5JQHC

Structure of beta2 adrenoceptor bound to carazolol and inactive-state stabilizing nanobody, nb60
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
120
structure length
120
Chain Sequence
b'QVQLQESGGGLVQAGGSLRLSCAASGSIFSLNDMGWYRQAPGKLRELVAAITSGGSTKYADSVKGRFTISRDNAKNTVYLQMNSLKAEDTAVYYCNAKVAGTFSIYDYWGQGTQVTVSSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endolysin,Beta-2 adrenergic receptor
publication title Allosteric nanobodies reveal the dynamic range and diverse mechanisms of G-protein-coupled receptor activation.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Signaling protein, hydrolase/inhibitor
total genus 23
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jqhC00
4IMKC 4OLZL 5ACZB 3RWEA 1RZ8A 1JZ2A 3S8WA 3BRDA 3C8DA 4NOBA 5F9OH 3HE6B 3UAJD 2VLRD 4H8WC 1UQSB 3LQAH 2VQ1A 5K93A 1YMHB 2HAZA 4OZHA 1UADC 3P0YH 1AHWA 1NH6A 5C09A 5E8PB 5T3XD 2X7LA 2VWEE 3T3MF 4DKEL 1A7BA 4HZAA 3BZ4B 2OJEB 5I73B 1OPGL 5MEQB 2CJUL 3B5GA 5GGVY 5HYQB 3BIAX 1OTTC 3MRCA 4XTRC 4ZPVB 4F7MA 4KK9C 4G43A 3VWJB 3D39A 4BSWA 1WBYB 1FO0L 4S1QH 3ZDZF 3VFVB 4OV6F 3ARDC 4LHUD 5LVEA 4R97C 5ISZB 4IRZL 1UWXH 4MSWA 3UZQA 3GHBH 5C08B 2A77L 5IM7A 2XXMB 4AM0A 1KB5H 4ZAKA 2RQ8A 2E7LC 1MFDL 1JFQL 4OLZH 1P6FA 4XX1G 4P2QB 5FO7A 1NDMB 2H8PB 2YD1A 4QCIA 2NY3B 1MLBA 1LK2A 3U0WL 5DEFA 2H9GA 5C1MB 3VD7A 4XZUA 3RRQA 3OPZL 3KNBA 5EA0L 3VFSB 1H15A 3LRSB 4BSJA 4Q9RH 5JUEL 3RL2A 1OAQH 3GSOA 5ENWB 3HZKA 1BBJA 3B2VL 2X2YA 3PGDA 1FNFA 3WDHA 4XMKL 4G8IB 3U79A 4Z7WB 1W0VA 5JLZA 4DKEH 1OPGH 3TNMB 3ETBF 1VA9A 2CJUH 3VXTB 5E6ZA 5IIEB 4CVUA 1MIML 1A2YA 2FBJL 3EIFA 1XR9A 4ZUWA 1V3KA 5GJTL 4K8RD 5DK2B 3V7AG 3RNQB 1G7HB 1NCWL 2P5EE 2DRUA 4P2OC 2VLKE 1NMCC 4IRZH 4KHTL 1N0LA 4FTVE 2A77H 1HOCB 3UTQB 1MRDL 4WO4A 2K1MA 1J9CT 1MFDH 5F7MC 3T0AA 4LCCA 6CGTA 1SM3L 2A6JA 4GRWB 4XNYL 4OLVL 1T1XB 4GO6B 2XN9D 1TTFA 32C2B 4ZYKB 1MNUH 4G6JL 4LSPL 3D0VB 3OWEA 2EDTA 4PRHE 1N3NA 5EA0H 2FLBT 1WC7B 4ODWB 5IVXB 5E5MA 4M1CC 5JUEH 3VE0B 3OX8A 3L5HA 1UACL 3LN4A 4I18B 3WFHA 5INDA 5DC4B 5GGVH 1T5XB 5CINL 5IFHL 4WHYH 4LBEA 2XV6B 2P5ED 2ITDB 5D6DA 2VLKD 5FOJA 5F1NA 4HWBA 2W0FA 5EIQA 4CVXA 3SE3A 2EZ0D 3TVMA 4CMMB 2MHAA 3AXLA 3E8UL 1G9MH 1KEML 2X9WA 1GGBL 4QRQB 2GEEA 4QRRB 4I2XB 3FB7B 1ZGLP 1NCWH 1UJ3C 2WINB 5FCUL 4KHTH 1MJ8H 5GS0L 2L7UA 2D7TL 2GSIA 2ZUXA 5JW3H 3N50A 3W39A 3G5VB 1KIRA 1MRDH 2EIZB 1UWEH 4PRHD 2AJVL 5C0JB 1E28B 3VG9C 1VFOA 3ECBA 3E6FB 4WTXA 4YDKL 5C0AB 3DX6A 4NN5B 2ZOLB 5GRUL 2XZZA 3LOWA 4LSPH 2LTQB 3V5HB 1D5MA 5TGBB 5CMAB 4MAYD 5E2VL 3RWIB 4V1DA 4YBQC 5KJRL 2Z92A 4L9LC 4KJYA 1UACH 2R1YA 3DURB 1UVQA 2GFBA 3BUTA 1V3LA 3SPVB 3VDCA 4WTZG 3KYOB 4NNXA 3RVUC 5IFHH 4JFZL 5J1AA 5GRZA 5DVMA 5SX5H 9CGTA 3RVXC 5IROC 2FGWL 7FABH 3RZCB 5H35A 2ESVA 5E2JA 3E8UH 1KEMH 1NMAL 2W65B 4PREA 3WFEH 3PIQA 3RY4A 1WICA 3GGWA 2GTWB 4LLYA 1KEGL 3IETA 3NAAL 3B9KC 5IB3A 1IT9H 4C83B 3UBXB 3U4EA 3IJHA 1Q72H 3ROLA 4EDXA 5D70H 3IYLW 4HMEA 3QIBB 1S78C 1RJYA 3SOBL 5DUBB 2AJVH 1HXYA 4B0MM 4CJ1A 4OFIA 3QJFB 3STBA 4HX1B 1CQYA 4LLVB 1YEDA 3BP5B 1QBLL 4YDKH 5HJ3A 3VXPB 3IRZA 3KPSE 4O2EA 3IDMA 3QUZC 5C0BD 5D5MF 1RZKL 3KDMA 3FKUS 5E2VH 4JR9L 2BHUA 4B7LA 3O3EA 1REIA 1JWSB 3P11H 1DN0B 5L0QC 4HBQA 4U6VL 2HT2C 3PXHA 2XQYG 4UAOB 2EO1A 4GSDL 3JSSA 3RWDB 4JFZH 5ACZA 4YHPB 1JJUA 3QQNA 1V5JA 2NR6D 1U3HC 1Y6KR 5LAXB 5KG9B 2G75A 1JK8B 2GITB 3STLB 2UZIH 4R2GB 3QUKB 4OJFH 3J8F7 2ZCHL 1A14H 4XNZC 1KEGH 1YJDH 2PYEB 5FYKD 5F6HI 5CD3B 2WW8A 2W0LA 4R0LA 1KB9J 5E8PA 2HWZL 3O6FC 2I07B 1ADQL 1NC2A 4KROD 2X70B 2OJEA 5MEQA 4S1RH 3KG5A 2WWMD 2XICA 1QBLH 2AP2A 2ZSWB 5HGDB 5KVMC 1FFPB 4KDWA 3U2SA 1DTUA 3QFJE 1RZKH 3QUXA 3ZDYE 1ZLUH 2IAMD 4IIQC 4TVPE 1AD9B 2KZ1B 3OKYA 5L2KA 1FAIL 1KOAA 4U6VH 1MJ7L 4LGSB 3S5LB 3BIBX 3T04D 4GSDH 3EDKA 3RVTC 4WCYH 4P2QA 4UB0H 1IKNA 4ZPTB 4D3CL 4KKLD 1CE1L 2NY0C 1U9KA 4DN3H 1SY6H 1WBXB 2BY2A 1F02I 4N0FA 5EORH 2ARJB 4ODHL 3LRSA 1TQCC 2F54E 2ZCHH 5KAQF 1QSEB 4X7FC 1IGCL 4P46C 5F7YC 3VGAC 2FO1A 2ZUTA 4FZEL 5ENWA 2LFGA 4X80L 4YWGL 2IPUG 5H94A 2J3SA 4H8WL 3GHEL 4QHKI 3UTTA 5MI0C 1ADQH 3QFJD 3B43A 3TNMA 4JFQB 4HHAB 5CCKH 4TVPD 1S3KL 3DRTB 1KJ2B 2GT9A 2MQ0A 5DO2C 4YHML 3PWUB 4GMSH 2AJSL 3O6ML 1HH6B 1G7HA 4BH7B 2IC2A 4L8SC 2BVPB 1JHLH 3ZDXE 5A2JH 1HXMB 2IJ0C 5GQBA 1QUNA 3MGTB 1MJ7H 3OTTA 4NQVA 4OFPA 1NBZB 4HLJA 4NRYA 1GYAA 2R9HC 1Y0LB 4HEPG 4NIKB 3DMMC 5HGGS 5EUKA 1CE1H 3IXAB 32C2A 1A7PL 4ZYKA 4N8PA 4G8GE 4DEPB 4I9WD 3AAZA 3HFML 4ODHH 3T0EC 5JW4R 4KPHL 1WT5A 1CFBA 1XF1A 3HI6L 4KKCC 3SE9L 3CLEH 1XR8B 3CFJB 3PWNB 4X80H 5D4QA 3VH8G 4H8WH 3GHEH 1Q94B 2VLRB 2DLFL 3VD9A 1Q0XH 1CXEA 4OCYH 5D6CA 5T1KD 1GL4B 3TZVA 4YHMH 4JVWA 4TNVF 1T80A 2AJSH 2ZKHH 3OR6A 5LWYL 1YEFL 1NGQL 3EDFA 1YQVH 5TPWH 1RIVL 1CDJA 1P4BL 1FL3B 3K81A 3G5VA 4XPAH 3MRFA 1KCRL 2K3TA 1MHEA 5ESAB 3VCLA 5ACMA 1E28A 5IMKB 4JM2D 4LAQL 3E6FA 3MRMB 4P4KA 4CW1A 3O11A 2PTTB 4HJJL 1A7PH 2FB4L 1LQSR 4PJ9D 3CDGA 2QTEA 1IKFL 5TGBA 4JE4B 2X9YA 3HFMH 2FIRT 4OM1L 3RWIA 4KPHH 3O41A 3AVEA 2J4WL 2GAZB 3B9EA 3HI6H 3ZE2F 1CFQB 3D3VE 4AY0A 3O81A 3CH8A 3DURA 3QNYB 4TSBL 5F8RC 4QKXB 3MLPA 3BGFB 3L1OL 3KYOA 2DLFH 