5JQHC

Structure of beta2 adrenoceptor bound to carazolol and inactive-state stabilizing nanobody, nb60
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
120
structure length
120
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGSIFSLNDMGWYRQAPGKLRELVAAITSGGSTKYADSVKGRFTISRDNAKNTVYLQMNSLKAEDTAVYYCNAKVAGTFSIYDYWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric nanobodies reveal the dynamic range and diverse mechanisms of G-protein-coupled receptor activation.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Signaling protein, hydrolase/inhibitor
molecule keywords Endolysin,Beta-2 adrenergic receptor
total genus 23
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jqhC00
4DQOL 4K71B 3THMH 3HUJB 4XPTL 4WWKD 2P24B 4OZFG 1EHNA 2DQJH 1NGQL 3T8XA 2ZKHL 3MLVL 4M6NL 4XC3L 3TC9A 2ADFH 5IKCA 4I0PB 1BOGB 3VE0A 4TUJB 5EOQL 3GIVB 3LZFL 1W72A 2DWDB 3CMOH 3E6FB 4DWHA 4I3SL 3CK0L 2CDGA 2HFEB 1QYGH 1XGYH 2OI9C 1FNGB 1Y0LB 4QRUA 2WIMA 1CE1L 5ISZD 4GOSA 4KDTA 4QXUL 1BVKA 3MRLA 3EBAA 5FCUL 4I3SH 3HNVL 3QEQA 4K9EH 3B5TA 2NXZC 3B9KD 3S35H 1K3IA 4LRIA 5E2UH 4LCYA 4PFEA 1QP1A 1FSKB 3QFDA 4GT7A 4JDTL 3Q6FA 3KPOA 3C60C 5C09D 2FEEL 4CNIA 3HZKB 3LKPB 5DO2C 4HWBH 5JW4Q 4K3GA 3S35L 5BW7A 1PLGL 4M6MH 2D7QA 4FZ8H 4UTBL 3Q6FB 5BV7H 3IDNA 3P4LA 1NCWH 4M1GL 1BVLB 1YPZB 3FB8B 2N7BA 1A9BB 1N0XL 2XNAB 2VIRB 1XF3B 1EDQA 5EORH 2CLZB 3QZWB 4POUB 1T03H 4AK1A 1N7ML 3RX7A 4GRMA 1Z6JT 3KNBB 2F58L 4MB5A 3KWWB 4X7TA 4ODWA 3TV3H 1FO0B 3BPLB 4N9GA 3BZEA 3ILQC 2EDNA 5C09A 2A74B 4JZJB 4DGYH 3VD9A 3EYQC 1OM3H 1MWAH 3CNKA 5HDQH 3FZUD 4Y1AE 4AMKL 5ITFB 4M93C 4TUJA 4EUPA 2GHWB 2JB6A 4OD2A 4RBPK 1JZ8A 2HA1A 1MLBB 4JFFB 1P4BL 3ULSA 5T1KD 3DXAA 5DUML 4MJ5B 1JP5A 4PYHA 5ELIA 3EYOA 3UTQA 2DWEA 4RWHA 4CJ0A 2CGRL 2AABL 4P3WA 3ZKND 2QHLA 5H2BA 4R2GB 1KIUA 1JZ6A 4GG6A 5DJDA 1BECA 1U8IA 5DD0L 4M62L 4GRLC 4UT6H 5F1OB 3FB6A 5I74C 3DV4B 4JO4L 3RWFB 2DQTL 3KDMB 4NKDB 4GQPH 3NZHL 2NYYD 1MUJA 2R56H 4NNXB 4YHOH 4ONHA 5J4MA 5F88A 4R8WL 1N6QH 4Y1AB 3ZTJG 2NY3C 4ODHH 4HGWA 5MEOB 1A6ZB 5DDHA 2V17H 4P59H 4IMLB 1PD6A 1GZQA 3OL2A 3UROR 5A2FA 4XP5L 3DBXB 5IIEB 4OCXL 4PRID 1JHKL 5FOJA 3DHMA 4ODVL 1JF5A 2YC1B 1A7QH 3LQAC 5D8JH 3V0AC 2CPCA 3BN9C 5FYLD 4RA0C 4R97B 1FFNA 4GBXB 2P48B 1KTRL 2XKNB 4QXUH 3KNBA 1U3ZA 4I4WA 1Z9LA 4PJ7A 2EDDA 4N0UA 4FHBD 4RMVA 3P4OA 1UENA 2D7TH 3IAQA 4XAKD 4M48H 4PUBL 5KAQF 4Z7NF 1PYWB 1WSST 1B0GB 3OAZH 4HIIA 5GZOD 2XXCB 1XIWD 2XN9B 3NACH 3BPOC 5C07E 2XI9A 5BRZA 5EU6D 2WMPA 3CX5J 1UM5H 3L95A 3PGCA 5CD3A 2O26U 1U8JB 4WHDA 1LO3H 3QULB 5GRVL 1ZWIB 3B3IA 4PUBH 1N3NA 4G9FB 4NSKB 3LSOB 3C6SB 1NANH 1OCWH 5FUZL 3R1GL 2BNUB 1U3YA 4P4KA 4RAVB 2C3WA 2R8SL 1HEZB 2BC4A 3NCFB 4B7LA 4MLSA 1I1YB 3G6DL 1G9NL 3KPSD 4M4RA 1MEXH 3PGFL 4FABH 3MV8A 4HS8H 4YH6A 1QSFD 3KYKH 5GGRY 1V3KA 3B3IB 5EZOH 1WF5A 1U3HB 4BQ9A 5DYOB 3PWVA 1QFUL 4XI5D 3BPCA 3LEXA 2GIYA 2FDBP 1B88A 3LEYL 4NYLA 1F3DJ 4YDIL 1I7UA 1NJ9B 5GZOC 2F53D 2VXQH 5BOPA 3JV6B 2MKWA 2YD3A 3KGRA 1KPRB 4L8BA 5JDSB 4J3XA 5EZLB 1LO2H 4OUUB 1R5IB 2FBOJ 3TZVC 4N8CH 5LGHL 4OCYL 2B1AL 3X3FL 5DRXA 2D03H 1LNUA 1TJIL 5ITBH 1KCSL 3RX8A 1MCJA 3SDCB 1FP5A 3S8WA 1A1OB 4DZBA 4NDMA 4OAWA 3ARBA 1RIHH 2HLAA 3RIAF 3UPCA 1JTTA 3AROA 4HJJL 2GJZA 5IF0A 2XOTA 3AM8C 3U9PH 2MQ3A 3R4DA 4MXQC 3GJFA 5T3XH 4POZC 2JJWA 4TNWK 5DURD 4PGJA 1QR1B 2QQQA 1UCBH 3FB6B 2F19L 2PTTA 5T1DH 1XGRB 3FQWB 1TXKA 5H35A 1PFCA 3L5WB 4XVJL 3QUKB 1AGBA 2ZP0T 4Y89A 3GSQA 3SKMB 1PBYA 5ADPL 5GGRB 4EI5C 4LSDA 3S37L 5J12B 2Q86B 5IVNA 1P4LA 4NO5A 4I8DA 1AD9A 4HIJB 3LS5H 3H0TA 4L9LA 3U2SA 3WIHL 1F58H 4G42B 4Q9CA 1JWSB 1S3KL 4Z7VA 2C7UB 3MJ9H 3D39B 4CGTA 3MV8E 2DQFB 1YEGL 4W6XB 4HKJB 4HUNB 3F6LA 2ATKB 4QRPE 3VGAB 2M8XA 2N56A 1NAMH 2WANA 2L7UA 2NY1D 3A6BL 3T65B 3BPLC 3ESUF 4KJQD 2O5YH 4UINH 3UTZB 3L3HB 1LO5B 4HH9A 3EO0A 1VESA 4ZUVA 2R39A 5IMOA 5TFSL 3QQ9D 4S0SD 4JFPA 3AS3A 4Y4HA 1VENA 1RIVH 4LIQE 4R4NC 1I85A 5C3LD 1YECL 5EOCH 2HJFA 5K9JL 4X4MA 3L1OH 2NY4D 3PABA 3MA7B 3V4VH 4OZGE 3VXOA 4F7EA 1MCOL 3O2VL 1U8QB 1QO3B 1QHOA 3SY0B 43CAA 1KENH 2QQKH 4NPYA 1WBYA 5KG9A 4KC3B 4WW2B 5ALBL 1MRFH 4APQB 5IEKB 2P8LA 3OAYK 1SVZA 3QG7L 4HJ0D 2VLJB 4PJ9A 2Y1VA 1MH5B 1NBZB 2E9BA 4OFKA 1IRAY 4GRMB 5HHQB 4Z78A 1V7MH 4Y4KA 2HLFC 3QUXA 2V7HA 3KLAA 4NZUL 1EO8H 1CDJA 3UTSA 4KKBC 1DDHB 2DQJL 4PREA 2DIAA 5EN2A 3NA9L 2OMNA 4ZXBC 4F37F 1BIIA 4RGND 1KTKE 3VMOA 3UBXB 4QRSB 4IRJB 1YEKH 2AJUL 5ITFA 2DQTH 2VDKH 1XAUA 1NC2D 1L7IH 2C26A 3H0TB 2HN7B 2X10A 3T4YA 3DV6B 4C55A 2ZZUT 3BDYH 4ALAL 3MFFB 3SDAC 1MWAB 4BSJA 4BQ8A 1A47A 2CDFB 2VDRH 3QXTA 1OP3H 2QV2A 2BVUA 4GRLD 1I3RB 4OGXH 2XACC 5IBUG 3U1SL 1N2RB 4PJHE 4JPKH 1AD0A 1MHPH 4U0QB 3DUUA 3DO3A 5DHVH 2BJMH 1KLGA 1KBGL 2IH3B 4PV8B 4ZOBA 5ANME 5EU5B 5IHUL 3CSGA 1ZGLB 3C6SA 3BAEL 1FNGA 2Z9TA 4FG6D 1KJ2A 4YFLI 2ED9A 3LQZA 5E7BA 4KMTL 5L2KB 4FZEH 1QFHA 1CFBA 1C7SA 2R1YB 4OF3A 5CEYB 1NSNH 2CDEA 3G5XB 4AYFA 1DBMH 1OP5H 1FE8H 1XGQA 1TZIA 1YY8A 3KJ4C 3DX9A 1KLUB 2B4CH 2BVQA 4RMSA 2JK5A 5IG7B 2VDMH 3PWLB 4JB9L 4U1NB 2R69H 2E6JA 1SJEA 2G5BB 2VQUA 1EZVY 3T8XB 3CDFA 4ELMF 4HBCL 4N5ED 4IOIA 1BJ1H 2J12B 4AEEA 