5JQHC

Structure of beta2 adrenoceptor bound to carazolol and inactive-state stabilizing nanobody, nb60
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
120
structure length
120
Chain Sequence
b'QVQLQESGGGLVQAGGSLRLSCAASGSIFSLNDMGWYRQAPGKLRELVAAITSGGSTKYADSVKGRFTISRDNAKNTVYLQMNSLKAEDTAVYYCNAKVAGTFSIYDYWGQGTQVTVSSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endolysin,Beta-2 adrenergic receptor
molecule tags Signaling protein, hydrolase/inhibitor
source organism Enterobacteria phage t4
publication title Allosteric nanobodies reveal the dynamic range and diverse mechanisms of G-protein-coupled receptor activation.
pubmed doi rcsb
total genus 23
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jqhC00
3UZQA 1I1RA 3OB0K 1WWAX 3CVIL 5AD0A 4LSSH 3OAUL 3EHBD 4N5UA 1XF5B 1FE8H 3GSWB 5DI8A 1H3XA 1EJOL 5FDWA 1KBGL 3MJ9A 1X3DA 3AS0A 1CDHA 4M7LH 4PJAB 3RDTA 3VI4F 3STLB 4YR6A 3QQ4B 1MHPL 4M93B 3OAZH 4PJDA 1WIPA 2FX9H 5SX4I 2BVQB 2OSLB 5JPMB 3MNVA 4C56B 3GMLA 4QRQA 1PG7H 2CKBL 4HUUA 1JGLH 5CBEA 4RMRA 5E2TL 1I75A 1NGWB 3ARFD 1MOEA 1K3IA 2I25N 3GDBA 5J1AA 1CD8A 3KPSB 4YHYB 5AZEH 3BJLA 4WDIA 4F7CB 4P4KC 3BMVA 1LE5B 4YAQB 4NZRL 2UY7A 2E7CA 2XYCA 5C3LD 4QTHA 3U7AA 4E5XA 3C60C 5FYJE 1JNJA 1GOFA 4X9HA 3A0OA 2NY4B 4K3EH 3G5ZB 3MZTA 4EDXB 5M7QA 4HZAA 1NANI 5E95B 4Z9KB 5D93B 1WGOA 5KVEL 1U91B 4NQED 1RUML 4NSKA 3MO1B 2J3SA 2X9YA 2IPTH 5BCAA 2DQJL 1H3WM 3VXRE 3L6FB 2R15A 2PXYA 3HNVH 3WFCL 1DBKH 4O51A 5F7DA 4HUXA 1CN4A 2BERA 4JRYA 3LDBC 1WBYB 1XGYH 5IVXF 4B5EA 1MFDH 3G6JF 5E5MA 4NN5B 2MCPH 4F57H 1LE9A 1U8PB 2AV7B 3ZT7A 4BZYA 3VXQB 5GGQL 4XGZA 2Q6WA 3SHSA 5CJXC 5I66B 4EDWH 3VFTA 2P43B 1ZXQA 2PO6B 5EO0B 1VENA 5A40E 3TIEB 4PJ9D 3TV3L 2K9UA 5FYKD 4QCIB 1S7TB 4GRMB 4K94H 5C6TL 2EDEA 4FZ8H 3UTTA 3WO4B 4X99B 3PP3K 4ZUVB 1AY1L 5FGCB 1LEIB 3HE7D 4GJTB 1MEXL 5C0IB 2GTWB 4LLWA 4LSPL 3D9AH 5DUBA 3MLUL 5EUKA 4ESKA 5FYKU 3QHZL 4LQFH 1X4XA 1P6FA 5DXWA 5FYLH 4DVRL 5BRZE 2HFFB 4JKKA 4TPRL 3HC4L 5KVEH 1FNSH 2F53D 2DL9A 5DO2C 1R5VA 3QZWA 3WFBH 1N0LA 3WFDH 5ENWB 1F11A 2JCCE 3OKEA 5GS1C 4Y5XA 1ITBB 2V2WB 4MD0A 4YHIB 3DXAA 4QXTB 3SQBA 1YUHB 3PV6A 1UB5B 2XFXA 5I9QC 3NABL 4K8RH 1YEEH 5D5MA 5HDQL 4OZIE 1FFOB 3WN5C 1XCQB 2XA8L 5CUSL 4GKOA 4OIAA 2J8OA 5DJ0B 2VLJA 2H26A 4W6XB 1EO8L 2ARWA 2FATL 3MOBH 3JUYA 1DN2A 4LOUC 2HG5A 4E41B 2DM7A 4R2GC 1JE6A 2D9CA 3GUTA 5SWZB 2XKSA 4MXWL 1DBJH 1IGJB 1WTGT 4NM8H 4JFFD 3U4EA 3GGWA 4X4ZA 1OCWH 3HFML 1S7QB 4LCUA 4S1SH 1A6UH 4L8BA 3QEQD 4I0CC 1B4RA 2MQ3A 3KPRD 4J3XA 3DVGA 1N7ML 2P8MA 2J8UE 3HNTH 1EK3A 2Z93B 2XZCH 3LPFA 2F8VA 4PJ7E 1X7QB 4XMKL 5I18L 12E8L 4Q0XH 1BD2D 3CFDB 2WBJD 4G42B 3BKCL 5IW1A 1CXLA 5B21A 5C0NC 1UM5H 5J1SC 3NAAH 4OLWH 2EDHA 2YUWA 4R96B 1A7RH 1F4YL 3V95A 2EYSA 3N1MC 2P5ED 3B4NA 3IAPA 4OIIH 4ETQB 1M7XA 2F5AH 2CKBB 1F8TH 4Y8DC 3WEXB 2OP4L 5H8DA 4KDTA 5HHVH 2XPGB 2FGWL 3E6FA 1FBIL 4U6YB 5E1AA 4GG6B 2PKDA 4N0YL 1QYGL 4KXZH 2SEBB 2QR0A 3BIAX 4P9HL 1NMBL 4HS8H 4GAFB 5JPNB 3TYGL 2JIXD 4HKBA 3MRJB 3J8F7 1FNGB 3ULSA 1NPUA 2O5YL 4L4TB 1MUJA 4WCYH 1LWRA 4D0CB 3EJYC 1W0WB 3PGCA 1F4WH 2BSED 3FFCD 4PJHF 3RX5A 1Q9LA 1HHKA 1KIUA 1U3HC 4JPIB 3NTCL 2APXA 4MB4A 4PREA 1B0RB 4BA8A 1CFVH 5F1SA 3QP3A 4JQVA 5EUOF 3KLHD 3MLVL 1LP9E 4GBXD 4XNMA 4XPHL 2APWA 1A7OH 1DANU 5JXED 3IDNB 3CVHH 3ARGC 4ZUSA 3JWOC 5GJSH 2YHGA 3IF1B 4NWTH 1MH5B 2NXZD 5LCVH 1W72A 2CK0L 3T2NH 2DMKA 4BZ2H 1I9RL 1F2XK 2B8OT 3MV9D 4AQOA 5KBNC 3LV3B 2G9HB 3QG7H 5GHWH 1QO3A 2NNAA 4HIEA 4PJEE 5GISH 5B8CA 2AJSL 3BZFB 5GSRA 4R7NA 4HKJB 5EO9B 4NO3B 1WF5A 4OTXL 1QR4A 5L0QC 4CVWA 1DQDL 1HHHB 4ZO6A 2AEPH 1IM9B 1ZA3B 5GRVK 2FO4B 4FZEL 4MJIB 4PB9H 4M3JA 4Y4KD 4OCSH 1TQBC 1RZ7H 3HB3D 5CZKA 5IB4A 1BD2A 5DS8B 4YO0A 3LSOA 2BRQA 5C08D 1LHZA 2C7UB 3MV8D 5TDNA 5F88B 5J3HC 5T5NG 4F9LC 1SEQL 4ZQKA 1FVEA 3CPLB 3DI3B 2NPLX 5IKCB 2OP4H 1BEYL 5IUSA 1HHGA 4N0UB 5HHNB 4Q9QL 3O2VL 5DZNA 1UC6A 1YEDB 3TO2B 4XVTH 2CMRL 1PY9A 1MRFL 4P5TC 2JTDA 3BXNB 4DZ8A 1Y6KR 4U2ZA 1WQVT 2XTJD 4G9FE 4HC1A 3ILQC 4LRNL 3FKUS 1IEBA 4WY7H 3DROA 2L0DA 3D85D 3WJJA 2CQVA 4Z7VA 1YEHL 4X98A 1QPPA 1UM6L 4PJ8D 3FQRB 4MLIA 5JW4Q 3BZ4A 1IILE 1BQSA 1GJIA 4BQCA 5GZND 4PBXA 1I3RB 3RI5F 3VXSB 4NQDE 1FL3B 3RNQA 2VQ1A 2WLZA 1BFOA 2BCKB 4PJXE 4MJ4A 4JR9H 3BKML 3I6KA 3VXSE 3O8XD 5FECA 3OWEA 2E7HA 2C26A 3GMNB 3QI9A 3BRGC 2AEQH 3O6LH 1G84A 2HTLD 4KHTH 1TPXC 1QLRA 1Q0YH 4RMWA 1NDGA 5E8PB 5CLWA 3ILPB 5C9JA 4OZFA 1DEEB 3MUZ1 4Y19D 4RFOL 1YMME 5JLZB 1MCWW 1RVFH 5I1JH 1A5FH 1YYMH 4S0SD 2ZUYA 4UTAH 1F6FB 3HAEB 5K9KA 2VABB 3OZ9H 3GMOB 4V1DD 4OLYH 4XPBH 1MHEA 1HEZB 4N9GB 2R69L 2UZIL 4KUZH 4ONHA 3RUGB 3FT4A 1P7HL 2V7HA 1Q0XL 4BYHA 2O26U 5F21B 2NX5D 3CVIH 3EFFA 5IEHB 2E9IA 2UYLB 5KSAD 3VI3F 1FG2A 5F6HJ 2FH8A 5FUOL 1GHFH 5C08E 5A2IH 5E9DB 1UZ6F 2C3GA 4XP4L 5DVLA 1QKZL 2D7NA 4JVWA 1V7MH 3A6CL 5ADPH 1KBGH 5ESQB 2VN4A 2HTLC 3KG5A 2NXYC 5DJXB 1AKJA 3V6FB 1E4WL 3VGAB 5GGSA 3OSKA 3QO1B 3CSGA 4MJ5A 1MHPH 4OB5H 5IR1B 4L8SA 3F7QA 2YZ8A 2CD0A 5IB3A 3QFDA 2AJUH 4GG6F 1X4YA 1X5FA 5KS9E 1KJMA 2FO1A 1CGSH 1IC1A 3T0EA 2DQJH 1S9WA 4FQ2H 4U1HB 3M8OH 4I4WB 1QZ1A 5LVEA 3TF7C 1MWAA 2AXGA 1A02N 