2WUCH 4O00A 3BZEB 5B38B 2IALB 3CDCA 3KLHD 1U3YA 4JRYE 3MCKA 3RZCA 2V9RA 1PJ9A 2JJTC 2W65A 2GTWA 4QNPF 1K8DB 1U8IB 1TENA 4N5ED 4GMTH 3UBXA 3NBNA 1MJJA 1RIVH 1P4BH 4PJDE 3KXFE 3MRQB 1WVZA 3MBXL 3TWCL 5F7DB 1QR4A 5DUBA 4QO1A 3L6FB 2FZ3A 4FFVD 3OKDA 2FEDD 2BSSA 2B1HH 5E5UB 3BP5A 1HEZB 5D5MB 3DI3B 1NDGA 3TCXA 1IKFH 1FFRA 3HLAA 5JMOC 3U46B 4OM1H 3VXOB 1XF4A 1MWAL 3GI9L 5CJ8A 3ULSB 1QO3B 3DYOA 3IU4H 1DN0A 3GM0A 4PTUB 1CGWA 4TSBH 1RULL 3MRGA 1K4DB 2XN9B 4FFYH 3L1OH 2RGSA 1EERB 3BE1L 3RWDA 3NACH 3ZHDA 1CTNA 5KVFH 3V4UL 3DVGB 3WD5L 4LHQB 5KG9A 2R56H 3FHQA 1YUHA 1JK8A 3KXFD 5BS0E 1GOGA 1U8HB 3STLA 5D2NE 3IFPA 5D7JD 1BZ9A 3EYSL 5TDNB 3WN5B 2OTUA 3ZE0E 4U6YB 1UA6H 5JR1L 2ZCLH 5CD3A 2AJYH 2OMNA 3DHMA 3TWCH 4KDTC 3RGVC 3E3QE 2RAMA 1AFVH 4IM8A 4ORGB 2ATKB 2ZSWA 3VFGH 5HGDA 1OSZA 2CXGA 1T6WA 3HAEB 4OKDA 1FFPA 3CPLA 1KJMA 5BV7L 4R4BB 5FKAB 5IJVB 1WK0A 1MWAH 5JPMA 5HHNB 4JY6B 1U2CA 2DQIH 3NFSL 4M6ML 3WNMA 2QQNH 3MLWL 4XCEB 3ULUF 5BS0D 1RULH 4PR5B 5L2JB 4LLAA 4Y19E 3S5LA 4MMXC 3PXJA 5IT2L 2ZPKL 3WD5H 3LS4L 3DJ9A 3PDDA 5KOVC 5JZ7D 3P4LA 1KTKE 1WBXA 1CFTA 3RQ3A 1UZ8A 2ARJA 2F5BL 4X6BB 3PV6B 1JGEA 5LXGH 1AH1A 1BD2A 1S9YB 4X6DA 1I8MA 4BFBD 4NQCE 1N0XL 4N0UB 2ICEA 4PRAB 4E42B 1BQLL 4JFQA 2XG5A 12E8L 2DTSA 1KJ2A 4P9MH 2P44B 2VXVL 3HC0A 5J7CC 3PWUA 4HH9B 4K71B 1UH4A 3QYCA 2VLLB 1WAAE 4ZNEA 4UDUB 3RWHB 2E6JA 4AIZA 1SBBA 5ID0B 1G7MB 3AMLA 4AK1A 3A67L 5HD8D 1EEQA 4PJFA 4ZUUB 2WBJC 3SKMB 1HXMA 5C70A 3MLWH 4P5TC 4ESKA 5IJKA 3IDIB 3MGTA 3TNNB 2YPLE 5LGHL 4JFOA 4N0CD 5IT2H 3KPRE 1Y0LA 4X7EC 5C0BB 3LS4H 3TYFB 1A4JA 1BPVA 3SDXA 4XX1E 3TM6A 1YNTB 5DJ8B 4N5UA 5FXCH 2F5BH 2V7HB 1IMHC 2A73B 1XR8A 3PWNA 1MCFA 4EDWH 5FGBA 3G08A 5FF6A 1DANU 1N0XH 5D2LE 1Q94A 2VLRA 4MJ5B 1PEZA 1A1MA 1BQLH 4QXWA 1G6RB 3TBYB 4YJZL 5HGBB 4OCWL 2VXVH 3SO3C 1H3XA 2DQTL 3KPRD 5FM8A 5J6GA 2X1OA 5IB2B 4KROB 1NC4D 2J7LA 2FX7L 3PL6C 1R0AH 3WFCL 5DQJB 5DJZB 1FZMB 2JE8A 2V7NB 3D25A 2A74B 5ELIA 3NTCL 2BVTA 5LGHH 2SEBB 5CZXC 4NQEE 3REWB 1CQKA 1TMCB 1MI5E 5IBLD 2RFXB 4XWOC 1PG7W 1JPSH 4LHUA 2PTTA 5GS0D 2IAMB 5BZDB 4PRDB 3P73A 4JY5L 4LVHC 4X9BA 5TQ2L 4G7YH 4WI9A 3RU8L 3C08H 4E41E 4BFGA 3H3KA 4UNUA 1IM9D 4CU6A 3FB5A 2GAZA 5DTFA 4Q74A 1FV1A 2LAAA 2YPVL 5IGXL 3NVQA 5D1ZD 2E6PA 1O5DT 1T6VN 5L8JB 3PHOB 3GSNB 2VZ3A 5I6XC 5JW5B 1CFSA 3BZEA 1MELA 4ELMF 2MQ3A 3S7GA 1Y6MR 4C59B 3FB6B 1X9QA 5J8OA 5MERA 1ZA3B 3VRJB 2QQLL 4I0PC 2Y6SD 3GSVB 2ICES 1NAMA 2DQTH 1U8IA 1GGUA 4NQED 3GMOB 2FR4B 3RWCB 1HILA 2FX7H 2W1NA 2YD7A 3WFCH 2IMNA 3MRQA 4RFOL 4EBQH 3NTCH 4FQJL 4E41D 2EEBA 4MYWB 3WJLA 5CP3H 5EB9A 4X8XA 3BP7B 4FOMA 4ZFOL 1HEZA 3S4SA 4LCUA 3GEWB 2PETA 1HHKB 4JY5H 4XAKE 3EO1B 4MVBD 1FDLH 5HDQL 4YDJB 3U46A 1MAMH 3GSRB 4HK0B 2B0SL 1QO3A 3MLUH 5C3TA 1U92B 2YPVH 1C8PA 4QRPE 4GBXA 1MFCL 1KSRA 4PTUA 1RJZB 5HVHC 2ZG3A 1EAJA 3VW3L 2XN9A 4C4KO 4LASL 3P4MB 1W0YT 3MXVH 2F58H 4Y4KC 4XP4H 1T7XA 4O5LL 3WS3B 3GJFA 3VWKB 2YOCA 4M62L 1Q0YL 1U8HA 1RURH 3ABZA 5TDNA 1G7QA 3SKNA 3WN5A 4OZIF 2W60B 1B6DA 4LCIL 4JVUA 4OCXH 1F13A 3NFNB 2P5EA 3MRDA 5AG8A 2VLKA 4YR6B 5IVNA 5T1KB 4FTVA 4HBCL 4XAKD 2BY3A 4FQJH 4RMUA 4LAJH 1CXIA 2VAJA 5I1CL 3QULB 4ORGA 2FGZA 1WFOA 3HAEA 4NO0D 5GSVB 4QRPD 4R4BA 1OB1A 5F8QC 5EZLB 4FQLH 4IJ3B 2H2PD 5L8LB 5HHNA 2YSSB 4PRHA 4JY6A 2YBRA 2NW2B 3QIWD 3MACL 4QHUA 2B4CC 4Q6IC 4JM2B 4XCEA 4PR5A 4IOSD 2EDEA 4LASH 4RNRB 2EE3A 4PJ9B 4N0YL 4MAYA 4MNQE 2VSDA 4MAUH 1T1WB 4O5LH 5E8DL 3QCUL 3D18B 3R4DA 1UZ6F 4M62H 1Q0YH 2V9TA 1HQRB 4GKZB 5C0ND 5A2IH 5JMRA 4L9DA 1L0YA 1JZ5A 3Q0HA 4I1NB 1S9YA 2XXCB 1IZKA 4H25B 1KCLA 4LSVL 2AKRA 3DXAE 1I9RL 4L29B 4N8CH 3BDYL 3RDTC 5I1AB 2YA2A 1D5XB 1Z9LA 1MFBH 1RZFH 3BVNB 4M4PA 3W2DH 5I1CH 3C09B 1UWGL 4E5XA 1P53A 4HG4K 1NCAH 3C2SA 2HJFB 4GAYB 4TOYH 4HT1L 1Q9KB 1EO8L 1DEDA 4FFZH 3L5XL 1SEQL 1I4FB 3Q1SL 1DBML 3UJIL 1KC5L 2R4SH 1QBBA 1KIUA 1J12A 3FQXB 3OZ9L 4PV9B 5JO5A 4MNQD 4NKOB 4JPWL 3RBSA 3WNOA 4GKNA 3GBLA 3SKMA 3LS5L 4NHCH 1DSFL 2JLLA 4LKXB 1KJVA 3MV8E 3AM8C 1IVLA 2OYPA 2BNRB 3KPLB 4JQVA 4JQXC 4ODSH 4G8FA 4KRPD 4XTRD 5E8DH 4LRIA 3B9AA 4FMKA 3EFFB 3F65A 2R0ZL 4TNVK 1UM5H 4I77L 3WFDL 2V7HA 2X9XA 4LSVH 1AI1H 4PJGF 2W9DH 5DURB 3T0BA 3VRLE 3BDYH 4GAGL 2OTWB 3CU1A 4MJ5A 1OAUL 4U1KB 3KXFB 1TCMA 3WUWG 5CJQL 5ID1B 2VZ1A 1MCKA 1UWGH 4YXKH 4ENED 3OR7B 1IM3A 1ZA6B 4X5XB 3SDDB 3VFWA 4M9OA 1OWWA 3Q1SH 1DBMH 3MV8D 3UJIH 1CL7H 1QVOA 1NPUA 4MB4A 1R3IL 4ZDHA 4UTAL 4PJHE 4P9HC 4JPWH 3WJJA 1ZWIA 4A6YL 1E4WH 1RMFH 5T33L 5DQJA 1UJTA 5DJZA 3LS5H 4DKDC 2V7NA 2A74A 3ARSA 1DSFH 3C5ZB 3CFDB 3U36B 1QR1A 5J3HC 4J3SA 3S98A 1NBYA 1VPOL 2CIKB 2RFXA 3EOAA 4NQDD 2IADA 1KXQE 5BZDA 4PRDA 1HDMA 4XMPL 1PG7X 1R3HB 3GMRA 2R0ZH 2X1QA 2NY5C 5FYJL 2BNQB 1IEHA 5IMOB 5GHWL 4LHJB 4ISVB 3W11D 1SMOA 1FO0B 2DIBA 2OX5A 3LDBB 4MA8L 4A2MA 1LE5B 1XGUA 5GGUB 5EDXA 4ELMB 1TZHB 4GAGH 1OAUH 3JWOC 1P7QD 1ZLWH 2XWJB 2QLVB 3VRJA 4QYOB 4WWKB 1ZHLA 1KTRL 2DTMH 3MLSL 2GJZB 2GI7A 3IFNL 3QFJA 3RWCA 2CRYA 2WBKA 2VIRB 1DP0A 1H5BB 3SBWC 1AQKL 2EDFA 2H1PL 3UYOD 3LEVH 1JNNL 2ENYA 1RUPL 5I76B 3V0AC 5JDJA 3MFGB 5DRNB 2APXA 4QF1B 2OI9C 1VPOH 3OAYH 3HZMB 4Y5VB 3BP7A 5I74C 4CJ0A 2W0PA 1DL7L 1HHGB 