4YE4L 1DLFH 1GOHA 2BSRA 4NWTH 4MMXC 1V3LA 4PJFE 1NGZA 2HFTA 3RRQA 3IETA 5IWLA 4CMMB 2DLFL 3ARBC 4NNYA 3ROLB 1TJHH 5CS7A 3ULVH 1BGXL 3RZCB 1GHFL 2FECL 3DVIA 4PJEA 3SJVA 1MWAL 2ICES 2BDNH 2Q8BH 4DKFL 4MXWH 5SWSA 2DMCA 5DJ8A 4AG4H 12E8L 2DQEL 4FQLH 3VRIA 3WFHA 3QI9A 3G04B 2DYPA 5E08L 3MLTB 5DYOA 5DC4B 3MLXL 1DBBL 1OHQA 3F7VA 3NFPB 3N1MC 3B9KC 1I9RL 1DQDL 1CIUA 1ZS8B 1JRHL 2VOTA 3HB3D 4UIKH 5HGAB 5JMRA 4MA3A 1BQUA 2O5ZH 2P5ED 4PGCA 5DQDH 1A4JA 1H0DB 3KXFA 4JFFD 1C5BL 4YK4C 2QJDA 4NRXA 3MRKB 1HH6B 1G7LB 5FYJH 3QIBC 5TF0A 3A6CH 3BQUA 5F21B 1DUYB 4L9LC 1IC4H 3RWGA 5DD6B 5D7LE 5C0EB 4DQOH 5J7CC 2D9QB 1BZ7B 4CN6A 4JANB 3QRGH 3MNVA 5DHXB 3SGDI 3C5ZC 1TDQA 3RL1A 4WEMB 1XF5A 4PJDE 1E4WH 3VXME 1S7UA 2EDXA 5CWSB 4LGPB 3CUPA 4ZO9A 2V2WB 2B5IB 4OZ4A 5J1AB 1WBZA 5JNYA 1Q9KB 3HC3H 3KPLA 4G7VL 2W1NA 2OL3B 4U1IA 3T77A 1HIMH 3IAGC 3GJEA 2IBZY 3TNMB 3QIUD 5T3ZD 4FQ1L 1OARH 4LCWA 5GGQH 4L9LB 5CJXA 3MOAL 4FXGB 5INCB 5I1HL 4HIHA 5F96L 1T7WA 3SDYL 4U6YA 1KLFA 4PRAA 1EHXA 3KYNA 3NIDE 4JFEE 1EO7A 3FOMA 3TN0C 1KB5H 4QGTA 5GGRA 3IDYC 3LKPA 3NN8B 2QSTA 4J1UB 4DUVA 3CXHK 3BP7A 2I9LB 5DD5L 1M7XA 2E6QA 3RKDC 1IEHA 2FX8H 4TNWF 4NQEA 1ZHNB 1UJ3C 3GSOA 4L8SB 5SWZE 5EFIA 5HDBE 5DD3H 3PQYB 1VHPA 1DANU 5DURB 5E1AA 4RAHA 3FMGH 4OIAA 2R9HD 4PJHF 4JFED 1NGXB 4G6AD 2V7NB 3ARGA 3B2UD 5AEAA 5IQ9B 3NFNA 3UXFA 3O6FA 3IJSA 2R0KH 4TSCH 3KPSA 3HNSL 4G7YL 1KNOA 2DM7A 1HHGB 1H5BC 3O6FB 2VLME 3HUJF 2JCCA 4TSBL 3WS3B 1J1OH 4BZ1H 4M7LT 4Z0XB 4XMLL 3TVMD 3OJMB 3C08L 1CXKA 3EDEA 3T0VA 5IR1B 1KEGL 5EUOE 3FO2A 1DBAH 4KUZL 3IF1A 4RCAA 1RUPL 4Y4KB 4JKLA 5LKNA 2BERA 4X5XA 2OZ4H 2Y6SD 3EKCA 4EN3C 2A6IB 2WINB 3CFIC 3MGAA 2F53B 3BP5B 5DD1L 1DL7L 5IEKA 3VFUB 1FFOA 3W9EA 3UYPA 1Z5LA 2BVOB 3WIFA 2HYMA 1IKFH 3ES6A 3HR5A 3BWAA 4R0LC 3OPZH 1ZHLA 3H7BA 3T2NH 3TVMA 3NVQA 4OLYH 1UG9A 5DK2A 4HG4J 4P2YA 3OGCA 5LWYH 2ESVD 5IHZA 4G6KL 3MR9A 1WJ3A 4WFHE 3GKZA 3ET9F 3OB0H 1WCBA 3CC5A 4IS6A 4NNPH 4ZUVB 4PJGB 5IMOB 3BEWB 4X6FB 1G6VK 1KB5A 3IFOB 3RGVC 3BKCH 2GK2A 4Q0XH 4UT9L 3C8DA 2KL6A 1QFPA 2F5AL 4GRWB 3C8KB 2LTQC 5I30L 4MWFB 5IJKA 2EDYA 4Y19E 2EEDA 3O9WC 1F90H 1E4KC 5HJ3B 4LQFH 1H8SA 4FXLA 4Q2ZA 1N5AA 5BVPH 4Y2DB 4MNHB 4RISH 4Y5XA 4PJAE 3REWB 3H3BC 3MRJB 3ZE2E 5I66B 5F44A 4DTGL 4PJXF 1C1EL 1NAKH 3P30H 2CKBH 4JVPA 1QBLH 2CLRB 3VFPA 4C4KO 1NAML 5AG9A 1RSFA 3MRKA 3D3VA 5GGVH 3QXAB 2FR4A 3JBG7 1A6PA 2WQRA 2CIKA 3OKDA 1X5ZA 3UPRB 4X7SH 4P2QB 1XCTB 2VL4A 1M1SA 2NY6C 4X4XB 5EC1A 4TUKH 5C08B 1MNUH 1A7OL 2XZQH 2ZNWA 5FA4A 1HXYA 3L3KB 3B9EA 4U3HA 1MUJB 5ABDE 1PEWA 1MHEA 4GXVL 3BYTA 2VLKB 1ES0A 2DD8L 4QWWD 4LSSH 3TPUA 5FUCC 1I8LA 3F6IA 3T1FA 5HHXH 1DQQB 4HMDA 2XRAL 4I18B 4ZS6D 5C0BE 4OF7A 2NXYC 4UINL 1Q9OA 1L0QA 1S5HA 5HDQL 1VKXA 3ZZ1A 2FNBA 4G8GB 3LD8C 4JRWA 1C5CH 4HWZA 4OQTA 1A1OA 4XAWL 1RZ8B 5T1LD 4P2OD 1X5HA 1J8HB 2O5ZL 1X7QB 3TT1H 4RIRA 1Z9MA 4WWKC 1A6UH 5I8EB 4I2XA 5E5UB 1VACB 2AJVH 2GUOB 3CSYB 4POYA 1J5OH 1M71B 2Y07L 3ZTNH 3LQAH 4KKCD 2X9WA 1NMAH 1AKJA 2E7LC 2P5WE 2W0FB 4BQBA 4Q9BA 1BM3L 3MFGB 4HIJA 3KPQA 1FGNH 1A6UL 5HYSA 3I02B 1F4AA 1UZ6F 1NDGB 4UIMA 1JPTL 2RIKA 4PG9B 1K2DB 1T3FA 4NT6B 5F7WC 4L8CB 1HK6A 2YD8A 5E1AB 1JPSL 3LCYA 5L2JA 4WW1A 2E3VA 5MI0B 3GSQB 1RZKL 4OZGA 1DJSA 2RGSA 2BJML 3U4EA 2AXGB 3LHPL 4G8GE 1DVFD 4HF5L 3ARVA 5JUEH 1H3TA 3RUGF 4FS0A 3IDNB 2B39A 3MV9B 4PB9H 5J57B 1I3RA 2MCG1 2BMKA 3LD8B 3P0YH 2F15A 4JFHD 4JKKA 3U7WL 3V4PL 3ARFD 3QIBA 3GZKA 3MRMB 5CP7B 3NZ8A 4LLQA 4O51A 5IEHA 4FQJL 2FSEB 4PJGF 4JM2D 1GZPB 1MFCH 3CMOL 2QR0A 4JY5H 3ZYIA 1DE4B 2LV4A 4KH2A 4JQVA 3T0BA 4PRPE 1JGUH 5MEQB 4JLRA 4N0YL 3SE8L 1C1EH 2P5EB 5GS0L 1NEZB 4L3EB 3MREA 5GZNC 2DLFH 3HC0A 3H3PL 5FYKD 4QLRA 1PQZA 1F3JB 1U8LB 5B38B 4DEPC 2VUOA 3O8XB 4LLDA 4TUKL 2W0FA 5I9QC 1IGYB 1T04B 5L6YH 2HJLA 1MEXL 1A7NH 4D3CH 2ARJQ 4X6CA 4RZCA 2QQLL 3BN9D 1HH6A 3KYKL 3VFMB 5IV2A 5EBWB 4JKMA 2QADB 2NX5E 2IPTH 4P4KC 1HXYB 4U1GC 3WFZA 3LN5A 2WK2A 3EYVA 3TNNA 3GKWL 1P4IH 3VWJB 1QSED 2WUBH 3VGGA 6FABH 3PL6A 3OKDB 2V2XB 2G5RA 4GRLA 4XXCC 1DQML 2CMRL 3RTQA 4BFBD 4X98A 3IDMA 1S5HB 4XPAL 1VKXB 5H2BB 1UB6B 1KN4H 1T7VA 4JKPH 3TFKC 3FTGB 1U2HA 2FX9L 5KN5A 4YHKH 3OJDB 2B8OT 1S7TA 5ALBH 2MSPA 1CU4L 2D7OA 5FYKU 2VSCA 3K2UH 5BZWA 4OZHB 3QG7H 2J4WL 4AEIL 4GKNA 1YN6A 2NY5L 3GO1L 4OTXH 4Y5VB 4ZYKA 1IC5L 3SE3A 1CK0H 1CIDA 4JHBA 3GGWB 5D70H 1PEZA 3LQAL 1KXQE 1CL7L 3ALXA 4IHOB 3GNML 4NCC2 5DA0B 4OZ4B 3Q5OA 3BZFA 4Z9KB 2DMKA 3G5ZB 2ITDB 4BH7B 1REIA 5FM4A 1K6QL 1J0YA 3DBXA 1R3KA 2EYSA 2CSPA 2X4TB 4PGZA 4PJ5B 3IJHB 4I5BA 5GGTH 1AGBB 4PB0H 1FZOB 4Q6IA 4W81A 4O02H 5DQ9B 1IAOA 2BCKA 4E42B 1F4XH 1EEZA 4HEPG 1NFDF 4MSWB 2EE2A 5F96H 3SDYH 5JW4N 1TZIB 1YY8B 4F7CA 1OB1A 1G9MC 1B3JA 2DLIA 2E5EA 2R0WH 3LRHA 4K7PL 2EH7H 1OLLA 5ADOL 2IF7A 1HOCB 4U2ZA 3QIUA 5JIHA 4HDIA 3QO1B 2AI0L 3H9HA 3RKPA 2PW2B 5FDWA 3QO0B 4PJ7E 3U7YL 2R23A 1FYTD 2XG5A 3BP5A 1LD9B 9CGTA 1Q38A 2LFGA 1JUFA 5C2BL 5M95B 3D5OF 1J87A 1RUKL 5SV3A 4LASH 1S7SA 3MROA 4PY8J 4QRUB 3N1FC 4ONFL 3W0WE 3D0LA 4LVEA 2VISB 4XX1G 3UTTD 1S7QA 5IB3A 2PO6B 5EPMA 3O2DL 3IVKA 4X9IA 2R1XB 1V7NL 3RVWC 1YJDH 1T1WA 1A6VH 2VABA 4XAKE 4Z7WE 1MHHA 2Q76A 3O9WD 