3MUGB 4YLQT 3S36H 2CR3A 3SOBL 4DAGL 1LDSA 2AK1L 1UVQB 5ITBH 1WVZA 1S5IH 4TTGA 5BRZA 1ZWIA 1VSCA 5D2NC 5C09B 1B6DA 2IALB 5CP7A 4M7KL 2WIIB 5L88L 2ITDB 4RIRB 2AGJL 3UJIL 1X44A 3BZDA 2XT1B 3I3BA 2NQCA 3IJHA 1QFWI 3VFRA 4NJ9L 5KAQG 4UQ2B 3VD7A 5IMMB 4JDTL 5GIRA 3MRFB 3RWJA 5MEPA 1A5FL 3QJHB 5F1NA 1AGCB 2YMXH 3ZHKA 1A6PA 1INQB 2YBRA 5LAXB 1IAIL 4FXKB 1MF2L 4KROB 1UADC 3ULUE 3WD5L 3C5ZD 3VFNB 1ZT4A 1N8ZA 2ENSA 5GJTL 5D7IE 3P30L 4N8PA 3QDMD 1N4XL 3QULB 3BD4A 4JLRB 4N8VG 1RJZB 1FVDB 4APQA 2FHBA 4P23A 2VUYA 4ZNEA 5JOFB 1EHNA 4WENB 1P4IL 1U8QB 1F42A 1M71A 5INDB 2GY5A 2X44D 3B6SB 3BESR 5DMKA 2XA8H 1NCWH 1NUFA 4BELD 3VRIB 4EOWL 2XIDA 1HCVA 3X3GH 4D9RE 5KVDH 5CP3A 3C5SB 3RDTD 2GI7A 3QNYB 3BN3B 1ZTXL 2W92A 4HCRH 4X7FC 5DRZB 3FTGA 4TUJA 1IAKB 5E00B 3NH7L 5INDA 2YWYA 2AJUL 3F65A 3O3BB 2CH8A 1EAJA 2P1YA 1AJ7L 5D2LA 2WSKA 4JRXA 3NIGF 4BJLA 5J11B 2PCPB 1R3IL 1CZ8L 4LDEB 2DDQH 3BAEH 4NQEB 1KLGB 3RTQA 1ZSDB 5DZLA 1N8ZB 3KYNA 4D3CH 2H8PA 2IBZX 4F7EA 1NGQH 2F74A 2IANE 4HT1H 1KLFA 4JG1L 1CK0H 4ODSL 5KANI 3IGAB 4X9FA 1MJ8H 4G7VL 1ZT7B 3F6LA 1HIML 4ZFFA 1GC1L 3OGCA 4UQ2A 5IMMA 1P4IH 2QL1A 4HWBL 1A1MB 5E99H 4MQSB 4TULH 2AVGA 2DQTH 1B0GB 2VTFA 3NFPA 1QLEH 1HKFA 4YIQB 4QHUA 2VSDA 3MXVL 3RU8L 3PWPB 4KWUA 5TQ0L 4M6NL 1LNUA 3TZVD 4FFVC 4JFOA 3PWUB 3OKKB 1MQ8A 4LSTH 3WUWA 2QSTA 1ZHKB 1J88A 3MRLB 4MYWB 3UTSA 3VE0B 4K7FA 3PJSA 4CL7A 4X6CF 3GJFK 2AXJA 4U1HA 2P5EB 1G0YR 5F7UA 3T0EB 3O3DA 4YGVB 2FR4B 2QQLH 4PRPD 1WCQA 2GY7B 2EE3A 4H26B 4OIIL 2LAAA 3IU3B 5LGHL 1KCRH 3IRPX 2DIAA 3FL7A 3VXME 4EBQL 4KDWA 4ZS6D 9CGTA 1CG9A 2BHZA 4MJ5B 1JTPA 2DQUL 4J12A 3MLXH 4YHKL 3FO0L 3TN0C 3BPLB 4S1RH 5DJXA 1RK1A 5KSUA 4YZFE 4EIGB 1X5HA 4U6VH 5E99L 4XPHH 5MERB 3AXLB 3OL2A 3WNOA 4N0FA 4C55A 2IJ0C 4NQXB 2X4QB 3DO3A 4LARH 3FQUB 1LD9B 1T5WB 1UA6L 4X80H 3LKOA 1VFBA 5C0AD 1E4KC 2NZIA 3KPQB 4H0GA 3MRNB 4IHOA 3V0VA 4H8WL 3OX8A 4MNQB 5FV2A 4EI5C 3IKKA 4HIIA 2WBJC 5I2IA 4GXUM 4CU7A 1G7HB 2ZUTA 5FV1L 3V7AE 4BQ9A 1IC5H 3NCEB 3BP7A 3DX6B 2DJSA 2VIRA 4OAWA 3OMZA 1NJ9A 1E28A 1V7NH 1BPVA 4JY5H 1YEIL 3KLHC 3DOSA 4M1DH 1MRFH 3S3JA 1NDGB 3MPCA 4JN1H 4XX1E 1JGUL 3MLSL 3T2NL 3ULUH 1S9VA 1BZQK 3LPGA 5KSVB 3X13A 1NAML 1T3FA 3T2OA 4F2MB 1TVHB 3CNKA 3BIBX 5CIPH 3I6KB 1D5BA 3MNWA 3MCKA 5F9DC 2DQDH 1JPST 3O3EA 1CFVL 4AZ8A 4PJXA 1R5IA 2I60L 1OPGL 3ZL4H 4OI8A 3EO0A 3GO1L 3G04A 4L8DB 1H5BA 3KPLA 2PR4L 5I76A 1C8PA 2BSRA 2VL4A 3SO3B 1KG0A 3O0RH 3EJYD 5E4IA 1OSPL 3UBXB 5H2BA 3QYCA 4N0RA 5F7YC 3W82A 1UM6H 3DROB 4FN0A 4MZ3A 2FX7H 3ALPA 1NFDB 3RA7L 2W9EH 4P3CL 1IKFH 5FGCE 3VWKA 1CGVA 3BVNB 4OUOA 1LEGA 5HHNA 2AV1B 3ULUC 1KTLB 5E6ZA 5EORL 4JN1L 5FGRA 4RGMB 3T3PF 1TTUA 4HULB 1ZV5A 2XZQL 5F9JB 1GRWA 5CJ8A 3P73B 4YPGB 2YPVL 4YWGH 4JQXC 4AYFA 4CJ0A 4EUPA 3ARWA 3U0TB 2A9NH 2RFXA 1RZKL 2NCMA 5L2KD 1A14H 4GBXA 1FL5B 3QZWG 4OV5B 3LVEA 2I9TA 2EH8H 3IRZA 1WFNA 3WKMH 4P5MA 4RMUA 3UTOA 5FF6A 5C08A 2ZSVB 1HILA 4Y16A 4G80A 5EOCL 3FRUB 3AU1A 1QFWH 3MJ7A 5BOZG 1OTTD 4JAMA 3DNKA 5FKAB 4Q9QH 3N50A 1TENA 3AB0C 3BZFA 4PRHB 5GSRB 5GZOD 2D7TH 5E2JA 3BI9X 3B2VH 1FFPB 3LV3A 1FNEA 1YQVL 1PEWA 5BZWB 3NMEA 5FYJD 2BY2A 3QA3A 2B4CL 2CUIA 3THML 4PJ9B 4R0LB 3RA7H 3W81A 3F7PC 43CAB 3VW3L 3Q6GL 2HTKD 5IVZB 5CEYB 4XVJH 1KPRA 5DLML 4WWKB 2PYEE 1M7DA 2E6QA 1HXYB 1BFTA 5IF0B 4K2UL 1T21B 1T1YA 1HSAA 5EOTA 3V6ZB 4FXGB 4PY8J 1GOGA 3EDEA 1B6UA 3SE8L 3UJJH 4ORGA 4BFEA 1FN4A 2EYRB 1TETH 4LGRB 3ULSB 5ELIA 4G43B 3C2AH 4CADB 2DB8A 2IPUG 2MKLC 4PJCA 5FYKE 4G6FB 3VFSB 1AR2A 2X9WA 3O9WA 2R8SL 4D94A 4M03A 1IC7H 5FUOH 3S96A 1WJ3A 3BRFA 3GBML 3BUYA 4K9EC 5ICYB 3C5ZC 3OKYA 2MQ0A 2UZYB 4P46D 3INUH 4Q6IA 2Y6SD 2HRPH 3EOAB 5DC9B 5J13C 4MDJA 4DKDC 2EYSB 2YPLD 3DRTB 4TQEL 1S7UB 5DF0A 3KPRB 3WKML 1IGTA 3LN5A 3FB7B 3BD5A 3CAFA 4LLDB 4YHNB 3G5YA 1G9NH 4HWZA 5D6DA 1J11A 4QY8A 4DTGH 1JYXA 5IMOB 1FYHB 2ZCHL 4G8EA 2FGZA 5TJWK 1QR1A 4ZUTB 1A7NH 3TM6A 1EEYB 4HUVB 4KPHH 2X4OB 2YSSB 2GFBA 3BGMB 3SGJA 4NOFA 1RJYA 4V1DB 5IHZB 4OGAD 2DQHH 1S7QA 1JGLL 2A6JA 4GMTL 4LCUB 4UMGA 2DAVA 2IFFL 3RTQC 4AMKH 4PG2C 3CDYA 5IFJA 1NSNL 4GRLB 3MV8E 5B3JF 1A7QH 5SWZA 3GUTB 4WFED 4MJ2A 5JNYB 4DCQA 5CEZL 3K1KC 3GBLA 4MA1C 3UTPD 4PRBB 5JIKA 5CEXB 3QUMA 2PW1A 5EO1B 5LGKA 4OZFH 5D5MB 1CD9B 2ZOKB 2HJLA 3G5XA 3D3VA 4MA3A 1IM3A 1TZIB 2V2WA 4MD0B 2DM3A 3GKWH 1B3JA 1H0DB 1INEH 2QQQA 4MGXA 5IMLB 5IK3A 4M6ML 5MEND 4HHAA 4R9HA 3DVNA 2UWEB 4NJ9H 5E9DE 4I48A 2FX8H 4ALAL 2J6EL 2P5EE 4QGTA 5EU5A 2DICA 4CW1B 4X6EB 3OJDA 4WUUB 2GTWA 5KAQF 2Y5TB 2HJKA 4OGAC 5FIEA 2IF7A 3QHZH 1R3HB 4YHPA 1MJ8L 2X89A 5D7JD 3V5HA 4F7PA 4ZFOB 1K4DA 5T1LA 5T1KB 1LO0L 1TCMA 5D2LE 1PG7L 4PJEF 2ESVA 1GGBL 3HAEH 5IMLA 2BNUA 1H0DA 4PGBB 3TBVA 4LAJH 3S88H 5IHUL 3D3VB 3SDXB 1PBYA 3SGEH 5F3BA 2HRLA 4LSVH 1UCBH 1U8PA 2AV7A 2MWCA 5EO1A 5DHXB 5EFIA 3QEGH 2E7LC 3QIWD 5A43C 2RCSH 3B5GA 5CEXA 3T2PA 3EO1A 5JDSA 4P23C 3DRQA 3L7FA 1PFCA 4XPGH 4G7VH 4HUXB 3MBEA 2Z0BA 3H9HB 1ES0B 5JQHC 5CSZA 3LEVL 5GSVB 5MI0B 3ZHLA 4IS6B 4P48A 3QCVL 4HWEH 2DQEH 3ARXA 4L3EA 4TVPD 3IJSB 3X3FH 5F96L 1FV1B 1GGCL 1MWAH 2A6JB 5CJQL 5JHLL 1U91A 4F8QA 3KYKL 2XZZA 4V1DA 1M05A 3MACL 1IGFL 3NCJL 1ZT1A 4UV7L 4F15C 