5GISL 5IB1B 3EO1A 4E0RB 4JHWH 3MRKB 4XPGH 1YN7A 4GAFB 1ERNA 4YDJA 4DZ8B 5IFJA 5GHWH 5B21A 1KN2L 1U92A 1X5IA 2F54A 5AAWA 2P49B 1RJZA 1U58B 5C71A 4R96B 4EUPB 1U8LB 3P4MA 1J10A 4NKIL 5IR1B 5EUOE 1VFAA 4HUKB 5LCVL 2AV7B 3HB3D 4YEEA 4M6NL 4OCSH 1TCRB 4OZIB 5EN2A 2R0LH 3L3KB 2YKLL 5D9SB 2OR8A 3MLSH 3M17B 3KS0J 4NQUA 2BDNL 1T7YA 1ZLSL 3PNWB 4F37K 3IFNH 2O5YL 3VGGA 2K7PA 4U0QB 2YRPA 5E1AB 4UIMA 1AQKH 1WZ1H 3HE7D 1JGDB 3ARBD 4YR6A 1JNNH 3C6LC 1MVUA 1RUPH 2NXYC 3RVUD 4HXBH 3I6LD 3BPOB 2AV1B 1WZKA 3MJ7A 2X1XR 1SVCP 2P24B 3RVXD 5A43C 5BRZE 2FECI 3STZB 2ENSA 3KPRB 2EYTB 1HI6A 1DL7H 1NC4B 3LEYL 4IDJL 5EZLA 1F4WL 3HG1D 4UI2A 5GS2D 3QXDB 5I1JL 4PJIF 2N7AA 5IVOA 3B9KD 1KN2H 2EE2A 2DAVA 2Q6WA 2NW2A 2DYPD 5K59F 3MJ9H 4JM2A 4ZSOB 4Z7VE 4NKIH 4PP2A 5HHQA 3UC0L 4F15C 5LCVH 4G5ZL 4M6NH 3RWJB 1IM9B 2UYLA 3ELAT 2HKHL 3LKQB 2YKLH 5FGCE 3GK8H 4ZFGH 1RHHB 1HQRA 4GKZA 1NGYB 3TIEB 3QUZD 2HJLA 2BDNH 4O9HL 1ZLSH 1MHHB 2CQVA 4JRXE 3U7WL 4YZFF 1FJ1A 4H25A 1T66C 3KWWB 3C2AH 4L29A 5F93C 2HT2D 2C26A 4FQIL 5I1AA 5IKCA 3KPMB 4R7NB 2PO6C 3BVNA 2C4XA 3BN3B 3FO1B 2V5RA 3CLFH 3TIDB 4GG8A 3H7BA 4MA7L 1NGPL 3K4ZA 5FO8B 5E8EB 4GAYA 1BM3H 2CR3A 5JIKA 3BQUC 1I4FA 1B6UA 3HRPA 1QG3A 2Y06L 4UBDD 4PV9A 1FZKB 2EIEA 2CRIA 1GHFH 1FORL 5MHSD 3O6FD 4K3JH 4KMQA 2VSCA 5F7FA 4B7IA 4JRXD 3CSBA 2AK4E 3INUL 4NNYB 4G5ZH 2BVOB 4BQBA 1KBGL 1GH7A 1U8JB 5BQ7A 4GJTB 5MENB 2Q87A 1UGNA 1TNMA 2HLAB 4PJGB 1YZZA 2ERJB 3VXNB 1QNZH 4EI6B 3MV01 4PJCF 2X4OA 1C12A 3CFEB 3O3BB 4M8QB 1JZ4A 2DWDB 4FQIH 4WGWB 4PJDA 4U1KA 3OKKB 3KXFA 4PRIE 5ID1A 5D7JA 4PRNA 5CP7B 4MA7H 1TPXC 4LPCA 3FQUB 3R0MA 3OR7A 2FO4B 4KK8D 3V4VL 4RFNB 5GRVL 2H32H 3VFTA 4JDTL 4NKDB 3OHXA 1KPUB 2NY6B 3MUY1 1L6ZA 1I9IH 2Y06H 1A5FL 4K7PL 4P46D 4F7CB 2R2BB 4XNQB 3UPRB 1FORH 3QB7C 4U1GC 1CVRA 4NO0B 5DJXA 1QRNE 2BOCB 4QRPB 3U36A 3T0EE 4HFWB 3IJYB 1QEWB 2CIKA 3INUH 2B4CH 3BPLB 4WI8A 1KBGH 4U1LA 3QIWB 3T4AA 2AXHA 5CHNB 4EXPX 5IV2A 3ILPB 3HS0B 4MX7A 5BS0A 4OCMC 3C5JA 5D2NA 5E00A 5IMOA 4ISVA 1FO0A 3FN9A 3L95A 3RJDA 2RHEA 3TJHC 3BN9C 1P84K 1PSKH 3EOTH 3SKJL 1NKRA 1TZHA 4ELMA 3LQZB 1CICA 5H8DA 1AP2B 2AQ2A 3MOBH 1HSBA 3VFOA 2WQRA 3DLQR 3DMMD 3FT3B 4S0TD 5C0CE 3V4VH 3VXUE 3ZSSA 5F9WC 2APWA 3NIDE 3AUVA 4UT9L 4OUUB 4YDLB 4R7DB 1I9JL 4JDTH 4NCC1 4EKXA 2GJZA 1QRND 5EO0B 3DUHA 3WHE0 4NQSB 2DQJL 3T0ED 5MEOB 2YD2A 4W6XB 3IKCB 4WFEE 5GJSL 1IE5A 2VIRA 4KKCD 4OD2A 1ULVA 4PD4J 4Y5XB 5JOEA 4Q58C 1S7TB 2UWEE 1X5AA 3E1F1 1N2RB 2D0GA 5EFIA 4WHTB 2P7TA 3MV7B 4I4WB 4LVOB 2AJXL 4JFXB 4P23C 4Y19A 3HZMA 4Y5VA 1IAIL 2D2OA 1XCQB 4MNQB 1FN4B 4M03A 1HHGA 1G0XA 5IB1A 3MRKA 3DBXB 1JYNA 2BP3A 4RSVA 5INCB 5C0CD 3MYJB 3TBWA 4RMVA 3VXUD 3VJ6B 4KRPB 3Q3GA 4EUPA 1U8LA 2NY5L 1KNOB 3SGEH 5J06A 5J56B 1GC1C 3PGFL 2YXMA 3RY6C 1F58L 1IGJA 1MUJA 4WFED 3SDYH 4XPTL 3S9DB 4ACPA 5EO1B 3L3KA 5D9SA 3FAWA 1F6LL 2XWTA 1T0MB 4UT9H 1I9JH 1MOEA 3JV5A 4NDMB 3D5OF 4HD9A 2DQJH 2DKUA 1WAAA 3JWOL 1QSFE 5IB4B 5E1AA 1DLFL 5D6DC 3O2WH 4JFFE 1KGCE 2X4SB 3TVMC 4FMFA 5F21B 5JPNB 3H2WA 2AJXH 3O45B 1EO5A 2YPLA 3MV8B 4P9HH 5CKAA 1FPTL 4X9GA 3AS0A 4HWNA 2EDWA 3ESVF 3KPRA 4JO2L 1QLFB 4PJIB 3DVFA 1NC4A 5IEKB 1ZTXL 4PV8B 1X3DA 1J0HA 3QXDA 3VFRB 3WS6A 2H45A 2ICWB 3B3IB 5ALBH 3HNSH 3O3DB 3V79C 2UUDH 1EBPA 1KENL 4LDOB 2DQCL 4G3YH 5EU4B 3ULVH 4NQDB 4UV7L 4ZSOA 1KACB 4OLXH 5F7UA 2NY5H 3F58L 3LPGA 3NCJL 3PGFH 2AJZB 1QSFD 3BT2L 4KJWC 1F58H 5D2LA 2YS4A 4G6FD 2VN7A 4XPTH 1QQDB 1IM9A 4K3GA 3ARXA 1A6VH 2HLFC 1YNKL 1C7SA 2J8HA 4WNQB 1YEIL 1SQ2N 1OAYH 5D1ZA 1NGYA 4MZ3A 2XQBL 2R0KH 1H8OA 1JHKL 1EPFA 3IS1X 3JWOH 5I8OL 2W59A 5DHVA 3ORJA 1MFEL 3F5WB 3V8OA 4KZDL 2WMPA 3KWWA 4KZEH 3HC3L 3DGCR 4HIHA 5F89B 3PDOB 3UTZA 4RGNC 5T1LD 3L3HB 3JWDC 3T09A 3TIDA 1CTOA 1HE7A 1FPTH 2XRAH 5E4EB 2Q8BH 5FO8A 1SBSL 4NQEA 3IAPA 1EEYB 2A9NH 1MI5A 4O2CB 5F6IB 2P4AB 3DNKA 4FQCH 1ZTXH 1BAFL 3SEPA 5D7IE 4Z7OE 5DMGD 3OB0K 4JHAL 3PJSA 4X8JB 4JFHD 1FZKA 3VMOA 2OP4L 4E41A 2EYRA 1TQBC 3V0WL 2UVFA 2HFTA 4PB9L 3OBAA 1F8TH 4F7TB 3BIKB 1UH3A 3NCJH 4LNRB 1ITBB 4NNYA 1CGYA 1HZHH 3PP4H 1ZEAH 1YNKH 1YEIH 4ZXBC 3GSXA 2R2HB 2QADC 4PJCB 2XQBH 4PJGA 3V0VA 4DOHE 4G6AD 3VXNA 4DTGH 4EI6A 1JHKH 5I8OH 2X42A 5IQ7H 5IP4A 2XKUA 5J89A 1VADB 4KZDH 2AEIT 2X41A 1L9MA 3O3BA 4M8QA 4XNMB 4IOFC 3HE6C 3PG2A 2DWDA 1A6TA 1R5WA 4MJIB 3VFNB 1MCSA 3WO4B 2VUYA 5GS1B 4X4XA 4Y1AE 2VDMH 4JN2A 2E8YA 5FHAL 1Q38A 2VN4A 1SBSH 1XGYL 4PTTA 2XFXB 3PWLB 4KXZI 5DZOA 3ARQA 2R69L 3HE7B 4R90H 2GQHA 3ARBB 1VERA 5FYJE 4JHAH 1L9NA 4M8VA 1NANI 5I73C 3ARZA 3WXVL 1GAFH 2L4OA 3V0WH 4PB9H 3UPRA 5FCSH 5DVLA 4F7PA 4NO0A 3WIFA 1EEZB 2BOCA 4QRPA 1P9MA 3VWJC 2CLZB 3HG1B 4AH2B 1ADQA 3MROB 5E56A 4EOWL 3D0LB 3QP3A 3QIWA 4POZC 1QFWH 4KVCH 3VFUB 3BEVA 3HS0A 5BV7B 2D0FA 4Y1AD 5KN5A 5TFSH 3G6JE 3QFDB 1N59A 4P5TD 1INDL 5AYUL 2NY3C 3QR2A 3LQZA 4JAMA 3S36X 1PZ5A 5FYJD 4ZS7H 4MNHB 3MRJB 3FT3A 3O9WB 1IGYB 2A9ML 4K3DH 2WWKO 1A3LH 1FZJB 3B2UD 1J8HB 3GSQB 1QSZA 2R69H 2JJVA 3H9SB 5KANI 3BGAA 1ND0B 3OJDA 5EO0A 3MGOB 1AC6A 5DGQA 3SGKC 1Y18B 4LSQL 3IKCA 2GTZA 1JGVL 2H6PA 2FLRT 5EIVA 5KSBF 4WHTA 4JFXA 3WLWC 1N6QL 2VLME 2WIMA 4EOWH 5IW6B 4MNQA 3D87B 4P3WA 3U0TB 1PEWA 