2YPKB 5IFHL 4FQIH 1QLEL 2A77L 4CVXA 4PG2C 2I5YH 4M5YH 1GOFA 5I18L 3P40A 4Y5XC 2BY1A 1AGCA 3AREB 2KPNA 2DYPD 3HC4L 4CMHC 1QA9A 2VLKE 4U6HB 1UXSB 4FMFA 3QUZB 4X5LA 2VXVH 3QDGD 2DIBA 4TQEL 1IAIL 2CIIA 2AEPH 5C08E 2EYTA 4N0UE 4PD4J 4LAQL 2DTMH 2X4QA 1MCLA 1QSZA 2W0LA 3MCG1 5BVJB 3U0TA 3EIFA 1EVTC 2ZCKH 4GW5A 5H94B 5JPMA 3TA3A 4RFEB 5IJVA 1CGSH 2AEPL 4BYHA 5EO9B 3QNZA 4KTDH 2A9NL 5I1IL 5EWIL 3VXUB 3TBWA 2MCPH 5JQ6L 1TNMA 4F7PB 3QEQB 4FFZL 2AXFA 3FONA 4Y4KC 1OAQH 5D96C 4F37K 4LCUB 1I3UA 4CKVX 2OXHA 1J10A 3EOYG 3C5ZA 1UVQA 1T1ZB 1AR2A 3ETBF 3QYCA 5EWIH 3GFUA 5CGYD 1RULL 2HKFL 3I9GL 3QCTL 4IJ3C 3TJEH 1MJ7L 4EDWL 4WWKA 3EOTL 4K7FB 2BNRA 2ZCHL 5C0CA 3H42L 3O4OC 5L0QB 4F57H 4PB0L 5D7JD 1IKNA 2VZTA 3B2UC 4AEHH 1LDSA 5IB3B 4I0CC 3ARGB 5KVEH 4KKCC 1XCQB 3HZMA 4N0CD 3ILPB 1OY3B 4DW2L 1JZ4A 5GS3A 4UDUA 4G7VH 5GGSA 2EIEA 3VW3L 4MZ3A 4M61A 1MFCL 3PJSA 4DKEL 3C5SB 3VMPA 4HT1H 1QLFA 1ZA6B 1S9XB 3CSPA 1FVDA 1P9MC 4PGCB 4PY8I 4HAGA 3N1QC 2X4UB 4H20H 1LO0L 1IM9D 4L4TE 5JHDE 1JGDB 2AJYL 3PJSB 5DRWA 2ATPB 4PLJD 3BEVA 3F7VB 1KJ2H 3FOMB 1WZLA 2GT9B 3NIDF 1Q72H 4M1GH 1FAIL 5HGGS 2IG2H 3H7LA 3KS0J 4NN7C 4YR6A 5LBSL 4KI5E 5EOTA 2H6PB 2K1MA 4QWWC 5CSBA 1OTUD 4OI8A 2YUXA 3O6FD 3GSXB 5E4EB 3V6BR 4K3JL 4DGVH 4JY6A 4LCIH 4I0PD 3BJLA 3BO8B 2I27N 1OF2B 4IMKA 4JRXA 1U8HB 3LKOB 5E0QA 2QQKL 5FB8B 2Z91B 3TLRA 3BKML 2DQDL 5C3TA 2IADB 5E08H 1U8OA 3UCRA 3EOAB 1RURL 1NAMB 3FN3A 4DGIL 2AJVL 3WNLA 4UDUB 4LCWD 4QHUA 3QI9B 5HDOA 3CZFA 5E8NA 2VZUA 5FHAL 5IEHB 3MOBH 4CMHB 3JV4A 4MVBD 1YN6B 3U46A 3MSPA 1FRGH 2BVQB 4X0KA 1MLCA 3F7RA 3IRZA 5I1EH 3OX8A 4XPGL 4O58L 1YEDB 5IHBA 4OLWL 4CNIB 1JGVL 5BVJA 1WC7B 4NUGH 3T0EB 1KJ3L 5EUOF 4PP2A 3V6OC 4XVTL 2WBWB 4OQTH 4PRHB 5L8JB 2GITB 1IGFL 5A3IC 4WUUD 2MOVA 4MAYD 1NFDB 5D7IE 1J05B 1J1PL 1JF6A 1HXMB 5KVFL 1B0RA 1EEUA 3P0VH 2X4SA 3FRPG 1N2RA 2ZNXA 3IDGB 1A14H 4NT6A 5E9DA 3OWEA 2CRYA 4YHMH 3HMXH 4KWUA 3OXRB 1QYGL 4OV5B 4P5MA 3BN3B 1AO7B 1DLHB 5IF0B 1Z0NA 3V0VB 1KIPB 3CJJA 3P73B 3TYGH 5CJ5A 4RFOH 3ULUF 3U4BL 2NZ9D 3BPNB 3D6GA 5DRNA 2MJWA 3CXDL 4P9HL 1CGVA 1RV6X 2EDFA 4HMCA 3BKJH 3G6JF 4RRPA 1VFAA 4JO1L 1NEZA 1TENA 3SCMA 4WY7L 4LK4A 5HHOE 1MQ8A 3KPMA 1LK2A 3GBLA 3SDDD 4RA3A 2K3TA 1HZHL 5BVPL 1EX0A 2W0PA 4MX7A 1XR9B 3RL2B 2JELL 3JV6A 4DN4L 1DLFL 3WBDA 4E41D 1A6ZA 5E2WL 2R23B 4BQ6A 2FX8L 1I7UB 2C3VB 5F7UA 1IM3A 2OQJA 3RIFF 4NQEE 3FFCE 5IMMB 3MBED 3WXWL 3VGAC 3QNXA 4KKLD 3D1MC 3O6MH 4KMQA 1URLA 1FVEB 4D0CA 1BEYH 4Y19A 1J8HE 2B4CL 3LQZB 5IB1B 3Q0HA 3WS6A 1HNGA 3IKKA 1A4KB 1AJ7L 1K8DA 4YDJA 1H5BB 3TO2B 3A6BH 2GSIA 3JWDC 3OSKA 4UAOB 4F8TA 4MQTB 4NSKA 4PP2B 1G7IA 1UADC 1QSEE 1QFWL 1OT2A 2EO1A 1Q9WB 5I1DB 1XT5A 5FKPB 3SDDC 4X4YB 3SOBL 4PRNA 3BQUD 2AEWA 4F7EB 3NPZB 3D0VA 5JXED 4POZD 4M6AA 3TN0D 4XCNA 4OD2B 3QA3A 2ZG2A 2HJFB 1IC5H 1EA9C 2EIBA 5T33H 3VH8B 4PJFA 1BREA 5TPWH 1CG9A 1EBAA 3JTSA 2DDQL 4JFPB 4LLVB 5SWQA 3A6CL 1JL8A 4I2XE 1LEGA 5ISZA 3F62A 1T5WB 2YC1A 4LLYB 5CEZD 3MOQA 3U30B 1GPOH 4KI5F 3DVGB 1P9MA 5TPWL 1U93A 1V7ML 1QNZL 3VGBA 1PAMA 3QDJE 3IFLH 4LLYA 5DMKA 3QZWA 5H35B 4YO0A 3NZHH 1P7KA 3MRNB 4YHOL 3CU7A 4FN0A 2NY7H 5DQDL 4PJCE 2LVEA 3SN6N 4FNLL 3IDUA 3RDTD 2IFGA 2KZ1B 1MAKA 4WO4B 5DJAA 3D39A 5GISL 1GJIA 3T3PF 3QWOB 3CDGA 4P3CH 1AHWB 1C12B 1Z5LB 1JHKH 2BVOA 3WIFB 5B3JF 2C4FU 5C0NC 3ECBA 2BNQA 3VG0L 1Q9WA 2ADFL 4PY7A 1BBDL 3MUY1 4FQHB 3BJ91 4PJCB 3VXPB 4RMUA 5CEZL 1S9XA 1UYWL 5HGAA 3KG5A 3DX6B 4QY8A 1EPFA 5E24E 1ZVSB 4KHTL 1F4XL 4RISL 2R15A 3VGDA 4B7IA 1J8HD 4PRBA 4FOMA 4ODTH 4M1DL 1J7VR 1FV1A 3NACL 3ZTJH 4Y5XB 5EU3A 2ZG1A 4PJ9D 5D1QB 5BV7C 1DVFA 3AGVA 4EUPB 3QA3B 2C1OA 3D25B 4L4TB 4ZUTB 4HGKC 1UXWB 2D9CA 4Z7QF 4DN4H 3UMTA 2R2EA 3P73A 3I6LE 1F3RB 1MI5A 4NWUL 4F33B 1HINL 2V7NA 4LNRA 5B22A 2P4AB 3MJ8A 2CIKB 1GC1L 3FRPA 3G6DH 3V4UH 4JGMA 5ETUA 3IDGA 1FIGH 1YEHH 3DVGA 4OLXH 2JCCF 4YFLF 5HHOD 4V2CB 4WHYG 4N0CC 3FO1B 1VGEH 5EZJA 3V52H 1D5XB 2UVEA 3VXUA 3HMWL 2W9EL 1QSEA 2C4XA 1OTSD 4OZGF 2H2PC 1IT9H 3BP6B 1DQTA 3QNYA 3KYOA 1E27A 3B8YA 1S7RA 1I1CA 4F80A 3HE6C 4KTYA 4L8CA 2BY3A 5C9JB 4CVWA 3VFWA 3CFKB 1NEUA 3P9WB 3WNNA 3NABH 5HHNB 1HHHB 1B9ZA 3NAAL 5A2JH 1ZLWK 4Y4HD 5FKPA 4HPOH 5D7KD 3QT2A 1HHHA 1HCVA 2IH3A 4PV8A 1T0MB 4KRPC 5IVXE 2D0HA 3CZFB 3HKFA 2HLAB 2MCPL 1A6WL 4KXZH 1LDPH 3MV8B 5IMLB 1NKOA 2IBZX 5EUKB 4BZ1L 4JKPL 4KDVA 4JRXB 4UOW1 5D9SB 1S7UB 4JR9H 2EKJA 4G9FA 2C3XA 1KELH 4JFEB 2BZDA 1W0YT 3GIVA 1EO5A 3QEHB 3QUXD 1T83C 3KLHC 2HTLC 3N9GL 5C0EA 3AVEA 2V5SA 4NQCB 3V0VA 2OTWA 2HTKC 5DJCB 4BSVA 3VGHA 4MJ6A 3RVTC 1TCMA 1L6ZA 2VYRE 4HAFA 3BYYA 1CVSC 2QHRH 3L9RB 3JWDL 4OFYD 1TJGL 4PBWD 4YZFE 2J8HA 4WFFD 1XF2B 4KY1L 1AXIB 1IFHH 4UQ3B 3B9KA 3P0YL 5FA4B 1XGYL 3F12B 4MDJB 4JG0H 1JWUB 4WW2A 5F9WB 2QHRL 2YWYA 4FXKB 5TE6H 3VRLE 4LPXA 3D3VB 5C92A 4QRQA 2AK1H 5T1DL 2ESVE 4PY7B 5GGVL 5TF1L 5JR1L 1A6AB 4Q58C 3D18B 3VXTB 3RWDB 3OXRA 4O2EB 4HK0B 1AHWA 4U7SA 4E42A 1MPAH 1OQOA 2PW1B 3MZTA 4WRLA 4N90E 3BZDA 3ORJA 1T2QL 4U05A 5JHDD 4M48L 1U95A 3BUYB 4PGEA 5CBEB 4Q9QH 4ZOCA 1J05A 1SJVA 4L8SA 5LG1A 3E8UH 5GIRA 4HEME 1BJMA 2H45A 5D5MF 2RHEA 5F7KC 4EVNB 3EYFB 3FOLA 5B3JE 3STBA 2M1KA 3QG6A 2E8ZA 