5JQHC

Structure of beta2 adrenoceptor bound to carazolol and inactive-state stabilizing nanobody, nb60
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
120
structure length
120
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGSIFSLNDMGWYRQAPGKLRELVAAITSGGSTKYADSVKGRFTISRDNAKNTVYLQMNSLKAEDTAVYYCNAKVAGTFSIYDYWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endolysin,Beta-2 adrenergic receptor
publication title Allosteric nanobodies reveal the dynamic range and diverse mechanisms of G-protein-coupled receptor activation.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Signaling protein, hydrolase/inhibitor
total genus 23
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jqhC00
12E8H 4PJDF 4X8JB 1H5BC 4J3VA 4UB0H 2OI9B 3V4PL 5JQ6L 4PY7A 1Q72L 2OI9C 3E1F1 1R5IB 3B6SB 1HIML 3H42H 3VRLE 3WCYA 4XX1G 1ZGLM 3INUL 2AXGB 3BXNB 2VDOH 4KPHL 1YEFH 5D71L 3TA3A 4IM8A 1UQSA 4CJ1A 1TETL 5DMKA 4OZ4A 3MJ9H 1UM5L 4NFDA 5H2BB 5FO8B 1Q9WA 3OJDB 2LV4A 4LGPB 1DSFH 3QJFB 1HYRC 2R1YB 1IT9H 3E8UH 2YD3A 1F58L 1KTKE 2Y5TA 4PV9B 4N9GA 3RVWD 1TDQA 3KDMB 1CD8A 2EKJA 2F5BL 1GC1C 1ED3A 3BQUA 2P5EE 2YZ8A 3F8UB 3ALWA 1A6VL 1IEAB 3RWGB 3B8YA 1TITA 3MRRA 4GQPH 5EOCL 5KN5B 5IGXH 1NBZA 4JFOA 4MAYA 1HXYB 5EWIL 3V79C 1N3NA 1ONQB 1IAKA 1EEQA 5HGDA 3JWDH 1QSFA 3CLFL 5HGGS 4OGXH 1PD6A 3LD8B 4PGBB 3TLRA 4ZAKB 4ZAKC 3EYVA 4NOFA 5EUKA 3GMLB 3HAEH 4P2OA 5DEFA 5MEPA 3CFBA 5I8EA 2ZKHH 3LSOB 4OIIH 1T1YA 3BDXA 4NOBA 5I16A 4HT1L 4FTVD 1T20A 1H8SA 3RBGA 5ISZD 1KPVA 1BEYL 3EGSA 1U8IB 5I15L 3O45B 4RAUB 4FQQB 1YNLH 1OAKH 5IHUL 2DYPA 3UROR 2AABL 3UTZB 4LP4A 3KJ6L 3QB7C 1U8HB 2EO1A 3U4EA 1N64L 4N5UA 5DRWA 1MHPL 2D0HA 1Z3GL 3ECBA 2KUTA 3RTQB 1CN4A 4WWKB 3RTQC 4FMFA 4JN2B 2B39A 1X44A 4WWKC 5K93A 1LP9A 1CLCA 2XKSA 1F4XH 4PJAB 4EZMA 1MREL 5IEKB 1F90H 4XH2A 3KLAA 5D1ZD 2XTJD 3UTSD 3O9WA 5GRUH 4PRHA 3MO1B 3LV3B 2HFFB 