3DBXA 5GSRB 2OXGA 2A83A 2OSLB 1X5ZA 1NBVL 5C2UB 4LP4A 3DIFA 3VJ6A 2MFNA 5AYUH 3EYUH 4HF5L 3OMZA 3NH7H 1NCTA 8FABB 2IGFL 4G6KL 4UZGA 4HAGA 4NJAL 4YAQA 1WT5C 2VH5H 5CZVL 5EO1A 4Z8FL 5HYSB 3FO2B 4G7VL 4OZGE 4U3HA 4I18C 5FOBB 5HVWA 4NDMA 3QXVA 4WUKH 4OLUH 2E7LA 1X4ZA 5IB4A 2BMKB 4NO5B 5AG9A 3LQMA 1EV2E 1HKLH 3MMEB 4XRCB 3BD3A 2AEQL 1JGVH 1DQTA 2APTA 2VLMD 1RJLB 3TESA 2E7MA 5E6YA 3MOQA 4QT5B 3O45A 1IGFL 1NSNL 1NUFA 3R06B 1B90A 3FQWA 3MV8A 3HKFA 4KK6C 2F8XC 3P3YA 1T89A 1QLFA 1CD9B 1SJXA 2D4DA 4GG6F 1VFBB 2W92A 4U1IB 3KJ6H 4YXLL 3OG4B 3B3IA 5D1XB 3O3DA 2EC9T 3NZ8B 5EU4A 4NN5C 4NGHH 4R4NC 4NQDA 15C8L 2APVA 2LTQC 4LPUA 4AG4L 3SJVE 1ZGLA 2IGFH 2AJZA 3R0NA 4Z95L 1YECL 2YR3A 1B0WA 4G6KH 5F7LB 5DRXB 1QQDA 3MRLB 2B2XL 1YA5A 4MXVE 4P2OA 3ZE1E 4Z8FH 4WNQA 4L8SB 2E7HA 4G7VH 4JFEE 3F7QA 1GC1L 4NJ9L 4ZTOL 1G7LB 2PUQT 3IFOB 3F5WA 1Q9WB 1I1CA 4TUOA 5EU6E 1UKQA 5F89A 3PDOA 2B1AL 4FQHB 4PJHA 4Y8AA 1P7QA 2XY1A 3RZCC 4Z0XB 3UZVB 4OD1L 5I1DA 5JHLH 5FA4B 1W8NA 3L3HA 3U4BH 4Y4KD 1INEH 3UO1H 1T21B 3ARRA 3O4OB 3B8SA 4Y5YB 1YYML 1VENA 5ADOL 2BJML 3RWFB 1I7RA 5CGTA 3SJVD 1EAPB 3QIBC 4X8JA 5HPMA 2FDBP 3QDJB 1FVDB 3O3UN 1A4KB 4HAFA 2V2XA 4XP1H 3MLTA 2HG5B 5JTWA 1QLRA 3TFKC 2ADIB 4PRBA 4RA3A 4U1MA 4Z95H 1BVLB 3K2MC 1T5WB 4NZTH 2NMSA 3VI4F 3HUJE 5EU6D 3FN0L 4PS4L 2FIKB 5CD5C 5C0CB 1FFOB 1WSST 1EZVY 4WEBH 1SYVB 2FATH 2R2HA 1T0NB 4NJ9H 4OGAD 4UAOC 2VITA 4RX4D 4YPJA 1JF6A 3CCHB 3TCLA 3PHQA 3S35L 1MWAA 4W68A 4BZ1L 1OTSC 1L0XA 4Q2ZA 3U9UB 1IGML 3CDFA 1A7QL 5DJCB 3WYRA 4R2GC 4ETQA 3L9RB 4ZOCA 5FGRA 2UWEB 2YMXL 4BJLA 4NFBA 1IAOA 2DMKA 2GJ6D 4KC3B 5BO1L 1M4KA 2JB6B 4H1LH 4XBPB 2XFXA 4HWBH 4F2MB 3PWLA 4OAWA 2P5WE 3HE7A 5D7LB 5ADOH 2BJMH 3ARBA 4XCCL 3JWDL 3R8QA 3ARUA 2VR4A 5IWLC 1JZ6A 1ZSDB 5I17B 2MTPA 2OLDA 2DS4A 3QZWA 2CLZA 3ZKSD 1SJEB 2VDNH 5A2KH 1TVDA 3MROA 3TBSB 5EUOA 3D0LA 3B9KA 4PS4H 1BFSA 1WUNT 3EDJA 3L5WB 5IMLB 1RK0A 2DYPA 1DUZA 5C9JB 5EU5B 2BSTA 4UNTA 1ZHKB 1ZS8B 2PXYD 3QFDA 4D2NA 1XF5B 4M61B 1XH3B 2P5WD 4JY4B 1YEKL 3V6BR 1IGMH 2GSGB 1A7QH 3GMPB 2DM3A 5HDBF 5I2IA 1E0OB 3QUZA 1AXSB 3MRJA 4PJEF 1SJHB 2C3VB 5BO1H 1FZJA 3L3OB 5DI8A 4GQ9L 2ZZUT 2NX5B 3JWDH 4P5KB 1Y18A 1K2DB 4WI2A 5T1LB 4U3XA 4PJ5B 5E7BA 3EFDH 2BFVH 5DSCB 1ZVSB 2C3GA 3L5JA 4NZDA 3WL9A 1OM3H 5HGAB 4Z7VA 1A8JH 3BKCL 4M6OH 5E8OA 5IW6A 2QSCL 2AXFB 4ZUVB 2O5XH 3EYQC 3LN5A 5IJKC 4P99A 5GSRA 4GKSA 5CBAA 4KUCD 4YIQA 3O6FA 5CEXB 2OSLA 2VXTH 5ESQA 5TE6H 2HVKB 1OAZL 4JRXA 1K6QL 5KVEL 5E99L 4RFEB 3B9VA 3I02A 3JUZA 2GUOB 3MJ8B 4NNPL 4WEMB 43C9B 4DEPC 5J3HD 2ARJQ 4X6CF 2JIXB 8FABA 3RP1A 3QXAA 1PZUB 4MQ7B 3VRIB 3U9PL 1KIPB 3K74B 4IIQA 1KTDA 4XBGA 4Y7MA 1JIBA 4JN1L 5FOBA 4LPWA 2CK2A 3C6SB 3DV4B 2ZUQB 5HYJB 3UAJC 2GCYB 4QHLB 2BMKA 2BZDA 4NO5A 3P0VL 5D7IB 3ZKND 3MMEA 4XRCA 4P2RE 4TYUA 5AWNL 4FZ8H 1N8ZB 2P8MA 3THML 5KANG 4QHNA 5F44A 5F9JB 1A1OB 3T0DA 4XWGL 4MHHI 4WI4A 4GG6B 4YHNB 3WEXB 3BKCH 1RD6A 2QSCH 1U91A 4P46A 1KPVA 1VFBA 1GIGH 3LKNB 3N85L 3DX8B 4UIKL 5B22A 4XHJD 1VKXB 1Q9LA 2VISB 4C4KT 5E7FA 5DJ2B 4WUUB 2LAGB 1K6QH 5E99H 4UOJA 2Z0BA 5SWSE 1OQXA 5DUPL 4A6YB 4NNPH 3BH8B 1FE8L 3U6RB 5C6TL 4TSCH 2EDBA 4CNIA 4WFGE 5DRXA 2Y5TB 3QUYB 4PRIA 3MRLA 4P2RD 3U9PH 2CKBB 4Y1AB 4L8SA 2AJUL 1CXLA 4JN1H 5JHDE 3N06B 3UBXG 4P5TB 4OF7A 4XHQA 5F7WC 3BGFC 4LPVA 3P0VH 3IFOA 2DMCA 1S9VB 3TO4D 5AWNH 1H3TA 4FQHA 1F6AA 1V3JA 1S7XB 2JCCF 2PW1B 3DMMA 2V17H 4Z0XA 3RL1A 2E7CA 3THMH 5MEPB 1I7ZB 5FA4A 4XWGH 35C8L 1PQZB 1QRNA 2FH8A 4Y8DC 3T0EA 3K4AA 3HCVB 2E5EA 5DDHB 4ZNCD 4Y5YA 5SWSD 4HKJB 3KYKL 1FL5A 3MC0A 2VR9A 4UIKH 3N9GL 1E4XI 3L5IA 4S1DC 5F1IB 3WJLC 4WFGD 1CK0H 1PD6A 4K8RC 3BP6B 4J4PC 4HJ0D 4XC1L 3QI9D 5JHDD 3MV9E 5E08L 1FE8H 3P77B 1ZHNB 3MR9A 1N5AA 5C6TH 3W5NA 1U8OB 1KLUB 4KXZH 1MCPL 2HFEB 4KU1A 4FA8A 4HCRA 2X1PA 2AJUH 4MWFA 5C0CA 4ZFOA 1SYVA 3VXUA 1FCGA 4HPOL 1S5HA 5TF0A 4O58L 3CCHA 4M7LH 3QG6B 1PYWB 1R3KB 1RJCA 4NBYB 3X3GH 4LF3A 4RQQB 1MCLA 2UV3A 2UWEA 1AE6L 3PHSA 1L7IL 2JB6A 4F2MA 3WIHA 1I1AD 1BZQK 5ICYA 5EOTB 3KYKH 2CDEB 3TGXA 1G6VK 2CMRL 3DUSA 5LGJA 5I6XB 4NN6B 1NAKH 1E6JH 1MRFH 1I8KB 2XYCA 1U8KB 1T66D 5E6IB 3S5LG 3GNML 4DK6A 2D0HA 4FHBD 3V4PL 4XC1H 1CXHA 5I17A 5E08H 3GRWL 2PO6D 2JJTA 3P4OA 4YO0B 3QQ4A 5DR5L 5D1QD 2FRGP 4JZOA 1NMBH 4Z0BL 2HMID 1UB5B 3DI2B 5EH1A 1T3FB 3L5WA 5CJOL 3REVA 3BX7C 3K46A 3BQUD 4U2YA 4BKLA 3BD5A 4MD0B 3SQBA 4KHXL 5C9JA 3LHPH 1WJ3A 4OZGB 3G6AB 4RMSA 4K94L 3BKYH 1LO2L 5FV1L 1QSFA 3L3IB 1XF5A 4BK5A 4OZHE 4PJEB 4JY4A 4HUVB 1P7KB 1DFBL 3MXWL 4JFFA 1DVFD 3GMPA 5CKGA 1AE6H 5HHVL 1AXSA 3FONB 3F7YB 1L7IH 3L3OA 5EC2B 4DZBB 2Z91B 3MLRL 5DUML 4MQSB 4YNYB 3VXME 4QXTB 1MQKL 2CD0A 1X5GA 1ZK9A 1OP3K 2Y36H 5JA8B 5T1LA 3GNMH 3P4NA 4KV5E 3GBMH 2MSPA 4NN7B 1MHCB 1ZVSA 3HZYB 4K71C 5EBWA 5F1SA 5BOPA 3DTXB 2X4QA 3O6KL 3L7EB 4RGOH 4O4YL 3DVIA 3T08A 3UXFA 3VDBA 4LDEB 4KHXH 4KDTA 3RGVA 4GXUM 1ZHBA 4PP1C 2HVKA 3N1PC 3ARVA 4X6CB 1EUTA 1ZXQA 3MFFB 1JTPA 4LRIC 5JIHA 1PY4A 1BX2B 1D6EA 1DFBH 1CT8B 3MXWH 43C9A 3VXMD 1X5XA 3GMLA 2ADGA 4IS6A 1BBDL 5HDLA 3ISWA 2ZUWA 5HHVH 2C3XA 5ESVB 1JZ3A 3LKRA 3MODL 4HDIB 1B3JA 3U30B 4Z76A 3MRHB 1U8NA 1J05A 3X14B 3MLRH 2P8LB 3C6SA 