5JQHC

Structure of beta2 adrenoceptor bound to carazolol and inactive-state stabilizing nanobody, nb60
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
120
structure length
120
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGSIFSLNDMGWYRQAPGKLRELVAAITSGGSTKYADSVKGRFTISRDNAKNTVYLQMNSLKAEDTAVYYCNAKVAGTFSIYDYWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric nanobodies reveal the dynamic range and diverse mechanisms of G-protein-coupled receptor activation.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Signaling protein, hydrolase/inhibitor
molecule keywords Endolysin,Beta-2 adrenergic receptor
total genus 23
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jqhC00
1OGAA 4IIQB 2ESVD 1CGTA 5IMKB 2W60B 1WSST 3CSBA 1JV5A 2ED7A 3FRPA 4X7SL 2F19L 3QQ4B 2IG2H 5CSZA 1A1OB 1OAZL 3TZVC 2O5XL 3MXVL 1LE9A 1I7ZA 5T3XD 2IF7A 5ICXA 3DX6B 1TTUA 1A1MA 2WAHA 3GO1H 3GSXB 4FQLL 4K7PX 4GXVH 1FYTB 5F89A 4PJCB 5HYJB 3U30B 3QULA 3GSRA 4IM8A 3NTCH 5I1GL 2UY6A 3QNYB 4D0BA 1UB5B 2FATL 3C5ZC 2AK4A 4XRCA 2VMFA 2I9LA 4MA1C 2XY1A 4IMLA 5I8KL 1AR1D 5EDXA 3QRGL 4IOFD 1QSEE 4WTWA 2NTFB 4YHOH 4ZFGH 1U8NB 5JDSB 5I15L 1EHLH 1HILB 1IILE 4IIQA 1J05B 2VQ1B 2YRLA 2HYMA 1CLZL 4PRBA 5F6IB 1WWAX 4HBQA 2BNQA 2XTLA 5ESVB 2P8MB 5BV7H 3S36X 5DMGD 2FSEA 1HXMB 4O2FA 3RGVA 1QHOA 4KHTH 1FN4A 3OB8A 7FABL 5DZNA 2IMMA 1N6UA 1AR2A 1XEDA 1A7NL 1IAIH 5I2IA 3CCHA 3Q5YA 4MD5A 1KEMH 1QD0A 3RVWD 3RZCD 1BREA 2XN9A 2DQIH 3ELAT 5EZLB 5FECA 1S7QA 1ZVSB 2GQHA 1NCDL 2FYYA 3STZA 3ZZ1A 5D9SB 2XICA 4OF6A 3EOAB 2FEDD 5C6TL 3ULVH 4PJCE 3I6GB 4M48L 1VGEL 4GOSA 1AGEB 3HUJE 4GRWB 1EFXA 4WI9A 4X6DE 3EOBA 4OKVA 3U4BL 2A77H 2F5BH 1I3UA 5L2JB 3BQUC 1RURH 3EO0B 2A0LC 3OB0K 1U8HB 3P0GB 5DEZA 4RGNB 2Z35A 4U33A 2EH7L 5I1LB 1P1ZB 5FA4B 2NY2C 5AYUL 3V6BR 3Q6FB 5DWUH 3W11C 1IGML 4I3SH 2VL5B 3QJHA 4O2CB 2QQKL 3B9KD 3SE3A 4DTGL 2GYSA 4MCZA 1QPXA 5CSZB 4ZAKB 5DFTA 4HLZG 1KYOK 1ZMYA 1CLYL 2H1PH 2Y9RT 3B8YA 3G04B 2XKSA 3NCJL 4KMQA 3RUGA 3RWJB 3QIBB 2FYYB 1S8DA 3MUGB 5L2KB 2DQHL 3CDGA 3VWKA 1BAFH 3T0ED 1DFBL 4R26H 1EAPA 4V1DB 4RAVA 2DD8H 5TJWK 4QRUB 2NY0D 2F53A 4JDVA 1NH6A 1NFKA 4LEXH 1KFAL 2GSIB 2VUYA 3EYQC 3T09A 4NN6B 4QF1A 5GS2D 3BRGC 1L7IL 1CQYA 1R3HA 4L9LA 3LQMA 2IADB 4ZSOA 5FM5O 1X6LA 1CD1A 5D96B 3QH3B 5E03A 3RIAK 4Q9QH 4PB9L 3IDGB 4S1QL 4CL7A 1B0GB 4Z77B 2ICWA 1DUZB 5TQ0H 3WIFA 4XMKL 4I2XB 3BMVA 4UT9L 4J1UB 3B3IA 4HKXA 4HH9A 3STBA 2APBA 2BRRL 3TA3C 1SQ2N 4IRZH 4F7MB 1MFNA 3MNVA 5DJYA 1IL1A 3QEQD 4G8GE 2RFXB 2R69H 4Y19A 2FL5B 5FAAA 1FBIL 1E6OL 1FIEA 1T1WB 2DQEH 2CGRL 1OP5H 2W9EL 4JDVB 4A6YA 3HRZB 4G7VL 4KK9C 1DBML 1D5IL 4JO3H 1D5XB 3MLXH 4OB5H 3LN9A 5E8NB 4MJ6B 1X7QB 3JV6B 4LHUB 1M6OA 5FUZL 1KN2L 5ADPH 3U4BH 4KPHH 1AFVL 5E8PB 2C1PB 3PWPA 2E7LC 2BOCB 3UYRL 5ERWA 5HGAB 2AXFB 4ZG1A 3VGBA 3CJJA 2APFA 1UQSB 5TQ0L 5FYJU 5EA0H 5GGQH 3VDBA 3QHZH 5LWYH 2X41A 4J3OC 5EIQA 3P11L 5JR1H 3DXAE 4JREB 1T2QH 2AV1A 2WIIB 5ACZB 3WFBH 1RUMH 3BFOA 3IDXL 5IVNA 4FQPA 5CKAA 5SX4I 5J11C 1FG2B 3RHWF 4TRPH 4Z9KB 1I9JL 4ODBD 3MRCB 4PJ7E 3BEWA 4NWTH 3V95A 4LOUD 1CLYH 2H1PL 4IMKC 3RUGB 2IPKA 3PUCA 2R8SH 3S34H 3EFDH 2AJZA 3LEVH 4NNYA 1BBDH 3QEHA 3LVEA 1EO7A 4HUUA 4ELMB 2Z92B 3EOTL 4ZFFB 4KDTC 5DD3H 5E8PA 1KB9J 2X7LB 1IC7H 3QDMB 3D0LA 1AQKH 4MAYA 3TFKD 3FONB 1JGLL 4L4VD 3L3IB 2VZ1A 3KLAB 4N0FB 4Q2ZB 2HT3D 1ZT1A 3RNKB 3WNKA 4DN3H 3OGOE 4NQCA 3AGVA 1MCJA 1Q0YL 1X4ZA 3QFJB 2DS4A 1GCFA 4DUWA 3WNOA 3O2DL 2SEBB 4HFUL 3B3IB 4PJ5A 2NYYC 4JO1H 2CKBB 4U1JA 1B2WL 1JNNH 3BP5A 4ODXA 1QHPA 3NN8A 4JFDE 4C56B 2XWTA 2ZG1A 4WWKD 1UB6B 1J88A 2O5XH 4HKJB 4MXQC 3MA7A 3SHSA 2GCYA 1VGKA 1B2WH 1JNNL 4TOYH 3PIQA 3RTQB 4BFIB 3MLWH 1ZLWK 1HQ4B 3UMTA 2R0LH 4WDIB 1VFBB 4NJAL 1CE1L 5E24E 2Z31B 3AROA 1FG9C 3MX0A 1KGCE 3BZFB 4Z7UA 1QFHA 1IKFL 3JWNC 3DHJA 3RNQA 4S0SD 4XWGL 5C09B 3TIEA 3S4SA 1I75A 1CGWA 4NBXB 2APXA 5LVEA 4JY4B 2EDDA 4NZUH 4MMZC 3I02B 1A2YB 1JWSB 1KB5H 4XCEA 5JHDB 3BWAA 1Z0MA 2J88H 4JRYE 4HX1B 1NGQH 5I1DA 1CFBA 5K33A 1R0AL 2EDFA 2BSSA 4P2QA 3MRNA 1SY6H 2A6IA 3FOMA 5EORL 3R8QA 3BKCL 2MJWA 1WEJL 5SWSA 2LABA 1UG9A 4RBPH 3GIVB 3DVNA 2PO6C 3MBED 5FV1L 1QSZA 5F7YC 3LH2L 4Y4KA 2WIMA 5EIIB 2OK0H 1QKZL 5GJSH 3PWVA 1XGRB 4ZMAT 1XGQB 2GY5A 5EZIL 1NCCL 4HZAA 1DQJA 1T6WA 1Y18B 4EDWH 4Z76A 5HDQH 5C0JB 1HZHH 3D39A 4PJGE 2DLEA 2OJZL 4NDMA 3VXRD 1KJ3H 5MEOB 3F7PC 4Z78A 5F93C 3DRQA 2XV6B 1D3CA 1RD6A 1ORQA 3LKSB 1CXLA 3HN3A 4NYLB 4X4MA 4M5ZL 5CHNB 5TGBA 1FO0L 4FQQB 5F7DB 5BRZA 1F2QA 2VE6B 3G5VA 5EOQL 3RTQD 3JBG7 4PJAE 3UTQB 1YEFH 5IESH 4L3CA 4NBZB 3NZ8B 4HIEB 4K3DH 1RZFH 5ADOL 1N6QH 2LU7A 3S36L 3LKPB 2H41A 4OD1H 2GJZA 3ISWA 4M93B 1OTTD 3RP1A 2BVYA 5A2FA 1SEBA 2YUXA 5GGSY 1SVZA 5C0AA 1KIRB 5HGBA 2XA8L 5LGJB 2ERJC 4RMRA 4FZEH 5BJTA 1WIOA 3NCJH 2E5EA 3O6FD 2CDGB 5IB2B 1JJUA 1NC2D 2MQ3A 3MRDB 5D72H 2K3TA 3PDGA 2CQVA 4RRPG 5E4EB 2ZCLH 3P3YA 5C0DA 3VXSE 4PRHE 3UP1A 4C56D 1QP1A 4ZFOA 2X4PA 5C3LD 4EKXA 3DMMC 3QR2A 3TCXA 3ZE1E 3HC0A 3GI9L 4PTTB 2VIRB 3CZFA 1FZJB 2Y36L 5DJ2B 2MHAB 3MMEB 4NQCD 3SDYL 4WGWB 3BP6B 5H35B 4PTUB 3LKNA 3RKPA 4E0RB 4YHKH 1BZ7A 3U0PB 5DJZB 4DGVL 3FT2B 4JKKA 