4HUVA 4LPWA 1K6QH 1RAMA 3C60D 3G5ZA 3WNPA 5LG1A 4LSUH 5FA3B 3REVB 3HRPA 1UM4L 1RZJL 2EE9A 3FCTB 3FRPG 4JO2H 1JBJA 4WFEE 1INDL 2R56H 1OLLA 2HJKB 2Y5TA 5GGVL 3JXAA 5J57B 4PV9B 4X6EA 2XTJB 1AC0A 1S5HA 4LLUB 3S88L 1IGTB 1YYLH 3LB6C 2VDQH 4UOW1 3W11D 3W5MA 2CRIA 3W39B 3DRTA 1E4XI 3LQAC 5IHBA 4QRQB 4I48B 4M8QA 3EOBB 2BVQA 3M17B 2DQIL 5CJ5A 4OCXL 1J86A 4O2CA 3C6LC 2DKMA 5MENE 2W1NA 5LKNA 5K9QI 3STLA 3MCLH 4GLRI 3UO1L 3O6FB 2X1QA 4MA3B 3I75B 4PJAA 1N64L 3I6LE 4HBQA 3S96B 2HJLB 3ZE1E 1AXTH 3ARBC 1G0DA 3O9WB 3OKMB 4JZNB 5IB2A 3JZ7A 2OXGA 1PGRB 2GIYA 3VFSA 3QUMB 3BKYL 4OZHF 1T03H 4U3XA 5JIHA 1T20B 5KS9A 1MCNA 1AHWB 2YN3A 5CBAA 4ONOA 3PQYD 4FFVD 4MQ7B 2V9TA 4JFED 4M61A 1KCVL 1K85A 3U9UA 2ZCKH 5EOTB 2VLRE 5AAMA 1OAZL 5EUOE 5IHZA 1XGUB 3T0BA 2ICES 5E2WL 5LXGH 1Q94B 2IGFH 2QJDA 1HXYA 3GIVA 1ZGLP 3MXWH 3QI9C 4NQVA 4WEBL 2HA1A 1QR1B 2EDLA 5I1AA 4PJBE 5IMOA 2EDXA 2X1PA 2A77L 5I19H 4PRDA 4HWZB 4RGNE 1UXWB 3IKCB 3S35X 4PUBH 5DEZA 4LPVA 2A9ML 3VH8A 5ESVB 1FH5H 2XXMB 1PSKH 3EYQD 3L3JB 4GRWH 4HX1B 4L9LB 2NMSA 3B9KD 4YWGL 3DTXA 2VYRE 4KVCL 1FNEB 3EOAA 2B20A 2WUBH 3U7WH 5D7IA 1INDH 2R56L 4ODXB 5ESAA 5ICYA 5HHXL 3UTSD 3JV4B 3AU1B 2WK2A 2R39A 3LRHA 1HXMB 1T2XA 3U6RA 3HNSH 5C08B 5FF6B 4ELKA 1EV2E 1EMTL 1G7LA 4WW2A 4OV5A 4OI9A 1DLHB 3W9DA 3KPNA 3DLQR 2I26N 1U8JA 2VXQH 3T1WA 3U0TA 1OM3H 2ADGB 2X1WL 2KQMA 2QSVA 4OZIF 4G43A 4DKEL 4PGEB 5F9OH 3LMJL 2VISB 2EYRA 3SE3C 2X4PB 2YA0A 4KJPD 2VDOL 5HHVL 5C0AB 3VGBA 1HK6A 4WTZG 5EOCH 3UEZA 1WCBB 1KB5B 4JY4B 3V6ZA 5J56B 2OYPA 2JJSA 5FYLD 2OXHA 1VHPA 3ROOA 2XY1A 5DC4B 1ND0A 3BSZL 4X83A 4JFFA 1OAYL 1VERA 4HH9A 1NFDA 3G5VB 3MLRH 2D9QB 3RVUC 4NBZB 5DTFA 2HLAB 5L8KB 3VMPA 1P2CA 2YD7A 3G6DL 5D71L 4ZOEA 4MNHA 1Q8MA 4NNPL 4RWHA 1I7TA 3N1FC 4HIJA 4UI2A 3TNNB 1AKJD 4XZUB 4R0LA 4PJ9A 5FFLA 2DBLL 5E2TH 1MFEL 2AJXL 2AEPL 1T5XB 3ZTJG 4NHUB 4PS4H 1U41A 1T1WB 1DQLL 1FFPA 5FCUL 4QHNA 4JHAH 5EG6C 4Q6IC 1T3FB 1RUPL 1T2QH 3FO2B 2AJYH 3OPZH 3SDCD 3THMH 4G80B 1HILB 2DIBA 4Q9RL 3DV4A 2PW2B 4JFZL 5HYQA 2PNDA 4IDJH 2I9TB 3QDHA 5GGTH 3O2DA 4RRPA 3QQ3B 1D5IL 2JKXA 3UZEA 2Y6SC 1T89C 4GXVH 5ISZE 4GBXC 4S2SA 3TBYA 4X5XB 3QXWA 1XGQA 2WUCH 2DQCH 2L4OA 1ODAA 3RVUD 3S6CA 1MIML 5F9JA 1QBLH 2AP2A 5JQ6H 1JCKA 4PJ5B 2DI7A 3MRMA 1G9NL 5GGUB 1ADQH 1G9NC 2WWMC 1G6RH 4R26L 3LEYL 4HIIB 2EZ0D 2FWOA 4IHOB 3V0VB 3MRNA 5GGQH 1RZFL 5FOBA 1WTLA 3DWTA 3ZT5A 4OGYL 2VLRB 5ETUB 5DD1H 5I15H 3B43A 1MIEH 1CLYL 2IC2A 5F9OL 1YN7B 3EYSL 3VW3H 1TETL 3GJFA 4PTUA 5KSAC 5JZ7D 4PJCF 1NGPL 1NUGA 4B50A 4U0RC 5F9WC 3KXFB 2F54D 4AM0A 3GSNL 2NY0C 4Z0XA 1H5BB 3GKZA 3KPLB 1A1OB 3F7YB 2YC1B 1IC7L 1E0OB 5HJ3A 3VG0H 4AG4H 5HHMB 4KVNL 4GG6E 5FYLE 3ME0A 5E8OA 5FM5O 2CUHA 1PLGL 2QKIB 3HC0B 3O4LB 5CS7A 4WV1A 1TVHA 2HTKC 3M07A 4F2MA 1KIPB 5BVPH 4B7LA 1GVIA 3I6GA 3HE6C 4IIQB 2X4UB 4P2OC 4PY8I 5IVXA 4PGDB 2Q7NA 4C58B 2P5EA 2VE6A 5FK9B 3G08A 4JPVL 5T1MB 4P3DB 3JTSB 1UWEH 1KV3A 2VIRB 3U9PL 3BP7B 1XT5A 3V79C 1IL1B 4I2XA 1QA9B 3S37H 4OLVH 5C0RH 4PLKC 1CLYH 1MIEL 5L6YL 4OSUH 1RV6X 4WO4A 3DUSA 3S5LA 2EYTA 1RD6A 4F7TB 4KRPC 5I2IB 2NR6C 5HHQA 2ZZUT 5DWUL 3VFUA 4MNQA 1TXKA 4BUGA 1X6NA 4Y8AA 4DKFL 4DWHA 1VFBB 5JHDD 1WBZB 2C4XA 4ZFFB 3FQUA 3WFEL 1QSFB 4JO3L 3Q48A 3T0VA 4S1QH 3QQNA 1A8JH 1UXSA 5MERA 3OKNA 2WQ8A 4LEOB 4XMPL 3QPXL 3QIWC 3TCLA 1GAFH 4ZO8A 1AD9A 5DYOB 4ZUUB 1DBMH 3HUJE 1L6ZA 5MENB 1BX2A 4P2OD 2PCPA 3LS4L 1L7IH 1EEZA 1ORQA 2ADIB 3ARVA 4GFTB 3NAAL 5CCKL 3ZKND 1MCFA 5C2BH 2ZKHL 4PJAF 1GPOL 1SMAA 5L2KE 1KCUH 4WJ5B 43C9A 2NTFB 2JE8A 5HI3D 3CLEH 4HK3N 3QUZD 4P2OA 4GKZB 4DQOL 4PY7A 4N90D 3KYMB 5TE7L 4OZHE 4IMLB 5EU4A 5EBLB 4TUOB 5EIQA 4G8IA 3TBWA 4JN2A 5BVPL 2ZG3A 5DD3H 4Y5VC 3OKKA 3PWUA 4JFOB 4X7DC 4XP1L 4RFEB 4M00A 2A1WH 3PWPA 1OW0C 3QUZA 4XBEH 2H6PB 1A7RL 1B0GA 4RMTA 5HDOA 4TSAL 5CHNA 3WFHA 2FBJH 1A1MA 2BY3A 3T8XB 1LK2B 5ITBL 4U3CA 2EXYC 2V7NA 5EIIA 4GMSH 3IGAA 4JCLA 5EBMB 3NGBC 4FQPA 4PRIE 3PHQB 1C5CH 5FGBA 2XA3A 5E5UB 4GT7A 3E2HB 4P4KA 5F89B 1KLGA 2HWZH 3MV8B 4TULL 4U0QB 1VPOH 4GW4B 2PYEA 4NFCA 2ADJA 4U1JA 3FFDA 2IALA 5CP7B 3SDAC 3NPSC 4JKMA 4KJQC 2A6IB 1IAIH 5BRZB 2YKLH 2JLLA 5JHDE 3JV6B 3QDJE 4D3CL 1JGEB 1IAKA 4TUJB 2FEDC 3O6KL 1P9MC 1NDMB 15C8L 1TMCB 3BYYA 4BUHA 2QADB 1BQHA 1S9WB 3TVMA 4HWEL 3VRIA 2H1PH 3HI5H 5AWNL 3X3FL 2ATKA 5DMKB 3MRBA 2K1MA 3QFDB 1G7IB 5IB3B 4LRIA 3QUMH 4J3OC 1T6VN 1QFHA 4AEHL 5IR1A 2EXYD 4U1MB 1RJZA 2DQIH 4PBWD 2XOTA 1AKJB 3AY4A 1OL0A 5J89A 2C4FT 4I5BA 5IBLD 4LSDA 4H5SB 2YD1A 3H8NA 1A6VL 4K3GA 2HLFD 3RGVC 1EGJH 2DQTL 4HLZG 2DYPB 3D25A 1SJVA 4R8WL 1AI1H 2YBRB 4N90E 2J5LB 1AGCA 1Q1JL 4KJQD 3VXOB 5TQ0H 2EEDA 1I9JH 3GSUB 3MBXH 3VGHA 4DFIA 4H25A 5HD8D 4HG4K 3VFRB 1DE4B 1FVCB 4K8RL 1U8MB 4FABL 1YY8A 3IDJA 5HBBA 3FHQA 2QQKH 2DLEA 3VWJB 5ICZB 2C1PB 3HAEA 5K9KB 3QT2A 4WFHE 1NGYB 3LMJH 4NQTA 4X6DF 5CJBA 3W2DL 3DXAE 1REIA 3ARYA 4Z5RB 5A2FA 5HXMA 2GEEA 1UVQA 5I74B 5TE4L 4RA3A 3B9KB 3DGGB 1JV5B 3MOAH 5H94B 4DK6A 2HFEB 2VLJE 3BP4B 3IETB 3SDYH 5SWZE 1D7FA 4MNGB 2NXYD 1QLRB 3LAFA 1FO0H 2XG5A 2WV3A 3LKNB 2A9MH 1UKTA 2MPAL 2ZJSH 1KJMB 2V5YA 3C60A 2YKLL 3K0WA 4QRPA 4P2QA 5E9DD 3I02B 4LVOB 3NFSH 2ZSWB 1ZEAL 3ARQA 