2CUIA 4YHIA 4C83B 5SX5H 5DMIL 5FUOL 1OTTD 2B0SL 3L7FB 4N8VB 5EZOL 2P7TA 5IK3B 1P84J 2BRRL 3G6JF 1LO5B 3EO9L 3VFMB 3BUYA 3ZZ1A 5KSBF 1HYSC 2D2OA 4XP1H 3OG4B 1R3JA 3UJJL 3IDYB 4TVSa 4JRYB 4DKEH 3WIFA 3IDYC 4Y1AA 3LB6D 5DJYB 1MHCA 2VOTA 1PG7H 1JHTA 3O0RH 4YUEL 1BFTA 5CLTA 1AXSA 1QSFE 1J0KA 2JCCA 4M62L 4NJAL 4U1GB 1HCFX 2BVOB 4LLVA 4U1GC 3J7HA 5BVJB 3LZFH 1FFRA 5J6HB 4HGKC 4GSDH 3QDMA 3ZE2F 3MR9A 5E99L 1S9YA 3BMVA 1B6DA 4Z7QF 4S0TD 3MXVH 4RGNB 3TJHC 1I1YA 4RGNC 1DCLA 4MS8D 3KPSA 3SGKA 3CFDB 4U1NB 2XZQH 4X98B 5H35B 1OHQA 3MGTA 1QKZL 4XPGH 3QO0A 4DFHA 2UZYB 3GMPA 4X9GA 3ARQA 4EI5A 4X7TB 1UWEL 2YMXL 3R1GL 5F88B 4CMMB 5L2KA 3ZKNC 1MHEA 1KC5L 5ICXA 4QF1A 3ARDB 5LBSL 3ARDC 2BK8A 3ULVL 1LP9E 2XQYK 2NW3A 2P43B 5CHNA 4RMRA 4JZOA 1D5MB 1XGQA 3MUY1 1OT2A 4MNHA 1RZ7H 2AQ2A 2YPLB 2OS7A 3W9EA 4XGZA 2ZOLA 3D9AH 4I0CC 2CLRB 4JDTL 4PRHE 1SQ2N 2Q3AA 1C12B 3QNYB 1FQ9C 2VQUA 3GGWB 2OTWA 2D3VA 2YD8A 1EZVY 4GG6F 2FSEB 4IRSC 4U1KB 4JPVL 3SKOA 3JVGC 5E1AA 3VDBA 4Y1AE 4YDJB 4PJFF 1BBDH 2EIZB 4XP5H 4RCAA 3PWNA 4LVEA 4ODWA 1ZV5A 4K8RL 2D9CA 3F5WB 1MFAH 1KEML 4ZXBD 1RIVL 1I1AA 1S5HB 2JCCE 4GQ9H 4TN9A 1DUZA 4XWGH 1YJDC 2GJJA 3PP3H 3QO1A 35C8H 5ID1B 4ZNEA 4M7KL 1F02I 3QDME 5MEQB 3VXPA 4H20H 2YN3A 2X44D 5GJTL 4LL9A 1P4LA 5IF0B 4EQ2A 3AGVA 4M5ZH 4M1DH 5D7JD 2X2YA 4XCYA 3BKJH 3KPSE 4Z7VB 4OQTL 1JWSA 3KPMA 3OKMA 5FKPB 5D1XB 3MLVH 1PEZA 3KYAA 5D1XC 4CRPA 5LGKA 3BP7B 1CDIA 3MLZH 5MI0B 3N9GH 5MI0C 5L2KE 4HIXH 4BSVA 2YRZA 3RY5A 3C6LA 3LN9A 2DQHL 5I1GH 2P49B 2X5PA 5JW3H 4NRYB 2EDOA 3BD4A 5E2TH 3MRQA 5TQ2H 3RWCB 4LSRL 1A14L 3GK8H 4FZEL 4PJ7B 2FBOJ 1IILE 5KVDH 2W9EH 1RMFH 3NZHH 4OCYH 3SE9L 4P3DB 4TQEL 1F4HA 4IRZH 4B7IA 3TFKC 5JMRA 3F58L 2AJSH 3O2VH 4WW2B 5C0FB 3RHWF 4WW2C 4DVRH 4HIEB 5EORH 5CZKA 4FQJL 3VFSB 5ICYA 1ZA6B 4P3WA 1GIGH 4GW5B 3WLWC 4DGVL 3REWB 1FVDA 4YX2H 3B9AA 4BH7A 4XZUA 3IDNB 1YEHH 4L4TB 3MOAH 4HV8A 