3V7AE 3MGOA 1LO4H 1IEBB 4M43H 5IWLA 4GRLA 4JFED 3PXJA 3FQRA 4XP9L 1OARH 3MA9H 4WVRA 4APQB 3QO1A 4QHKI 1INEH 5DVKA 1LO4L 4L8BB 4H5SA 2B1AH 4OFKA 3WBDA 4NQDB 5J9PA 4GLRI 4PJGB 5E1HB 4NWUH 4JFFA 3HR5B 1I7UA 2F5AL 4ENED 3T0AA 2DKSA 2XXMB 2KDGA 2J8OA 1JYXA 1NFIA 5C0BE 3TN0D 4CN4A 5C0AE 3ES6A 3GNMH 4M6OH 2Z91B 4JRXD 5ISZB 4BM7A 4P23A 5DR5H 4UBDD 4CKVX 1KNOA 1YEDA 1AD9A 4AEHH 1WITA 3BMWA 4HUWA 1CDUA 3Q6FA 4LSTL 4JPIA 5DJCB 3BPOC 3N1PC 2YD6A 5BRZB 3QIUC 5AWNH 2GUOB 4ODSL 4BFBD 4GMTH 4F33A 5JO5A 2GJ6B 3N1MC 4KAQL 4NKMA 4WGVB 4GG6A 1NMAL 4L9DA 1T2QL 3EFFB 5CP3A 5K93A 1F3DJ 2VOTA 3GMQA 3B2UC 4CMMB 4Z5RB 2IJ0C 5DA4A 2WQRA 2XWJA 1FL6A 4Q6IA 1AIFA 4CVZA 3PWNB 3UTOA 3REVA 1MCLA 3EYOA 3N85L 1QFWL 1N0XL 2EE2A 4UDUA 2E6QA 5HI3D 1OAQL 3QWOA 3O4LA 1MFBL 3G08B 2RCSL 2EEBA 2XTJD 1F3RB 4FG6D 4LIQL 4Z0XB 1LMKA 3AU1B 3MRJB 2BNRD 4KUCF 1DVFD 1A3RH 2X4TA 4RMQA 1OAQH 2J8UA 4JFDB 3BAEL 4ALAH 3BZEA 4Y2DC 4LSTH 4OZFG 4JN1H 4I3RL 2DTSA 4P46C 1LO3L 1OF2A 2QSCL 4PJ8A 4M61B 3VFWA 1H3WM 2VZOA 2B2XL 2MKWA 3P77B 5F1NA 3S4SG 5ETUA 3IDMA 4UIKL 2CR6A 4S2SA 2NPLX 5GRYA 3OAZK 3B5TA 3O2WH 1A5FH 1WCBA 4YHZH 3BSZL 4FOMA 2J6EL 1QYGL 4ODHH 1FFOA 4OSUL 3O6LH 4HPOL 5E6ID 1DZBA 3EYOB 5CD5C 3MLVH 2VDLL 2Y1VA 3BSZH 1A6ZA 4NO2A 1YMMD 5EU3B 4OLZL 4WUUB 1JRHH 4ZPVA 4V1DA 4RGND 5JIHA 3QUZB 4LIQH 2G75B 2JLLA 3ARDA 4P4KA 2E3VA 3NCEB 1I3RA 5E8EB 1FL3B 1SMAA 3IETA 5FGRA 1R5IB 4PJBE 1KCVH 2V2TB 5CGYD 1MLCA 5GS0D 4O02H 4BSWA 3MC0A 4OI7A 4POYA 5L8JB 2DI8A 2DYPB 4I18B 5KG9B 2C1OB 5C7XH 4D8PA 2FBOJ 4R97B 3WO3B 5DJDA 5DJXB 1AQKL 2N1KA 4X6DB 3RWDB 12E8L 3MOBH 3GI8H 3OSKA 4Y5YB 4ODSH 3MFFB 4X7FC 1QFPA 4EJ1C 1WVZA 1UM4H 1WWWX 2ZSWA 3H2WA 3T2NL 4MD0A 4QRTA 4OV5A 3Q3GA 5IHUL 2ADGA 5IFAL 4HMDA 2HG5A 4I77L 1CD8A 4HFUH 3ARBD 1RPQA 2BK8A 4HUXA 1A22B 5KSAD 1DBAL 5T33H 2ESVB 1ZT4B 3FMGL 3ILPB 1T66D 3DI2B 5L88H 3VD9A 1JWUB 4JRWA 5HHVH 1W0VB 5EB9A 3IFLH 4Y5XC 2IPTH 4LHJB 3P4OB 1N26A 4NUGL 5FKAA 3VW3H 3EJZC 2D31A 2BNQE 5DGRA 3C08H 3MV8B 2OL3A 5FFLA 2HWZH 4Y8DC 3ULUD 1E4WL 3C2AL 2FB4H 3VFOB 1NFDA 4YHYC 3QPXL 4XPFL 3WMSA 4IDLA 1YNLL 3X12B 3EYSH 4P46B 4KI5E 1P9MC 1PKQE 3DMMD 5E7FA 3F65A 4LK4A 3O4LE 3BN3B 4FZ8L 3V52H 1S9YA 4LLDB 1JTPA 1KTLB 3IYLW 1NGQL 4DOHB 1LP9B 4H88L 5EU7C 5IFHL 5E2VL 4JDTL 1G9NC 4POUB 3W0WE 1VSCA 5F7EL 4ORGA 3RY6C 5F72S 3QH3A 2X4RA 4LCCA 3GKWH 3UYPA 2IPTL 4G8GA 4PJ7F 1F90H 1XCQB 4JFYA 5HSFA 2CDFA 2YKLH 2NY4D 4YHLL 3KPRB 4RMTA 3ROLB 4AQ1B 5EBLA 1MQKH 2LQRA 4Z8FH 3L5IA 2KQMA 5JPNB 4UUJA 2VQ1A 1EUTA 5H94B 3ZSSA 3QHTC 5KN5B 4GRMA 4F9PA 1KJMA 4YH6A 3GUTB 2XQBL 3ARBB 2JE8A 2NY6C 2OP4H 2OMBA 1V8HA 2R1YA 3KPNB 4G9FB 1VCAA 4LHQB 5C2BL 4NNPH 3LKQB 4K3EH 2JIXA 4Y4KC 3MA7B 5FUCC 4OV5B 3FFCA 3MJ9H 3RL1B 2ZUXA 3UZEA 5I1HH 3DX9A 1JGVH 2R2EB 4JDTH 3CFIC 1ERNA 4WFFE 4OFYA 3TPUA 4DKEH 1F4YL 4FTVB 2ZOLB 2IH3A 2ICEB 4LDOB 4G9DA 2VISB 5DSCA 1RVFL 1MJ7H 5AAWA 1V3LA 1EFXB 2ZG2A 1TDQA 5I71B 1PW3A 4WFED 1U3HA 2UUDH 4NZDA 4ONHB 4PY8I 1L0XA 1P5VA 1BX2A 3CK0L 1G0YR 1MHCB 1QLEL 5D1ZA 1RZJL 3MLPA 1IGFL 3BPNB 1XR8A 4R90H 4OLWH 4HH9B 2D4DA 5EIVA 4YFDB 4LVNC 3UTZB 15C8H 3C5SA 4DAGH 2P5WD 4N8CH 1CS6A 3T0EC 2HJFB 4M48H 3G6DH 3HC4L 1QA9A 5K9OB 2CUMA 4ODVL 2DQFB 3N0PB 3Q1SH 3BT2H 2VZUA 1IQWH 1QFOA 4BZYA 2DL2A 1DQJB 3PE9A 3QFDA 2X7LA 3QDMA 4KJYA 4XZUA 4KZEH 3FQUA 4BQ8A 4WJ5A 1U8QA 4LHUA 1RJCA 5D2NA 3CFCL 5DEFB 3GKWL 3TH4T 1CXFA 1K3ZA 3VGGA 3JWDC 5FGSA 5KANG 4JHAH 4FXKA 5KBNC 5EU5A 3VXUB 4L8DB 5J6GA 3GNML 4HK3N 2FO4B 4MDJB 3BIKA 4RA0C 1RUKH 1BVKA 1LEGB 3L7FA 3TESA 5EU6A 1IM9B 1G7QB 4FQHB 3C5SB 4NP4L 4PBXA 5FF6A 4G6AC 2NXYD 5HPMB 1G7LB 2B8OT 1QFWM 4L3EA 4XNUL 3OKYA 4QO1A 4G6FD 1FAKT 1KBGH 3RL2A 3VXQB 4IJ3C 4HUVA 1YYML 3HE7D 1OLZA 2F74B 3QEHB 1QRNA 3FOLA 2VLKA 2HJKB 4RWHA 5A2IH 3EYFA 3AXLB 4RMUA 1D5XA 2A1WL 4ACPA 4FQXC 1MJ8L 4FQIH 4OQTH 1WZ1H 5HI5D 2IBBA 5IBTH 2X4PB 2XQYK 4F58H 1ZT1B 2UWEF 5BVPH 4R2GD 4TNVF 3L7FB 1HOCB 3SO5A 2AXFA 1NEZA 2HVKB 4NHUA 4HIXH 5ICYA 3W0WD 1UJ3A 4R3SB 5C07E 1EJOH 4OD3L 43C9B 4NC2B 5KVMC 1IGFH 4N0CC 2HTKC 4DJMA 4R97C 2H8PB 1A64A 1M7IB 2X2YA 1DQQA 2VXSH 4PGJA 1ROWA 5FB8A 3HE7B 2YD3A 4JQIH 1DDHB 1IC4L 4GW5A 2VLRB 5GZOC 3RJDA 4DCQA 3GK8H 5T1MA 1ITCA 1VADB 4L1HA 3D85A 4W81A 2VL4A 4LLYB 3LRSA 1IGTA 5MEOA 1OM3H 4NJ9L 3IKCB 3ARYA 1LDPH 3BZFA 4OCRH 1VERA 4JHBA 4OIIH 2CK0L 4OCXH 5EUKB 4GW4B 1QEWA 5F3BB 4L8CA 1CICC 1JFQL 1AXTL 4LL9A 4FQQA 3CU1A 2EDJA 4UILL 3RUGF 5DRZA 4IS6A 1WFUA 4P2QD 2DQTH 3HZKB 5C0CE 3TO4C 1J86A 1SJVA 1YEIH 4OZIA 4BQBA 1BLNB 3DO3A 1IGYB 4PG9A 5D1ZD 1C5BH 1LE9B 4XP6H 4QRPD 5DD5H 3HI5H 4DUXA 4XCCH 1D9KB 5F1OB 1JZ7A 2VERN 3HZYA 4GQPH 1KIRA 4P2RB 3WLBA 1JK8A 3AVEA 4PS4L 4Y2OA 2ZUWA 4G6JL 3BP5B 4ODXB 4LLQB 2HT2C 5IB2A 2EDTA 4LSQL 5GRVL 1WTGT 3ALPA 2CK0H 4OCXL 3WS6A 3O2DA 1EBPA 2P8LA 2V17H 3U9PL 1MHEA 4IHOA 1EXUB 1GIGL 4J4PA 2VDKL 3SJVD 5J7CC 5HTSA 1B0RA 1P4IH 3SGDI 2UY7A 1ONQB 4CMHB 3IU3B 1WC7A 3VFUA 1EEZB 3WFCH 4Z95L 3DV4B 4JFEE 2FO1A 3KPPB 3RPIA 1WFOA 1RI8A 3V5DA 1UZ8A 5H2BA 3TO4D 1T1XB 1ZTXL 4F7CA 3BVNA 3VXUE 3G5VB 1CGSH 4Y16A 3B9KC 1YPZA 1S7SA 5IR1B 4JM2F 3VH8G 3BZ4A 5JMRA 4YX2H 3G5XA 3DV6B 2ZSWB 3CXHJ 4X6BB 1T04B 