3T3ME 1KNOB 2NY5H 5KVGL 3WHE0 1T83A 2FJFB 5CWSA 1HH6A 2BK8A 3EFDH 2BX5A 2R0ZH 3HA0A 4FP8H 1SJEB 1EPFA 4LCYB 1P7QD 2LV4A 4LBEA 3S5LG 1FL3A 3RNQB 3LHPH 5ESQA 3PWJA 2P49B 3HI5L 5AWNH 5HI5C 4BQ6A 1XF4B 5F8QC 3BZ4B 4POZD 4OLYL 4K3DL 5E9DA 2QHLA 4PJFE 1FPTH 1NCBL 1OGAA 3WIIH 2Z8WC 1PY4A 1IJ9A 3DBXB 1IQDB 1SBSL 1X5LA 2BSSB 2UYLA 4X4YA 4N8CH 1C7TA 3ZTNL 2DM2A 2RBLA 1KLUA 1KGCD 1A1NB 5C07B 5E7FA 5DK0A 4N1EA 3ULVD 3B9DA 2Q87A 1R3KA 5DQDH 4PS4L 2D7QA 1BJ1J 4HF5H 5E2UH 3I9GL 2FZ3B 3PXHA 2EIBA 1HHGB 2Q76A 1QUNA 1PJ9A 1OVZA 3MGTA 4QRSB 5GRUH 1CL7L 4ZQKB 3VD3A 3VXSD 3FJTA 1V5JA 2X4TA 2C7UA 4WO4C 1UJ3A 1HSBB 5F7HA 5C0BD 1B4JH 2A6DA 4OD1L 4YO0B 4IRSC 3KLDA 3ZT6A 5DUML 3B5HA 3CLFL 1BF8A 2BY0A 1L4IA 4P9MH 2YR3A 4K23L 4AIZA 4TOYL 1PZ5A 4C4KT 3U2SA 4JFYA 1ZA3A 4PJFB 4M93C 3ARFC 3MR9A 1A6AA 4HKJA 4R7NB 1KUMA 4JB9H 4KKLD 3HE6A 3BSZH 4Z7NE 2D7TL 4V1DE 4WV1C 3P2TA 3W0WE 4FQIH 4OF3A 1QKZH 1NBZB 4NWTL 3QO0A 1S7XB 1MY7A 2P5WD 5BVJA 2VWEC 1LP9A 2NX5E 2HKHH 4X98B 2FCBA 2YEZB 1ZANH 3FB6A 2M26A 1T0NA 2DI9A 1GIGH 1A9BB 5IBTH 3ZE0E 2YD9A 3PIQA 3ULUF 4JRYD 1DQLH 1MHCA 2WM0A 4JKPL 4XT1C 2BSTB 1MLCA 1JF1B 4PYHA 5I30H 3F5WA 5F6IB 1Q9OB 4N0UA 2R1YA 3H42L 1KCKA 3LDBB 1HH9A 4PJAE 2D31B 1W72L 3CCHB 4HKBB 1CXHA 2R2EB 2GJ6B 4GXVL 5JPNA 3ECBA 3GSNH 2SEBA 3O2VH 1P5UA 4K7PL 1A3RL 4M6OL 4EI6B 1BREA 2Z8VC 5DRNA 1URLA 3D18A 2X41A 1SJHA 5C6PB 4QTIH 4RBPH 2Y07H 4U4BA 4RGOL 3S4SG 3HUJA 4MCYB 4JM2C 3WO4C 5CGYD 2OCFD 1HWHB 5TDPB 5D1QA 4EQ2A 2O61B 4ZTPH 4J3SA 5DLMH 3D69A 3TZVB 4B7IA 1JZ3A 4NO0D 3WCYA 4DFHA 3IF1A 4NDMB 4S1DD 3TO4A 5HYJE 4PGCB 4YDIH 4ZUSB 3FN0H 3SGDH 4NP4L 3MREA 2BP3A 4XNZC 4AEIL 4OLVL 5C0RL 4DTGL 5GS1B 3D0LB 4EN3B 3RZCA 4GRLD 5BQ7A 3PWVB 3WYRA 1JZ5A 2CXGA 1JZ7A 5I9QB 4PR5B 5C0FA 3PWNB 5JHDB 3ARRA 2Y25A 3C8KB 3N0PB 1RHHA 4ZS7H 3GGWB 3U4EB 5DWUH 1CD1B 4CMHB 3HZVA 1AXSB 1IGJA 2C5DC 1DBKL 1ED3A 1T7VA 1I8KA 3RAJL 3RL2B 2Z92A 4UTAL 4YGAB 5CGYC 3JWNC 2EDOA 4J3UA 1BVLB 4G6JH 5DJ0A 3SKOA 2QR0B 5SWSA 2VLKB 5FYJH 4EDWL 1I85A 1T1XB 2MNUA 2XFXB 3PP3H 4YBLC 3T4AA 5DJZA 4DVBA 5JA9A 4LEXL 3OKEB 2OTUA 4ETYA 2CKBA 3U36A 1S9YA 2R0WH 1Q9KB 1AY1H 4L8CB 1OP9A 1ADQA 1YC8A 1BZ7B 2RR3A 3H2WA 4YDLC 1NCDH 3H0TA 2HFFA 4M1CC 1AR1C 3JUZA 4DQOH 1RPQA 4MA8H 4JRXD 5DHYA 2AW2A 5DUBB 5E4EB 3PHOB 1JPFB 5I71C 5HGAB 2EH7H 1Y18A 5JOPE 3PWPE 3GSXA 3HMXH 1F6LL 4L8CA 2XRAL 1G7JB 1F4AA 1XGTA 1CCZA 4GS7B 1QEWB 2X4RB 4YHOL 4HXAL 2X1OA 3QIUD 1WBXA 2KL6A 3RWIA 4DVBB 4PIRF 4BZ1H 5C0GA 1YDPB 5FAAA 1MEXH 2ICEA 5DJCB 5HHOB 4A2LA 4XXCA 4ZXBB 3BP5B 3MLXL 5F3HB 3RKPA 4E41A 2Z92B 2AXFA 2AXFB 3QFJB 4NFDA 5IJVB 3SGDI 5F3HA 1TVBA 5T3XH 3ZHDA 2VLJB 3MFFB 1CD1A 4Y4HD 3OKDB 1YDPA 1UEYA 1U3HB 3FO1A 4UV4L 4YHMH 2EDDA 3WS3B 4FTVD 5DMIH 3DXAB 4QXTA 1U8OA 3PWNA 5JHDA 2YMXL 4OLEA 3PWVA 5BQ7B 2X4RA 2ZNWA 4Z8FL 3D0LA 2CGRL 1G7JA 1XGTB 4QTHB 3L3OB 4WW1B 1RQ5A 1KJVB 3VXTB 1C16B 3QQ9C 1DQJA 4UTBL 2OR7A 5HGAA 1WIUA 1JPFA 2ICCA 3NFNA 4ONFL 5J1AB 4R90L 3HR5A 1SY6H 5IWLC 4LP4A 3CFIC 1A6ZA 4KK9C 1JWMB 4FFZH 5DHYB 1NGWA 1RUKH 2H32H 5AUMA 3NCCB 2VLME 4NZUL 3D39A 2EIDA 4XVUC 5ILTH 2QV2A 4HUUB 1IGMH 1NCTA 4IJ3C 3EHBC 3QDME 4WCYL 1PX3A 1BZ7A 2BZDA 2VZUA 4GRMA 5IROC 1Q9KA 3T77A 3U46A 4AK1A 5H37G 3Q0HA 1UGNA 1MJ7L 3CSYA 4YR6B 5E2VH 2PO6A 5EO0A 3QUKA 1CLZL 3QAZB 4Y2DB 4ZFZA 1SJHB 3MCLL 1NAMH 5I1DA 4EI6A 1T0MB 2I24N 1XH3A 4D9RD 1S7WB 2NZ9D 4NN6B 1FLTX 2OJZH 2FYYA 4Q58C 1S7VB 1I8KB 1OGAE 2XZQH 3MV7B 4LCCA 3SDAD 1AXSA 3QUXA 2Z91B 4LSVL 4TNWF 2NY3C 4P5TB 4IMKC 4Y7MA 3ARDB 4EQ3A 4JANA 3VXRD 4KY1L 4CDGC 3ORJA 5DC0A 3MROB 5ALBH 1GGIL 4FQQA 2GUOB 3V52H 5GGSY 1NAKL 3PGFL 2BRRH 4M7ZC 5DMGC 3EBAA 3S8WA 1YPZF 1A9EB 5FA4B 4LAQL 4WDIB 5E8EB 5IT2L 1VGKA 2E8ZA 1LP9B 2QHRL 4UV7H 4F9PC 4XAWH 5F70A 3VJ6A 2GAZA 5HPMA 3D69B 1T83C 3LKSA 4Y1AA 4IRSD 2NY5L 5KVGH 1UKSA 5D1XC 4JPWH 1SHMA 2HT4C 3CLFH 2VQTA 2O61A 3NFSL 2CIIA 3RWCB 1CD0A 2WUBL 2IGFL 5ISZD 1G9EA 3UYRH 4NNXB 1QBML 3I2CL 3QQ4A 1MAKA 32C2A 3MRPB 4GH7B 3MR9B 5CLTA 3S97C 3BE1L 2D03H 3SKMB 1TPXB 4OZGE 3QPQD 4XB7A 3CDGB 5EC1B 2NY6C 2IPKB 3C09C 5LWYL 4HJ0C 1Z9SA 3FAWA 3GSWA 5DI8B 2NW3B 3IDMA 5HI5D 1OWRM 4L8SC 2H2PD 4FQHB 3QDAA 4K71B 1HSBA 2D31A 4PRPE 1IGCL 1JHKL 1ZLVK 1NAKH 4L4VA 1DCLA 3CUPA 4HEME 1JZ6A 2EO1A 2R1YB 4UB0L 2FZ3A 3F5WB 2ORBL 3MODH 4NUJB 4ZOAA 1LVEA 3ULVC 1MLCB 4RX4D 5CEZE 1DQDH 5DK0B 5EWIL 3NACL 2HH0H 3S34L 5ACZB 2X4SB 3PIQB 4FQIL 2FEEI 5JO5A 1SYVA 1A9BA 3O8XB 1UENA 3ARUA 2VXQL 4QRRA 1U3YA 5DJDB 1SBSH 1J8KA 2P42B 2XWBB 4HDIA 1KPVB 3UJJL 4RGNC 1HINH 1XF4A 2VC2H 4PJXF 4U1SA 2NXYB 1MCOH 4TOYH 3QPQC 1RMFL 4OZFG 4KTEL 4WEMB 3QO0B 4BK4A 1WZKA 4ZG1A 5BOPA 1NBZA 4TTDD 4KZEL 1MCLA 5LGJB 1PYWB 4KGJA 2DOCA 4Z0BL 1KNOA 2V2XB 3BKMH 3MRRB 5GRUL 3UPAA 4X6BA 3I02A 2F5BH 4KKLC 4LNRA 2R69H 2J12B 4O00A 3SJVA 4NZDA 1BOGB 1CIUA 3U2SB 1KN2H 2HKHL 4YNYB 2WINB 4JJ5A 3IETA 2J88L 1TQCB 4H20H 1JV5A 3E6HB 3B9KA 3DGGA 5DFWH 4CJ1A 5FEBA 5D2NB 3VFVA 3QISA 2BVPB 2I60H 4U1LB 4Z5RA 3ZL4L 3QIBD 1B88A 1PD6A 2ICWA 3E3QC 3GMPB 1V7ML 4QRSA 4MXQD 1P7QA 2H3NA 2Y7QA 3O41B 5ICZA 5KTEH 3O6MH 4GG8A 5F9AC 1RFDH 3GMQA 3MRCB 4NKDB 4QHKI 3SCMD 2XQYG 1AFVH 3H7LA 4U3HA 4JM2F 5KS9F 