2X4OB 1BZ7A 4CN4A 1T4KB 5HDBF 3QCVH 4KV5E 1SEBB 3BKYH 3D9AH 5FUZH 1GYAA 4XAWH 4PD4K 1MFBL 4X83A 3EYUH 5KANI 5CJXC 1JN6B 1S9KC 1R5VB 4LNVA 3E3QC 3CXHJ 3H9SA 3OJDA 2YD9A 3HNSH 3N50A 4NKMB 3SBWA 2Z31B 4MD4B 2PUQT 4G9FE 4XPGH 2N7AA 2R1YA 5CEYA 3BWAB 1X5XA 1UFUA 1QPXA 5SWSD 1I9IL 1EMTL 4LCYB 1OSZA 3EAKA 4U7MA 3FFCB 5I76A 4AL8L 3HUJE 4S11A 1SBBA 3WUWG 4HIEB 2OZ4L 3QDMD 3IS1X 3QJHB 4K07A 1SY6L 2NTFB 4QOKA 4S10A 5DTFB 3EYSL 3G04A 2IAMA 1N64H 3DI2B 4QCIB 2FD6H 4IDJH 2I9TA 2E9WA 4OM0H 3U48A 2FEEI 2NY7L 5F7FA 4DVBB 5ICYB 3D18A 5IB1A 2V9QA 5CJBA 5DXWA 2K7PA 3QHZH 2EDLA 4M6NH 4WO4C 5DMIH 4NUGL 3LPFA 3HR5B 3OPZL 3TYGL 3VI3E 4GAGH 5AUMB 3EYQD 3O4LE 5C0CD 4Z7VE 2VWEE 1NGWA 2BRRH 2ENSA 5ANMB 4OF0A 3VWJC 4GKZB 3RQ3A 3UPAA 4DVBA 2VDOH 3RNKB 1DDHA 2OX5A 5HHMB 3WO4C 3TWCH 3C2SA 3V6FA 1WIPA 4U6HA 2CR3A 1OAKH 2IQ9L 2YXFA 5C0AA 4H26B 4ZODA 2WUCL 5DQJB 1OPGL 1SJEB 2G5BA 5D7LA 2IH1B 3ALPA 3EDKA 2NY2C 4XWGL 1G7QB 3QDJB 3B9VA 3TCLB 2DKMA 5H94A 2OS7A 8CGTA 3CXDH 4P9HH 2E6PA 1R3JB 2A9MH 3AMKA 4X7FC 2FWOA 3VWKC 2FH8A 4JN2A 1MHCB 3SDDB 5IQ9A 4NBYB 3OF6A 2YWZA 4UOW0 5JXAH 4ZUWB 3WKML 2NY0D 3QB7C 5D1XB 1OOAA 4KQ3H 2DOCA 4KJWD 1AE6H 3ALWA 3WNMA 3VXRD 2ADGA 4JFFE 1CQKA 1GC1H 2BSRB 3TYFA 4KJQC 4P99A 1KJ2L 1N3NB 1FYTE 3V6OE 2QQLH 5ALCL 4YHNB 1DQLH 2VLKD 4WFFE 2G2RA 2VDML 1ZHNA 3NTCH 1IAIM 5CINH 2D2OA 4ZUWA 5T1MB 5HVHB 4YZFF 3QNZB 3R1GH 5CWSA 2DLTA 2ZSWB 1NFKA 4JE4B 1G9NH 3HFMH 2Z4QB 1L7TH 4JY4A 2Y9RT 2Y72A 4E0RB 5DFVD 5IFJB 5C0GB 1F13A 2BSTB 4Z7VB 1GGCL 1P6AB 1OP5K 1LP9B 3BP6A 5KSAD 4XPHL 5D72L 5T1LB 5IUSA 2Q3ZA 3FB5B 5DQJA 1FL3B 3O45A 3ZT5A 3FFDA 4NN7B 3W0WD 4Q97A 1ZT1B 2HVKB 3ZKXC 1INDL 5FHAH 4YWGH 5GGSY 4BH7A 1VFBB 4MB3A 3V6OA 1KTLB 1ZEAH 1F2QA 3GNMH 3I6KA 3RZCC 4AY0A 2LU3A 5K9KA 4LSVH 3S35X 4WEBL 3B8SA 3BO8A 5JO5A 2X9YA 3O11A 1KEMH 3FL7A 1P84J 5HVFB 2DL9A 3RY4A 1KIQB 3OG4B 4LEXL 5FECA 3BDBA 1DBJH 1OAQL 5ACZB 4L5FL 3UBXA 3MLYL 5B3NA 1ZEAL 4P2OA 4MNGB 3IDIB 3UAJC 5C0JA 4QCIA 2Q6WB 3QUYD 5HVWA 3HHRB 3MNZA 1IVLA 2DKSA 1JYNA 3NOIA 5HYIA 3PNWB 1JVKA 4BJLA 2AJXL 4TSAH 3O4OB 2V6HA 2EKSA 1FZJB 1FHGA 1HIML 2DI8A 4M7KH 4WCYL 1ZLSL 2EE3A 1U8NB 4XBEH 4TOYH 5FK9A 3QXVA 5SWQB 3IJYB 5GS2H 3J7HA 3ZE2F 1CLZL 3VFOB 5GJTH 3K4AA 2FCBA 3HAEH 5DSCB 4P3CL 1CICB 2BP3A 3N1GC 3MRIB 4ZO8A 5IB2B 1CD8A 5EU7C 5E8EA 1TETL 5D2NC 2Q8AL 1LILA 2G9HB 2X09A 4OZHA 2QTEA 1LGVA 3O8XA 5HI5D 2CKNA 3VXUE 5FYKE 3BD3A 1X4YA 5FOBB 5FAAA 4HH9B 4ZO6A 1UZ8A 2IMMA 3B9DA 4WHTB 3CFKA 2HFFB 3IGAA 1DBML 4M5ZL 3LV3B 5B8CB 1V7NH 4TUOB 3HI5L 1GC1C 4KK6C 2Q3AA 3SE8H 1WTGT 2ITDA 3L3IB 1CDUA 2A1WH 3RIAK 2P5EA 1A6TA 1FZKA 3EYVB 3ZKQD 3DSFL 2NY6D 4Y2DC 4CUCA 1YJDC 2JIXA 3WXWH 5CBEA 1JGEA 2BVPB 1YEIL 3O6ML 2PXYA 3QWRD 3TYFB 3F7PC 1MJ8H 5TDNB 2EXWC 5I75C 3QNXB 2XZAH 2ZPKL 3FT3B 4NOBA 5FYKH 25C8H 1P7QB 4LLDB 3V8CA 4AJ0A 3D87B 5J6GB 1JK8A 4EIGB 4M00A 4HH8A 4OZIE 5C86A 1DBAL 2ARJA 15C8H 3GBMH 1YMMD 1S7RB 4DKFH 1UM6L 1S9WA 5ENWB 1SJHB 4M8QB 5D7LB 1IT9L 2C9AA 5FYJU 4O5LH 2PYEE 4PJXA 5DJYB 1UWGH 3VXMA 4G7YH 4M8QA 3GHEH 3INUH 1CZ8L 1R5IA 2XQYK 4R0LB 4LHUG 1S7VB 4QY8B 1E6JH 4JFQB 1MIEL 2V2TA 5K9OB 4QHLA 3T3ME 4I0KA 4MDIB 1W0VB 5LVEA 4YBQD 5E4EC 1OTTC 4JDZA 3SKNA 1TTUA 3U6RB 2NXZB 4ELMA 5L0QC 3TBVB 5JTWA 1TVBB 4K9EC 4X7CC 3BI9X 1W0VA 1FJ1A 5E8EB 4IJ3B 2CUMA 4JFQA 5D70L 3Q1SL 1PY9A 1YEKL 5IW6B 3BH9B 3CFDB 1CICC 3ARED 4CU8A 2LU7A 3DNKA 2OSLB 1X5LA 5T5NG 1WWCA 1E28A 1CE6B 2IPKA 2VDOL 4YXLL 3RAJH 3E6HB 4G8GD 1P7KB 2G60H 1R3IL 4DZ8B 4PTUA 5K9QG 4DW2H 3DX6A 3GMLA 3IFNL 2VERN 3GEWB 4R8WH 1NANI 4MS8D 4YXLH 3MUGA 3I9GH 3DYPA 4NHUB 1TVHB 1ZANL 4K3EL 4OB5H 1MJ7H 4EDWH 5INCA 4MNGA 4BK4A 2BMKB 1WT5C 1U3HA 4PJFB 4P5TA 4B41A 4MNHA 4OD3L 2P5WD 2VAJA 4X6DE 5F72S 4WO4A 2Q8AH 1NFDE 2EH7L 1IL1A 4ODVH 1JTOA 1MCCA 5EC1B 5C08A 5E2WH 5AD0B 5K9KB 4PRNB 2GITA 4PLNC 4KQ3L 4WI3A 4ERSL 4UT7H 2A6DA 4HLJA 4H1LG 3L3GB 4P2RB 2FR4B 3ARRA 3BW9B 3QDMB 4W68A 4W4OC 3PWNB 3J8F7 5LXGL 1HHKB 1T2JA 5EH1A 2O5YL 1RZIB 4LEOB 1F8TL 3G9AB 3F5WA 2QQNL 4OCWH 2BHZA 1IGCL 4WGWB 4ZD3L 5I66A 2P8PA 2YPLA 3EYUL 5CKAA 1IAMA 5B4MC 1INEH 2BXZA 3PV7A 2BSTA 3PIQB 5F9AC 1NAMA 2EC9U 4OCSH 3P77B 3GMRA 5DFVC 1C5DB 1RURH 2YZ8A 3RWFA 2DB8A 3PE9A 4ZUUA 2XKSA 1X7QA 1PKQB 3O2VH 5FK9B 1IGTB 4Q74A 4Y16B 1YUHB 5JOFB 5EO1B 2UZIL 1EXUA 5KSVB 2GAZB 1QSFE 1T1XB 2UWEF 1ADQL 1FG2B 2FLRT 2VDLL 1BZQK 1WZ1L 3RBSA 3NBNA 5GS1B 4YHYB 5DWUL 4PRHE 4M7LH 4ETYA 4O00A 5KW9L 3NPSB 4M8VA 3ARFC 1YPZE 3FFDB 4RDQF 5C70A 4NZUH 5D2NB 4KJWC 1DQQA 2QKIA 2ID5A 1MRCH 2FZ3B 4FFYH 4OM0L 5IM7A 2E8YA 5JIPA 3WYRA 4PJCF 3DXAE 2WBJD 3GJFB 3NCEB 1RVFL 5BZDB 2MQ0A 5A1AA 4X99B 1NLBH 3IAPA 1T0NA 1KIPA 5E70A 2UUDH 3O11B 4EUPH 3I3BA 3QPQC 4OV5A 1R3LB 2XWJA 1NGXA 2VQ1B 5T3XE 4S1SL 3P11L 4MWFA 5KAQG 2WIIA 3RL2A 4RGMC 3DGCR 1Q9LA 2H1PL 3BW9A 4G8IB 2H41A 4XCEA 3KPMB 3LZFH 3VDAA 2MPAH 3JWOH 3VFGH 3Q2CA 2VLMD 4TOYL 3QHZL 4NNPL 4D2NA 4EJ1C 4WFHD 5I16B 4IRSB 4LRIC 5I71B 5D6DC 3RIFK 3EFDH 3GSRB 4K7FA 1Q0XL 2V5RA 3ES6B 3S34L 4HFUL 2F19H 3X12B 1G9ML 1MFAL 3LEXB 5FFLA 2IH1A 4OGXL 1PZUB 1CFSB 4GAFB 4O9HH 5A2IH 4OKVB 2R4RH 1AXSB 4ZFGL 1AD0B 1Y6MR 2WUCH 1J12A 1B2WL 3IS0X 1KG0B 