3BP7B 3EOYG 3MBXH 4YHPB 4OD3H 5M94B 4ELKB 3O3EA 3O6MH 5ESQB 3RI5K 4YJZL 3LKPA 1Q9OA 4EIGB 2YZ1A 1PD6A 4L3ED 5K9KA 4PLJC 5D71H 2FB4L 3F5WB 4U1MB 4XPTH 4J3XA 5E6YA 1J8HE 4NO5A 4HCRL 4OZGE 5KSUB 5I15H 1EHLL 2VLLA 5JHLL 4GG8A 2NLJB 1P4LB 4L4VA 5HJ3A 2EDLA 1NCUA 3QPQC 5EIIA 4QOKB 2B4CH 5IM7A 1W72L 1EO8H 1E4XH 3C6LB 3NZHH 3F7RA 1ZLUK 1OSZA 1YNTB 4BYHA 1KNOB 1YEDB 3VXNB 3QG7H 3RPIB 3STLB 3O41B 4NDMB 3RVUD 3QO0A 3HMXA 4UILH 1TJHL 2HTLC 5JW4N 5J4MA 1KTRL 1F11B 3S97C 3A67L 5CZKA 3QJHB 3OKEA 1OT2A 4WV1C 3U0PA 4L29A 4LVOB 1UCBL 5DMGC 1RMFL 1F90L 5DMYA 1J0JA 3GBNH 2OLDA 1NCAL 3SE9L 2YA1A 4HEME 5ITFB 9CGTA 4XNQA 2QV2A 4U1NB 4L3CB 1QO3A 1G9NH 3LPGA 3DWTA 1KEML 1QLFA 4ZS7H 4LRIA 2YPKB 1U91B 5T5NG 3K1KC 5DHYB 4IRSD 4UTAH 3NACL 3X11A 1YYLL 4X6EB 4BZ1H 5CEYB 4WWKC 3AB0C 3LHPH 3MLSH 4N0UE 3KYNB 3FQWA 4BFEA 2F15A 2P8MA 2HH0L 1RAMA 3B9AA 3LEXA 4XPBH 5EBWA 1MCQA 5DVOA 3MRHB 4POZD 2FR4B 4U1LA 2GFBA 4PJ9A 4Y16B 1ZHBA 1FAIH 4OZFA 5CD3B 3AY4C 3SE4C 3JTSB 3VGAB 4WTXA 5B3JE 4PGCB 5EZLA 5IEKA 3ZE0F 2BY2A 2ATKB 4HPYH 4DKFH 3CK0H 2QLVB 2PO6B 3FB5A 4PV9B 3T1FA 5K9KB 1L7IH 1RUQH 3OXSA 2EYTA 3BH8A 4UQ3A 3FN3A 3QO1B 3QNXB 5AYQA 1O5DT 1I1YB 2ZOLA 1DSFH 1BJ8A 4ODUA 3BHBB 5FYLL 5F1IB 2NY0B 2RIKA 2ITCB 1TMCB 5IIEB 1JUFA 4EBQH 4J4PD 4XI5C 3BIAX 1M7DB 2H2PC 3TJEH 1ZT7B 4IRJB 4FFWD 1FQ9C 2HT2D 5EZJB 5GGQL 3ZT6A 4XNXH 3O6KH 2NTSP 2VABA 3TO4A 4NQEB 3AAZA 4U1SB 1UZ6F 3K2UL 5AD0A 1CGUA 3NABH 4JPIB 1JV5B 4OZIE 5HVGB 1ZHNA 4MD0B 4Q6YA 4Z7WA 2D03H 3V6ZB 1I3GL 1X9QA 3QUZD 1MCBA 3FTGA 4C55A 1A4KB 4P4KD 1RUQL 5E9DE 1GOGA 4XBEL 5GJTL 4LQFH 4DVRH 1QLRA 4JY6B 2Q7NA 3C2SA 3UTTD 3QNXA 5CGMA 3L3KB 3GMMA 1G7PB 5LBSL 2DJ4A 3DXAD 1T5XA 5IW1A 2Z93B 2DWDB 3CLEH 3QUKB 4W6YB 2QADC 3VGFA 3WKMH 1MF2L 5E8EA 3T1WA 1ED3A 3I6KA 3VMPA 2BERA 4X6CA 2Z35B 5CLWA 1VACB 1BJ1H 1NKRA 1MVFA 3L3JA 4IBLT 2VJXA 4LSRL 1MCPL 2AP2A 5EFIA 2IBGA 4M7ZC 3L5HA 2YMXH 4Y4HC 1OTUD 3P9LA 4LNRA 1VA9A 1IBGH 1I8MB 4QTIL 1DLHB 3X3GL 5IB5A 1L9MA 3I75A 5DTFA 3GJFB 5BCAA 4RMVA 3IF1B 4O9HH 3PQYB 1LO5B 1U93B 2DQHH 3VXOB 5ENWB 1HQ4A 2QR0A 1X7QA 3JV6A 1CT8A 1A7BA 3UZVB 4F9PC 3PGFL 5FYKL 4ONGL 2GTWA 1ZT4A 2NXZB 4BK4A 2BOCA 1N5AB 1OT1A 2E7BA 2ADFH 4OZFH 2VAJA 3S4SB 4I9WE 3ZYZA 2Y72A 3W2DH 4WW2B 4J2XA 5L9DL 4X9GA 4LDEB 4OLVH 4F8QA 4ZUSA 1I4FA 5DC9B 4C83B 1BVKB 1UH4A 2FD6L 2Q86A 4HG4J 5KVGL 1OGAD 2A6IB 4LCWA 2QQKH 5BV7B 3MV9E 1H5BB 3FAXA 4M8QB 1MRFH 2QSQA 3RWGA 1U8IA 4R4BB 3ZDYE 2O5ZL 3RL2B 4H0IA 1EEYB 3MLYL 1XF5B 2FX8L 4WU7A 3VA2C 4N68A 4NO3A 5FO8A 2R2BA 4JG1H 1FH5H 3ULSB 2ZCHL 1FVCB 4MQXC 4Y8AA 4KPHL 4U6YA 1RJZA 2BVQB 2V2XA 4JFYB 1BX2B 4QRQB 3GI8L 4ZUTA 5KS9A 3TGXA 3DYMA 1XR8B 2DBJA 1PLGH 1YEFL 1JMZA 5DVMA 1QSVA 1YEJL 4LCWB 1VDGA 3MRFA 1RZFL 2N7BA 3IAQA 3ESVF 4YBQD 4KI5D 4IOFC 1T7ZA 4N90E 2X44D 5JXED 3DJ9A 3RGHA 4JAMB 3ARWA 1CTNA 2Z8VC 1U58B 2Y5EA 4Q9RH 3EFDL 3PP3H 5CD5D 3O9WB 3D0VA 3DURA 5F7KC 3VW3L 1EJ6A 1U3HD 3RU8L 1H5BC 3B83A 4JB9H 3U46A 1C08B 3GBMH 3ZSTA 1T4KB 2EE9A 3CVIL 5T3ZD 1BIHA 4HWZB 3PL6A 2CUHA 4TNWK 4Y19E 4XXDB 3U82B 3S37H 3VFRA 5DO2C 1ZGLB 1KN4L 2EDWA 3MRIB 4ETYA 3OKLB 3PGCA 4UIMB 3VFVA 2EDYA 3SE3C 3FO2B 3X3FL 5JOPE 1GOHA 1R5WB 5D4QA 5A2JH 2CDFB 2Q87A 1UQSA 4M1DH 1RFDH 3TBYA 3WIHL 4WO4A 2I9TA 4JFZH 1CLZH 4MHHG 5DI8B 2Q8AH 4X8JB 4HV8A 4LF3B 2NXZC 5T1LB 3QHFH 4TQEH 1ZVHA 2NNAB 2OK0L 4MVBC 2BNRA 2V9TA 1EZVX 1F2XK 4JG0H 3WLBB 3CPLB 4DGYL 4LDLB 5T5NF 4IRJC 1LEIA 1D6EB 2ARJB 2IAMD 1CQKA 3SDXA 2F53E 1MRDL 1CLCA 1VFBA 5A16A 1IGJA 4S1DD 3DRTB 5CBAA 1MREH 1NFIB 1FVEA 1MFCL 2EXWD 4KTDH 2IAND 1KYOJ 4OKDA 4LEXL 1OB1A 4K7FB 4G7YH 2XA3A 3JVGA 3MPCA 3TT1H 1BWMA 2CO7B 3RAJL 5EU6D 4JFOB 2F53D 5EOQH 4U1HA 3WSQL 1HHIA 1CGVA 1AGCB 3KPLA 4UB0L 1A7RH 3HG1B 4WO4C 5ICZB 4MX7B 2JELH 3C60A 4NQSA 3V6FA 3O45A 2FO4A 3SDAB 1F4XL 3RWEB 3LKOA 3X14B 4Z0BH 1YMMA 4PR5A 2Q8AL 3O81A 3CX5J 2G2RB 1OTUC 4WV1A 5TFSH 2DLFL 1UM5L 1HQRA 3P9WB 1IGMH 4BQ6A 1DDHA 3U30C 3HG1E 2Z31D 1KJ2B 2DLHA 1WLHA 2GSGB 4QTHB 4XP4H 1FBIH 3MV7A 4KHTL 1BVLA 4NO5B 4ODWA 3QYCA 3T2QA 5IUSA 4ZDHA 1MI5A 2QADD 2R0LL 4JDZB 1MLBA 4XCNB 3KGRA 5IJVB 1BZ9A 4Y4KD 1A6AA 5E2UH 3RU8H 3FL7A 5CJOL 1IAKB 1WBXA 4XVTH 3UPCA 2O5YH 2H45A 4JPWH 5MI0B 4X0KA 3MGAA 1ODAA 1TZIA 4LSUH 4NO0B 3LKNB 4EI5C 3QFJD 5INDB 3ZKND 5B4MC 4Y2DB 5DEFA 1KG0A 3PGCB 4UIMA 3OGCB 1YMHB 1RUPH 2AXHA 3PWPD 3WUWA 1MAML 2YD7A 3HC4H 1DQDL 4PGCA 3H8NA 1EV2E 2EE3A 4U7MA 1JMXA 4OM1L 1LE5B 2VTFA 5IMLA 1INDL 4P59L 4PJGA 1NMAH 1N3NA 1KC5L 3EJJX 1F6LL 5BOZG 4XPGL 4BUHA 4WI5A 3G9AB 3EO1B 4NKQB 4NWTL 3WNMA 3O6FC 5DVNA 3P30H 7CGTA 1I1YA 3IAPA 5E94B 1U8MA 1ORSA 5IVXB 4J4PC 2Y4SA 5F9OL 1NCDH 1GGYA 4RFNC 4TUOB 5CUSL 1WISA 3EYUH 5FIEA 1DBJL 3LN5B 4X7CC 5I1CL 3IRZA 3K46A 3NPSC 1IAIM 2E7LA 1VENA 1BAFL 1QRNB 3DMMA 2YN3A 4YHIB 4NQED 4U6TA 1MCEA 1LP9F 3BVNB 4NP4H 1LK2A 2OTUA 1I8LA 5A3IC 5ADPL 4XBGB 4NKMB 5FEBA 2VL5A 1JE6A 4X7TB 3WHE0 4WEBL 4UTBL 1G9MH 1A7OH 4R2GB 2VDNL 4OZFB 5CD3A 4Z7UF 1E28B 2X4NA 1FRGL 2D7OA 5E5UB 2VLKE 1QLRB 4JY6A 3ALWA 2M26A 5DUBB 3LSOA 4ZUWB 3G5ZB 1QYGH 2CLZB 3MCKA 4QTHA 5DT1H 1A7PL 3ZKMC 2MOVA 3T0BA 5GZOD 4TUOA 5E4EC 5JPMA 2YXMA 4HQQH 4OLYH 3GSVA 2D2OA 