2Q20A 5EUOB 1A1NA 35C8H 1BAFL 3GRWH 1IEAA 4BSVA 5HYSB 1JHKH 2XNAB 3DX8A 5IM7B 3BO8B 1YNKL 3DBXA 4QRUA 1CGWA 1LEKA 3D25B 3DVFA 3S35H 4CN4A 2XZAH 5C0BA 3OB0H 4WHTB 4AT6B 3CC5A 3WXVL 3WHE1 2FJGB 4I5BB 1UQSA 1AXIB 4LBEB 1YNLL 4YHZH 1T7ZA 1BGXL 4HWNA 2OS7A 1DBAL 4O58H 1CXFA 4YXLH 2R2BB 2X05A 4YHYC 5CEZD 1DBBH 3B9VA 1LO3H 3MNZA 2P24B 2VLJD 4NKQB 4CVXA 2ZSWA 5J9PA 3TYFA 5HVHC 3C60B 4J1UA 3ULVH 4AH2A 1S7SB 3HCVB 1P1ZB 4U7SA 4ERSH 4JG0H 4WRLA 5T5NF 2VB5A 1P53A 4MNGA 2BHUA 4I13B 1T04B 3NCFB 2EDRA 2HFEA 5D93C 3ZKXB 1J1XL 4H0IA 1MF2H 2PF6A 3RNKA 1YECL 4QXGL 2IAMA 4I9WD 1RZIA 2F5BL 2VR9A 1LK3H 4X4XA 4EJ1C 4OLUL 4UOW0 1GSMA 2OL3B 1NGYA 3LD8B 4AIOA 5DT1L 1MNUH 2B4CH 3HZYA 5KVFL 4UBDC 2C1PA 4L1HA 4PJ7B 1FIGL 3ARGA 4I77H 4KRPD 4HPOL 4NO2B 4NYLB 3V7MA 3ZTJH 2BVTA 4XCCH 3LRSB 2YPKB 4CAGA 3TIDA 4NNYB 3WIFB 5IQ7H 3BQUD 4NQDB 5TPWL 3CXHJ 4NRZB 3N06B 2V7NB 1IZKA 1CBVH 4J8RB 3GM0A 3HZKB 3LEYH 3EW3B 4C56E 1O5DT 2Q86A 1A21A 4B41A 3B3IB 7FABL 4JY6B 4N8VA 2GJZA 4Y2OA 3RWFA 3QUZB 4U1GC 3MV7D 2IG2H 5ICXA 2O5XH 5IFAH 3S35L 4EKXA 4FA8A 5EU4B 5GGRY 3MRBB 3CFCL 3BH9A 5D1ZA 2AI0H 3T0EC 4OBRA 1I7RA 3H9YA 4DJMA 2Y5EA 1NEZA 2FIRT 3QQ9D 2RB8A 1RZ8A 4BFBD 3EIFA 3FT3B 3JV6A 5AEAA 3BPLC 3IFPB 4YHOH 4HS8L 4F80A 3TYGH 4X9BA 3LOWA 2WW8A 3IXTB 2ADJB 2ZKHH 5JXAH 4R2GB 4ZXBD 1EEZB 1JI1A 1ORQB 5D6CA 3RJDA 5KN5A 4ZAKB 1J18A 1XGPA 3VGDA 5KG9B 3PP4H 1W0VB 1O0VA 3TCLB 4EI5D 1Z3GH 2JK5A 4WNQA 5I8CA 4LEOA 2DIJA 5KVDL 3X3GL 3MLWL 4L3CA 3GFUA 2NY1C 1FZJA 1HNFA 5TE6L 3NTCH 5L6YH 5E2VL 4PJBF 3RPKA 4OM1L 4WFHD 3JVGA 3MMEB 3DXAD 1T6WA 1LK2A 3WFHB 4GO6B 1U93B 4HS6B 4PUBL 1NCAL 2H6PA 5GRZA 3WFCH 2CGRH 3H3PL 3BIKB 3HAEG 3WJLA 5JW5B 1IL1A 1IGIL 4I2XB 3WHXA 4LLVA 4GW1B 3FQXA 5EBLA 1VFMA 1NEZB 1MAJA 1P4BH 3QUYB 4UINL 4HT1L 5T3ZL 1MCHA 3P9MA 2PTTB 4MAYA 4GMSL 2EDKA 4OZ4B 4MJ6B 4X6FA 5E2WH 4YXKL 2CKNA 4JQIL 1E6JH 1LDPL 5FK9A 1YQ2A 1PX4A 1JTTA 3SO5A 3T04D 3GKWL 3V5DB 3H9SA 5I1HH 1A22B 1XAUA 4IIQA 5K9JH 2XTLA 3ZDZF 1FORL 3PL6D 2NTFA 3CX5K 3H9ZA 1S7RB 1W8OA 3CU7A 5D1ZC 5FM4A 2QKIA 3HC0A 1RZ7L 4D8PB 1CFSB 3HB3C 1EO8H 1LO2H 1U95A 4M6NH 1IAMA 4FQCL 2BOCB 3F7RA 4POUB 5CJOH 3F7YA 1A1OA 4J4PC 4PP1C 3KJ4B 1KGCE 1OF2A 4NT6B 5CD3B 3BX7C 5DYOA 4YFEA 2YA2A 2YRPA 3FQNB 3P77B 1V7NL 2AJZA 4Q2ZB 5D1QC 4UT7H 1UXSB 4HC1L 5A2LH 4NRZA 4JM2A 4HWBA 3BE1H 3LY6A 4G9FD 2XTJE 1WC7B 5DMJB 2GSGB 5AYUL 5JDJA 5FOBB 1J0JA 3LRSA 2Y1VA 4Z7UB 2VKXA 2VDRL 4QNPF 1F90L 3QCUH 4JEGB 4NNPH 3ARGB 5GGUA 2ESVE 4YXKH 4XNUH 5C8JB 4ZD3L 5EU7C 1GZQA 4NUGH 3CX2A 1D5XA 1ERNA 2F58H 3QWRA 3A6BH 1CDCA 1DBJL 2VDOH 2F54A 5HI4D 3N1PC 4HJJH 3QHFH 4KQ4H 5EOQL 4Y5YB 3LKPA 3HC3L 4ZTOL 1T22A 5DRWB 2R4RL 3UAJD 3DV4B 1QD0A 1S7SA 4AH2B 3ULUL 5J1TC 4RA0C 4ORZC 1SEBA 5CD5D 1KIPA 2HKFL 2DQDL 3MNZB 5T3ZH 1EGJL 1TQBB 4P9HH 1MI5D 2R2BA 4YC2C 4HC1H 1A3LL 2A0LC 4KKBD 4NHUA 3QEQB 4PJ9C 3T0WA 1KB5H 2B2XL 1F4YH 1I7TB 1JZ4A 4I3SH 4AEHH 1F90H 4YDJA 3BT2H 4QRUB 4ODVL 1LO2L 1U8HA 2NTSP 1II4E 3V6BR 3W2DH 1IVLA 3LQZA 1WAAE 3EYSH 5FHAL 5GGTL 3P4MB 1TNNA 2LTQB 3ROOB 2FWOB 3TCXA 4CVZA 4Z7NF 2HVJB 3GB7B 1IKFL 3SGEI 5DQDL 4LFHG 4Y4KA 5CZVH 4YHLH 1FJ1A 5DK2B 4OCMC 4MXQC 1F4XL 5HHPA 2O5YH 1D5ZB 1L9NA 2NX5B 1XGQB 3VFVB 2OI9B 4DUWA 1IGYA 1D5MA 3WIIL 3QNZB 1DLFH 1J1PL 2HT4D 3QQ3A 3O3AB 4JHWL 1RU9L 1A6TB 4PJIF 5DK3A 3Q6FA 3SJVB 3LHPL 1CT8A 4KI1A 3U6RB 4BQ8A 3FO2A 1FRGH 3P0YL 2GCYB 2IQAA 4WWKD 4ODXA 1XGRB 5AZEL 5HD8C 4QHNB 3SJVE 4IRSA 2QTEA 2EC9U 2J1KA 4HIHB 2F53B 3DTXB 4K8RC 5T5FH 1GZPA 2MPAH 4ZUWB 4JO4L 5B22A 5D9SB 3VG0L 1J12A 4WI6A 2AABH 2C1OB 4HIJB 3TNNA 1KPVA 4RDQF 4FQXC 1UXWA 1L6XA 2RJMA 3EOTH 3IKCA 4KZDL 2PETA 4WFFD 5CGTA 4Z7WE 3KPTA 3NN8B 3TNMA 3O8XA 3EFDL 2Y4SA 4I3RH 3WFEH 1CL7H 4G9DB 5IIEA 4HH9B 1Z2KA 4H88L 1ZHLA 3MLZH 1I1YA 1Q94A 3L3HB 2Y06H 4JGMA 4R4ND 1J1OL 4JREB 1QFUH 1S3KH 4NUJA 1MVUA 5INCA 2CK2A 5E56A 1CFQA 2XG4A 4XCEB 1LK3L 1IFHH 3VDCA 2HRPL 1WFUA 3N1GC 5JA8B 5AYQA 4A6YB 1Q9WB 1KSRA 2HT2D 3MRQB 3GRWL 1AHWA 2D4FA 3ARPA 2WIMA 3T65B 1NBVL 1DQML 2ERJC 2XV6B 2JJTC 4DW2L 4M62H 5JIPA 3GSNB 3KYOA 4LVEA 5C0EA 1OAYH 4PJ7F 3I75A 3DPBA 3PWLA 4JRXE 1DBBL 3JV4A 4FFWD 3BISA 5F7FA 1I3UA 3OR6B 4X8XA 3MGAA 4O58L 5ESAB 4HH8A 2CIIB 1KYOK 4X7EC 3LN9A 3SDXF 1FFNA 1OB1B 4QRPD 1F58L 5I16A 1JWUB 4NN7B 2IFFH 3AAZA 4AMKL 2BVUA 2GAZB 3PGDB 1PAMA 2Z31A 4POYA 4NBXB 1FO0A 3LS5L 4Z77B 1CGYA 5DURB 5E8EA 3HN3A 4RAVB 1I7UB 3X12B 1QRKA 4IM8A 1N0XL 1R3LA 3HG1D 3OV6A 4UT9H 1A9EA 5FA4A 3PQYA 4TSCL 3QXAB 2VDPH 1JFQH 5D4QA 1T7YA 3REVA 1DBAH 3HI1B 1MFAH 1WISA 3RHWF 4KK6D 5HYEA 3OHXA 3EYFA 1ZT1B 4X6DA 4PLJD 5H37H 3T3MF 2VKWA 3U9UB 3FOLA 1I1AA 1FV1A 3HG1A 3VU2A 3C5JB 4IS6A 2J6EH 3IDIA 4NQCA 3QUXC 4UIKL 1OARL 2FYYB 5F7LB 3MJGX 3RAJH 2LAGB 3L7FB 4OF0A 4Y5VA 1YEJH 5I18H 3IVKA 3RPIA 1XZ0A 2FBJL 5D2LF 2M1KA 5I1DB 1MPAL 4WTWA 3SDXA 1VCAA 4Y2DA 3AVEA 4IRJA 3S98A 4XNXH 5HTSA 4CBPA 3B8SA 2VDMH 3UXFA 5C6TH 4F33B 3T77B 3U46B 2CR6A 1RZJC 1ZLSL 2FHCA 3VGEA 3M17A 3RQ3A 4C59B 3OGOE 1BBDH 5T1KA 3BPNC 3S36L 1K4DB 2ILLA 4NJAH 3VXMD 3JWDL 4MB3A 2XTJC 1R3HA 4YHPB 4M6AA 1GGUA 4KJYB 1D9KD 4U6HA 2OL3L 5KSBE 4LLUA 1S5HB 4WUKH 3LEXB 1BM3L 1JZ2A 5GGRB 3FB5A 