1WFTA 3K8MA 1ONQB 2DQUH 5D1QC 4MB4A 5BV7B 4NRYB 1BBJA 3VRLF 3CFJB 2IANE 2AV7A 2B0SL 2SEBA 3ZMRA 5J0BA 3FAWA 1LE5A 1O7VA 3DV6A 4NFCA 4QF1B 4TRPH 5C2UB 1U6AL 3AU1B 2EEBA 4GLRH 4XNZB 1UWEL 3BOVA 5GSVB 5ID0B 3VFVB 1YEDA 5IB4B 3RWCA 3HI6L 1F8TH 4M43L 1F4WH 1IEBB 5EPMB 2QL1A 1V3MA 2D0FA 3B2VL 2EIDA 5L88L 5IVZB 4TVPL 2HVJA 1L9MA 3IKCA 5L2KD 3GJEB 6FABL 3FHAA 3HC4H 3MXWL 1A7BA 2B2XL 3MRLB 4OFVA 3HA0A 5TDOB 4FQXA 2Z91A 1FLRH 5F9JB 2BRQA 3VXMB 1GGBL 1ED3A 1JRHH 4OFPA 4UILH 1OF2A 1N8ZB 4YX2L 3H9HB 3BE1L 5IIEA 1T7YA 1X4XA 3HE6A 2NY0C 4IRJC 3VI4E 2UWEA 2AABH 1R0AL 1FLRL 4LSPL 4KJYB 3GM0A 2E9IA 4NO2A 5GXBB 2BNQB 5IVOA 4OCMC 5C9KA 3CVIH 4HIHB 1YNLL 2X2YA 4FFWC 4P23C 4XPAH 4XP1H 2J1KA 1JPGA 5HBBA 2UWEB 3SDXE 5DHYB 4J6RH 4NJ9L 2RQ8A 2JIXB 3MACH 4U6VL 5E6ID 1WBZB 5JNYB 1CD1B 2X4UA 1WUNT 2NW2A 3SKOB 3GMMB 1A3RH 1XCTA 1YEFH 5LCVL 2JKXA 5DFTA 4K7PY 3FQUB 4UQ3A 5K9QI 1NL0L 5LGJA 3OAUL 3P0VL 4CDGC 4YHLL 2PETA 1KT2A 3RWJB 3R0MA 4WHCA 3MLTA 1A3RL 3QJFB 5HGBB 2Y06H 1AO7D 5DLMH 4Y8AA 1NUDA 3FT2B 5D7LD 3VI3F 2R1WA 2QLVB 3H3KA 4Z7OF 3K0WA 4KUCD 5SV4A 2OR7A 1FH5H 4NZTH 5E95B 3KLHD 4JPVL 1MHPL 1YYLL 3E1F1 5FGCE 5I2IA 3S34H 4JQXC 3LB6C 1N6QL 2A74A 3LS4H 2D7TL 3LN4A 4R6UA 4KGLA 1GAFH 3TVMC 3EOBA 3L5HA 3VG0H 4LASL 3TBTA 3FQWA 3Q3GB 5DJ6B 4Q9RH 1HINH 1CFVH 1P6FA 2DQHH 3L6FB 3QXDA 4YGVB 1ZS8A 3QHTC 4IM8A 1XF2A 2VJXA 3WIIH 5HI4C 4NN6C 2VAAB 4HMEA 2AP2A 1BVKB 1BJ8A 5MP6H 4RZCB 4MHHI 1HI6B 3WFHB 3S5LB 2MMXA 1OTUC 2FIKB 3RY6A 4P0DA 4BKLB 5KTEL 5C0IB 1OCWL 4EI5D 1GOGA 3C8HA 4AQOA 3PHSA 3IXAB 2H32A 3H7BB 5HHNA 1EJOL 2BK8A 4TSCL 4HS6A 4M43H 4GRLB 4J8RB 5F1NB 2MHAB 1IQWH 4HWEL 1UQSB 4EBQL 3DWTA 4U6XA 2VO5A 1VFBA 3UTSB 4PJHB 2A6IA 2WINA 3F58L 3CFEA 1BGXH 4GAJH 2OYPA 5J3HC 1U91B 2X4NB 4L4JA 4WIQA 4BQCA 4QNPE 2VE6A 5KS9B 3TV3L 5DRZA 2X70A 4EOWL 4PJ9B 5D1QD 5MHSE 5I19L 4LOUD 4MYWB 1WICA 1CTNA 1NJ9A 3ESVF 4PV9A 3RJQB 4G80A 4YPGA 4OLEA 4AL8H 4LQ1A 3IDXH 4LKCB 4O2FB 1BFOB 4L3CB 2C3GA 1GGYA 3AY4C 2A0LC 4RGNE 4QO1A 1RIHL 2YZ1A 2PO6A 4LLMB 3VRJB 1S9VA 1YY9D 4NUJB 2CJUH 4O5LL 2FZ3A 1OVZA 1MVFA 4HKBB 4XPBL 5CILH 3MBXL 4PTTA 1W72H 1I8LC 4LAQH 3CDCA 2GI7A 5I74B 5LWYL 4RAVA 2NTFA 4JQIL 1C5BH 4U33A 1RULH 2HKFH 1RUQL 5GS0D 1NMBH 3TH2T 3MNWB 5L2JB 4K8RL 2FHCA 2CJUL 2GTZA 4JFYA 1R3KB 4U0RC 3NGBB 3MV01 2XTJC 1NFDA 3IU4L 2VC2H 3JWOL 1IFHL 5CZXC 4XCFL 4OD1H 3OZ9H 4GRWE 1XGQB 1G7HA 1SBSH 4ZFZA 2VDNH 5GISH 2HRPL 5E2VL 5CHNA 4PB9L 1V8HA 4NKIH 1MVUA 5D6CB 4F3FB 4MD0A 2F8OA 5D1ZA 3MRHA 5IW1A 4HHAB 1AGDB 4PS4H 3VA6A 2WBJC 1IGMH 2H32H 1DFBL 4HK3J 3L3HA 1RZ8A 4F57L 3N1PC 4O2CB 4JO2H 2XZCL 3TN0A 3HPJB 5AAWA 4MGXA 2XA8L 1JBJA 3V7AG 3VD3A 5SX4H 5GIRB 1Q94A 1CR9H 2ERJC 4JCMA 4MAYA 3VXQB 5AD0A 1F90L 1OAZL 2AJ3A 4H0HB 4X6BA 3WMSA 1D9KD 4UNTA 4JANA 4ONHB 1U41A 3WNKA 4JFHE 2HJKB 5MP6L 2NY4B 3VFOA 1JJUA 3WDHA 1JFQL 5EOTB 3SKJL 2FBJH 1LO0H 3DOSA 3X11B 3X14B 5I73C 1WFUA 4KK5D 1VEOA 4WU7B 2EKSB 5KJRL 1XH3B 2EXYD 3FO0L 2B2XH 5J56B 2FEDD 1H5BA 1T5WA 5CUSL 2EIZB 4RRPG 3QIUB 5ESAA 3S3JA 1X6NA 2R0KL 1OM3L 3DTXA 3WV0A 5CP3A 3HCVA 5SWZB 1BQHB 1M7DB 2VTFA 3MRGB 1ZVHA 1MCPH 1JNLL 3MRPA 3OXSB 2VKWA 3QHFL 5CP7A 3LY6A 1EJ6A 2C3VA 1MRDH 2QSCH 3SGKC 2DQDH 1IM9B 1YECH 5EOCL 3DROA 1KPVB 2F5BH 1B6UA 3TIEB 1OAXH 1BX2A 1UWXH 2X42A 4QOKE 4LKXB 2EYSB 4G5ZH 4FTVB 4R0LA 4QF1A 3MBEB 5HVGB 3DRTA 4TTGA 5HGHA 4XRCB 4L3EA 1JMXA 1A7PL 1MRCL 2JJTC 3C5ZB 4HQQL 1SJHA 4A6YB 1UJ3B 3OR6B 4GMSH 4YNYB 3JUZA 2NX5B 3VXNA 2CXKA 3EYSH 4JY4B 3RUGA 4XVSH 3F65A 1MJUH 5DC0A 1X5GA 4URTB 3AAZB 2EDKA 4JKWA 3S36X 1SM3L 2MWCA 1L6XA 4MAUL 4HG4K 4JFZH 4X4YA 1J1PH 4LF3A 4GUPA 5HDLA 3V4PH 3QCUL 2H1PH 1FC1A 4PBXA 3SKMA 3TJHD 2PXYB 4Q6YA 2R0WL 1G1YA 1E27B 1F11A 3D69B 5EBLB 5DA4A 4ZFGH 4IRSD 4AIZB 4PJGA 1JHTA 1GAFL 3NCBB 3LN5B 3QBTB 4HC1A 4ODTL 3O2DA 3RHWK 3RVVD 2A6JB 3KPRA 3KPNA 2FHFA 1FVEA 5EBGA 4F15B 2HLFD 2J8UB 5JORB 4EDXA 3UTTB 3VFTB 5JR1H 3WNPA 4DTGH 1RJCA 3WN5B 4HS3A 2F53E 3RPIA 4S1DD 1FDLL 3VFUA 2VZOA 1WV7T 4JY5L 3RDTA 5FCUH 2C1OB 3D25A 1CGUA 4ISVB 4L4TA 4ZUTA 4Y19D 2J8UA 4GRWF 3ARBB 3QI9C 5I1GH 3RHWF 1FN4B 2IWGA 2DQUL 5DO2D 1FV1B 2EYRB 5FF6B 1A1MA 3PWJA 2D4DA 4GG6E 4M6OH 4S1RL 4U4BA 3OG6B 3F58H 4R90H 1F4WL 2Z31D 4HXAH 5F7EL 1WVZA 2DQCL 2YK1L 2AGJL 4OFYA 5CIPB 1IBGL 3TA3D 5F7DA 3QEGH 1IQDA 4BH8B 1WBYB 4PJ8A 5KG9B 4K23H 1IAIH 2FIKA 4BKLA 3ZYOA 1B0GA 1GHFH 5C07D 3TP4A 4JM2F 1FL5B 1PG7H 3DUSA 4JVWA 5TQ0H 3RUGB 2VZ3A 4ORGB 3CVHB 3GI9L 2FO4B 4CADB 5KW9H 3HG1A 1GGBH 3LKSA 5ESAB 4H25A 1ZT7A 2XKNA 2DRUA 3DX7A 4J3WA 4X9GA 1FYHB 3WFDL 2A2QT 5EUOB 5JW4M 3MODH 3GMOA 4FNLH 4MQXC 4YAQB 4BK5A 5I2IB 5TE7H 5L2KE 4YWGL 1OWWA 1RVFH 4HUVB 1EGJA 5DUMH 1KPVA 2P44B 5FOBA 4I77H 4IS6B 2XQBH 2ED8A 5F3HB 3MA9H 4UB0H 4FP8L 1GPOL 3JV4B 3O4LD 5ERWA 4Y1AD 3B6SB 3KPTA 5IFJA 5D7JC 2QADC 1CICA 3EOAA 3HZKA 1UYWH 5D7SL 4QYOB 3ROOA 3SGJC 3UAJD 3QXWA 2BX5A 2Z35A 1PZ5A 1WWWX 5C6PB 2GJ6D 4OBRA 2RJMA 1G0XA 4X7TB 5SWZD 5EA0H 3QDME 2EDHA 3QRGL 4PGDA 2UYLA 2CH8A 4ACPA 2WP3O 5MENA 1UACH 4AENB 1IAII 1JPGB 2PTVA 1MFEH 4WU7A 5FYLH 4HFUH 5DMGD 2Q7YB 1A8JH 3I6GB 1CE6A 4QRRE 2GSGA 5DJZA 2NNAA 5JOEA 1F97A 1K4DB 3MCKB 3DX8A 2HMIC 