2P5EE 1MUJA 2AKRB 4JPVL 2GHWB 1A02N 4QXTA 5L88L 3RWCA 5JOFB 2V6HA 4EI5A 4YHIA 3BRDA 2ITCA 2NW3A 4KV5F 5HI4C 3QUXA 1T6VN 1QEWB 3SPVB 3U7YH 2W60A 4NO0A 1UM4L 2E7CA 3OKEB 1EA9C 1IKNC 3UTSA 4NT6B 2VXQL 4ZS6D 1ZKAA 4NZUL 5MEQB 5TF1H 3BRFA 3UPRA 2MQ0A 3BP6A 2VDQL 4PJXA 4LSDA 3KXFD 2J12B 4X6BA 4OFYD 1JZ8A 3GFUA 4OM1H 5CLTA 2R15A 2R2HA 2G60H 2P4AB 1I7RB 2UYLA 3QXUA 4HXAL 3MOAL 3NH7H 1WFTA 1T1WA 2JK5B 3HE7C 4XX1G 4LLUB 1RK0B 1WGOA 1RUML 3TJHD 5C0BA 1JPGA 5CEXA 4F9LA 4Q97A 5E8NA 2V7HB 3B5GA 4YDVB 1U8HA 4LLMB 3OZ9H 3I6LD 3LEYH 4XNZC 4BKLA 5D1QA 3QNZA 4J8RA 4KDVA 4WW2A 4XPAH 3SPVA 5DS8A 1HHGA 5JORB 2PR4H 5D2LF 4I48B 2EYRA 1XMWA 1JF1B 3EDFA 3D3VE 1K4CB 3DUSA 5F88A 4GW1B 5DD3L 3OF6D 3CFDA 2FHBA 1IVLA 2DKUA 2PYEE 5E95B 2OTWB 1YQVL 4MD5B 3BZ4B 4QOKD 3F7VB 3T77B 1WV7T 4KRPC 4PJGF 4J3VA 5KVEH 3N9GL 5C0BB 4L4TD 3IB4A 2FCBA 4LBEA 4KGJA 2Y7QA 4L9LB 4GSDH 4D0BB 4TPRH 2GAZB 4ZFZA 3GSOA 3C5JA 3WNNA 4FXGB 1D6VH 3E6HA 2XKNB 3QUML 4KROB 2ICEA 4HF5L 2XNAA 2IQ9L 3P9MA 5GGRA 1MREL 2EIEA 4BSWB 4N0YL 1WICA 4J1UA 1L4IA 1NC2A 2VABB 2NY1C 3TO4B 1U8KB 4AG4L 1MY5A 2J5LC 3IXAA 1IL1B 1L9NA 3VXPB 1MWAH 1YY9C 1S9WB 6FABL 1OF2B 1OGAB 3AMKA 2R0ZL 1RIUL 5B22A 3V6OE 5HHPA 4U1IB 3ECBA 3IJSB 3W9DB 3SCMA 2ITDA 1SEQH 1EGJA 1VGKB 3RTQC 4HT1H 2ICWJ 2FGWL 1OAUH 4G8FA 4YO0A 4NNPL 3WXVH 5K9OA 2MCPL 1JYVA 1QRNE 4OD1L 4ORGB 5TDPB 4OM0L 4WHYH 2GAZA 4DGIL 3F7YB 4NO3B 1JPGB 2C1PA 3QCVL 1BWWA 3U0TA 1IM3A 4YE4L 4JY5L 5I6XB 3QUMA 5C08D 4U3XA 3WKNA 1MHHB 5C0NC 3STZB 4EXKA 3NOIA 4R90L 2HFFB 4LU5L 4PLNC 4P5KB 5CJOH 1AC0A 1P53A 2CIKA 5J1SC 4QHKJ 1HH9B 1P7QA 2DLGA 4NZJA 3BIKB 4WRLA 2OJZH 3VFOA 4YWGH 1AGFB 2HMIC 1DLHA 4N0CD 1RZ7H 1YPZE 3I50L 1CL7H 3OR7A 2R29L 4XGZA 2Y36H 3UTPE 1BIIA 1JNHA 4KAQH 2FZ3A 3CH8A 4XB7A 4OZ4B 4YHKL 5GGTL 3EYQD 3H9SD 1WZLA 3F7VA 5FHBH 3RVXC 4ZXBA 4Y4KB 4LKXA 4F3FB 4OM0H 3G6DL 4U1KA 2CMRL 4ZFFA 3CDGB 3QIUA 1UXSA 2EZ0D 4Z7UE 5AAMA 4F2MB 1AGDA 1M05A 2HKHL 2XN9B 3RY6A 3NAAH 5J11B 3DURB 3FOLB 4RIRB 1VFOA 5I75C 4EUPA 5F9AC 2WQ8A 1P6AB 5IK3B 2LAAA 2FHCA 1HHIB 2YD4A 1CXHA 4RAVB 3CVHB 5E2TL 3PV7A 4WUUD 1BEYH 2D31B 1FO0H 3OJVC 1DEDA 3NGBC 1NEZG 3QXDA 4XGZB 1UH3A 4W4NA 2BRQA 1FFNA 4GKNB 4BZ2H 3VFSA 4WFHE 1RIUH 4UTBH 5C0RH 4NC1C 4O4YH 4YGVB 3WFDL 4GRLD 1SEQL 5D93C 2F54D 4RGMC 3WIFB 2IPKB 5J57B 4FFVC 1A6TB 3F62A 3SGJA 1CDCA 3CFBA 2EKSA 3SDAD 3HRZA 4RQQB 4K7PY 4X0KB 1CFVL 1AXIB 1ZA3B 1PG7X 1G9MC 4OZGB 2PXYA 2F53B 4PJ8C 3W5NA 3KNBB 5HHQA 1DEEA 4JHWH 2HT4D 3H7LA 4KKBD 1SHMA 4NZTH 1ZSDA 5J6HA 2VH5L 3F6LA 3GMRB 1IT9L 1YY8B 2H6PA 5HHNB 2VZ3A 2ZZUT 3VRIA 5I1CH 3JWDL 5L7XL 4ERSH 2CKBA 4U1JB 4ZYKB 3MV8E 4MAUL 4LEOB 1C16A 1AHWC 1U8OA 4CADA 3HFMH 4OLXL 4APQA 4RGNC 1H9VA 5GGTH 2IPUG 1U9KA 3RKDD 4JFEB 3VRJB 3D0VB 1PSKL 4LSPH 1R3KA 1K2DA 1T1YA 3SDDC 1BQHA 4Y19B 2JTDA 1FNLA 4NWUL 4TUJA 3N1GC 1H15A 4LSSL 1V3JA 3DETC 4M8VA 5FGCE 4PJHA 3BW9A 4EN3C 3NAAL 4WU5A 1JPSH 2YA0A 4CN6A 3IVKA 2HN7B 4JRXB 3C5ZA 2OZ4L 4OGXL 3DV4A 3BEVA 1N5AA 1O7VA 4HHAA 3U79A 4TYUA 1HE7A 1YY8A 5HHNA 2DMKA 4MGXA 4LSVL 4HUUB 4YDKL 3D3VA 4GKZB 2IBZX 3MJ7A 4NKDA 3T65B 2BSTB 5B8CA 4WIQA 4JFQB 2H26A 4FFZL 5GIRB 1MNUL 4G6ML 1BJMA 4ZUSB 3TA3D 2QQLL 2EECA 2BVOA 1ZK9A 1PBYA 4PRIA 4NKOA 4I3RH 3KYMA 4KKCC 3TJHC 1CICA 3SJVE 5ISZD 3H9SA 1X5ZA 5EO9B 1D5MA 4MNQE 1K2DB 3QUYC 2FIKA 5H8DA 4GO6B 3D18B 3TYGH 4K07A 3D6GA 3NIDF 3AS1A 3ILQC 1FVEB 1DN0A 5AZEH 1TZHB 1KGCD 5AUMA 1Y0LA 2B4CL 1YEKL 3RWCB 4M7LL 4WU5B 2J6EH 2ZUQB 5KZCB 2NY3D 2AJZB 3PL6B 3HMXH 1R5VB 4LLWA 3RRQA 5DLMH 4OTXH 2XI9A 2ZNXA 5LQBL 3RBSA 3FMGH 4XP1H 4KTYA 1HNGA 5I1AA 4K94H 4F58L 5BVPL 2VR4A 2IQ9H 3INUH 2R9HC 4HLZH 3MOQA 3VH8A 1C5DA 4PR5B 1UJ3C 2A73B 3VG9B 4XP1L 1J0ZA 3MLRL 5GRXG 1DLFL 1EGJH 1G6RH 2A83A 2EC9U 1L7TL 4LCUB 4LVOC 1B6UA 5JNYA 4TVPD 4RISL 4NQVA 3FO0L 4HV8B 4LF3A 2GSGA 3QDGE 3TN0C 4AENB 4YLQT 5IV2A 2Y25A 1G9NL 2X40A 3D2UB 3TYGL 4TSCL 4L4TE 5EU7E 1R24B 2L4OA 1J9CT 4YR6A 1QUNA 2CR3A 2W65A 3V4PH 1QACA 5AUMB 4FHBD 4DWHA 3IU4L 1MSPA 4V1DE 2J8HA 2OQJB 5JQHC 2YPVH 4OFIA 5DK0B 4NNXB 5EUKA 4Q74A 2IQAA 4Y5YC 4ZNEA 5T3ZE 3N1QC 4WW1B 2YPLD 4QYOB 4YPJA 3QQ9C 3C5ZB 4OCYH 1I85A 2BDNL 4MS8C 2EIZB 1RZIB 3QG7L 3TM6A 2MHAA 3MMEA 4AH2A 5JW4M 3PQYE 3KPLB 1MCSA 1KLFA 4HEPG 2BC4A 1UKSA 3IFPA 2YK1H 4M7JL 4WUKH 2G9HB 1RJYA 3CC5B 5D1XB 1VEMA 1ZHBB 1NCBL 4K3HA 3FO0H 3ZO0A 4DUVA 4PJBF 2C9AA 4HWBA 4Y4HA 5F9JA 3S7GA 1FFRA 2GT9B 4KK8C 3QIWD 3V7AG 1P2CA 3JV4A 1EZVY 1UKTA 1DP0A 2Q76B 4HX1A 5I1KH 1HEZB 3P2TA 4OJFL 1GAFL 4QRPA 3VXRB 5GGVL 3LHPL 5IM7B 2EXWC 1QFUL 3DTXB 5CP7B 4OFVA 2P5WA 3CPLA 4IOSD 4K55A 4UDTB 4NNXA 2ZCKH 1K4DB 2O61B 1HWGB 4FFYL 1OAYL 4XAKE 3U36B 2GJZB 3OHXB 4FQ1H 3PWVB 3SGKC 5IJVA 3PWLA 3SKOA 5SWSE 1RFDL 2YUZA 1GL4B 2VWEC 4Z95H 5C0DB 3S37X 2NXZD 2DRUA 1OSPH 1BZQK 4G8GD 3AS0A 3QDMD 1F3JA 2VSDA 3IXAB 5HHVL 4HZLB 5F6HJ 4PGBB 1U41A 1A3LH 4O2EA 4OZGF 3OGCA 3NPSB 1YPZB 1VB9A 1WCBB 5IVOA 2XOTA 3IDIA 5DRWA 1NFDE 5E2TH 2IPUK 4N8PA 2PYFB 3QAZC 5B21A 1P2CB 5D2NE 3FZUD 5FYLD 4I0PD 3KS0J 1ES0A 4OF0A 4ZOBA 4JANA 3G6AA 3LS5L 4CJ1A 5DUPH 3GMPA 4EN3D 3TBVB 3KDMB 5D96C 4HIEA 3O2VL 3WL9A 2N4IA 3EO9H 3RQ3A 4A6YL 3BKJH 5L8KB 4GMSH 