4S11A 4OFVA 1QRNE 3QIUB 4PV9A 3QRFM 3NFNB 4JFDA 1W0YT 4F9PA 2AGJH 1IKNA 4ZFGH 1C16A 1KJVA 3VXTA 4WW1A 4O5LL 3H9SE 5IJKA 1MFCH 4YDVA 4JKWA 4F3FB 5F93C 1EA9C 1KEGH 2VOTA 3BQUC 4ELMF 1D9KA 1TZIA 3QEQE 3O9WC 1OGAD 3M8OL 3BW9B 3KAAA 3G5XB 4G6AD 1QBBA 3QNXB 1U3HA 4XP9H 1CF8H 1DTUA 3U4AA 1J5OH 3OKDA 4QGYA 1KIRB 2PYED 3GJEA 2RHEA 3BWAA 1JYVA 1JMXA 1B2WL 1ES0A 3RVTC 3QFJA 1VEMA 3GEWB 1KCSL 1SM3L 3U0WH 4GKSA 4BH8A 3RFZC 4BKLA 5JHLH 4GXUN 1L0YA 5F96H 1P4LA 5F3BB 2V9RA 4JVPA 2NY4D 1MJJA 2GFBB 2YSSA 3U30B 4LIQE 4Z7QF 1LQSR 4ZOBA 2VDNH 1I9JL 3MBXL 4WI4A 5HVWA 4ZUTA 2ESVB 1I9RH 2I9LA 5D6DC 1Z3GL 3NPZB 4G8EB 4OCYH 2I5YL 3SDDD 4MNQE 3MA7A 2C9AA 5LBSL 3V5HB 4F7PB 1F3JA 2DKSA 1HYRC 3G5YB 4WTZA 4YHNA 4WUUA 2EICA 3STZA 3TN0B 3WNKA 1Y0LB 1YMHB 3BD3A 1WWBX 3O9WD 4RSVA 3MV9B 1QBAA 2J4WH 3H0TB 2Z4QB 5IW6B 2X6MA 2F19L 4MDJB 4PJDF 5IWLA 5DD5L 3MFGB 1ZE3C 5MHSE 2DYPD 1A64A 2UWEA 3D87B 4HFUH 1I7ZA 4ELMB 4TNWK 2X4NB 2OTUB 3H3PH 1BFSA 5IHLB 4LSUL 1CE6A 5LXGL 3H7BA 1JPSH 1QYGH 4JGUA 3JTTB 5L2KA 4NHCL 4J4PD 4PP1D 2PW1B 2DQGH 1BVLA 3SKOB 3OXRB 2WBJB 4P9HC 4PJCB 4KKBC 4PRBA 3QHFL 4KQ4L 5JNYA 1SVZA 4OZGB 3C8HA 3KJ6H 5EDXA 1D3CA 1VFUA 3NOIA 1H3VA 4XB8A 1FN4B 2VDRH 2AQ3A 4I0PB 4X6CE 4N1HB 4OD2B 1F4WL 4AJ0A 3OKLA 4LVHB 5AYUH 2DKUA 4OCSL 2W9DH 3RUGE 3VXNB 1A7PL 1A14L 1V3MA 3MLTB 4ONFH 2OTWA 5I8EA 3R4DA 4PR5A 1HI6B 4WEBH 4OF6A 1H3UA 3RZCB 1SM3H 4EN3A 1K3ZA 3WIHA 1OTTC 5CEYA 3RX8A 4U49A 4XPTL 2D0GA 3BEWA 3RWEB 4APQD 3V7AG 4PGCA 4PJBB 1F6AA 4P5KA 1KEML 3X17A 4H1LH 3IFNH 4ZTOH 1J8HA 4PLOB 5BZWA 4Z8FH 3V6OA 4QYOA 1UWXH 1SEQH 5DD0H 2LABA 4D9QE 4Q6IB 2CLVB 3L3IA 5D1XD 4D0BB 5HHXH 2DWDA 3PDDA 5FKPA 1A3LH 3ULVE 4PYGA 5TDPA 4WHDA 3U7WL 2VL5B 5E24E 2UUDK 3WSQL 2YOCA 2B2XH 4S1DC 3EYUL 1C12B 4G6KH 2XWTB 5JIIA 1MREH 5L7XL 2W0FB 3PABA 5DJ8A 3CXDL 3D18B 4K2UH 2FNBA 1FL5A 4GBXB 3UX9B 3O3UN 3ECBB 1MQKL 1WAAA 4EUPB 4HGWA 1TZGH 4FMFA 3CCHA 1Z9MA 4RGMC 1EEQA 4YPGA 3HMXA 3P73A 5MEOA 3ALWA 1SJXA 2DBLH 4QF1B 5D72L 2F15A 2AAVA 1C7SA 4FXGA 1Q9OA 3J7HA 4FNLH 4XPFL 1XIWC 3BVNA 1A3RH 4M6OH 4ZSOA 3KPMA 2X42A 5F7NC 5IF0A 1MHCB 1YY9C 3QH3B 2OQJB 2E27L 1HHIB 5KSAB 1CGUA 2B5IB 1FLRH 4U0RB 5F9WB 5J4MA 3D5OF 2VXVH 3FQWB 2AK4B 3RL1B 1H5BC 1PKQB 4XC1H 4J4PA 4KQ3H 1YN6A 1MRDH 4PJGA 5FCSH 4UDTA 2VZTA 4Z18A 4OD3L 1S7XA 2JCCA 3SE3A 2H9GB 1QSFE 4XWGL 5EA0L 1QACA 1YMMD 1R5IB 4PJXB 4QHKJ 4EIZC 5SV4A 4PRAA 5L2JA 3HE6B 2I07B 5FCUH 4PRHA 4CUCA 1JRHL 4X5LA 1S3KL 4I9WE 2WLYA 4WWKC 1UH4A 4JQVC 3FRUA 1EERB 2WAHA 2FIKB 1S9VB 3IFNL 4P5MB 5GS2H 4JFYB 4OGYH 3EJZD 4Y16D 1FFRA 3O4OB 3RDTC 2NR6D 2JJUA 2H32A 1MJUH 3UMTA 4DOHE 1CDGA 3C08L 1CU4L 1T7XA 2WUCL 3ZMRA 5HDBE 2A6DB 1NCCL 2VXTL 4OAWB 3N85L 3CZFB 3VD9A 4OFIA 5F97E 3GIZH 2PTVA 3DHJA 2BVYA 2VR4A 3TBSB 2AV1A 1LEGB 2J7LA 2A6KA 2EEBA 2VO5A 4WI2A 3TWCL 1RZKH 3OX8B 3VWKB 1NAMA 1T0PB 1V3KA 1TZHB 3RY4A 3ZYJA 1NC2A 1E4JA 4IDJL 4R3SB 2ZUQB 1T5WA 2CRZA 4X4YB 3RWDB 3UPRB 4GAJH 1E6OH 4ACPA 5JW4R 3KXFE 4JVUA 5E7BA 4YH6A 1OGAB 3MV7E 4R7DB 2P8LA 4ZS7L 4JPKL 5CGMA 3I9GH 2FSEA 5IB5B 4PFEA 4LPXA 5J13B 1FE8L 3ZDYF 4IOIA 2EE2A 5D5MF 2DLTA 3EO0B 5J6HA 3EJZC 1EAPA 1ADQL 4K3EL 4U05A 2IH1B 4MX7B 2BNRA 4OLZH 2NW2A 2VAJA 4G7YH 1BAFH 4JZJC 1IAIM 3D6GA 3RVVC 2FR4A 3RP1A 5IEKA 1XFPA 3ULVL 1JN6B 1H3TA 3TFKC 4LSSL 4E42B 4HAGA 2B4CC 2G2RB 4LASH 1DSFL 3MYZA 4LDLB 4HG4J 3VCLB 1FGVH 5BS0B 1ZVHA 4MSWB 4TVSa 4DGVH 1MFAL 2HN7B 2RCSL 1TCRB 1YNLH 4KKCD 1U8IB 4OSUL 4QHLA 4P4RB 4XPGL 1G9MC 3OXSA 1CK0L 3EYOB 4ODSH 3K80A 4MA1B 4BFGA 1KN2L 4ZMAT 5CSGA 4OQTA 4NQSB 4MXVE 2IPTL 1DQTA 1YY8B 3IDJB 4ZNCD 3KPQA 1HYSC 1RUMH 4U2YA 1FL6A 5IBTL 2P5WE 1UG9A 5DQJB 3DJ9A 3GSUA 3L9RB 5I0ZA 3VFPB 4PJGF 5TH2A 1K6QL 1DL7L 3KPPB 4EVNA 3HNVL 2BDNL 3FQTA 1UM4H 4WU5A 3LN4A 3QFJE 1ZLUH 1J5OL 1CXKA 3IDUA 4MAUH 4DUXA 5C0JB 4JRYE 1XR9A 2Q8AL 5KSUB 1A0QL 3O45A 3NPSB 4R90H 3PWPD 5D7KE 4JRXB 5DVOA 4G9FB 1CVSC 4U6TA 5D7IF 3HUJF 2CJUH 2YWZA 1KELL 1CG9B 2R29H 1G7PA 3UBXG 5F1IA 2XQBH 4ZS6C 5DMYA 1G7IA 5E6IB 3FTGB 4O4YH 1UACL 3VMNA 3SCMC 4OUUA 3I3DA 4LRIC 3PHSA 1IMHC 1J87A 5D96C 2OK0L 3TVMB 1KT2A 4RGOH 3UJTL 4G5ZH 4PRPB 1NCUA 2W07A 2G60L 3LKRB 4HZLA 1KJ3H 3K3QA 4WUUE 1NDMA 3C87A 3SDDC 1JPTH 5E6IA 1MPAH 4OCYL 4DGYH 3MRLA 4BSWA 1JGEA 1G7PB 1J7VR 3WUWB 2NLJB 5GS0H 4P23B 4APQB 1LNUB 4KDVA 2E7BA 5IV2B 3FFDB 1DUZA 3QUXD 2W0PA 4XI5C 4HJ0D 4JO1L 1T66D 2PYEB 3QXVA 3O6FD 3BAEL 5BO1L 2UV3A 4XBEL 4KKAD 4LL9A 1XR9B 2E7LA 3SY0A 3NZHL 1ZT4B 1Z5LB 2J5LC 2OL3H 3OGCB 3PHQA 4R4BA 1DANT 4HCRA 4FXKA 4YHKH 3CZJA 1ZT7A 5ABDE 5EBMA 4EVNB 3KPPA 4GRWB 2KZWA 5TE7H 1B2WH 4F7MB 4BH7A 3BDBA 4P2CG 2F74B 3Q5TA 4MQTB 3RVTD 4M6MH 4R97B 4RBPK 1Z5LA 4JHZA 3KYNB 5IJKC 1VGEL 4GMTH 2R4SH 3SY0B 1T7WA 1VPOL 4RIRA 1LO5A 2APVA 3T09A 2OK0H 1GH7A 3MLUH 3D39D 5KOMC 1MCQA 3EJJX 4Y89A 2BVOB 4TUOA 5BS0A 4IMLA 3KNBA 5GZNC 3QDGD 4E42A 5I1EL 2ZUVA 3C5SA 5IG7A 1T66C 3TPUA 3GNMH 3TA3D 3O6FC 1QVOB 5IEKB 5C0CB 1JVKA 5LWYH 2BMKB 2RQ8A 5C2UB 1RIHL 2JJTA 1VFOA 1KXQE 3AMLA 4CKVX 3V6OE 4KJWC 1AHWC 3CMOL 4JLRA 1MSPA 5DDHA 2ADIA 4G5ZL 3QULA 1A7BA 1DJSA 3SQOH 3O6KH 5IB5A 5JXEA 1GGCH 1MWAL 1RJLA 4OFKA 3GMMB 3OBAA 4R7DA 4WU5B 3ARGD 