5DUMH 4XB8A 5FECB 2NR6C 3FT2B 1MQKH 4ZFZB 4QHLA 3OXSA 4BSVB 5D7IA 2CK0L 2F19L 4HIJB 1I3GL 2GJ6B 4Y16B 4MMZC 5I9QB 4N9OB 4LHUG 4L4VB 4LGPB 3O6KH 2FX8L 4HIEA 3IFLH 4YHNA 2VC2L 3HNVL 1M7IB 1FVCA 3WJJC 1FVEA 2PW2A 4PJXF 2WWMC 1GZPA 2EKJA 2F53E 1HHIA 4GRMB 5J4MA 5CUSL 4P57A 1YEHH 2VDLL 3JUYA 4MA1B 5GRYA 4XP5H 2IAMC 4A6YA 3BJLA 3U6RA 2PTVA 4EQ3A 1BBDH 3QEQB 4P23D 2GYSA 5E94B 4UQ2B 3CFBA 4PJ7E 4Y1AA 1MCEA 4BQ9A 2WBJA 4JCMA 6FABH 1B0GB 2PXYB 4KKLC 4P5TA 4PGDB 1ETZB 4MXWH 2P5WB 5DRWB 4OZ4B 3DX7B 1CU4L 1B2WL 1ZMYA 2CK0H 4LSUH 1I3GH 3B6SB 4DCQA 2JELH 4YHIA 3QG7L 1VSCA 1I7ZA 1XGQB 2AEWA 2F53D 3S4SG 1QSVA 3ZL4L 3LRGA 1DEEA 2DB8A 2GHWB 4XC3H 2FX8H 3LSOB 1QBAA 3BRGC 3W9EB 3Q6GH 2BXYA 2VC2H 3HCVA 3HNVH 3QNZB 3BKJL 4Z77B 1KJ2H 4HKJA 4I8DA 4A2LA 1FNAA 2D3VA 1HSAA 5CUSH 4MHHG 3TA3B 3KYNB 5F1IA 5C0FB 2VDLH 1IC7L 4ZMAT 3I50L 1A1NB 1JWMA 1NGXB 3W0WE 3G6JA 1DQLL 3P77A 1ZHNA 1W2KT 4KH2A 5JIPA 3LD8B 4NCC2 2CO7B 3RPIB 1G9NC 4D0BB 4Z7NF 4QWWC 2UZYB 3OKMA 5M94B 2Z8SA 4RGNE 1OLZA 3I75B 1ACZA 4WJ5A 1CU4H 3QG6A 1B2WH 1PYWA 1R3KA 3K3QA 5DHXB 3V6OC 2R2EB 2VUOA 1JN6B 4LFHD 3VWKC 3QG7H 2J8UE 1TVBB 4C58B 1UWXK 1YPZF 4RQQA 3UJJL 2VZUA 3HAEG 4OQ1A 4XH2B 3ZL4H 3DETC 1Q1JL 4U7KA 4JM4L 4OGYH 2HLFD 3GSUB 5EOTA 4J3UA 3W0WD 3BUYB 4L5FL 3IRPX 4DK3A 1TJHL 3HHRB 2XACC 3BISA 2I26N 4RBPH 3FO0L 3L3DB 4YE4H 5T3XH 2G9HA 1EA9C 1I8KA 1MF2L 1IC7H 2AEPH 2IBZY 3I50H 2DMBA 5CZKA 1D9KB 5ERWB 3BHBB 1DQLH 1C16B 3C9NB 4RGND 1S7VA 2H26B 3RHWF 3LMJL 4IJ3C 4I0PA 4BQ6A 5GIRB 5HGHA 2R29L 3ULUC 1UB5A 4X0KB 5TH2B 1AKJB 1J1XL 2DL2A 5HXMA 4JM2C 3DO3A 1Z5LB 1FGNL 4LLMB 1EGJL 5CAYB 4W4NA 4I48B 4P0DA 4D9RE 2V6HA 5LG1A 1LHZA 4OZGA 3G6AA 3VG0L 4PJ9C 3H9HB 4S1SH 5K9OB 5KVDL 5B39B 3L3IA 1FNGA 2BY0A 1ZV5A 1K8IB 1CFNB 1BQUA 4P3CL 4CADB 1DQMH 5JA9A 2G2RB 3CNKA 4B50A 2FSEA 1Q1JH 1WWBX 1XMWA 3QO0B 5EC2A 1CD0A 4QY8B 2FWOB 3NIFE 3TO4B 4L5FH 2XIDA 3QCTL 3KLHC 5CLTA 3TBTB 4HIXL 2YUVA 3MUGB 2C1PA 1NAMH 5DJDB 1FIGH 4TUJA 3C09C 2YUXA 5ISZE 4Y4KA 2PKDA 1TJIL 4OV5A 5C08E 2EECA 2GIYA 3HE6D 1MHCA 3HI1B 3MRRB 4JVPA 4N5EC 1LMKA 4HV8B 5I19H 5SWSB 1NJ9B 3DTXA 1BEYL 3LMJH 1EHNA 2A1WH 3QDGB 2R29H 3SJVA 4K8RH 1DE4B 4FFVC 1OARL 2B5IB 1J1XH 3IVKB 1CGUA 1FGNH 2H32A 5JW4M 4EVNB 3QI9B 4MJ6B 5DD5L 5JHDB 2DI9A 3VG0H 3MBED 4K9EC 4MCYB 5KVDH 1A6UL 4U2ZA 4OKVB 4P3CH 1G7IB 5EU6A 1BX2A 2R4RL 5EG6C 3VWJD 4Z7WE 3L3JA 1EFXB 1BF2A 4GUPA 1IEAA 1LO4H 3QHZL 5ESVA 4HDIA 4RX4A 4BELD 1CXKA 2JJSA 1F4XH 4MQXC 1TDQA 3X14A 5E9DB 5C08D 1OP9A 1BOYA 3GJFH 5DQ9A 4POZD 2Z31B 1LEKB 3SDCB 3CX5K 1G1CA 4HMCA 3I9GL 1TLKA 2C7UB 3GI8H 3NN8B 5DD0L 1T20A 4R3SB 5EZIH 3U82B 4WENB 1TTUA 1F97A 1A47A 1S7QB 3SDDC 1P1ZB 1I1AB 3IU3B 4TRPL 2DJUA 2FHFA 3KPNB 1BEYH 1ZT1B 4GRWE 3EW3B 4G8EA 1MREL 3DX9A 3DVNB 5I1IL 1EHLH 1OARH 3HAEH 3HUJA 3LPWA 3LCYA 2IPKB 4YHLL 5SX5K 1TZIB 4OFDA 2ED7A 3C5ZC 5C0DA 1I3RB 2VLJE 2A6KB 1A6UH 5IVXE 5D1QB 2VKWA 5DRZA 5DJYB 1NFDF 1M71B 4LU5H 4AZ8A 3RX5A 3A6BH 2ZG2A 4HKXB 4I0CC 5E94A 4UQ2A 3VA2C 3QHZH 4MDJB 5CIPA 4TSAH 4HSQA 4ELKB 2BRQA 1WWAX 3TPUA 1E4XH 3LDBC 3MRBA 3GDBA 3I85A 3D9AL 1ETZA 4QRRE 2EICA 5JZ7C 2F74A 4I2XE 2P5WA 5B3NA 3ARFD 3M8OL 1MHPL 5DRWA 4OZ4A 1DVFB 5DD0H 1CXFA 4AT6A 4HZLB 4HLZG 2NZIA 1XGQA 2Q3ZA 4WWKC 3EYVB 1JNLH 3HPJB 4IEFB 2Z93A 2VLJD 5JXEC 3W9EA 1G6RL 3QH3B 5C0AE 1H5BC 4I3RL 3CK0L 5C2BL 5FYKL 3GJEB 4YHLH 1RZJC 4ONGL 1A6WL 4J3VA 3HPLB 3KYNA 5C0FA 3QIUD 3F7RA 3OAUL 3FHAA 2Y4SA 1QLEL 4Y5VC 2JKXA 3P30H 1NGXA 1AGCA 4F33A 1X4XA 3SCMD 4QRRD 2VR5A 3UYRL 5K9JL 3ARGB 1ZT4B 1JZ8A 2NLJA 4ERSH 4N0CC 4D0BA 4W6YB 2Y7QB 2DBLL 5GGRA 3DROA 1ZAGA 5DD6B 2D7OA 3I75A 1TIUA 2EDJA 4APQB 1QP1A 3GZKA 1MHPH 4U3CA 5D72H 2HRLA 1YPZB 4OT1L 3OKOB 5C0AD 2FL5B 2D7PA 1JN6A 3CZFB 4M1GH 5C6WH 3MREA 5KS9F 3BRFA 2FHCA 1ZLUK 1FFNB 1C5CL 3GSNL 1UM6L 4X6EB 5HHPB 4XH2A 5ECJE 5IHZB 5H2BB 2L7JA 4HXAL 4ODUB 4K7FA 1A0QL 4G9DA 1AJ7L 1G6RH 2PYFA 1A9BB 4I3RH 4WVRA 4LEOA 3BUYA 4N90E 5I8EB 5C2BH 5FYKH 1P4IL 1F11A 4ONGH 2XY2A 2QJDA 5I30L 3L3DA 4NRZB 2DQFB 3VDAA 2WIIA 3BPOC 3K2UL 4ODXB 4RWYL 5BVJB 4Q7DA 1J1PH 3IAGC 5ERWA 4OI8A 5E24E 3BHBA 4FP8H 1FLRH 5GRJL 2NPLX 5K9JH 4MQTB 1YDPB 4JDVA 5GIRA 3WS6C 5TH2A 4X6FB 1F4YL 4FG6D 5FKPB 2LQRA 4RISH 3SBWA 4PYGA 1QFPA 4LK4A 2DBLH 5IBLC 3MOAL 1HQ4B 4LLMA 5F96L 3QIBD 5EZOH 4HFUH 5F7EL 1MCWW 5FYKU 3HMXL 1MCRA 5C0IA 5B39A 2PYEE 3EUUA 4NZUH 4OT1H 4CADA 3T3ME 1VACA 3L3GB 1BVKB 2YK1L 3AS2A 3QEGL 1TETL 4IOIA 4N90D 4P2RA 1C5CH 3GSNH 5JQ6L 2G2RA 4FRWA 5HHME 2IANB 3JVGA 5A16A 4HXAH 1A0QH 5F3HB 2VAAB 1GGCL 3QO0A 1AJ7H 2A0LC 4LSRL 1T03H 4QY8A 3RPKA 3ZDZE 5CD5D 5IOPB 2FWOA 3TO4A 2O93L 2DQHL 1TVHB 4HQQL 3TBTA 1OP5H 3BZFA 4BFIA 5HSFA 1F2QA 3K2UH 4YLQT 3F7PC 4PIRF 4RWYH 3X13A 5C07E 3NGBB 2X4PB 4UDTB 3MRRA 1OTSD 4TVPH 4P59L 1NCUA 4QXGL 4HV8A 5CILL 4X7SH 5SWSA 5I0DA 1DBKL 5ANMB 1DE4A 5HHXH 3QWOA 1D5ZB 3MJGX 3MOAH 2P43B 4UT6L 3C6LA 3KYMA 4EVNA 3QI9A 5JHDA 3HMXH 5HHMD 1RUQL 4L4JA 2WUBL 4OIBA 3T2PA 2PCPA 4LLQB 1XZ0B 3KLAB 3FAXA 1QSEE 1T04B 4MVBC 3ULUL 4HH8A 5T5NG 3V5DB 2F9BT 1G9NH 4CRPA 3T65B 4K55A 2OJZL 5C8JB 1T2QL 1J1OL 2IF7A 3ALPA 4WEUD 2VQUA 2WWKT 1IEBB 4Q97A 1CI5A 4UOW0 1T1YB 2ERJC 