1AD0A 1U8MB 4NFDA 3T0EE 3THML 1TZGL 2W9DH 3MV7E 3MJ8B 2C7UA 3R0NA 3KPMB 4CN1A 1BQHG 4ZOCA 3CLEL 1MLCB 3QI9B 5D6CA 1NGWB 2XKUA 2DLIA 2HP4A 4Z7NE 1ZOXA 4ZDHB 1J05A 5DQ9B 4ZNCD 4D8PB 4PJEF 1C1EL 1NKOA 4P3DA 4ISVA 3QFJE 1IAOA 4AJ0A 1CG9B 4G6FB 1NBYB 1Z9MA 4FQXD 5HYQA 3QZWB 4MAYC 2BSRA 3MLTA 3QWQB 3Q5OA 4QRTB 4XHJD 2NY2B 3B9EA 2OS7A 3LRGA 4LCIH 5LJYH 3DIFA 2RBLA 1ACYL 1Z3GL 3LAFA 3NMEA 1VKXB 5KSBA 1T0MB 4LCCC 4A6YH 3JUZA 1T1ZA 1QLEH 4YHML 4FQXB 1N3NB 1OCWL 1S9XB 1J8KA 1Q72H 4XPTL 2B39A 4QHMA 3E6FB 5I1EH 1UWXH 3EFFA 3OL2A 3UAJD 1WF5A 2BNRE 5IVZA 3W0WB 2PTVA 3E8UH 4YGAB 2ADFL 2YWYA 4OIIL 1GGTA 1S7RA 2NX5E 4LHUD 5MENA 3LQAH 4NC0B 5CCKH 3VXNA 4WW2F 4KKLC 5CZXC 1OSPL 2AQ1A 5D5ME 5DO2D 2VC2L 4KY1L 4S11A 2BSRB 3SGEI 1PKQB 1KC5H 3QXTA 2EDRA 1HINH 1I9EA 2I5YL 1C5CL 4NM4L 2VC2H 3TPKA 2ZUQC 2ORBH 4I0PB 3OAYK 2E8YA 3SGJC 4PBWD 1S8DB 2WINB 5D70H 1EJOL 4I4WA 2QQLH 4R26L 3TCLA 1N4XH 1QBAA 2DWDA 2HFTA 2J6EA 2Z93A 3M17B 3DNKA 3QRFM 1UCTA 4MJ2A 2W0FA 3MJ6A 4G8GB 3TWCL 5DFVC 1BD2B 4LLMA 3KNBA 5HHQB 5JPNA 3RHWK 1CK0H 4WEBH 4G8EB 4LSRH 4L4TB 1J8HB 1RHFA 3T4YB 2JJWA 3ARVA 1S3KL 3HB3C 1U8NA 5J1AA 2AQ2A 1G7JA 5JDSA 3SEPA 5DJ6B 5BVJB 4I18A 1WZKA 4HGWB 2JJUA 1Q0YH 3EOBB 4OKVB 3KLHC 4Y4FB 5AYUH 1C16B 2R1YB 3MREB 4R96B 1HN1A 1I8KB 3MLYH 4AT6B 1LO5A 2W1NA 3PNWB 5DHVA 4P9HH 3FTGB 5D70L 1KCKA 4EI5D 2ED9A 5FYJL 5DD0H 1GGUA 4D9LL 1FZMA 2CRZA 2MSPA 2RQ8A 4D2NA 4EN3A 4XCCL 3AY4A 4M4PA 2WWMC 5IMMB 5HGDB 1SJHA 5KW9H 2YS4A 5HYIA 5CBEB 3K4ZA 4D3CH 2OSLB 4LCCB 4HJ0D 2X1QA 4FXLA 1BBJA 5L2KD 5GRUH 5I8OH 3ILPA 3K74B 5HGAA 3L9RA 1SVCP 2FECI 4KUZL 2R0WH 4QRUA 5D1QB 3X3FH 1Y6MR 1U0QA 4YC2B 5GRJL 4DK3A 1VFAB 4HWBH 1ACZA 4IRJA 1A6VL 3GDBA 3HMXL 4OZHA 3RFZC 1MRFL 4RX4A 2OR7A 2EE6A 1D5MB 4LVHB 4TNVK 5DJDB 4HLJA 5EUOE 4P2RD 1YEIL 2K7QA 2YHGA 4OV6F 5FA3A 1JPTL 1QKZH 3CH1A 3D85B 4NQDE 2F58L 4LLAA 1WAAA 2DLTA 5HYSB 4RIRA 1Q94A 1XIWD 5J12C 1KXTB 1XZ0A 3WEXB 1AY1L 3DPBA 5F9WC 3WJJA 4M1CD 2FLBT 5E5MA 3ABZA 4G6JH 5IW1B 4KRPD 3H0TB 5BZDA 4QRSB 2R56L 1XGTA 2P8PB 1ZS8B 4KKCD 3SJVA 2JCCB 5IHLB 3HG1A 5ICZA 2E9WA 2E8ZA 3CD4A 5D7JA 3MJ7B 4N8VA 4RWYL 5JIPA 1T66C 3WIIH 1FG2A 1H5BA 2Z0BA 4WCYL 4TRPL 1KXQE 5BRZE 2XRAH 5HHOD 3HTLX 1XGQA 4PRNB 4GRWH 2DTML 3CMGA 5LGHL 3NIDE 5D1XC 5F3HB 3BDYL 5C0EB 1RMFH 4KKAC 4B53A 3MNVB 3CH1B 3WV0A 3QEGL 3MV7B 3CUPA 1KOAA 5CINH 4Z7QE 4JG0L 4JB9L 3D1MC 1PEZA 2AW2A 5IW6B 4FQCH 1I8LC 1O7SA 1A6AB 3ULVL 1X4XA 2ZUVA 4MD4B 3UBXG 1BBJB 1S5IH 3RKDC 4ETQB 4WFEE 5IWLC 4TSBH 3PHSA 4QNPF 1FPTH 3U9UA 5TE7H 1MEXL 4PJAF 5FYKE 1JZ2A 2H2PD 5CGTA 5C0FB 1WBZA 3CDFA 5DI8A 4X4ZA 4N8VB 5D5MA 4D0DB 5C8JA 1T22B 1JYWA 2LU4A 1FSKC 1AR1C 4KC3B 2DTMH 3BDBA 4N0UB 2H9GB 4K8RC 3G6JE 3KPSE 5CWSB 1NC4A 2L7JA 5T5FH 3RVVC 4L3AA 3WCYA 1KJVB 5TH2B 4PY7B 5JXAL 5KSUA 3RWGB 3MLZL 4OUOA 4RDQG 4XCFH 3NN8B 1UC6A 1DVFB 4P23C 3W39B 1MCDA 4MD4A 2FX8H 3IVKB 1OVZA 1AI1L 2QADB 2FJFB 4N5ED 4E41A 1IKFH 3MRGB 1FZJA 2BVPA 1ZLWH 3SDYH 4L9LC 5HYEA 1I1AD 1DQDH 3IS1X 2PTTA 5TPWH 3HRPA 1MFAH 4GKZA 5LAXB 2J7LA 2VISA 3MRLB 4ZUTB 4UTAL 3QIBD 4FA8A 5TPWL 1PFCA 2P24B 3HMWH 1OARL 3MA9L 3WJLA 2GJ6D 1DANT 1PY9A 4FS0A 1M7IA 4IRSC 5BXFB 1CICB 2O26U 3TVMD 4JJ5A 4KRLB 4LP5A 3GBNL 3T4AA 3QEUA 5CUSH 2FWOB 4PJ5B 1JCKA 4MXWL 4X80H 5E6IB 3KYKL 5DUBA 3SDCC 1S7VA 1LEGA 5A43C 3EHBC 3LH2H 5FDWA 3VRJA 25C8L 2OBGA 4XCNA 1TENA 5HGHB 4W6WB 3B8SA 2FJGA 3FQNB 2OZ4A 5BZWB 5HXMA 2DAVA 1A6TA 4X6EA 1MFEH 3A6BL 1K6QL 2IAMA 3VXQA 1DFBH 2HJKA 1CFNB 1NUNB 4JFOA 1ETZA 4NUJA 5CJ8A 4X4YB 1NPUA 2WUBL 4E5XB 1DEEB 5IB4B 3OKNA 4FABL 3LKOB 5D6DA 5C0FA 4HWEL 4NQVB 4DTGH 5ANMA 2IFFH 4G43A 1A2YA 2ATKA 3QBTB 3ULUC 2FWOA 3N85H 3TV3L 2R2HB 4R0LA 5ADOH 3IDXH 2RB8A 2W38A 4YEEA 1HSBB 2PXYD 4HKZA 4GAJH 4MQTB 4Z0XA 4YIQB 1C5CH 3DBXA 2OI9B 1AKJB 4GW5B 1JZ5A 1I85C 4Y0GA 4U0RB 2IQAB 4PJ7B 3LQAC 2NCMA 1EXUA 3S34L 1XF1A 1NCNA 2R1XB 5C6TH 3MV7D 5IIEA 5KW9L 3QB7C 5C1MB 2ZKHH 3X17A 3GSWB 2BVPB 4D3CL 2CKBL 4H26A 4G7VH 4PJHB 3SQBA 4GG6E 3MR9A 4L29B 3O3BB 1JNJA 3D5OF 2LVEA 5J1TC 4N1HB 1KT2B 1FJ1B 3Q2CA 1CG9A 1UEYA 5MP6L 3GI9H 4MA3B 3VH8B 1OQXA 2IWGA 4PGDB 4LQ1A 2PYEB 1MAMH 2FRGP 1R3JB 1U6AH 4YHPA 1QO3B 5I74B 4LCUA 4R2GC 3UROR 1PSKH 2YWZA 1SYVA 4H25A 5C3TA 3JZ7A 2D0GA 3M8OH 3ORJA 4HKZB 1F8TL 4KJWD 1UVQA 3PV6B 2KUTA 1BFOA 1BVZA 5GS0C 2V5MA 3V4UL 3KYKH 4LGRB 2P7TB 1A9BB 1QVOB 2X9WA 5KSAB 5FB8B 2RCSH 3ZLQC 3D3VD 1DBMH 1KELH 1M71A 3E6FA 2FJGB 3FQWB 4MWFA 4OB5L 1HHKB 2ESVE 2I60H 1JK8B 4PJDE 3H3BC 4JFDA 1TJIH 1BOGA 4KROD 1KFAH 4QGYA 4KV5E 1IGTB 2EIBA 4YHNA 4PGEA 3U4AA 2OCFD 1FH5L 1S7RB 1B3JA 3SOBL 3RWDA 3BUTA 4G6AD 2A6KB 2X4OB 2VXVL 1EO5A 4MJ5B 4M9PA 4N90D 5JR1L 1UZ8B 5H2BB 2PYFA 4Z7WE 2WUBH 3IDMB 4QHLA 4V2BA 5CMAA 5AWNL 5FUZH 1A7OL 1WIUA 3DX6A 1YMHA 3QPXH 1ONQA 1KB5L 1NGPL 4RAUB 3M8OL 1IAMA 3VG9C 4RFEA 3L7EA 5DJCA 1J87A 5SWZD 4P46D 3D48R 2P47B 3DSFL 2XWBB 2ESVA 5KS9F 4Y4FC 1J8HD 4XBPB 1NLDH 5DYOB 4KK5D 4F80A 3UBXA 2V7HA 4X6FB 4YDVA 4YIQA 4EIZC 1QBLL 3S96A 3DROA 4GXUN 3QCVH 3RWFA 1K4DA 5D8JL 5F8QC 2HFEB 4Z7VA 2Z4QA 1CGXA 2VLJD 2NY6B 2R1XA 4HIHA 5JQ6L 3C6LA 1IAOB 1QNZL 2C4XA 2F58H 1GPOL 4P4RA 1FC1A 2J5LB 2YKLL 3PQYD 