5E08L 1JZ8A 3D2UD 5LQBH 3RWDA 3MRFA 3RWJB 1DFBH 1XCTB 1XF1A 4FHBD 3RUGA 4J2XA 3NIDF 3AGVA 2W9DL 4N9GA 3VFUB 4F7TA 4G6FD 4L4JA 4ZODA 4FMKA 1FZOA 2WIIA 1WZ1H 4WO4B 3EYOA 5C09A 3D0VA 4L9LC 1U8IA 1TCRA 5ALCH 5DHVH 3VG9B 3D3VD 4PG2A 4MSWA 4DK3A 3F7VA 3VCLA 1N5YH 3ILPA 5C9JB 1MWAB 2AXGB 4L1DA 5T1MA 1EVUA 2B1HH 2H32B 4XVSL 1XF2B 2G2RA 3U1SL 2DLFH 2CLRA 5EOQH 3NACH 5ITFB 4E41E 3KPSD 1OGTB 2YD2A 5KZCD 3I6GB 3BFOA 1QNZL 3NA9H 2YD3A 4WV1B 4NBYB 2IH1A 4MX7A 3BH8A 3O81A 3SDXE 2BCKA 5GGSB 1CICC 4JQXA 1P84J 5DD6A 3SPVA 1WIOA 1R5WB 1EAPB 4OD3H 1CXEA 3NIGE 4FTVA 3L5JA 3ZKNC 3K2UH 5I0DA 4XP5L 5HY9B 4UDTB 3EYUH 1U2HA 2R2HA 1KB5L 1MAML 2D7OA 2P8LB 1UKQA 1FG2B 3DSFH 4FQCH 5KSBA 3UPRA 4LHUG 5KSAA 1HHIA 3FT4B 2HKFH 3AREA 3CGTA 4TN9A 3MLVH 5FUCE 1Z0NA 5F6IC 4ZNEE 1OLZA 5B3JE 2ZOLA 1CDBA 4ZSOB 2ENYA 1MHEB 3ZE1F 2CXKA 4QRTB 3ZDYE 2WQRA 2VABA 5K33A 1KTKE 1HE7A 2Q8BL 3BDYL 3WXVH 5B39A 4LCWA 3L5IA 5IVXE 1JRHH 1ORSB 1KULA 4HS3A 2A9NL 4JM2D 3VD5A 4LRNH 4X5XA 3FRPA 2V9QA 1KTRL 5GHWL 2XKUA 1DEEA 4OZFB 4I18C 1TJIH 2FEEL 4J3TA 5E8PA 5CINL 1JL8A 2DJ4A 2NY7H 3BPCA 3G9VA 2XWTA 2FIKA 1F02I 3NIFE 1I1FA 3DVIA 3DARA 3FN9A 3QDJD 3PUCA 4PRHE 2G5BA 2VL5A 4MNQD 5B8CB 1UWGL 5FKPB 1T1WA 4OF8A 1JJUA 3WXWL 4OIBA 2UZIH 4C4KO 2H9GA 3VXSA 4GRWE 2DWEB 2VXVL 4XZUA 1F6AB 4P5KB 5MHSD 5DVKA 2JJWA 3FQRA 4KQ3L 3RWEA 4GAYB 1P2CB 2FHFA 3RVVD 3KPSE 5D7SL 3VXUD 3QEHB 5I75B 1NCCH 3G5VA 2HFGL 1HNGA 2OQJA 3QH3A 1NKOA 5EN2A 4JFFB 2DF3A 3ARZA 5IB1B 3KPMB 2XQYK 5GS3A 1WCBA 4OD2A 2VR5A 4OI7A 1PQZA 2G5RA 4P46C 3WLWC 4PGEA 4JFQB 4OZGA 5M95B 4P23D 1FNGA 2IPUK 1CLCA 1RURL 5T3ZD 4X9IA 1BD2B 4Y0GA 5DS8A 3IDYC 3EUUA 1DR9A 1J0IA 2VXTH 5ID1B 3KPNB 4KGLA 2LVCA 4XPAH 4YBLB 1G7LB 4K7PH 4WW2B 3ZLQC 2W0FA 1IM9A 2V2TB 4JKLA 4ELKB 2O93L 5TF1H 3H7BB 4WGVB 2JB6B 3O6LL 1CTOA 3C9NB 3WDJA 5C70A 3BGAA 4LKCA 4UNUA 3NCYP 4ELMA 1CBVL 1CLOL 4HIEB 1DLFL 1J1PH 4QNPE 2WWKT 2G9HA 4MDIB 4NPYB 2Z4QA 2MFNA 2W0LA 4R96A 4PPTA 1U6AH 5I1IL 4JM4L 3GSRA 4LPTA 5E4EC 1FAKT 3LKQA 1YMHA 3ZKMD 4XX1G 5ANMA 5IW1B 5JUEH 4XHQA 4QRRE 4R26H 1KIQB 3IDNA 4PRDB 3UTPE 4P2RE 4XNMB 2EIZB 3WLWD 1X7QA 3A67H 5BW7C 1B0RA 4PREB 2G75A 3LRGA 1Q9LB 1NFIB 1MJJB 1KFAH 3VXNA 4NGHL 4YEFA 5IGXL 1W0WA 3PGCB 4MAYC 4NC1E 4XPAL 5DFVD 1C5BL 1YJDL 4M61B 4BKLB 4FQ1H 4BH8B 5F71A 4MQ7A 3QHTC 5CMAA 1WZLA 4NO0A 2DD8L 5KS9B 1T20A 4L9DA 3WN5A 2A83B 3BWAB 1F13A 1FGVL 4YJZL 4ZO7A 5FM5M 1ZTXH 3AS3A 3OKMA 4QHMA 3JTTA 4HQQL 3Q5YA 3BHBA 1NMCB 4Y1AD 3WEXA 1I4FA 1D9KB 3BRDA 5HI4C 1Z6JT 2E6JA 3UCRA 3LEVH 5SX4H 2Y72A 2MJWA 5ENWA 4M7JL 3STBA 4QOKD 1YA5A 2DDQL 3W39A 1ZLWH 2P45B 5GGRA 3WD5H 5HSFA 4U6HB 5C0IA 3GSVB 4S10A 3MA7B 4HUWB 1GGYA 1NEUA 3FCTA 4YEEA 2DQEL 2A0LD 3BKCH 4O5LH 4FQ1L 3TT3H 1UJTA 2ICWI 3TIEA 3DVGB 4IRJB 3VFTB 3MXVH 3RU8H 2UVFA 4GW5A 3R8QA 1DVFD 1Y6NR 4NN6C 5I66A 4MLSA 1XZ0B 5GJTH 4XP9L 3TJHC 1BJ8A 1OAZH 4L3EB 4EOWH 3BP6B 4YBQD 1OAQL 1ZLUK 4HJGA 5CSZB 4WFGD 1BFVL 5F7DB 1HIMH 4O51B 5DT1H 3MBEB 3L95A 4XNXL 4KI5D 2NY3B 3C5JA 4RDQG 3EAKA 3FB8A 3KYKH 4XCCL 3MO1A 3NCJH 3BKYH 1FGNH 2EDJA 4X6DB 3BW9A 2VLLB 4NIKB 3EYFB 5B4MC 3CFBB 4LSPH 4YHIA 4YHML 4Y5XB 4PGBA 3DMMD 3TBVB 1OARH 3CMOH 2BNUB 4OZHB 3UO1H 2CDGA 2EEAA 5BV7B 2WWKO 1LE5A 3X12A 3KHQA 3ARBD 3MV01 1FO0B 5HDLA 1IKNC 4FP8L 5T3XE 5T3XL 2BXYA 4XI5D 2PXYD 4LLWB 5I1EH 4CW1A 5EU5B 2BJMH 4DZBB 1NKRA 1N2RB 1ZLSH 4M7JH 1IC4L 4X99A 2DQUH 4UQ3A 4NJAL 3UTQA 1X6LA 3FO0H 5DD5H 4QCIA 2YA1A 5E8NB 2C3XA 3TT1L 1QLFA 1BMGA 1BFVH 3F62A 5FXCH 5HYJD 1IBGH 1MCKA 4QOKE 1RIVH 1NLDH 3ARDD 2BXZA 4MB5A 2ZOKA 4TRPH 5C0EB 5FM8A 3HLAB 1WLHA 4K71C 3DYPA 1XF5A 3IVKB 4WGWB 3OR7B 3BZEB 3HMWH 3VWJC 4UNVA 2NYYD 1BVZA 4DCQB 1CQKA 2P48B 3JWDC 1N6VA 2X1XR 4WW2F 2R2CA 3IDIB 2ATPA 3MSPA 5LJYH 3L6FA 4GRLA 5IFJB 3ALXA 3PE9A 3L7EA 4XCEA 2X70A 4LP5A 4K3HA 3B9KC 5AZ2L 4P9ML 1RJYB 2A74A 1CLZH 3CFEB 1I1YB 4W4NA 4FQLH 2HYMA 2VN7A 1EHXA 3UTSE 4J6RL 3BN9C 1C5CL 1YEIH 5E03A 2V6HA 4RAUA 4RGNB 4HBCH 5KZCB 2HWZL 4GRWF 3CFKA 4PRIB 3FB7A 3QDGB 3W0WD 2P46B 3R06A 1R24A 2AEQL 3MJ9H 4QXWA 5ECJE 4ZUWA 1OWWA 1S7UA 1M7IA 4I0KA 12E8H 4KJPC 1DN0A 2IQAB 1E4XL 3OR6A 4PJDB 2NYYC 3HMWL 1KCLA 3QRGH 4N1CA 3PWLB 4X4ME 4FQJL 1CT8B 3SE9L 3WSQH 2HH0L 3S34H 4PV8B 5FDWB 3O3AA 3CK0L 4XMLL 2EKSB 4Z95H 1P7KB 3MRGA 2R1XA 4JDZB 1QQDA 1RUAH 3B2UC 2YD6A 1G7MB 1G6VK 4M1CD 2R1WB 4A6YA 1A4KA 3IFLL 5T33H 1XF3B 3QXDA 1W8NA 4CGTA 1UYWH 3BYTA 5JORB 1MHHB 4KZEH 4LDOB 3GB7A 2HVJA 4HWUA 3QDMB 4OCWH 2AKRA 4ISVB 4AL8L 4E0RA 1FO0L 3SJVD 3AROA 5I8KL 4G9DA 5A16A 5IIEB 1JNHA 4H88H 3S4SA 1M6OA 1KPRB 1PVHA 5KVMC 4CU8A 3RGVA 2BNQD 1O7VA 2QQKL 1J0YA 1FC1A 4RZCB 4YX2H 1NANH 4WFFE 5T1DL 5D9SA 4HK0B 1QG3A 2J8UB 4G6KL 2KH2B 3ARED 4P3WA 1CFNA 3P4OA 3DECA 3JV5A 2YS4A 3B2UD 1XGRA 5HVHB 4XWOC 2W65B 1JGVL 1OSZB 4NKMB 4D0DB 1WICA 4AEIH 1K2DB 1N59B 4PJDE 3MJ7B 1K5NB 5IVOA 3ZE2F 2CK0H 1N3NA 5HYFA 1A6TA 4DEPC 5D72H 1UB6A 4Y16C 1TJIL 4CU6A 3HPLB 2DS4A 4LKXB 4OZIB 4P2QD 3LD8C 5L8JB 1BJMA 2MMXA 3K8KA 3MRDA 3NZ8A 5SWQB 1RK0A 2E27H 1D5XB 4RQQA 5D7SH 2N7AA 4K55A 1PW3A 3U0PA 5C8JA 3CXDH 1OHQA 4P46A 4PTTA 1AD0A 3WXWH 2V5SA 4W81A 2C3WA 3D1MC 3P4MA 1NQBA 4K3JL 3GI8L 2H41A 4LF3B 