3CSPA 1EJ6A 4HUWB 4MLIA 4OF0A 4UQ3B 1RU9H 2AGJL 4KAQL 4LSRH 3L7FB 4GRLB 5C07D 1JWUB 3LRHA 3RAJL 1LEKA 3MNVB 4I13B 4K23H 3UDWC 4DVRH 2E7BA 4U4BA 1S7RA 3P0GB 3BEWA 4KQ4L 5J0BA 5DMIL 2C7UA 5ICXB 4Q9BA 1JPFB 1S7WB 1XF2A 3RNKA 3CSYB 4RFNC 1S7QA 4J8RB 1CLOL 3IU3A 5CILH 3IDXL 3Q5TA 3KPNA 2DD8L 4FXGA 4GQPH 2NY6C 3MV9A 2CLVB 3MLVL 2X4NA 1DBKH 1DN2A 1CGSL 1UH2A 3MNWA 4L3EB 1QSED 3DVNA 3LKPB 4YC2C 2NNAA 1QACA 2PR4H 4TUKL 3V6FB 4PJBF 3AROA 1TZIA 5BOZG 2CIIA 4XCNB 1P9MC 1NFDB 4XGZB 1N6VA 2PO6A 2WUBH 4ZO8A 1A6AA 3TT1L 4G9FB 4OBRA 4AEHL 3C8HA 4U1HB 5GGQL 1TNNA 2OJZH 5DC9B 1T2QH 3BPLC 3MRPB 4Z7QF 5JXAL 2UZXB 5FUOH 3QIWC 4DVBA 4MS8C 2VLRE 5EC1A 3X12B 3BQUA 4K9EL 2J8UB 4F58L 4ELKA 4KAQH 4PJAF 4F8TA 2IPUK 2DQGH 4AEEA 5DMIH 1T4KB 1DVFA 5C0NC 2Y07L 2I5YH 2OTPA 4NHUB 2Q76B 1CLOH 5CS7A 4ZFFA 2J1KA 4WHYG 4YDLC 4OSUL 4Z5RB 4LVNB 3IDXH 4WY7L 1IGTB 2DD8H 3HPJA 3IDJB 1DBAL 5DHYB 1A3RL 4LLDB 1CGSH 4F57H 1ZGLM 1BECA 2IG2H 3ES6B 5HYIA 1S9XB 4Y5XC 4C56E 4ZOAA 2ZJSH 3H9ZA 1QA9A 2VXUL 4LVOC 3TT1H 4EUPG 2VL5B 1UEMA 2O61B 2QQKH 3KPPB 5F9DC 5JXAH 4LKCB 3FL7A 1JNJA 4WGVB 5DEGB 2X05A 4GOSA 5DYOB 5FUZL 3UROR 1ZT4A 1CD8A 3DECA 4F58H 1BQSA 1YNLL 1P6AB 4WW2F 3MBEB 3QJHB 5JQHC 3RWGB 3X3FH 2X5PA 2Y7QA 3N1GC 4KRPC 5J6HA 5B3JF 3W9DA 4CN6A 1IL1B 5KS9B 4H26B 4K07A 3VXMA 5I8CB 3F12B 3T2NL 2Y07H 2W0KA 3M07A 1QFUH 2WQ8A 3CZFA 4YHKL 2X89D 3EO0B 5SV3A 3F6IA 5HHPA 4C56D 2XG4A 1FSKB 4LQFH 4OSUH 1A7OH 5IHZA 4ZOBA 1U95B 1A3RH 1YY8B 25C8L 5KSVB 4PGZA 3RHWK 3R8BB 2COQA 3QHTC 5D5ME 3I6GB 1UB6A 5I8EA 2NZ9D 3BMVA 1QBML 4ENEC 5CBEA 4PLOB 4X4YB 5IK3B 2DQFA 2VXUH 4CGTA 3LKOB 4XI5C 1U8MB 1T89C 5E8NB 1XF3B 1CE6B 1RZJL 4YDVB 1HWGB 2XN9E 4HJGB 5AD0A 4KKNA 1PKQB 2Z4QB 1SYSA 1KLGB 3C87A 5HHOB 1ZT7A 1YNLH 4XP9L 1I1FB 3WIIL 5K9KA 3HRZB 4S1DD 3BI9X 3KPQA 4KFZC 4MCZB 3HA0A 4YK4B 1IAKB 1FO0H 4P23A 4J4PD 3P9MA 1FZOB 1BVKA 3W11C 2GK0B 1DUYA 3UYPA 4BZ2L 5F88A 4MJ4A 2M8XA 25C8H 1WBZA 2BX5A 4JPKL 5CGYC 1JFQH 1NEZA 3ROOB 3ARFB 5HBBA 5IOPA 4LARL 3IDYB 1MH5A 4LLWB 4IMLA 1P4LB 3U0WH 1ONQB 2F53A 3OPZH 1IFHL 3RY6A 4PB0L 5E4EC 1BFOB 2VLJB 2X4PA 4UDTA 3T0XA 2VDKL 3G04B 4L8DB 1FH5L 4LNVA 1RZJH 5F6IC 4WHDA 5EZJA 4CN4A 3B2VH 3FQNA 3BXNA 4XMKH 2JK5A 2DL9A 5CJXC 4BFEA 3QIUB 1M7DB 4XP9H 1D5ZA 4PJ7A 1OCWL 4H1LA 1E4KC 1MIMH 1GZQB 4O51B 4YH6A 4AMKL 1G0YR 2Y72A 2FBJH 3CH1B 3SCMB 5GJTH 3TPKA 5F72S 3V5DA 2R8SL 4ODVL 4YGVB 4I5BA 1R24A 3W5MA 1IEBA 3VI3F 3SDAD 4EUPH 4N0UE 4DFIA 2KPNA 3VA6A 4JPKH 1UYWL 1SM3H 3AC0A 1R3LB 4XNYH 3HB3C 1U8PB 4OLVH 4KMLB 1KUMA 4YDIL 5DJAB 3IXTB 4G6JH 1P5VA 5ICXA 3WO4C 5GS1C 1W72B 4PB0H 4ZOEA 4NCDA 1A3QA 4HIIA 5FDWB 2VDKH 2DIAA 1FH5H 1JHTB 3HE7C 2BVQB 3W0WA 1RIHL 3KYAA 3ARBC 1OTUC 3HZVA 1XT5A 4PJBB 1XEDA 3H7LA 3RUGF 2FH6A 5C0BE 5I18L 2XZQL 5CINH 2RB8A 1DQDL 1DANT 2NY2B 1WLHA 3VGHA 2HN7A 4EJ1C 4GH7B 4AMKH 4XGZA 1NFDA 5E70A 1GGBH 3BH9A 2YWYA 3CXDL 5KVGL 4IRJB 2R1XA 4KMTL 4ODVH 5F97E 5FCUH 4D0CB 4JG1L 2V2WB 1JGLL 5GS0H 2D7TH 1JMXA 3X12A 4JKKA 3EZJB 5TF1L 2J8UA 5BV7C 1UYWH 4U1SA 2EE9A 1D5IL 1N6UA 1BIIB 3MRIA 5FYKE 4YDIH 1KJ3L 3F7VA 5GRUH 3DUUB 4HGKC 1IQWL 2JJWA 4LPXA 4PP1D 5DHVH 2J8OA 3O9WC 3BWUC 4LMQI 4HG4J 1UXWA 4FQQA 4Y2DD 3TEUA 4U1JA 4ZXBA 5KJRH 4Z5RA 5DHYA 1JL8A 1OGAD 2OR9L 3HC4L 3IDJA 5EBLA 4U1NB 4FFWC 1R5VB 4NYLB 5I18H 2XZQH 1UM4L 2ILLA 1DQDH 3OKLB 4V2BA 5I15L 4KRMB 1S9XA 3DYPA 2B39A 3PDGA 2FGWH 3HE6A 3ZE2E 3VXRB 1J88A 1QD0A 3DYMA 3O8XC 3SGDH 2FEEL 3TP4A 1C7TA 1NMAH 1UQSA 1F3JB 5D93B 1JPST 1MCCA 4JRWA 4KMTH 3KPPA 3NAAH 4UBDC 1YMHA 2M26A 1KLFA 2C1OB 4JG1H 1JGLH 4WW2B 5IQ9B 3FRUB 5TF1H 3IDNB 3SOBH 5HHMB 3BZ4A 4LCWB 1D5IH 4JDZB 5HYQA 4QNPE 2FJHB 2BHZA 4ZPVA 1WITA 1JCKA 2X4RB 1IL1A 1IQWH 3VWJA 4JJ5B 5I8CA 3F12A 1WBYA 1OGTB 2K7QA 3VFVA 4JR9H 4AEIL 3EO0A 5ISZA 2OL3B 4WU7B 1AQDB 3MZTA 5C07B 5C08A 3HC4H 1HNFA 2OR9H 1YY8A 5KSVA 4X7TB 2DWEB 3WUWB 4WWID 1FG2B 3TJEL 4FS0A 5I15H 1P5UA 1EBAA 1HCVA 1NDMA 2H8PA 4KK8C 3ZKQD 4X9HA 5ADPL 1FC1A 4WHCA 3NCMA 1YMMD 1RZGB 4PG2C 3ZHKA 1RK1B 3VFSA 3K8KA 4HUUB 3LKOA 4NO2B 3VXSD 1BQHG 1CE6A 2WK2A 3FO9B 4M5ZL 3ULVF 2O26U 1PKQA 2Z4QA 1QFHA 4PY8I 4G8IA 2HWZH 4I9WE 4Z7WA 5D1XC 3V6OE 3SGKA 1X5YA 3J7HA 3SY0B 1E4JA 3VXTA 1NGWB 5IIEA 4NWTL 4RZCB 5E2TL 3U0PB 4O2FB 5I1GL 5KSAD 4MCZA 1RPQA 5DK2A 4KJPC 5BMFL 2CLRB 5IF0B 3RNQA 4TVSa 5JDSB 1HHHB 1FZOA 4AEIH 5JOFB 1KCSL 2GK0A 2XT1B 1CYGA 1E6OL 2EIBA 3OB8A 1HOCA 3UTQA 1FAIH 1RQ5A 2VMFA 4K3EL 3ROOA 3ARFA 5L8KB 1T2XA 3TJEH 4QWWD 4XCYB 1T1XA 4D3CH 4MNGB 1P4LA 4AIOA 3D0VA 4WW1B 3ULUE 1X44A 2YD5A 3RX8A 1WC7A 1BFOA 3NCCB 4F3FB 2VLJA 1VDGA 5J13B 3O4OC 4ODWA 5IVXA 3VWKD 3G04A 3CXHK 1IGCH 4L8DA 4Y5YC 3VE0A 4M5ZH 4FZEH 4NT6B 5HY9B 2YA0A 4YWGH 3TT3L 4I18A 1M1SA 3DETD 4HGMA 2XKSA 1T5XA 3QIUA 2X4TB 2IQAB 2ITDA 3LIZL 1S3KH 4CMMA 4GXVL 3HR6A 2BVUA 3CH1A 3G5XB 5I1GH 3NABL 3SCMA 4QRQA 4QRRA 1NLBL 3O6MH 4I2XA 3FB7A 4QHMB 3FRPA 2WINA 3CFCL 4YGVA 3KLDA 2DQDL 1D6VL 1J0IA 3V5KB 3EDEA 1I7UB 2EIZA 3ULUD 4GW5B 2EC9U 5C0JA 1GVIA 3WE6B 1ZOXA 5EULV 3PQYD 4XVTL 1U8PA 5C0AA 2ZOLA 4NFDA 3IXTA 2IEPA 3V5HA 4C56B 1AXTL 3BMWA 5CMAA 1W72A 1M6OB 1J86A 2ZOKB 1Z9MA 3QZWG 5AYQA 2C9AA 1CL7I 1W8OA 3SE9H 