3LEVL 1QNZH 1YMME 2XIDA 3QQNA 1FGNH 4OZHB 1Y6NR 5MEQA 4Y4FA 4WFHD 4NN5B 4OLUL 3HZMA 3IDYC 1F4AA 1HHHB 1N2RB 4PFEA 4UIKH 5I2IB 1DQLL 3OJDA 5KSBB 3I9GH 3B9DA 3KJ4B 4JGUA 5BW7A 4OGYL 2EYTB 4YAQA 3KXFA 1OAXL 4KTEH 4ZOEA 3RGVD 2EDKA 1OW0A 1UXSB 3BKCH 1TQCC 1T80A 2BSED 2R2BB 1WT5C 4QT5B 4U6XA 4CVZB 1FSKB 1A0QL 4CAGA 4XVSH 5JQ6H 3MROB 4M6OL 2VN7A 1U8LB 1N64L 5EZOL 1OAKH 1B0GA 4Z77A 3L9RB 1CWVA 5ILTL 3NFNB 1FV1B 2VZSA 1CXEA 2KZ1B 5KS9B 5ACLA 1V7NL 4L8SB 5I1LA 3OQ3B 1LWRA 4XC3H 4YUEL 5IF0A 1A21A 4WI6A 1QFWI 5TDNB 2B5IB 1KENH 1SY6L 3O9WC 4TUKH 3I50H 5KVFL 1A4KA 2YUWA 2HKHH 2QR0B 4UINH 4QXUL 3GMLB 3RWJA 1NGXB 1BGXL 3N06B 2DBLH 3WFHB 4HGKC 3WIHH 2KQNA 1T5XB 3U7AA 2VDOL 2XZQH 4YZFF 4NCC2 4JQXC 4NOFA 1MCOL 1TETL 5FDYA 1N5YL 4L4TA 1ZA3A 2Q1EA 3V79C 4M7LT 2LVCA 4ZUVB 4OFPA 4JR9H 3SKMA 3VG0H 3DUUA 3U6RA 1NANH 1K6QH 1MRDH 3V8OA 1AGFA 1MIML 1ZGLM 3HHRB 4OCWH 4NQEA 3C2AH 1NBYA 4Q7DA 3ZYJA 8CGTA 4HDIB 2J2ZA 2AEQH 3JTTB 3WLWC 3KR3H 2DQCH 2P42B 4U1LB 2A9NL 3QWRD 4HJ0C 2CRMA 2PCPA 1A6WH 4E41E 2AXGA 4KUCD 4U1GC 2BHYA 5TE4L 3K81A 1KTLA 4OGYH 4W4OC 3VFMA 4L4JA 1H8NA 3VDAA 2CJUL 3IGAB 3M1BB 1YNKH 3Q3GB 1A7PH 1I1AC 4TUJB 4FQXA 2IH3B 3DUHA 4RZCB 1NMCB 3S3PA 1PJ9A 5TE4H 4MXWH 4QRQA 5GGVY 1TNNA 5EOCL 1HZHL 3BKYH 4PJIF 2X89D 3MV9A 3EYUL 5F96L 2X4QB 5FYJD 2AK4D 4U1GB 3L3HA 3S5LB 1S7UB 3BKYL 3RVVD 3X14A 4XNUH 3ARFD 1TCRA 3GSUB 2GCYB 5CEZH 1T22A 2AJVL 4NCC1 1NFDB 2ARWA 2X1OA 3BEWB 1UM5H 3E3QE 2YPLA 1PYWA 3QAZB 4LKXB 5ID1A 2G60L 4JO2L 3L5XL 3EYVA 3CMOH 3SDCA 4HT1L 1PG7W 2R2EA 4YDLC 4KKBC 4OGZA 4FN0A 3VWJB 3ULVD 2A1WH 4P3WA 1OPGL 1IJ9A 3BUYA 1TTFA 5J13C 2PW2B 2I26N 1IGCL 3BGAA 3H0TA 3QT2A 2P5WE 2OTPA 1G7PA 3WJLC 4M7ZB 1FYHB 3GMOB 1AXTH 4Y1AA 3RA7H 1UJ3B 4R3SA 4JY5H 5BS0E 4HS8L 4P49A 3ZHLA 1HXYB 4M7KL 5JHDA 5FHAH 1V3MA 4P2QE 2Q8BL 1NGZA 5D1XD 3PABB 4POZC 3W81A 4CMHC 3KJ6L 4EUPH 1C5BL 4JZJB 4R7DB 5BS0B 4JKMA 3ZHDA 4Z7VF 4DGVH 1MCNA 1PYWB 4FFZH 3KR3L 1HI6B 4DKDC 1DE4A 3TO2B 4LIQE 2DQGH 2KL6A 4LNRB 2BVTA 5LXGH 5M7QA 3L5WA 5J56B 1S7VB 3QIWB 4P2OA 5KVEL 1WAAF 5K59F 4OZHF 2NY3B 4WW2C 1GGIH 4HULB 1T5WB 2HJLB 4APQC 4ZAKD 5EWIH 2GY7B 3ULUE 1VESA 1CZ8L 4FQIL 1XIWC 3QUYA 4TVPE 2OSLA 5DQJB 5B38G 2H2SC 1OL0A 4S1RH 3LDBB 3SDAA 4AEIH 4R0LC 1UM6H 4XP6L 1T0NB 4JHAL 4GXUM 1IARB 5DR5L 1LO3H 4X7TA 2QSVA 4R4FL 5GSVB 1G84A 4F57H 1YN7A 1G7HB 1MPAL 1QSFB 3SBWC 2VAAB 4PS4H 2CXGA 4MJIE 2N7AA 3V0AC 1OW0C 2OMNA 5CWSA 2AJSL 3VMOA 4YHYB 4QHUA 5CEZL 5I16B 1LO2H 4ODHL 4Z7OF 1CIUA 2X4UA 3WD5L 2EEDA 1AKJD 3VFGL 1WTLA 1LK3L 3Q6GH 3VI3F 5JPMB 1WZMA 1GZQB 5GSRA 3B4NA 2DM4A 1H3UA 1XH3B 1A3QA 1F6AA 2NY1B 1AXSA 3DARA 2Y6SC 3VGAC 4ZOAA 5FA3B 4GW4A 4BUGA 5F3BA 1ZV5A 1H15B 1PQZB 3VFGH 1BOGB 2AABL 2NY5L 5DJ0B 3KS0H 1Z9OA 3UJJL 4Y19D 4UOW0 3EW3B 1PG7L 4YDJB 4KFZC 3WJJC 4GSDL 3O4OC 4H20L 3ROOA 5CFHA 2F74A 5H35A 1KPVB 4N1EA 4ZUUB 3A0OA 2VLKB 5E08H 1XGTB 2ZJSL 4NKDB 4CW1A 5JZ7C 1AGBB 5DHXB 4YK4C 4PBVC 4FQJH 1IC5L 3KLSA 4QWWD 2J8UE 3KJ6H 5I16A 1T3FB 4KJPD 4PJXF 2QQQA 3WIHA 3W9EB 4JQXA 5HVWA 3QJFA 4JFFB 1OTSD 1UVQB 1S5HB 5F21B 1G7LA 3KG5A 1UKQA 2M1KA 1FFQA 5IP4A 4MA7H 4PJDF 1KCSL 2MQCA 3IXTA 3NFPA 2VDKH 1FCGA 5F9WB 2R1WB 1FNGA 4PY8J 5E5RB 4XBGA 3EHBD 4EVNA 4DFIA 1TETH 1MCCA 4MLSA 3T3ME 3MRDA 5EOCJ 1MAJA 1NCCH 4KJPC 4WCYH 2DQTL 3PWJB 4Z76B 1IFHL 4YX2L 1J12A 1G6RB 4ZTPL 2C26A 3SGKA 4OZIB 3CFDB 4MS8D 1KJ3L 4QHLB 3QQ3A 4FQLH 1XGYL 2E9IA 4R0LB 3NPZB 3DHMA 3MGOB 4WNQB 5I74C 5HYJA 1RY7B 4BK5A 2WUCH 4B5EA 4AENA 3BPLB 5SX5K 3VXRA 2NY2D 4GAYA 3QJFB 3BH9A 4PTUA 4PJIA 4LASL 1XGYH 3PJSB 1ZLSL 2DJUA 2Y06L 3GHBH 1L0YA 3HR5A 1RZ8B 1CXIA 3DGCR 4N5EC 1K8IB 2QBWA 5BW7C 3T0EB 1SM3L 2C3VA 2HFEA 1MI5B 4Z7VB 3TLRA 2RJMA 4TPRL 4AL8L 5I73C 2GI7A 3KXFE 3STLA 4TVPL 4AYFA 4P5MB 5T33L 4N9GB 5A16B 4YXKL 1DCLA 4P4KC 4PIRF 4ZO6A 1LK2B 1SM3H 1ETZB 4MA3A 5C08A 4QRRE 4U3HA 4G3YH 3A6OA 4HWUA 4LMQI 3S8WA 1GSMA 3O3AB 4KU1A 1DBBL 1T20A 4QKXB 1PKQA 4OCSH 4EOWH 1YPZF 5I19H 4NQXB 3BN9D 4U1HB 3HE6B 4V1DD 1G9EA 4EXPX 5HHPB 6FABH 4M5YH 3S3JA 3MLRH 3BD3A 4MAUH 3GMQB 1ZWIA 3B5HA 4XCYA 4Q0XH 1A9BA 2VIRA 3CZFB 2GUOA 3VMNA 2XWJB 3BPNC 4XAWL 4G5ZL 5J8OA 1U91A 3MYJB 5KVDL 3MRQA 1E4KC 2GITA 2P1YA 5CJQL 2WW8A 5TE6H 4YR6B 1I3RB 4HKBB 4PP2A 4IRJD 2X10A 2NY7H 1IM3B 4K2UH 3NCFB 1N59A 4GKSA 4JVPA 1C1EH 5EPMA 1EO8L 2V2WB 5E2VH 1JF1A 1MCFA 5C2BH 4HGMA 3LEXB 1YEHH 1ND0A 3AS2A 2NY7L 2EICA 4G3YL 2PUQT 5I1JH 5DWUL 1R3LB 3VXSD 4WW1A 3BYTA 4O2CA 3IAGC 2BMKB 5SWZE 1ZHNB 4JRYB 3SCMC 5K9JL 1ZLUH 1BF8A 4OFDA 5C0CB 4OCYL 4LU5H 4RGOH 1MCPH 1NGYB 1SMOA 4OZIF 4RAUA 3EDJA 3P4MB 2ZOKA 1GZPA 4I0PC 1YECH 2A38A 1I8KA 3OAUL 1XIWA 3QG6A 2DWEA 5EO1A 3S88L 2PW1B 3BXNA 4Y5VB 2OTUB 5CS7A 2EXYD 2B5IC 1RUKL 3IT8D 2JCCE 3MYJA 5DMKA 4LASH 3B9KB 3T8XB 3WE6B 3MBEC 4DZBB 5IG7A 3LSOB 1MF2H 5TQ2L 5E56A 2DM7A 2OJEA 5ICXB 4GUPA 4FMKA 3ZDZF 4CVXB 1JUFB 3NACH 1ORSB 3KWWA 1EHAA 3U36A 1HHGB 5JORA 2E9JA 1IZKA 1HNFA 1K8DA 5C07B 3REWA 2CRIA 3BGMA 1LNUA 5HYJE 1BFSA 4KKNA 5C08B 5DD1H 1QSFE 5KAQG 3TV3H 1N8ZB 3LQZA 5C92A 3DMMB 1TXKA 3ARDD 2A6DB 5A2KH 2HTLD 4G6KL 3L6FB 1OGAE 1CLOH 5HYJD 5ID1B 1MQ8A 3L3KA 3SDAC 2GTWB 5C9KA 4NRYA 2GEEA 2P45B 