4G9FD 5EBWA 4JPVH 3CLEH 1FNHA 3ZKMC 1HHIB 2XA3A 2D7MA 4I13B 4A2MA 3GSWA 4LCCB 3SGKA 3P9MA 2DBLH 2I07A 1G7MA 1VGEL 1KTLA 4YDKL 4TTDD 1DN2A 4MA1B 1BLNB 3EJYC 1EHLH 1ACYL 2E7MA 1ETZB 4YPJA 1M6OA 4NRZB 3VXMD 4ONOA 1RPQA 5E2TL 2AQ2A 15C8L 3GBML 1I9EA 2J8UF 3MREB 5E03A 1QLRA 3ZHLA 4MJ5A 4NFDA 2ADIB 5KSAB 5B4MD 1VFAB 2FB4H 2VIRA 3O2DH 4MNQB 4WW2F 4MD0B 4B5EA 1T03L 4RFEA 3C09B 3T2QA 4XCCL 2Z8VC 5JDSA 1T1WB 2J6EH 1Y6KR 3I85A 1RZGB 4S1DC 3W82A 6CGTA 4I3RL 3KPOB 3MLZH 5GRUH 5DJ0A 5CZXD 5IQ7L 2HKHL 2WBKA 5J12C 5C09E 5FO8A 2X70B 4XT1C 4P46D 3KR3L 1JPFB 1W72L 4V1DA 3I6GA 3ZE0F 4UTAL 4PRHD 2J6EL 1CF8H 2JIXD 1BQLH 4J4PD 5EUKA 1NDMA 4CDHA 3ARGC 1RK0B 4NHCH 3F7QA 5GGUB 3WN5C 3QQ4A 1QOKA 2H3NA 3DVNB 4OD1L 2HN7A 3QIWD 3C6LB 4NC2B 4Y0GA 1BFTA 3QWQB 3VXSE 1WZMA 1HYSD 3UTPE 4WHTA 1U8JA 1Y18B 5DVNA 1RZFL 5DEFB 1AGEA 1CTOA 1JF1B 3U9UA 5CIPH 4N8VG 1OWRM 1S7QB 3FT2A 4LVHC 5TDPA 32C2B 1LWRA 1ZSDA 2YUZA 3LHPH 5D96B 3OKMB 3P4OB 4LEOA 4X9BA 3DIFA 1J0ZA 3QZWG 4JFDB 4JFDD 4TSAL 4XCYA 3OF6D 4XBGB 4NRZA 5LGJB 5CJOL 4KHXL 5KVGH 1AGFA 2IFFL 2VQ1A 4JHAH 3PQYE 3MMEB 1ZGLP 2ZCLL 1NFIA 4X80H 1DUZB 4RGNB 1BPVA 2YD5A 3HC3L 1PSKH 1GGIL 1NGWB 1TNNA 1VB9A 1FZMB 4UT9H 2BOBB 1P2CB 1F00I 1JMZA 4CADA 1RUAH 1TETH 4QRSA 5D7KE 4QTIL 2VL5B 1AFVH 2R0LH 3FN9A 3O3DB 4MNQA 3AS2A 5DT1L 1OP3K 1OLZA 4W6YB 4PRPB 1VPOH 1KB5L 3H8NA 3GB7A 4FTVD 5IK3B 3TO4B 2XA8H 4AIOA 4M5ZH 2APBA 1UWEH 2FGWL 4JDVA 1QKZH 2NPLX 3L6FA 4BM7A 3EO9L 2IMNA 1KN2H 2GAZA 2P8LB 3AS0A 3T65A 1TVDA 4ONFH 3MYJB 2Q87A 3RJDA 3X13A 5F9JA 4LDOB 4PJDF 2BOCA 3GRWH 3MXVH 1UEMA 3SCMC 4J3TA 3MV9E 5E56A 4M7ZC 1K4CA 3PXJA 1FPTL 2LQRA 3QWOA 5DJXA 2DYPB 4PRAB 1QLEH 2A77H 1KPUA 3HMXA 4UQ2B 3Q5YA 1RHHB 4B53A 3CFCL 4JJHA 3REWA 4HS3B 3SOBH 2NY5C 3SKNB 1IAOB 2BCKB 4J2XA 3DX9B 4GAJL 3F5WB 4LSTH 5C0GA 4EKXA 2PXYD 5IB4A 4OZHF 3NABL 3WE6B 1ZTXL 2PO6D 1KJ2B 5EUOA 4XVUD 3I84A 1KCVL 1U3JA 4NRYA 3GSUB 4QNPF 4IDJL 4ZAKA 3W9DA 1MCBA 4XBGA 2ZUQC 4HQQH 4G6FB 1JZ2A 1MF2L 4U1MB 4FQPA 1JWSA 5D6DA 5DD6A 2FL5A 4NBXB 1T66C 4KRPB 4GS7B 3UZEA 1AD9B 1MHCA 4YDVB 3SDDA 3G5XA 1AXTH 1NL0H 2VKXA 3VH8G 1D6EB 5CEXB 1P1ZB 3GSRA 3H6JA 4JM2B 1SMAA 3QFDB 2BFVH 4D9QE 4M7JL 4PJ5E 4QHKJ 3SDCA 4N0RA 5D1ZC 2PYFB 4LVNC 3S37X 2V17L 4NO3B 3BAEH 1YNTA 4XB8A 5J6HB 4H26A 4YXHL 5CSZB 1F45A 3S4SG 3H42H 5MI0C 1CFTA 1OGAB 1I3GH 2VH5L 1ETZA 2CDFA 3VFGL 4HFWA 2WIIB 2VXUL 2ICWA 2Y4SA 3D48R 3UDWC 5IBTL 1MOEA 3B9AA 1FFRA 4GKZA 2JJSA 5JDJA 2YPKA 3U7YH 3WFEH 2X1OA 1ZGLM 2DQHL 5IBLD 1I9JH 1KNOB 4HT1L 5HPOA 3BGFB 4TULH 4IOFD 5EU3B 3SKUD 3WHE1 3OAZK 1A64A 1BIIB 3JVGC 5DS8B 1PX3A 3RFZC 8FABB 1S7WB 2CKBL 1N0XH 1QRND 1T20B 4IBLT 1VPOL 3AXLA 3VD5A 1YNKL 1YDPB 4LAJH 5LXGH 1L0XA 2DQGH 1LO3L 4K55A 5CAYB 5MENB 1MH5A 3ULVL 1T6VN 4R90L 1XF4A 1T0MA 5IT2L 3VG9B 1Z2KA 1GGCH 4I18A 5F8RC 4ZS6C 1G6RL 1RJYB 4TRPL 4FA8A 2UZYB 2F8XC 4G8EA 2A73B 3GMPA 3P4MB 4DGYL 2FL5B 4L1DA 5E9DB 5JW4R 1FNEB 2CD0A 3KPNB 3DVFA 1J8KA 3DUHA 5D1ZD 3KYOB 4GKSB 4FMKA 2ZOKA 4XHQA 3LKNA 2EYTB 3O2WH 2OL3L 1HCFX 4LCWB 3C08H 3TM6A 1KEGH 5DMKB 3BUTA 1A2YB 2VLLB 5C0AD 3VDBA 1ZWIA 4QHMA 3EYFA 3WEXA 5DR5L 1H3VA 2V2WA 1LEGB 1CL7I 2M26A 2I24N 5GRWA 3U30C 4OCYH 3BMVA 5FYJL 3WFCH 5HHVL 4C4KT 1CDBA 4HHAA 1YN7A 2RFXB 4HC1L 3EHBC 3M1BA 4NN6B 4UB0L 1UKTA 3MJ6A 1UXWA 3AC0A 1WITA 3HTLX 1N5AB 3OAUH 5E4IA 4MQ7B 1A1NB 4M9PA 2J4WH 4AEIH 1U8HA 1SYSA 3LKOA 3DRQA 3MODL 2F74B 5C8JB 1IQDB 3WUZA 4BH8A 3OZ9L 3U9PL 3TBYB 1D6VL 2VDNL 4HWZB 1KCUL 2AKRB 4G8FB 4U6VH 1YMMA 3RTQB 3VXRE 1BX2B 1HQRB 4K8RD 3TO4A 1EUTA 1T21A 4XNQA 5E8DH 4AEHL 1ND0A 1JWUA 3OJ2C 4XC3H 3V5DB 3LKNB 4XVJH 3MRJA 3CFDA 5SWZA 1GCFA 3P77A 1DZBA 2R56L 3CDGB 4OF6A 4HXBH 4H1LA 5E8DL 3MC0A 1X9QA 1CWVA 3HLAA 4EXKA 4BELD 1WZKA 2BNQE 1QD0A 2EIZA 5BQ7A 4LCWE 5CJQL 5E6IB 2VDQH 3UO1H 3TESA 2X4PB 4O9HL 5E9DE 4XZUA 3HNTH 5FYLE 4XP4H 3PGDA 2XY2A 2B20A 4WI5A 3MV11 2BSSA 3MCLL 2A6JA 1KB9K 1MJ8L 1R3HA 3R06A 4I48A 1I1YA 4OLUH 4ESKA 4L9DA 5IFHH 4Y16D 1UQSA 4QXWA 5H8DA 3RVUD 5C0CE 3VH8A 4NQDE 3RZWA 3V5KA 2A6KB 2CK0L 4NQCE 3NFNB 5FUCE 4ZS7H 4Y4FB 1KYOK 3DVNA 1I1FB 3MUGB 4QKXB 2ADJB 1I4FB 4Z7VF 3Q6GH 1L7TL 3QH3B 4MMZC 4QOKB 3MUHL 2OR9H 1WZ1H 4YIQB 5DK0A 2GKIA 3IDJA 2BVPA 4L4TD 1P5UA 25C8L 3QDGA 2MNUA 1LDPL 2GSIB 3V0WH 3GIZH 4P9MH 3IF1B 4PJXB 5DJYA 1NGPH 5EU5A 3VCLB 1BIHA 4BZ2H 5I76B 4L8SC 1CGSL 5KSUA 1GVIA 3ARWA 4M1CC 4EIZC 3ELAT 4HS8L 3L7FA 1YPZA 3FB8A 4YGAB 3NH7L 4XRCA 5TQ0L 3BH9A 4JQIH 3CH8A 3CDYA 1B4RA 1EEQA 1R3JA 5B39G 4PLKC 4ZFZB 1KTDB 4OLYL 5I16A 3KR3H 2R4SL 4MXQD 5KS9F 1RHHA 1FGNL 3FQXB 3ARGD 5DFWH 5KSAA 4ZNEE 1T6WA 1JPTH 4ZSOA 1UH3A 1RU9L 3TNMA 4LRNL 1DBJL 2WBJA 1BQSA 3HC0B 5TH2A 4DK3A 2HRPH 3BSZL 4DVRL 1FFPA 2HRLA 4U6XB 3RNKA 1R3HB 1CYGA 3HRPA 1NUGA 4LLMA 3VRJA 3A67H 4XPFH 5TQ2H 5DEZA 1II4E 2VQTA 2VNCA 3RTQC 3GHBH 1NCBH 4Z0BH 5I1AB 4P4KD 2YRPA 2NQCA 1XIWB 2VISA 2XN9D 3JV5A 3MRPB 1K4DA 3MCKA 3OXSA 4LL9A 4O4YL 3DXAB 3IDIA 5FO9A 3TT3H 5DHVB 3IFNH 3ULUH 1FH5L 2B1HH 4NZTL 3VA2C 1MIML 2GY5A 3NCJL 4Z0BL 3FT4A 1KIQA 3MLUH 2F54B 5E8OB 1P2CA 4LLWA 4Z77A 2UV3A 4ZNEA 4U1HB 5C08D 2Y7QB 3ULVC 1PG7W 2PNDA 1BZ9B 5ESQA 3STZA 1U92B 2XQYG 3LN9A 4U3XA 