1MRDL 2GSGA 3DIFB 3LQZB 3WNNA 1FIEA 5HHME 1WC7A 4JFPB 4E9LA 3AREC 4JM2B 4OKVA 2NY2B 3C08H 5H2BB 5IROA 3HR6A 3UBXA 3R1GH 2LE9A 4LLMA 1KG0B 2BSRB 5TF1L 2APFA 1OW0A 3QUZC 1X5KA 1G6RA 3T0ED 3OAYK 3G04B 4L8DA 3X11A 5I17A 5KTEL 4PJEB 4OLUH 4PJ5D 1K8IA 5C07D 3O3EB 3GK8L 4RFNB 4WVRA 3MNWB 3AUVA 1D5BB 5IFHL 3Q6GH 1EUTA 5C7XL 5H35A 5JOPD 4XNZB 2W60B 3ZDXE 4RFOH 5DD3L 3LS4H 2DLIA 1C5BH 1YJDH 3OKOA 3DURA 2BNQE 3LB6D 3LH2L 3W11C 1T22B 3MCG1 1S78C 2HFTA 2VSCA 4X6FB 4JPKH 5DR5H 2R8SH 3B83A 2F8OA 2LU4A 1E28B 1NJ9B 2RGSA 3WHXB 2F54B 4CMHC 1OQXA 1HQRA 1NGXB 5K9QG 3H42H 4YQXL 1YECH 1BGXH 4QXGH 1V3JA 1WUNT 1BM3H 1GZQB 4NGHH 2IMNA 3MTRA 3QXTA 1G7HA 2GKIA 3QIWA 4HXBH 4Z78A 1U93A 2CKBH 1JF5A 3CVHA 4HPOH 4F58L 4YDKL 3LKOB 4NCDA 5TPWH 5IQ9B 3TESA 3MMEA 2VJXA 2W0KA 4FTVE 4D2NA 5HI3C 1C5DA 4N0FB 4M5YL 3QWOA 1FZJB 1KPUB 3D39E 3LZFL 3RY5A 1PKQE 4GSDL 4WNQB 4OB5L 5DJ6A 5D7JC 5TGBA 2OMBA 1W0VA 4YDLB 2R0LL 4Z7WA 2WBKA 2WP3T 3ARSA 1XGPB 1KTDB 4ZAKA 4KMTL 1UZ8B 2FBOJ 4KI5C 1SMOA 3I85A 1I8LA 1U95B 2VLMD 1RULL 5JXAL 1U42A 4U1NB 3PL6C 4NP4H 4O02H 3SOBH 1HN1A 3NABH 1EFXB 1QSEA 4H26A 1SVCP 1AGEA 4GS7C 2GSIB 3IB4A 1NGZB 3C6SA 1T4KA 3GMRA 3O3DB 4YGVA 3DMMC 3VRJA 4LQFL 4ZAKD 5HPOA 2BFVL 3H9SB 3V5DA 1G7QB 5IBLC 1JK8B 1U8LA 3WIHL 1T4KB 3VRJB 1NGZA 3GMRB 5HYSG 4C83B 3BH9B 5D1ZB 3P9MB 2GJ6D 4OFYA 3WE6A 3FQXB 4GW1A 4U1NA 3NVQA 3SN6N 5D1QD 3QJFB 5JW5A 1DVFB 1F45A 1MFNA 1AGFB 3WFDL 4I8DA 1H3PH 5M94B 2IG2L 4X9GA 3DHMA 4YDIL 4JY6A 4N8VB 4L3AA 3ISWA 2OR8A 4ZPVB 5FYJL 4RRPG 5I8OL 1U8NA 3FONB 4QOKA 3HZKA 4J8RA 3D9AL 2F5AL 3VXUE 1ONQA 2ZWLT 4YBHA 4YQXH 1L0XA 1F3DH 5FOJA 5EU7E 2FB4L 1BLNB 1VB9A 4XH2B 1JYWA 4MWFA 2YK1L 1BQHG 2R0WL 3QIBA 3P4NA 5FO8B 3D3VE 1FZKA 4N0YH 5K9JL 3HPJB 4KU1A 4NQEA 2CDFA 4YDKH 3VXRB 3RWGB 3L5XL 1ZGLM 2VDLL 3LIZH 4N68A 5D2LB 5GGVY 1ZGLB 2R23A 3IXTA 4KKCC 1AH1A 3UTZB 2W91A 3S3SA 1JIBA 1NGXA 1RZ8B 3Q3GB 1I1AC 2Z35A 2L7JA 2AQ1A 2IEPA 2ADFH 2IBBA 1T03L 1C1EL 3E8UL 1HHJB 2N1KA 3VFWB 4HLZH 4Y2DC 3M1BA 5I1HL 1TDQA 3B6SA 3TYFB 1ETZB 3RY6A 3P11H 5H35B 3BJ91 3I84A 1BBDL 1I8IB 1NCBH 1BVKB 2HVKA 3Q2CA 1KN4H 5JOFA 4G6MH 5CIPB 3TO4C 4D9LL 5ACLA 3ZDZE 3RWFB 2ZJSL 4TRPL 2GW5A 1G6RB 2AJ3B 5I17B 2V5TA 1A3QA 4I0PD 1IBGL 3B3IA 4XRCB 4LLMB 3O2DL 4GUPB 4MMXC 3ARDC 1KXTB 5F6HI 5C0ND 1LEKB 1JHLL 1R3JA 1QTYT 3N1QC 4Z7WF 5I1LB 5IM7A 1BOYA 3ULVF 3QJHA 5F1NB 5MEPB 1IEAB 3ZZ1A 2LTQC 1FORH 4KK8D 5K59E 3TBTB 1FCCA 4JFDE 5E94B 3TP4A 3DUHA 5CJXA 1CZ8H 1FZMB 1S9XA 5A2JH 3CK0H 4XMLH 4GLRH 2EZ0C 4PTTB 2ITDA 1FNAA 4XCNB 2XN9A 3ZTNH 3QRGL 2IADA 4XAKE 4DUVA 1AGBB 3BEVA 1ZWIB 2BVPA 1RZIB 4J6RH 5D1XB 4DN3L 4MXVF 2OM5A 5SV3A 3S3PA 1WEJL 4LKXA 1KOAA 1QFOA 3HPLA 4WTXA 4XXDB 4Q9BA 4WU7A 1KF9B 2DQFA 2IFGA 2NY6B 3C09B 1N64H 4DKEH 3OF6D 1KJ2H 3RKDD 1H15B 3IFLH 4X0KA 5T33L 4FOMA 1A6WH 3SCMA 4CVXB 5J9PB 4X4MA 2W65A 4L8SB 3F58H 4WWID 5DO2D 1QNZH 3NA9L 3P4OB 1O7SA 5DA0B 4FFYH 5LGJA 3VWJD 1EXUB 1EMTH 1UQSB 3F6IA 1X4ZA 3ROLA 2J4WL 3CC5B 3FO9B 2YD4A 4Y88A 4XP5H 5GRVL 3X14A 2DMCA 5DJDA 1IQWL 5C0BE 4XNQA 2E7MA 3BO8A 1M6OB 3EFFB 5GS0C 1YPZA 1SYVB 5JO5B 5IEHA 1OM3L 5HYSA 3VI3E 2V7HB 2X4SA 3E0GA 1I1CA 2ZPKL 4KMLB 2P4AB 4KHTL 5EUOA 5ACZA 4ISVA 5T3ZE 3FOMB 3S7GA 1CGTA 1HEZA 2VNCA 3GMOA 1AQKH 4XHJD 1MCBA 3VXPB 4G8GA 2HMID 3B5TA 4HFWA 3GMPA 3MRHA 3SDCC 4KJWD 1B4JL 2ERJB 5BMFL 3OQ3B 4U1LA 5KJRL 1I3GH 5I1CH 1N6QL 1TJGL 3GI9H 4JPWL 4Y4KC 3BT2L 2IAMD 3E6HA 3MRGB 1DUYA 1P7KA 5KANG 2E3VA 3CX5J 4KUZL 3W0WB 2IPKA 5EU6B 2WMPA 1CVRA 3GSQB 5C6WH 2ZG1A 4YUEL 4GAJL 4HGKC 4X6BB 5EZIL 5FECB 4HMCA 1TQCC 2V2XA 3DV6A 1DN0B 1N5YL 3OAZK 3BPOB 4FQXA 4P2RD 3K46A 1YNTA 2D7MA 4LLAA 1M7IB 3ZO0A 4LQ1A 4Y1AB 4AENA 3ILQD 4XAWL 4DN4H 4TNVF 4KHXL 3L1OL 4LNVA 3VRLE 4OQTL 4PRIA 3CFKB 4UBDD 1DZBA 1VGKB 4O9HL 4P2YA 1CI5A 1A4JA 5D8JL 1RUQL 5HGBB 4QRRB 3EGSB 4RAUB 1TVDA 3VFOA 3MZGB 4W4OC 5I1JL 1GHFL 2PTUA 1B9ZA 4MD4B 4FQQB 1T2JA 4XPBL 2A74B 3CFEA 3O0RL 4LASL 3MROA 5FHBL 1NFDE 2X7LA 3ARDA 4C56D 2X70B 2Y06L 3CH1A 5IOPB 4WHYG 2Z91A 3NIDE 3QUXB 5ERWA 3CPLA 1FVEB 1AGDA 1A7NL 2VAAA 4M7KH 3U7YH 2E5EA 2FDBP 3KLAA 4FQHA 5HGDB 4Y4FD 3EOYG 1XH3B 3IDMB 4JPVH 2NW3A 2FO4A 5DJ2A 1BECA 1YEGL 2FECL 3PDOB 4ZFZB 4DN4L 25C8H 2NXZC 2LQRA 4ZYKB 3RJQB 32C2B 3MRPA 1QLFB 2YRZA 1Q38A 2HT3D 2VDKL 2WZPD 3DO7A 5E8NA 3W9EA 3ZKXC 2EH7L 5EU3A 4OM0H 4KXZI 1IFHL 2BNQA 1I9IH 4M8VA 1N2RA 3TA3C 3D39B 4KMTH 5HPMB 4FQ2L 4NKIH 1T1ZA 4G8GD 5J12B 5E0QA 1U6AL 4CMMB 5IHUH 1QSEE 1CGSL 1MY5A 5EULV 3V5KA 3HR5B 3O11A 4DW2H 1UCBL 4XP4H 1DQJB 4KH2A 3G6AB 4O02L 1LGVA 1UH3A 3L3OA 4G6JL 1WFTA 3I50H 3QG6A 1OP5K 3U9PH 2GUOA 1ACZA 1L7IL 1HHKB 2Z8SA 4HXBL 4I2XE 4KI5E 2CLZB 2VLLA 1NMAL 3FO1B 3OB8A 4HUNB 4JANB 5D8JH 5HHOD 4NCC1 4MAYD 3KGRA 4ODUB 4PJHA 4UV4H 2P47B 4PRNA 3N85H 2V5MA 5HGGS 5FUZL 4L4TA 4P0DA 4S1QL 4HXAH 4M5YH 2AXHA 4U6XB 1FCGA 3MRJA 1RJCA 2MHAA 2HT3C 4P4KD 4U1GB 4M3KB 2IANA 4RMVA 2FRGP 1YC7A 1S7WA 3SE4C 5HHOA 5DJCA 2ICEB 2QBWA 3D2UB 5I8OH 3O4LE 4WHCA 5EZLA 2XPGA 5CKGA 3U30C 4GG6A 3EDFA 1WT5A 5IMKA 4JQIH 3TVMD 3JVGC 3RWIB 3QUKB 1X5XA 1EFXD 3QXUA 4IRZL 4NQEE 4P59H 1GPOH 1QEWA 2C4FU 5KOVC 4F58H 2P7TB 3CLEL 3GSXB 1MRCL 4CNIA