4LSSL 2BNRE 4JO3L 4X83A 5TE4L 3SPVA 3ARTA 5C6PB 1TFHA 4Q9QL 1BFVL 4M1DL 3ZTNL 2XNAB 1S7SB 1QYGL 4XMLL 3DV6B 3O2DL 3NABH 5LWYH 3MCLL 3T0WA 1NLBH 3BKML 1MCDA 1YEFH 1NGQH 2UY6A 3RA7L 4C83A 2DQDH 5L9DL 2ADJB 2V5SA 2Q7YB 3GRWA 1KCRH 3QIBA 4JFYB 3WNPA 4OGXL 3QCVL 1CDHA 1UEYA 3QJFA 1BIIA 4HX1A 4LLVA 4XVTH 4LAQH 1WIOA 3S3SA 3OAYK 1JTTA 4XBEL 4HJJH 2FB4H 3DUUA 3VXPA 2BNRD 3ILQC 1R5IB 3QDMB 5KTEL 4FQPA 2J4WH 4R4FL 3TH3T 3WKNA 1JWSA 3OKNB 4DGIL 4JG0L 2DI8A 4LSSH 2P45B 4XAWL 5TE4H 1R5VA 4NYLA 4MQXD 4YHPA 1ZVYA 3O6LL 5DURD 1AGBB 1F3DJ 5IHLB 2ARWA 3ZTNH 5LAXA 4YEFA 4XMLH 3M1BB 2GITA 2BNQE 3O2DH 1JI1A 4NM8L 4PLKD 3QUKA 3MCLH 1N5YL 3BKMH 5DMGC 1SHMA 3VXQB 3AB0B 5KSUB 5EU7E 3FT4B 1FYTB 3MUJA 2PYEA 1U93B 3SDDD 3ZYIA 4ELME 5EWIL 1G7JB 1A7RL 3RTQB 1GCFA 5L9DH 1VGEL 1XGTB 3FOLB 3MBXH 1C1EL 4XB7A 2I07A 4OGXH 2X70A 3QCVH 4JDZA 4JHZA 5IWLA 4U7SA 4U31A 2FJHA 3UTSD 3C5ZD 3EO9L 5IB5B 4F37F 3SDAB 1OGTA 3KS0H 5GS3A 1KYOK 4ORZC 4G6AC 5KTEH 3GI9H 2OL3A 2Y5EA 1V7NL 1AD9A 4PPTA 5C07A 4DGIH 2ZUQC 2BNQD 4X7TA 4ONOA 4XAWH 2V9QA 3BE1H 3O6LH 1A7NL 4ZPTA 5DJ6B 3V4UH 3G6DL 1RHFA 3HMWL 4PGEB 1N5YH 3EYSH 1RK1A 4BYHA 4HUUA 3CUPB 4R6UA 3SKOB 1FQ9C 1QSEA 3FMGL 5JR1H 4WWKD 3T2OA 1A7RH 5E0QA 3TN0B 1C1EH 4BQ8A 2P42B 5JXED 1WFTA 5GS2H 3SE4A 4QXUL 5EPMB 4OZIE 2VQTA 3ARWA 1NGWA 1PX3A 4HHAA 1CD1B 1XGPB 1P84J 3DRTA 2HFGL 5BV7H 2ESVD 3PF2A 4O2FA 5CSGA 1HH6A 3QUYC 4L4TD 4BH7A 5A40E 5JOFA 1V7NH 2BVPA 1C5BL 2BY1A 3NFSH 4M6MH 5ABDE 3DWTA 5F71A 1MCOL 1S9WB 3H3PL 5J9PB 1X7QB 2OZ4L 1NBZA 4IRSB 1Z9OA 3JV4B 1JYVA 4XCYA 2ZPKH 4XPHL 5AUMB 4LPYA 1VFUA 3IXAA 4AJ0A 4NKMB 3OG6B 5SX4H 3QA3B 4Y2DB 1FGVL 3B2UC 4WW1A 1OGAB 1BGXL 3FCTB 4LRNL 1J0KA 3FMGH 4DW2L 4RAUB 3GIVB 1LP9F 3CFJA 4ZSOE 4XNXL 5HY9A 5GZOD 1XGRB 3T3PF 2XA8L 1UZ6E 5J11B 3V52L 2E3VA 4QXUH 2X4TA 3NIGF 1JPGB 2P1YA 3FTGB 12E8H 4M3JA 4B41A 1MIEL 3G5XA 2FJFB 3GB7B 2VDOL 1EZVX 4QHMA 3EOYG 1QRKA 2FD6L 3A67H 5FO9B 1KG0B 1C5BH 1FL3A 3WFZA 4YHYB 3DGGB 5C0RL 3I2CL 4GW5A 5ESAA 2OZ4H 1INQB 3WE6A 4JPIB 2E8ZA 3QUML 5IMKA 1A22B 3K4DA 4XPHH 4ZD3L 3MRMA 1QPPA 2X89A 4AENB 3VFPB 5FM4A 4P4RB 4C56A 7CGTA 2EXYC 5FK9B 2ZOKA 3H3BC 4WTWA 1BGXH 3P2TA 5JIIA 4LEXL 4PY7B 1GPOL 1CFQA 1HN1A 2QR0B 4XXDB 3QNYA 2XA8H 4NN6C 5L2KD 3V52H 5L7XL 2A0LD 3O2VL 2DM7A 5B38A 1M05B 5E6IC 1YMMB 2EKSB 5FIEA 2IALA 1JRHL 5MENE 3VXSB 4KKBD 2EEAA 1S7SA 4OCWH 1MIEH 4PJGE 3KHOA 1Y6NR 2VDOH 1MCWM 2DM4A 5DK3A 1RAMA 3FZUD 1OD7A 4WI5A 3CSGA 1K8DA 2FD6H 1WZMA 2IMMA 3EKCA 4KI5F 1I9EA 4FNLL 2C3WA 1QHOA 2ADJA 1XIWD 2M2DA 3IKKA 1MPAL 3R1GL 3I2CH 5F7DA 4X5WB 2IQ9L 3L6FA 4JLRB 4JFYA 4PJ8B 4U6TA 3UTTD 4HCRL 5KSAB 3GMQB 3OKEB 4J4PA 3MLXL 5IESL 5D5MA 4G6ML 3BFOA 1IZJA 3C5SB 4RWHA 4EN3D 1RUKL 2I60L 5TQ2H 1EGJA 3RU8H 1LWRA 1R5IA 5CWSB 5HI4C 3VXOA 5IG7B 4C54A 3ULSA 3QEUB 4XVJL 8CGTA 1GPOH 3FJTA 3OKNA 4KK5C 5IGXH 5MEND 3NCEB 5M95B 3CVHB 1RZIB 1K4DA 3D2UD 1SVZA 4XNUL 3O2VH 2EDQA 1MY5A 3WIHL 1FHGA 3DVGA 1JRHH 4NN7C 3DSFL 4KQ3L 3EYFB 4AEFA 2QQLH 1B0RB 1FC2D 4RAVB 5ITFB 4AL8L 4U6YA 3S34L 2W9EL 5KSUA 3OGCB 3FT4A 4F8QA 5DFTA 1U93A 1G7JA 4DGVL 1EUUA 1NQBA 1XGTA 1DLHB 2DICA 3TLRA 2NY6D 3RWEB 1MPAH 4RFOH 1EJOL 3R1GH 1K3ZA 1GJIA 2IQ9H 4HCRH 3CD4A 2ATKA 3SGEI 4YFEA 3MLXH 4N68A 1U2HA 2BOBB 1PLGL 2H2SC 4YFLI 3OSKA 3QEHB 5FKAA 5IJVA 3ESUF 4OGAC 5HDQH 5IHUL 1W0WB 2B0SH 1AHWB 2JJSC 4G80B 5C09B 3U30C 2G5RA 2X7LB 1WISA 2UUDK 4MS8D 1MFCH 3PQYB 4FQXD 3MV7E 3VW3H 5L2JA 3LH2L 2CR6A 5F7KC 4GLRH 4UMGA 3WIHH 4G43B 3D39B 2DKSA 4Y16C 5EU3B 5I9QC 3DSFH 2E9IA 4DN4L 2YD8A 4U0RB 4MSWB 1VESA 5F9AC 1AR2A 4X6BA 3S34H 2W9EH 1KF9B 2DIJA 3PV6A 3SKOA 4AM0B 4LCIH 4ZAKB 1ZLVH 4OFVA 3SKUD 4DGVH 2QQQA 2HKFL 1EJOH 4HBCH 4MD4B 5FO7B 4N0UA 4QCIB 4MA1C 2QKIB 5C86A 1LK2B 4PRAA 4XZUB 4E42A 1Z9SA 4F9PC 3QQ3B 3KNBB 1CD1A 1XGPA 1H15B 1JNHB 5T5FL 1PLGH 4HH9A 2VLLA 3MV7D 4OB5L 2EYSB 4UDUA 3RL2B 4JANB 3RWHA 3GSOB 3UPAA 5ID0A 1G7MA 1BBJB 4F7EB 5IHUH 3EJJX 1WWCA 3PGDB 4ZUUA 5JLZB 3MACH 1L7TL 3RVWC 5HPOA 2PXYC 1MFNA 3IDIA 3TNNA 2NXZD 3LH2H 1X7QA 1P2CB 4N0YH 5EOCL 2GW5A 3JV4A 3MGAA 4PJIE 1YEJL 5AUMA 5C0BA 1EMTL 3QCUH 3TYFA 1YQ2A 2WNGA 5K59E 1VFMA 3QQ9D 4Y2DA 1YNTA 5BZWB 4DN4H 2EDLA 4HUMB 5DJ8A 1LP9B 1J5OL 4WO4B 4QGYA 1F45A 2A73A 2XOTA 4LCCB 4NQDE 1J0JA 2VTFA 2A6JB 4YBLB 1I9RH 2YD6A 5E2WL 3WFBL 3TA3C 4ZUSB 4XVSL 1CDBA 5BW7C 4DKAA 3JXAA 1JPGA 4EXKA 1N3NB 1G6RA 1I3VA 3FTGA 3S36L 3TBYA 5HGBA 2OK0L 1CGTA 4YZFE 5T5FH 2A6DB 2YRLA 3RKDD 2VDQL 4HT1H 1EO8H 2FJFA 3GB7A 3L5XH 1SEQH 1S5IL 1KC5H 4H88L 4M93B 3LD8C 4XI5D 3S37X 3OZ9H 3WFHB 5IB2A 3C60D 1K4CB 4JQIL 1KG0A 1WWWX 1NLDL 4LBEB 1EO7A 5FM5O 1FZMA 5CSBA 4CAGA 1OW0A 1YJDC 4X98B 3UTSB 4M5YL 1DQQB 4CVXB 1EHAA 4WFHD 3A0OA 2F8OA 2SEBA 2MHAB 3AXLB 2ED8A 4JPIA 3REWA 2CKBL 4P2YA 2ZCKL 1B4JL 1YEJH 2G60L 5CFHA 2IAMA 4CMHB 2ICWJ 4P4RA 3IT8D 4I3SL 4I3GA 1ORQB 1BJMA 5FK9A 2VOTA 2DI7A 2GSIB 1J5OH 1MRCL 4I77H 1LD9B 3W39B 3WFDH 4KGLA 2HTKC 3ZKNC 2QR0A 4XXDA 5HI5C 5E2WH 3PHOA 3GSNA 4U49A 5JW5A 5CGYD 5I8KL 4XVSH 3ME0A 4DGYL 2OCFD 4MZ2A 1M7XA 1M05A 5CJQH 1D5MB 3MLYL 1D9KC 3VXSA 3WNKA 3FB6A 4PJCE 1ZA3A 1IC5L 4V1DB 2DLHA 2XTJD 1S5IH 2DLEA 3GSVA 4H88H 1R3IH 1UVQB 