4KQ4L 3QSKB 1IGML 4LCCC 4KRPD 2HT2D 2EDWA 4X6CF 1OSZB 2CUIA 1HOCA 4PRHA 3UO1L 1C08A 4OD3H 2EZ0C 1A7OH 5HVHC 4J4PA 3T08A 3WIIL 3BZ4A 1K2DA 1T3FB 3EJZC 4IDLA 4QXGH 3X17A 3IXAA 1ZHBB 4DGVL 3I2CL 3H9SB 3O81A 4GMTH 5CBAA 3T3PE 5ERWB 4TVPE 3QDHA 5GQBA 3RWGB 1G6RH 1CT8A 1CN4A 1WBXB 5MENE 5GGVY 1U58A 3OKOB 5FEBA 2D4FA 2YA0A 4L3AA 5LBSH 2EDTA 3L3DB 2HMID 4JQXA 3CUPB 3GKWH 3BZFB 4L3ED 4XP6H 1Y6NR 1MRDL 2QSCL 5FGBC 1GIGL 3TN0B 4OCRL 2JJTA 2Y23A 5F9DC 4GW1A 1KB5B 1T89C 1FVCA 1N6VA 1JZ7A 1U8KA 3C5JA 4XNMB 5JPNA 3KJ6H 2X7LA 1MJJA 1XGPA 4I1NB 5I19H 3JTTB 1ZE3C 3CFBB 5C0FB 1W0WA 4LSVL 4OBSA 4L4VB 2GFBA 5JW5B 4HD9A 3DJ9A 4DJMA 1VFOA 1QEWB 5IWLC 4G43A 2AJSL 2VXTH 3UTSE 1WFOA 2B1AH 3STLB 3PP4L 2I60H 3IXTB 3GM8A 4G80B 4M7JH 1QSEB 1H8NA 1XF4B 4FP8H 1RZ7L 4YHNA 2O61B 3AM8A 4MJID 1TTFA 1UXSA 1A9EB 5I6XB 2EE6A 3WL9B 5HD8D 5DI8A 4QRRA 3MRCA 5I8KL 1AP2B 1DEDA 5KSBF 4JPWL 5CCKH 2AS5M 1I7RA 4E41B 4PJDA 2PR4H 3AFLA 4OGYL 5LQBH 3SDAD 1NBYB 3U7WH 2MHAA 5ILTH 5IBUB 1P53A 5EA0L 5HYEA 1N5YH 3IB4A 1F3JA 5DRNB 3W2DL 2FJFA 4Q0XL 3WSQH 1S7VA 1KIRB 2JJVA 1NSNL 3FZUC 1T80A 1BHGA 4QRPB 3HR6A 4NQSA 5E5MB 4N0YH 2ICWB 1S9YB 4K94C 4HV8A 3WS6C 1S7SB 4E5XB 7FABH 3QUXB 2G2RB 4PR5A 1NDMB 3QRFM 1DEEB 1XZ0B 3QWRA 3UJTL 1U6AH 4JZOA 5B39A 4KTEL 4DAGL 5ICZB 1BLNA 2Q1EA 4MNQE 1U8MA 1O0VA 1J86A 4WUKH 3M8OL 4WV1A 1B4JH 4KGJA 3SQBA 1CE1H 2NX5D 4ZFOL 1WFNA 3STLA 3HI1B 5HGDA 3T3MF 3BP7B 3LH2H 4F15C 1TLKA 1X6LA 2BVYA 3VDCA 4JZNA 2AK4B 2JELH 1T2QH 1LK3L 3KYMB 2DM4A 1QEWA 3WD5L 2NY4C 1NQBA 1DBKH 4YUEL 4ODUB 1QFWI 4IRSA 1SMOA 5IVXA 2EXWD 1RJLB 4BZYA 1U0QA 3RVWD 2QSVA 1D5MB 4HWBL 3RI5K 1HSBA 4GXUN 3BD4A 3HI6H 1J11A 3QFJD 3ZE0E 3L3GA 3QCVL 1UM6H 5HHXL 3HE7C 3QUML 1EGJL 4U1SA 3MFFA 3DHJA 2P42B 2NY0B 5D1XD 4LARL 1FQ9C 5F9WC 3RGVD 4C56D 3MGTB 2IALA 5E6YA 5JA8B 3I3EA 4WO4D 5JIKA 2R1XA 1R5VA 2Y5EA 4R7NA 3DYOA 1EMTH 2X5PA 4P48A 3P2TA 1HDMB 4UUJA 3W39B 1G6RB 1PKQE 5SX5K 3RWJA 4CU6A 4EI6B 3QG6B 1TTGA 1DQJB 1HQRA 3RWIA 4Y5YA 2C3HA 2X89A 3QEUB 1OW0C 1UGNA 1EO8L 1CBVL 2ZUTA 1JTPA 4Y4FC 3MNZB 3V5HB 3UZQA 5FGSA 1XGRA 3SY0A 1ZA6A 5TDOA 1HHIA 4XPTH 5T3XL 4OT1H 4C54A 3GB7B 5ACZA 3SE4C 4GLRI 2DWEB 4LVOB 3FFCD 4GKOA 1QQDB 2BNRE 4YHIB 1FGVL 4C59B 3UTOA 3ZDXF 4QRQB 2W60B 2IQ9H 3SJVD 5ACLA 3VW3H 2X1XR 4EQ2A 3PWNA 1PDKA 4G6AC 5ADPH 3VWKA 4DCQA 2WWKO 2PN5A 5C09B 3C60B 3C6LC 5TF1H 4ODHL 4OCNC 4U1SB 2APTA 1ERNA 2IBGA 1I85C 5FF6A 4P59L 1T1ZA 1NAKL 3P30L 4LVNB 3ROOB 1ZHKB 3EFFB 1HILB 3ZL4L 3KPPA 5D6CA 4F3FA 3RWEB 3A6OA 1EJOH 5C0BD 2W9DH 3CVHA 4KPHL 3BIKB 2EXYC 2ERJB 5FM5O 3OKYA 2OTPA 2V5MA 3RWDA 3U9UB 1A7RL 1IEBA 4Z95H 3UJIL 5HYQA 4MCYB 5E1HB 2J3SA 5F6HJ 4P4RB 4WJ5B 1HHJA 1HH9B 1G7IB 2EDOA 3EO1B 3P4NA 5F89A 3P3YA 4LCIL 4TTDC 5E94B 2BVTA 2ADGB 2EZ0D 2IEPA 3K8LA 4TSBH 3S36L 2AXGA 5CGMA 2HKHH 2PTTB 4XMLH 3BT2H 2OSLA 1B90A 5DS8A 3BVNA 3NFSL 3NFPA 1FN4A 3INUL 4GH7B 5JIIA 4H0GA 3CCHA 3S7GA 1UA6L 4PG9A 3AREA 5HI5C 2NY1B 3OHXB 1QBMH 1TVHA 1HWGB 4TPRH 2FB4L 5F6HI 5E5MA 4BSVB 2YD6A 2V9TA 1P84K 4PJ8B 1BAFL 3C5ZD 5I8CB 5J1TC 1PYWA 3CD4A 1U8LA 4NQUA 3CGTA 4YXKH 1M7DA 2VN4A 1I1AD 4HBQA 3RDTC 3TIDB 4MX7B 4UIKL 4GSDH 2F8VA 2UY6A 3KPPB 1NGPL 3E6HA 5FV1L 2DLHA 3V7AE 3IJYA 5D9SA 4WEBH 4KUZH 3K2UL 1R24A 1F42A 2VC2L 1JV5A 3SCMB 2Y5TB 3GMQB 3MROB 4JAMB 4XP1L 2CGRH 4RSVA 5CLTA 4D94A 1DE4A 3PGDB 3I50H 5DMIL 1YMMB 3HG1D 5C0DB 4ISVA 2ILLA 2FSEA 4PJAA 3R8QA 4IRZL 1WIOA 4WJ5A 3DROB 1IAKB 1T2XA 3QO0A 2XQBL 1KCSH 4KI5D 3L95B 2GTWA 5EB9A 2JK5B 5IG7A 5B38G 3G6JB 4EI5A 3O4LB 5ICYA 1IKFL 5KOVC 2ZKHH 2FIRT 1UB5A 4MQ7A 2O5XL 3LIZH 2EEAA 1VADA 4QHNA 5EDXA 3TBSA 4NKQB 2GW5A 4G43B 5FKAB 4RFOL 2VAAA 4X7EC 2A0LD 5DJAB 3W0WB 1RUAL 4YGVA 1E4WL 2DI7A 1FGVH 2AJ3B 3VFNA 1U9KA 4YBHA 1CR9L 3EOBB 1F11B 4I5BB 1MPAL 1HWHB 3ARBD 4LKXA 1EHAA 1OGAE 2WLZA 1ZT1A 2HVKA 3PV6B 4KZDH 3GDBA 4PBVC 4A2LA 2Z35B 4XXDA 2FHBA 4JFXB 3UYOD 1HN1A 4L4VD 5GS0H 2YS4A 3KXFD 3P9LB 4JFFA 3MRQA 2B1HL 4YJZL 4L8DA 4N5UA 1AKJB 1F5WA 5BS0A 2WZPD 4JDTH 2HJKA 5CMAA 1ZLVK 1EFXB 3QUYB 5MEPA 1A22B 2CKBA 3MO1A 4X7DC 5BS0B 3WD5H 3S4SB 2YPLB 4HUKB 2A73A 3GMPB 3D0VB 1ZHKA 4M3JA 2HT4C 3GUTB 1WEJL 3VFSA 5K59E 1PVHA 4LHJB 3L7EB 1MFDL 4JZJC 2X40A 3UZVB 1S3KH 3DRTB 4W70A 5EORL 4GAYB 1VCAA 2DQIH 3QI9D 3HFML 1ZVSA 4HUVA 1YEIH 2QEJA 3N0PB 4XB7A 2YXMA 2NXYB 4OCRH 2ZOLB 4HKZA 3FONB 3PNWA 2BSED 4ORZC 4ZS7L 4I18C 5JOPD 1CGYA 2XNAA 2OZ4A 3U7AA 1T7ZA 1G0YR 1IGJB 2D3VA 4R26L 2ZUQB 3HCVB 4P3DB 3G5YB 3RU8L 5J9PB 5HYJE 1OSPH 4PIRF 5D93C 5GHWH 1T0PB 3CFCH 2XWBA 1MCIA 5C7XH 5T3ZE 3EO0B 2IGFL 4OM1H 3DMMD 3KWWA 4HFWB 5GS2D 4JDVB 1AC6A 3C6LD 4IIQB 4DKAA 4EN3B 5KVFH 4M61B 2Z93A 1U91A 2IAMD 2X4NA 4NHCL 5DD1H 1CL7H 1CI5A 4LVOC 5DJCA 2R0ZH 2Z92B 4MAUH 2EO9A 3M45A 5HYSG 4D0CB 3LOWA 4P2CG 4LRNH 3D85D 3PWPB 1NC4B 2P8MB 4OQTL 1FZMA 2X9XA 4ZSOB 1BFOA 4XCNB 5GSVA 1TVBA 2YD2A 4JFEA 3NA9H 3P9LA 4PRDA 4WTXA 1Q94B 2H3NB 5FXCH 4E41A 1KBGH 1NGZB 3QIWA 1AGFB 3TJEL 1G7JB 2XYCA 4P2RE 5JORA 4R4ND 5TGBB 4AQ1B 4LCUA 4UMGA 1WT5A 1JGEB 3HMXL 2P5EE 3TGXA 3OB8A 4K7PH 3MPCA 1CFSA 4Z7WA 1RJLA 4JHAL 3ZKNC 3GSUA 4ZAKB 3TZVA 1S9WB 5ENWA 4PTTB 3T0WA 5M7QA 3DO7B 3S96B 1UT9A 4OJFH 