA 1ZMXA 4RA6B 3H6HA 1RRVA 1QHGA 3V1MA 3UTDA 4INAA 1WZEA 4LMRA 1NLFA 1T8WA 4Z9AA 4FW8A 7GPBA 4JUAA 1E1RD 3HCBA 5AW1A 1S4MA 2EHJA 5BWBA 1AKUA 5IDWA 4EYEA 1JYFA 3H3FA 3O8NA 1PQUA 1RYEA 1WCWA 4B9AA 3FTPA 1A7JA 5JJ5A 1DTWB 4GPAA 1OLSA 1DE0A 3CRZA 4DDMA 3KYDB 1FRZA 3Q3JB 1ISGA 2QG4A 4Q4JA 4FX2A 3S2GA 2IKSA 4FSHA 2HIVA 2HUPA 2O1EA 4MYUA 2HFKA 2Y1OA 3C1OA 4G9EA 3U81A 3UMVA 5F3RA 1XCLA 2OCPA 3VGPA 5KSWB 1PFUA 1RI3A 3VYUB 1WTCA 3K4HA 3E3MA 2N0SA 3KPWA 4GYJA 1NF9A 4LRQA 4XB1A 5FPQA 3HDYA 4KH1A 4XB2A 3KVOA 1C9KA 3HA2A 3GDFA 1NR1A 3JYHA 4N6NA 2HHHB 1NNEA 2CV1A 3TYXA 1H42A 4LJSA 1PDOA 4OO3A 4AJPA 4F8YA 4BL5A 3F96A 1WIWA 3CLKA 4E4YA 1ZISA 2ZYTX 3RBVA 3C98A 3NJ4A 3NTLA 2JLYA 3OPYB 2H1OA 1BS9A 4CT4B 4HY3A 3AMVA 1JKJA 3RIXA 3RWOA 3ON5A 3OX2A 4BGIA 4W7HA 4DXDA 3GCGA 3TR0A 1D4OA 5FTLA 4Z8XA 1OR8A 3R7AA 2BW0A 3LUDA 2VH5R 1ZA2A 2HYIC 1H2ZA 4LN1A 1FLVA 3AHJA 4RJIA 1WXDA 1TT7A 1O0BA 2PMCA 4MINA 1P3JA 1WVGA 3H65A 3G88A 3IQFA 4IRUB 4YDHB 3O0TA 4IF4A 1QPBA 4FGLA 3LA8A 5HPYB 1FQOA