2VLJA 1TTGA 3QEQE 2J8UF 2B2XH 3VFMB 2WBJD 1IGIL 3OPZL 5IGXL 3TH3T 1BFVH 1IEAB 2UWEA 2P7TA 4RMWA 1I1FA 4X6CB 1CFQA 4MNQB 2G75A 3OPZH 1G7IB 3L95B 4NC1E 3RY4A 4HUXB 2MTPA 5ACMA 1LNUB 1G0DA 3TYFA 4MQSB 4QF1B 1B4RA 1Q9KB 4ODUB 4GH7B 3KAAA 5KN5A 2R4SH 3O6KL 3WFCL 1H8OA 5I30H 5DMIL 1ZEAL 3LPFA 2QHLA 3P4MA 3L6FA 3O11B 4XB8A 4HK0A 1E0OB 4EEEA 2XQYG 2FH8A 4WU7B 1DQMH 1KELL 4MLIA 3TEUA 1L7TH 4LLDA 3L7EB 1CT8B 2FBJL 1T1YB 2W9EH 5FXCH 3U0WL 1U3JA 3ESUF 1CFSA 4NKIH 2EIDA 3S35H 3GMMB 1CVRA 3A6CL 4LNVA 3S3SA 5E6ZA 3HNTL 1JGLH 5KTEH 3QSKB 5C6PB 1P6FA 4GJTB 1CK0L 5INCB 3FQTB 1T0PB 2XPGA 1R3HB 4ZSOB 2DICA 3P4NB 3ROLA 1KB5A 4WI2A 5C0GB 3FHAA 3KPQB 5LG1A 1A47A 4ZFZB 4ZFOL 2DQDL 1OD7A 1LEKB 1IQDB 2ED8A 2A9MH 2XG5A 4GRMB 35C8L 4DW2H 3ARGA 5DLML 1NL0L 5GS0L 5JZ7D 5JLZA 3UTSE 4JZNA 3KPNA 1A7NH 1IAIL 2H32H 1HHHA 1WK0A 1T89C 5GS2H 4OIBA 2B4CC 3CFBB 2C3WA 4MMXC 1A7QH 3IJHB 4ZPTA 5ISZE 1LILA 2R8SL 3JV5A 4XC1H 3L5WB 2IMNA 4JFDD 1HH6B 3H7BA 5C71A 1A14H 2NZ9D 4OIAA 4GMSL 4J3TA 1QOKA 1CU4H 4TNWF 3KHQA 4U6YB 1B9ZA 1YJDL 4L5FL 3TWCH 1PVHA 3ZDXF 2B1HL 1GIGH 4FXKB 4KJQC 2ZUSA 4XWOC 5GZNC 2R0WL 4OTXL 4X8XA 3ARRA 2B1HH 5DRXA 2X4SA 3I9GL 3WS6C 2VLRD 1S3KH 4YNYB 5EN2B 4X5WB 2AV7A 4PRPB 3AM8A 3PWPB 5EUOF 4D9QE 3T0XA 4XI5D 2DLFH 1AP2A 1CE6A 1CDGA 3QDGD 4MNGB 2FZ3B 3RWIA 1MFCH 2AJYH 3HUJB 4MDIA 3ULUL 1J0HA 2WIIA 3LD8B 4XBEH 3IJSA 5GJTH 5ACZA 5JA8B 4QY8B 3UTZA 5T3ZH 1FZMB 1RU9H 4X7DC 2EKSB 5HGHA 3U0WH 3U46B 3LS5H 3P0VL 3GO1L 3RL1A 4Z7UB 4M8QA 5E7BA 3IU4H 4X7EC 2IANA 3CSPA 3OX8A 3BGFB 3GSNA 4X4XA 3BPLC 4MQXD 4KGLA 4C58B 5FO7B 3CX5K 5CKGA 1AI1H 5E4IA 5BZDB 2Y06H 1AJ7L 4MXQD 3SY0A 1MJJB 2C3XA 4L3EE 3L3IA 4JREC 3I02A 1YEHL 4S1QH 5MHSD 2VSCA 2X42A 2ENSA 4KY1H 1RJZB 2BVQA 5FM4A 4NRXA 3H9SB 5EO9A 1YN6B 5DD6B 4Y2DD 5F1SA 5HPMA 35C8H 1ZVYA 4Q9BA 4PJFE 4XHQA 5DFWH 1CR9L 1DVFC 3SDDA 3FB7B 4M62L 2R69L 2FECL 5T3ZL 3AC0A 1TFHA 3GM8A 5DEGB 3VRLF 4C4KT 5CP7A 5HBBA 2I25N 1I9RH 1MRCL 4WTZG 3VFPA 4AM0A 5I1KL 3PP4H 4K7PH 5HD8C 2WWKT 5M95B 4FTVE 1AO7D 3PDDA 1KV3A 4S10A 5SX4H 1ULVA 5ITBL 1MI5D 4Q0XL 2D9CA 2VB5A 4NPYB 3CVIH 1ZHLB 4FABH 5DRNA 1AJ7H 4U2YA 3LS4L 3PP3K 5EUOA 5IBLC 3BKJL 5IHZB 4YBQC 5KANI 2DQJL 5FYLH 3HMWL 4H8WC 4PRPE 1W8NA 1X5LA 3FO9B 1A6WL 2EO9A 2YBRA 5T3XL 5BQ7A 4L8DA 5J6GB 5C09A 2I9TB 3ARFC 4URTB 4EI6B 3S36H 1FL5A 4KXZH 5K9JH 4CADB 5FYLE 4WHTB 2YSSA 1KJVA 4HAGA 2F5AH 3UJIH 5GZND 4PJEB 4QRRA 3QPQD 2OX5A 4YK4B 3HLAA 4X5XA 3ZKXB 3ULVE 5C0ND 4FP8L 1GJIA 3MJ9A 5HHMD 3MRKA 4I3GA 4PJDA 2WANA 1PZUB 2VLMD 3OX8B 5IHZA 5GRUL 2DKMA 3NFSL 3VXMB 1GC1H 1IC7L 1R3KB 1S7XB 3C60D 4C54A 4ETQA 1S7SB 4AY0A 4JM2D 3VGDA 1QSED 4LLVB 5E8OA 1TIUA 5I1EL 4E42A 4I18C 2HLFD 1A7RL 4RGMB 3D39B 1BZ7B 1OB1B 4NQSB 1HXYA 3MLTB 1JPFA 2DWEB 3JV4B 4LCWD 1T21B 4O58L 5ESAB 5GISH 3O2DH 4UMGA 3BGFC 1WBYB 4XPGH 5AG9A 1D5BB 4XH2B 5DA0B 4Y16C 2LE9A 4JPVH 4GRWF 5EC2B 3OKOA 5T1LD 3ARDC 4NRZA 1FE8H 2AI0L 1I9RL 1MRCH 3L3DB 3MRMB 5LCVL 3SN6N 1P7KA 4XX1E 5IVZB 3W0WA 2IFGA 4PRIB 2V5YA 2Z4QB 5DF0A 1PZ5A 2E6JA 4TULL 4ESKA 3MR9B 2EEAA 5F7LB 5JW4Q 2FJFA 2I60L 2EIZA 2G5BB 4DVRL 1CI5A 2XZAL 2NX5D 3G5YA 1WT5A 1R3IL 3TVMC 4PB9H 4OF3A 3MLXL 1YDPA 5D7IB 5I71C 4F8TA 5LAXA 4HHAB 1V7ML 4KUZH 4YHZL 3NH7L 2HLAB 2AEPL 5MERA 3O45B 4XVUC 3OG6B 1GGBL 1IGYA 2D7QA 1OP3K 3UX9B 1QBLH 3QDJB 5C07D 5JXEA 4Y2DA 1A6VH 5EOTA 5J0BA 3VDCA 1I7ZB 4WV1B 2E6PA 3L3GB 2YPKA 5CZXD 5DC4B 1GGBH 1S5HA 3BDYH 4RSVA 5DJZA 3NCBB 5E94A 1RJLB 5ESQA 2W0FB 4LGSB 4PGZA 2OJEB 5GGTA 1GPOH 1J1OH 4WY7L 4JJHA 2Y5TA 3PL6D 3SE8L 4UNVA 2K9UA 3I85A 1D5IH 4JO3L 2M2DA 4PJDB 5DVLA 5LBSH 5DJAB 5C86A 1UGNA 3OAZH 3TNNB 4NQDA 1J1OL 4IMLB 2HTKD 3T3MF 1MWAA 4HZLA 4N0YH 1BBDL 3KPTA 3WSQH 1FNAA 3HNTH 4Y5YA 5I9QC 3ROOB 1OGTA 1QG3A 3HPJA 2NMSA 2R2CA 4JVUA 4B0MM 5TDNA 4XHJC 4YDIH 1A1MB 2VYRE 5ANMB 4B41A 3DV6A 3GMPB 1VFUA 4MJIB 1IBGL 4X6FA 1NBQA 5KAQF 1JIBA 3QQ4A 2X89A 5CIPA 3BN9C 3CIQA 3NCCB 4C4KO 1QQDB 3REVB 1KUMA 3MLZH 1F6FB 3T0EA 4IDJL 2I9LB 5GJSL 1FL3A 3EOAA 4YE4H 5DS8B 1Q8MA 4I8DA 3VWJD 3MNZB 3VXPA 2BMKA 5E2JA 3QUZA 2ILLA 4P99A 1KENL 5EZOH 1JVKA 3D87B 4F9LC 5GS3A 1INQA 3HPJB 4HFWA 4JFHE 3VJ6A 1FZKA 2BFVH 4QXUH 3G6JA 3KPSA 4UU9A 1B6DA 4YHOL 1KIQB 1SJEB 1T7XA 3TZVD 4BELD 4HBCH 4TSBL 4S1SH 4MB4A 2ADJA 1OSZB 1F11A 3RI5F 1S9YB 3T3PF 1G6RA 3PWUA 4RFEB 1CBVL 5IJKC 3SCMD 1A1NA 3NA9L 5DJXA 1ES0B 5JA9A 2MWCA 4Y1AD 5ITFA 1MIEL 4Y4HB 2X6MA 3ARTA 1I9JH 1K85A 5GXBB 3QUMB 3MROA 4M62H 4GBXA 1WEJH 4NO2B 3E6HB 4JRYD 1FCCA 4U4BA 4HF5H 1J8HA 3CFKA 4DGYH 3JWOC 1I7TA 1MQKL 1S7WA 3PG2A 3QNZB 5IKCB 3BKMH 3AUVA 5D2LE 5E2UL 4QNPE 3GKZA 3PWLB 3SKOB 1WJ3A 2YPLE 4FNLH 4JO4L 3BO8A 3IETB 5GPRA 2W0PA 1Q9LB 5A1AA 3BQUB 1N6QL 3T0DA 4ZAKA 3PQYA 3K4AA 1NFDF 1U8JB 1K5NB 4R4NC 3WIIL 4FRWA 2MCPH 5FCSH 2E7MA 2OR9L 2F54E 4FFVD 2ADGB 1OLLA 2RFXA 2UYLB 4XP9H 4XBPA 4Z7VE 4D94A 1HH6A 4G9DB 1MH5A 4X80L 4HAFA 4QHMB 4X99B 1TCMA 3OV6A 2WWMD 1MFBH 2A2QT 3V8CA 1HCVA 3DSNA 1FHGA 5D8JH 1N64H 4IOIA 4G7YL 2Q6WB 1ED3B 2XFXA 1T1ZB 3GMOA 4Y1AB 3U1SL 3LMJH 1I1AA 3Q0HA 2Y6SD 5DQ9A 4NHCH 4JO4H 2X09A 1A4JA 1EPFA 2L7UA 2X4SB 1G1YA 5C9JA 3BJLA 5FYKD 2YD8A 2VXTL 2DI9A 2R29H 3G6JB 