3ZHKA 1KXTB 2AQ1A 4GQ9L 3MLUL 2LABA 3OX8B 4IMKC 2YD7A 1G9MH 1NDGA 3KYNB 3ARDD 5LAXB 4GFTB 4NZRH 4LFHD 4XH2B 5KZCB 2A38A 2NLJA 5CKGA 2V9RA 3HE6D 3ZT6A 3HAEG 5TDNA 1EH9A 5KS9A 1FNLA 3FQNA 2XIDA 4QHUB 4MJ2A 1RZKC 1QKZL 2BOCB 4UBDD 2DQCH 2YK1H 4NC1C 1MWAA 4MNGE 1M7IB 1OGTA 1VGKA 3EW3B 4HBCH 4QRPA 3JV0A 2C1PA 1WC7A 3BE1H 4JJ5B 5ANMA 3GSWB 4D0DA 1MHHB 1KGCD 4QT5A 1DQLL 1VFMA 5HY9B 1DBBH 4NCDA 3WJLC 2W07A 5HYJB 2J5LB 1CFNA 3IFPB 4EOWH 5L88H 2H6PA 2FX9H 1P4BH 4KK9D 1MY7A 4XP6L 3KLSA 1BAFH 4PREB 5E99H 1HKFA 1R6VA 2OCFD 4WTZG 1I8KA 1G7LA 1CZ8H 1KB9J 4HX1A 5FGCB 2B4CC 4CBPA 3KVQA 4OGZA 3S97C 4YK4B 2UYLB 3FRUB 4QRTA 1T1XA 2FJGA 5E99L 3MBXH 4P2QA 3O3BB 5BXFB 3FRUA 3FJTA 1OAXL 3L3DA 4QRTB 5F8QC 4WI8A 5DVOA 4K3HA 5FUOL 4OZIB 4HS6B 5C0BB 5T33L 4HW6A 5C0ND 2DL2A 3V8OA 2IPUG 2HTKD 4YDVA 2JJUA 2HJLB 2WV3A 3SPVA 4KMLB 1VEMA 3ARFB 4Y4HB 2HTLD 3NPSC 5DUBB 1HI6A 3P11H 3ULSB 5T1LA 3EHBD 3QUZD 2ZJSH 4LIQL 2VDPH 4ZUSA 3KLDA 4Q2ZB 2FYYA 4YEFA 2IALB 3BXNB 2X4TA 1CLYL 3F7YA 1N4XL 3M1BB 4PJ5A 2B5IC 1TIUA 2UWEE 3AY4A 4Q7DA 3SDXB 4JZJA 5DJ6A 3BISA 4NM8H 2SEBB 2GJ6A 2VUYA 4H8WH 1MCSA 3LS4L 1JI2A 3RBGA 4WUUB 2ZJSL 4PRPD 4KK9C 4H25B 3ZDZE 2D0GA 1BJ1J 1X5KA 2YN5A 3U4BH 2LU4A 4WI6A 2FYYB 2Z31A 2IJ0C 1FCCA 3GSXA 5C2BH 1CVRA 3SJVE 1D9KB 2PXYC 2Y36H 5DHVA 1AFVL 3O8XD 4L8DB 4LOUC 5EO0A 5AZEL 2YKLH 5HHOA 3HB3C 3JZ7A 5F88B 4H20L 3WUWB 4KK8D 2APWA 4ODUA 1CD9B 2X1PA 2X05A 3KYMA 3UJTH 1ACYH 4OCXH 5I0ZA 1JZ3A 5DGRA 5DUPH 4NQVA 2H2PD 3I75A 4K2UH 3QUKA 3L7FB 3KHQA 5T1MA 4M1DH 3SCMD 3WKMH 1KOAA 4XWOC 1NMCC 2D7NA 1UC6A 2FJGB 4RAUA 1LHZA 3ZL4H 3MV7D 1RK0A 2VR4A 3PP3K 3T09A 1QA9B 5E8OA 3OKNB 3RWIB 4ZTPL 1AI1H 2FO4A 2OJZL 3VFMA 4YIQA 4IOFC 4XCCH 4PR5B 4FQQB 4OZFA 2DD8H 5INDB 4OLUL 3TBSB 3FO2B 4PJIF 1VEPA 2IANB 3RY5A 4MZ2A 1TQBB 5KSBA 2OQJB 3SDAB 3MV8D 5F7DB 3T4YB 4R7NB 3SO3B 2Z0BA 2UZIH 1CQYA 3BKMH 3CZJA 2BOBA 5JHDB 4QT5B 1MCWW 2IC2A 3GSNA 4J12A 2C1PB 4MJ4A 5FYJD 1MCPL 5IM7B 3RUGE 4K23L 5D2LB 4EBQH 4AG4L 4N8CL 5LGHH 3RVUC 4LARH 1C8PA 4NN5B 1JWMB 2A9NH 3KPRD 5DTFA 1JHLL 2IGFH 3GRWA 4DKDC 2CO6B 4XX1E 2BSSB 3HUJA 2WBJB 3QFJE 1TITA 1KELL 4X5WB 4F9PC 1D5MA 5D5MB 2XFXA 5D7IF 1MCHA 4TQEH 3OR7A 1MCEA 3LEYH 5TDPB 1LP9E 3CVIL 1U2CA 2FD6L 5DK3A 1H3UA 5EO9A 5IJKC 5I73B 4J1UA 5TE7L 2VITB 1NCDL 3L5JA 3VXNB 3G5YA 4RMWA 1DL7H 4NKMA 1HYSC 2J88L 3RTQD 2XXMB 3D2UD 4P5TC 4YNYA 3DSNA 5CCKL 3CFBA 4M62H 5C0FA 5KVGL 2F5AH 5F1IB 1ONQA 2OMBA 5JW3L 1OTTD 4R4BB 5EC2B 1U93B 4K8RC 3QXDB 4LSQL 3CVHH 1LD9A 5D1XC 4FFWD 1I3GL 4WCYH 1Q0XH 5J1AA 4V1DB 2WM0A 1QRNA 4H8WL 5DEGB 4AH2B 3DRQB 2ESVB 4WTZA 5E00A 1H3PH 1F4YL 3SDXA 2FECI 7FABL 2LE9A 4IRJD 1NCBL 4GQ9H 2NY2B 5FYLL 3O3AB 3ME0A 4K9EL 4EN3D 3IVKB 3O0RH 4TULL 1AQDA 4QXTA 2ESVA 1RZJH 1ULVA 1LQSR 3MQIA 3W5MA 3GRWL 3W11D 1INEL 4NC0B 1A9EA 4UV7H 3KXFB 4KPHH 3KPSE 4APQC 3OKLA 3O9WA 2A1WL 5JZ7D 3E2HB 1RFDH 1HSAB 1E4KA 4Y7MA 1BD2E 4Y1AA 5CUSH 4RQQA 2NW3B 4PG2A 2KH2B 4ETQB 3LDBB 3LKSB 5JQHC 3G9VA 2HG5A 2WP3T 4MD5B 1TJHL 3NCYS 2W92A 4GJTB 4ORGA 4Z5RB 3M17B 4JRXE 2AGJH 2HG5B 4MD5A 3VFRA 4M7LL 2IPTL 4MSWA 2OL3H 3G6JA 1S7TB 5T5FL 5BO1L 1KC5L 3U36B 3BHBA 3WLWC 3MRNA 4KJYA 4KI1A 4R2GD 3UTTA 4PJEB 2V2TB 1PGRB 4X6DB 3PL6B 3NIFE 4NNYB 3UYRH 3O3EB 1NLBL 4P2RD 4YHKL 1E28B 4PRIE 4XNXH 4NKOA 3ARTA 1CF8L 4QYOA 1BFSA 2NZ9C 1M05B 3B43A 1QACA 5IGXL 2I26N 3DIFB 4XCYB 3TO4D 3BGFC 5AYUL 4Z7UE 3O41B 1MSPA 3QIUC 5JLZB 4RFNC 5D2LF 3DMMB 3U2SB 1A21A 3MRMA 2HWZH 1JK8B 4NHUA 4NC1E 4D9RE 1RMFL 2WNGA 4G5ZL 4KRLB 1D6VH 2EE9A 3FO9A 1YC7A 5JHLH 1NMAL 5I17B 2VLRD 1HSBB 2R29H 1E4XI 1NCAL 2VLRB 2V5YA 4ONGH 1F2XK 4R9HA 1I75A 2CLZA 5GJSL 1UWXK 3VFNB 2BNUA 4NIKB 4P4KB 1U92A 4U1GB 1EERB 3WXVH 4QGYA 5EBLA 2J8UE 1S8DA 2I9LA 2VDKL 1ZHLB 1CGXA 4IEFB 3L5XH 4KKAD 4LMQI 5TGBA 2FWOB 4KHXH 3U0TB 4X8JA 3VU2A 3VMNA 5D2NE 4PJBF 4X0KB 1T04A 2ITCA 3MLVH 3PDOB 5EU6B 4HIIB 5ICXA 3OBAA 4YBLC 4K94H 1FL6B 1ITBB 4N0UB 2XG4A 5GZND 4ZG1A 3PWPA 1YYMH 4NDMB 4OAWB 1NCCL 3OR6A 5AZ2H 2R0LL 1P7HL 3EFFA 2PTUA 2IPKB 1INQA 5F70A 4JAMA 4HCRH 4XWGH 3BD5A 4H0IA 3G6AB 4NP4H 2FJHA 5C07A 1HZHH 4XVUC 5ESVB 5I1JH 4D3CL 2ZWLT 4ZNCD 4JO3H 5IOPB 3MNVB 4JRYE 3VE0B 2XTJE 3LQMA 1IGCH 2CQVA 3W5NA 1TCRA 3FAXA 4JDZB 2JB5H 1EGJH 2YUVA 2NY3B 4L4VE 3OHXA 3H3PH 4V1DD 2VE6B 3D3VD 1LEKA 4LSSL 2D31A 5DVKA 4JN1L 3C2AL 1DVFC 2W38A 5C1MB 3BVNB 4M7ZB 1DQDH 5EFIB 1DN0A 4Y5YC 5DJZB 4JCLA 4MA8L 1LE9B 4MAYB 3VXQA 2AEQH 3HZVA 2ZUVA 4NQDA 4RX4D 2ZSVB 1NCUA 3O9WB 4YXKL 1QLFB 2F58H 2GY7B 3EO1A 3P4NB 3BRGC 2DLEA 5KS9E 4ODBD 1LMKA 5IK3A 1YEJH 4MA8H 1JNLH 1I4FA 3UTQB 2GFBB 4LF3B 3LRSB 1ZKAA 4HSQA 4N0FB 2EDEA 5BRZB 3VGEA 3X14A 5C7XL 5I1IH 4OGAD 35C8H 4OM1L 3M17A 5F6IB 1MLBA 4R7DA 1KXVC 3GMRB 3ULUD 5I71C 1MHEB 4FQXC 1KN4L 2X4SB 1JGVH 1EFXD 4XNUH 3H9SE 3ZHDA 1K4CB 1U8OB 4X6CE 4Z7UA 4GBXC 5I15H 3GJFH 1YQ2A 2EECA 4XXDB 4YO0B 4NM8L 3WJJC 3BRDA 5DLML 2W9LA 1QUNA 3MBEA 4TUOA 4XPFL 4X6EB 5FA3A 2AQ3A 2ICEA 1E6OL 3QDMA 2NXYD 1A14L 3WLWD 5MEOA 1XGTB 4JFOA 3FB5A 5GJSH 5BQ7B 2PR4L 4YBQC 4WVRA 3G5VB 3NIFF 3D39E 2DM3A 4LVHB 1YPZF 3O3AA 1Q0YL 1RJZB 5DVLA 3ULUL 4JPIB 1T66D 2HAZA 3LPWA 1H8OA 5DRWB 4JZNB 1ZLSH 3CLEL