2GFBB 4UTAH 1F90L 1QFWI 1QFWM 3GMOA 4XHJC 2FR4A 1LO0L 4JQIH 4OI9A 4MJIE 4NNXB 4A6YH 4JFDD 5T33H 1SJVA 5J1AB 4UINL 3MCG1 4M5YH 4F9LA 2HA1A 5F9OL 1LILA 4JLRA 5H35B 2ESVB 3WBDA 5KSAA 2CKBH 1BHGA 4PREB 3BSZL 2ZCKH 1B4JH 3GGWB 4L4TB 2X1WL 5DA4A 4Y4HD 1HHKA 4XMPH 4EQ2A 1YC7A 3IJHB 3JVGC 1PVHA 5FYJH 3ROLB 3HMXA 4EDXB 3N1QC 3I6LE 1MRCH 3GSRA 1OAKL 3P0YL 4HK0A 5AAMA 4S10A 1RJYB 1HXYB 4MJ2A 3TO4C 4MA8H 4J3XA 3CVHA 1YEDB 3VMPA 1JYWA 5I8KH 3HG1E 1JE6A 4DGYH 3AREC 1BFTA 3V6OA 4S1QL 4Z9KB 5GZND 3WS3A 4MJID 3KDMB 3JTSB 3VWKA 3AGVA 1IC5H 3ARYA 1B0RA 2XTLA 4X5LA 2Z9TA 2WANA 1TTGA 2W60A 5DA0B 1ZKAA 1KB5L 5FYJU 1LO0H 1J11A 2B5IC 3NFNA 5DGRA 2H1PH 1DLHA 4UINH 1OTUD 4HJ0C 5T1KA 3QI9C 2WAHA 3CFIC 3QDAA 5FYLD 2G75B 3LPFA 3QULA 1U3JA 3BSZH 4OIAA 1EVUA 1J8HE 2EEDA 4H0HB 1BLNB 3H9SE 1WZLA 2BOBA 5GSVA 2ED9A 3IAQA 4Q9RL 5GISH 4LIQL 1AO7D 3QEHA 3BDBA 1OAQL 4R0LB 1LE9B 5TDOB 1W0WA 1OAKH 1H3GA 2YSSA 4G80A 5EBMB 5K33A 2DLIA 2EC8A 1NC2B 3SDCC 2Z31C 4DJMA 4P2CG 3PQYA 4FXKB 4RNRA 4NQTA 4U6XB 1ED3B 2F8VA 2LVCA 4PJ9A 3U2SB 4ZG1A 1T1WA 3D18A 5EU3A 3QUXB 1MCHA 1I1AC 2GK2A 5MHSE 1QPXA 1H8SA 3F6LA 3O9WD 4MB5A 4KDVA 5L2KB 2O5YH 3VGFA 3S6CA 3BPCB 1J8HD 3K7UA 1UFUA 3H9SD 3U48A 4ODTL 4MD4A 5DD1L 3GUTB 4FFWD 5DJ0B 4KY1L 1D5XA 2QKIA 4W4OC 1MNUL 5D1QC 3OAZK 3QQ3A 3QRFM 2HMIC 4N0FB 1JNHA 2HJFA 5H37G 1UCBL 3O8XD 1Q9KA 3LEYH 4IDJH 4LIQH 2EYSA 1F4WH 4JANA 3TV3L 1XIWB 5I1JH 1Z3GL 4F7EA 5H94B 3FQXA 3UTTB 4NKOA 4X6DF 5GGVL 4K7PY 5B4MD 3QISA 4LKXA 4YPGB 5FAAA 1P2CA 2GT9B 1DVFC 1G9ML 2BNRA 4EN3B 3UC0H 4ZS6D 5J57B 3KPLA 1H0DB 3PP3H 2HKHH 5BZWA 2QV2A 1MJ8L 3EFFA 1LP9A 4O9HH 1MFAL 5JW3L 2NY4B 3D2UB 4PJFF 3ARPA 1UWEL 4JZJB 3QSKB 3U7WH 4MXQC 4NQVB 1T83C 1BZ7B 4NRYB 3WXWL 1FL6B 4GBXD 4ODTH 4ZUSA 2OTWA 5DD1H 5EUKB 4KY1H 4QEGA 1FG9C 2EDHA 3V95A 1NGPH 3AAZB 5ICZB 1AGDB 1BIHA 3SDXF 2A6DA 5KBNC 1UCBH 1YEEL 1ZA6A 4X5XA 3SDDA 3KR3L 4RRPA 4UU9B 1RFDL 3ARGC 3TV3H 1Z3GH 1UKSA 2EO9A 4X4ME 3VGEA 1K4CA 3F8UB 1FAKT 5M7QA 4YC2B 2KZWA 1WCQA 3KPOB 2ZUSA 3QWRD 4X98A 3UTSA 5D6CB 1DQQA 4APQC 3C5ZA 4LLUB 3CFDA 4FTVD 5D1XD 7FABL 3TZVB 5C92A 3OR6B 3WFEL 2ATPB 4K3HA 2P46B 5I71B 4Z6AT 4JHBA 1IT9L 1R3HA 2XI9A 4YXHL 5GGRY 3ZKMC 1ORQA 4KJPD 1Q72L 4FQXB 5DXWA 1MFAH 3QDJE 2BNQA 1FBIL 3E2HB 1LD9A 5D70L 3MRFB 1AD0B 1MHEB 3VCLB 3WXWH 1LE5A 5GGUA 2IBZX 4P4KB 4CW1B 3O11B 2NY1D 1IAMA 3CDGB 2XWJA 5B39G 1YEEH 3O41B 4QYOA 3KR3H 1T0PB 4WWKA 1RFDH 2B8OT 5HVGB 3P11L 3EJZD 4LPTA 2YA1A 1A5FH 1BVZA 5JXEA 4K7PH 2XZAL 2NY7L 1H5BA 4H20L 2KQNA 3DOSA 2EE6A 5SWZE 4JREB 1HCFX 5I76A 3MCKB 2MWCA 5CIPH 3QDJD 5DRNA 4KWUA 4QF1A 3CJJA 2UZIL 3M45A 2MJWA 4OJFL 3EZ8A 4L4TA 5D7LE 2DLGA 1A14L 1YJDL 4E0RA 4YXHH 5KZCD 1MJJB 2VE6B 2BSRB 2CRMA 1FBIH 4DZ8A 5H37H 3DSNA 2NXZB 4HC1A 1YC8A 2FZ3B 3OKDB 3PV7A 4J6RL 4LCYB 4S1RL 2BSSB 1U58A 3CZJA 3SKJH 5GGSB 4R96A 5IR1A 1NDGB 4RDQG 5TJWK 1A9EB 2AV7A 3HLAB 2WBWB 3NGBC 1TCRA 4OZIA 1XF4B 3JTSA 4N0RA 4DKFL 5SWZD 1V3MA 3VD3A 3M17A 5DZLA 2FX9L 3BO8B 3PNWA 4QTIL 3MRGB 2Q1EA 2XZAH 4XVUC 5GJSH 2NY7H 1TJGL 4H20H 4WCYL 5D7LD 4UB0L 1JGDA 5JORB 3A6OA 2P47B 1OF2B 1YUHB 2JTDA 4JGJA 4DN3L 1SY6L 2AV1A 3IFPB 1IAIH 1BZ9B 2P24A 5EORL 1BLNA 3STZA 2OTUB 5FA3B 2EYTA 2NX5E 3C60B 2YEZB 1BJ1J 1V8HA 1LE9A 5TDOA 5KSBE 1LO3L 4PJ5E 5EBMA 3KPSD 4GRLC 4J6RH 1Z0MA 2ORBL 5CCKL 4PRPE 3AS3A 4FXKA 4OF6A 4YGAB 1OSZB 3ZYJA 4U6XA 1ED3A 1UCTA 3CPLB 1GOHA 1KJMB 4GMSL 1YY9C 2AK1L 4JFHE 4RIRB 3RWJA 4B5EA 3LKQA 5JPMB 3SHSA 4DKFH 1RHHA 1BWWA 4IDLA 4XPBL 3ILQD 1JHLL 5DS8B 4JKMA 3TIEA 2FX9H 1MHHA 3Q5OA 4CUCA 4QTIH 4XPFL 1QHPA 1OSPL 3BPCA 4PYHA 1DLFH 1TJGH 1U6AL 2NX5D 2PF6A 3AU1B 3KPMA 3GUTA 5DJ0A 4NWUL 2HVJB 4R7NA 4BZYA 2H41A 3FO1A 4PJ5D 1CFTB 1VGKB 1NUGA 2XTJB 3BOVA 3TBVB 1FIEA 1UZ8B 1KTLB 4YHOL 5E8EA 5JNYB 4JO2H 5HYJE 1JGEB 1I8IB 5DMJB 3G9VA 3TH2T 1BD2B 4PRPD 4X6DB 4JFDB 4D8PB 3QT2A 3CLEL 1XIWA 1I8MB 1KN4L 1LO3H 3D69B 2ICEB 3GO1L 1KENH 2DQCH 1Q0XL 3QPXL 3QXUA 2ORBH 1NCDL 4OCYL 4UV7H 4X9IA 4YPGA 4Y4HB 3F58H 4GG6E 4PG9B 3HC0B 3IF1B 4EN3A 2X09A 2J2ZA 2ZKHL 3BT2H 2AK1H 1H0DA 2BVOA 4J2XA 4ZO9A 4AIZB 1YQVL 3SQOL 1U8JA 3OL2A 3CDYA 4PJFB 5BJTB 2JIXD 2NQCA 4LVNC 4XPBH 5MENA 5TPWL 4ETYA 2HLAA 1CLZL 1H3WM 4WUUE 3D2UA 4XPAL 1HK6A 4M3KB 4QOKE 4XPFH 3CAFA 4HK3J 4JZJA 1MFEH 1OSPH 1U6AH 4JFOB 1BZ7A 3HC3H 1FL6A 3CFEA 2CPCA 2F54D 1A21A 3UDWA 3RFZC 2J12B 5HYJD 4NWUH 3OKKA 1A4JB 5EOCJ 3SDXB 1CN4A 2QHRL 5CP7A 4Z7UE 1JV5B 2QL1A 3FQUA 3UEZA 5ICZA 2FO4A 4YHOH 1AGDA 2WSKA 4UU9A 3B8YA 1BAFH 3BPNB 4NKDA 1KPUA 3WHE1 1KN4H 2KQMA 3G08B 5FF6B 1IJ9A 3MBEC 2OP4H 3GO1H 4F7CA 2WUCL 2R2BA 3KPOA 3QPXH 4JGUA 1A1MB 4XNQA 1NCDH 2I24N 2R2CA 4LLUA 3X11B 2DKMA 1WFNA 5FFLA 4HFWA 3IJYA 1AO7B 4WUUD 2FCBA 1QEWA 3K8LA 4QOKD 2ATPA 2JF1A 4YBHA 3BW9B 3SQOH 2HFFB 1I85A 1FSKC 5J6GB 4GMTL 5CHNA 4FQXA 3ILPA 3QUYD 1O7VA 1CLZH 2LU4A 3D25B 4G8GD 1NEUA 1AD0A 5C0EB 1ZVHA 3VI4E 2B1HL 2D9QB 1AP2A 4LHUB 3OJMB 3RBGA 3P73B 2QHRH 2Q3AA 4TN9A 1HIML 5FHAH 2GY5A 2GY7B 1XGYH 3FB5B 1HYSD 5DTFB 4OUUA 1FV1B 3IU4L 4R7DA 4N8VB 4NQSA 1II4E 5MEOA 1JMZA 4FFYL 4OZFB 1CFSB 3WXVH 1NEZG 2BVYA 2DJSA 3NACL 4Y5XA 4EEEA 5KVFL 4EI5D 1S7TA 1ITCA 1T22B 4M7LT 2R56L