3KPSB 5TF1L 1FGNL 2UZIH 3QZWG 4G5ZH 4PJAB 1BIIB 4CRPA 1D5ZA 4PP1C 3VFNB 2DQJH 2AS5M 5H94A 4KHXL 1AQDB 5EO0A 4HWEH 3EZJB 3FFCB 3WN5A 3H3PH 4KQ4H 3VXSA 4OAWA 2D7TH 4PRDA 3WFEH 3ZTNH 4JO2H 4WEUD 1UEMA 4ELMA 1JHTA 2NY3C 3E1F1 2GTZA 4OF8A 1H3PL 1WCQA 1G6VK 1PAMA 5FHAL 3WHXA 3MODL 1N0XH 1I1FB 2Q8BH 2X4QA 1E6OH 4DEPC 4YPGA 4S1DC 3LMJL 1Q1JL 5HHOE 3ZL4H 3MSPA 1U3HB 2Z92A 3UTSD 3VXRE 4HCRA 4NHCL 3O9WD 5SWQB 5A40E 1LEKA 3TC9A 1MJUH 1TJGL 3MXWH 3B43A 4OQ1A 5F70A 3BD5A 3VXMD 4GMTL 2X4RB 4PRNA 1F02I 2VXVH 3F8UB 1EHNA 1X3DA 5IF0B 3BO8B 1JN6B 3LN4A 3T4AB 4JRXE 1AQDA 3LCYA 3IFNL 3L5XH 4H0HB 4Q9QL 1UACL 1MVUB 3UDWA 3CXHK 3UYOD 1LK3H 3Q6GL 4WUUE 2XTJE 2OR9H 3M45A 4HXAH 5D2LA 2BNUB 3VWJC 3QFDB 4FMFA 5IMMA 2VLJB 1U8IB 1EEQA 4JE4B 1DL7L 4GQ9L 2DQFA 4NFBA 5HYFA 4GG6F 1FLRL 5DDHA 5I73B 1EHXA 3LIZH 3LEYL 4PV8A 3EKCA 1KF9B 3MUZ1 4G6KH 3JWDH 4NM8H 3K7UA 1UM6L 2NY1D 1MCIA 1A4JB 1IM9A 1G7QA 4TVSa 5EG6C 2VQUA 1BHGA 5GRVK 3SOBH 1WBYA 1C8PA 5DSCB 5D1ZB 3QCUL 5EU5B 5D7SH 2W0KA 3VXUA 1VPOH 1OD9A 4U6VL 5IBUB 2PNDA 3AREC 4M3KB 2YRPA 1BFVL 4HKJA 2YSSB 5EA0L 3W39A 5B39B 2A9NH 3QHZL 1YC8A 3MACH 1CCZA 3TT3L 4H20H 5FYKU 3N9GH 2WM0A 3CFEB 3DSFH 3DX7A 4ZAKC 32C2A 1F3DH 3VFTB 2WSKA 3DRQB 5F7EH 4MQ7A 4R4BA 1QA9B 4RMSA 5C0JA 3MV01 1F4WL 1W72A 2Z31A 3GRWH 2CUIA 2BDNH 1Q94B 5L6YL 3SJVB 1WBZB 1YZZA 1EUUA 1RQ5A 5DRXB 4HQQL 1OP9A 1V7NH 2XZZA 3FN9A 4XZUB 1H3GA 4Z18A 4MHHI 3QDGA 3LKSA 3VRIB 1CYGA 4JLRA 1F58L 3KYOB 1E6JL 5IQ7H 1AHWA 4RFOH 4P2QB 1E4WH 3U83A 4GRWE 1S7TB 2FIKB 2HVJA 3IFNH 5KVFH 5FUCE 4K3EL 4Z7QF 3QFJA 4HPOH 4LSPL 1JI2A 1DQQB 3LRSB 1YQVH 3CUPB 4ZTOH 3S35X 1M71B 1T5WA 4EZMA 1CFNA 5FGCB 1MCWM 1XCTB 5D7KD 1NAMA 3RIFK 1CL7I 1SBBA 4DGIH 4OLYL 3VCLB 2ATPB 2DMBA 1ZA6A 4K94C 4LOUC 4JFXA 1FLTX 1T4KA 2KPNA 3INUL 5E00B 1YA5A 1NCBH 3H9SE 2P46B 1A9EA 4NYLA 2PXYB 4BQCA 3O9WA 3PGDB 2J4WL 4BJLA 1LGVA 2FX7L 5FM8A 2NXYB 5IROC 3OZ9L 2DMCA 5HI4D 3U2SB 4D0DA 1HHJB 1XR9B 4XC1L 5IV2B 1O0VA 5D71L 12E8H 3MOBL 4PLKD 4PP1D 4E0RA 1VPOL 5BS0A 4Y1AE 3QQ9D 2DDQH 2HLFC 4G80A 1OAYH 2MFNA 5L8LB 1NC4B 2AGJL 4L5FH 1AP2B 1CE6B 3UTQA 4TVPH 3ARFB 2FEEL 3TBSB 5IESL 2F8XC 1Q0XL 2VXUH 1VADA 4L8BA 2K1MA 2CXKA 4JCMA 3QHFL 4TQEL 4WWKB 3V9FA 3ULUF 5AZ2H 4V2CB 1B0RB 4NQTA 3IS0X 4M03A 2CLRA 4G9FE 4MQ7B 3VGEA 3OAYH 3DO7B 1KIUA 1LEIB 4ZTPH 2Z31C 5FO7A 2J4WH 2WP3T 1UCBH 3QQ3B 4WUKL 4P23B 3WLWD 3DI3B 2FGZA 2C3GA 2D4FA 1OGTB 3SQOL 1RIHL 3FB8B 5MEPB 4HS6B 2AJYL 1MCHA 3ULUH 2BCKA 4QLRA 4EQ2A 1T1XA 5E99L 2DDQL 3RX7A 4J3UA 1GAFH 1AIFB 3SKJL 4FNLL 3ARFA 5E9DD 4AIZA 2UZXB 5DMKB 5CHNA 5GS1A 1I9IL 4NGHH 4ELKA 2VLLB 2VZVA 4GBXC 5FV2A 1IEBA 5I1JL 2I07B 1KCSH 2G2RA 3GSRB 3P73B 4LPUA 4ZTOL 4JJ5B 3WO4C 3KYNA 4CVXA 2HH0H 3ILQD 4XT1C 4YFEA 2IC2A 3SDCD 4AEFA 2IAMC 3F12A 4K2UL 4LLQA 3O4LB 4OI9A 2AJXH 3L3OA 3WYRA 5B39G 5JUEL 5HHXH 4JZJC 2NTFA 4F37F 3WO4B 4NUJB 2EH8H 3LRHA 3OXRB 3BZEB 3P77A 5F1NB 4YWGL 4UU9B 1B4JL 1E27B 1RVFH 4PJ5E 1T21A 1T0MA 4RGOL 1KLUB 3TNMA 4M4RA 5C09E 2JK5A 4GAYB 3OKKA 3MQIA 2WZPD 3UC0L 2B0SL 3MRQB 1NMCC 3ME0A 2UVFA 3O2VH 4PJBA 1FYTA 2BC4B 3IFPB 1KULA 3B2VH 2A6JA 1TZGH 2W9DL 2Z8RA 3BHBA 3PWNA 5B38A 1AGEA 3G5XB 1JGEA 5DZLA 2V2WA 1Q0XH 4XP5H 3QXAA 5CEZE 4MXVF 2VXUL 3RDTD 3QWOB 5HGGS 1JHLL 2FX9L 3HPLB 5D9SA 5F89B 5IMLB 4QXTB 5DD1L 1X5JA 1OM3L 1RZKL 2EYSB 5I6XC 4P5MA 5D2NC 4FG6C 5FHBL 1J10A 3ARGD 3MLUH 3MRPB 3QUXB 3RZCC 4LPCA 4G9FD 4OGAD 5HI3C 4GG8B 2FEEI 1F3JB 1RUAL 2FDBP 4PJ7A 1JNLH 3EJYC 1RK1A 1YDPB 5D7IA 1HIML 4NN7B 1Q9WB 5DHVH 1A3RL 4KMTL 3RGVB 3HNSH 4PJFA 1RZKC 4LLVA 4LCWE 4AH2B 3NA4A 4PJXB 2NR6C 4JHWL 1H3VA 3O11A 4NIKB 2MPAL 4M1GL 4OLWL 3SGDH 2H2SD 5IB4A 5DK2A 1RJYB 4MCZB 5C0RL 4WNQA 4CJ0A 1MNUH 2OL3L 3FT4B 1KJ2H 1RSFA 3U7WL 1J1XL 1E28A 2D0FA 3EJYD 4KZDH 2Y07H 3IDIB 1D5BA 4XH2A 3IGAA 2EDNA 2GITB 3VD4A 4JCLA 3KPRE 5ETUB 3WD5H 2Q76A 1PX3A 5CEXB 1QVOA 4KRPB 2UV3A 4ONFL 2LTQC 1TVDA 2I07A 1FV1A 1HSAA 4OSUH 3ARDB 3P0YL 4BH7A 1FRGH 3PV6A 1JYNA 2BX5A 3F7QA 2VDLH 4KVNL 2Q6WA 1C12A 2NY4B 1PG7H 3BDXA 5JOFA 5J89A 1I3VA 3KPMA 1HINL 4PLJD 1W0VA 4YFLI 1NUGA 4BKLB 4P9HL 1HHKA 5IB5B 2A9ML 4PJFF 3VE0A 4C56E 3UTSB 1FORL 1E4XI 3OAUH 3ALXA 1EFQA 2PXYC 3UXFA 5IHBA 5EO1B 3VI3E 3MUJA 5IFJB 4Z6AT 5DD5L 5KTEL 2JJTA 3HI5L 5DZOA 2BNQB 1IKNA 4PV9A 4H25B 3BE1H 1JPTH 3VWJA 4ZSOE 4EUPG 4WHCA 5ALCH 2WNGA 2YUVA 4WI4A 3KDMA 5IQ9B 1ITBB 2ZCKL 5TE6L 2F8OA 3UDWC 1MHHA 4ELME 5DDHB 4MNHB 3HPLA 4R7NA 4B7LA 2VR9A 2C7UB 1XCQA 4XMPH 3T4YA 3MNZA 1K8DB 1KLGA 2QKIB 5HYSG 2O93L 1ND0B 4JVWA 2GSIA 4ZXBD 5F6IC 4H1LH 2RAMA 3I6GA 5EWIL 4M7KH 1JWUA 3QIUD 4MYWB 4ODTH 4Y4HD 3CXDL 1RULH 5LQBH 3HNSL 4PJ9D 1M7DA 3QZWA 4F37K 4UZGA 4F3FA 2XZCL 3GMLA 4KJQD 4CVUA 2ORBL 3QP3A 3S88H 1KJMB 2BHZA 3VRLE 4R4FH 4NRYB 1MVUA 1EAJA 4JG1L 1NSNH 4RZCA 3GZKA 3QEGH 4YAQB 3P0VH 2VO5A 3FRUA 3HKFA 3GHBL 3G9VA 1L0QA 3UBXB 3CFKB 1LQSR 3EBAA 5I0DA 3KJ4C 3LKRB 3QUKA 1FNEB 4H8WH 4PRIE 2QQNH 1CDYA 4R8WL 3MCLH 2IG2L 3QUZC 3FONA 5KSBF 1C7TA 5C07A 4OLVL 3MRFB 4JFHD 3D25B 4KI1A 4UT7H 4ODTL 5I9QB 4XNYH 3ZYIA 2Q86B 5I30L 4WI3A 1UXWA 1DANU 4HG4K 4F57L 1P84K 3ARPA 1CD1B 1CFTB 5DXWA 3RX5A 1GRWA 4I2XE 3VXSB 4ZD3H 4CNIB 5J06A