1RSFA 3SOBL 5F7DB 4Z7NE 1T2QL 3VGDA 1DTUA 1AKJA 3H9ZA 4O58L 8FABA 4OUOA 1PBYA 3JV4A 1MIML 4JFDB 1DBAL 2EIDA 4DFIA 4LLWA 2YK1H 3G5XA 3FOMA 4MQXC 1G84A 5CGYD 2F19H 4ZNEE 2J6EA 3GSRB 2O5ZH 2C3WA 1B2WL 2FYYB 2Y4SA 5T5NG 3HR6A 4PJ9B 2OL3A 4PJ9C 5GZNC 1Q72H 1J1PH 1G9NL 3C8DA 1RVFL 1ERNA 2FO4A 5FYKH 4LPCA 3OKNB 3ZKMD 4KTEL 2LQRA 3C5ZD 1BVKA 2CGRL 1GVIA 4NO2A 4N0UB 4W6YB 1E6OH 1I3GH 1F4WL 3KVQA 2QJDA 3T3ME 2XICA 1MIEL 2L4OA 2X4NA 4AIZA 3QH3B 2HT3C 2XZCL 1GRWA 3EOAB 2DS4A 2ICES 4G6FB 3QUMB 1MFCL 3CLEL 2HLAA 1SJVA 1BGXL 2F53A 3FCTB 2J88H 3GRWA 4HXBL 4KHTH 4O2CA 4WO4A 1U3HB 1A1MA 3QWRA 1NDGB 4NC0B 4PJDA 3OKDB 4R97B 1U3HC 3LEYL 4R97C 3IXTB 4YBHA 1A6VH 1QR1A 2AKRB 3N1FC 4LFHD 3WEXB 2VLME 3V8OA 4JM2B 5EOCH 4NWUL 3BP5B 2WM0A 4QHMA 3TGXA 3NA9L 1ZT7A 1SJEA 2AJ3B 2B4CH 3L9RB 1LHZA 4MD4B 5BJTA 2JELL 3TV3H 3S36L 2EXWD 3WN5A 1WZLA 2VNCA 3ILQC 2BY0A 2Y07L 3RWFB 4YBLC 5D2LB 1G7PA 3GJEA 3FB6A 5C3LD 5K9KB 3RDTA 2C3HA 3RNQA 4PRPB 1BEYH 3E6HB 1PQZA 3MRLA 3O11B 1IAOB 1NC4B 5IHUH 1H8NA 2IFFH 2IAND 1NPUA 1JHLL 4FMKA 4KGLA 4U1LB 2LFGA 3KJ6H 3GBNL 3SN6N 3DI3B 1N64H 5IMLB 3LKOA 4Q58C 3D69B 5IB3B 5JO5A 3OB0H 4PY8I 3BQUB 5FO9B 4NFCA 2E7LA 4JFYB 1W0VB 2XV6B 1IGYB 1QRND 4Q9RH 1S78D 4MAYB 2EYTA 1N3NB 1V3KA 3WS3A 1A6PA 1H0DB 4LU5L 1QFWL 4Z7OE 4J3SA 2W65B 1BIIA 1CFTA 2JJTC 1AR1D 1G6RL 1HILA 1KLUA 5AD0B 4GMSL 3K80A 2VDQH 5FUOH 3TF7C 1I8LA 4P2OB 4F7CA 5DEFB 5EZOH 2WWMC 4F9PA 1J05B 2F53E 3FKUS 1MJ7L 4FG6D 4NQSB 3SHSA 1EO8L 4PJDE 3U7YL 5B22A 1AQKH 5B38G 4K2UL 5L8LB 3EGSB 3QCTH 4WEMB 1I9EA 2DYPB 3IFLL 4JB9H 2ICWJ 3T09A 1OAUL 1PKQA 4HQQL 1JN6B 5BV7B 3DVGA 2FGZA 5BV7C 1CR9H 3UXFA 2R2HB 4Y7MA 5HI4D 4M9OA 3VGAB 4ODBD 2I9TB 3TBYA 3VD3A 2OZ4L 3VGAC 4D9LH 3QYCA 3G6JA 4KJWD 2V9RA 1FCCA 3LKQA 3BW9A 5KSBA 4XH2B 2H1PL 3CUPA 5LJYH 4LVHC 4ZPTB 4IMKC 2BC4A 3O9WB 1QKZH 1AD0B 4Q9QH 4JKPL 3QIUA 3P0YL 4ETQA 5TDOA 4WHTA 4OJFL 4WGWB 4NKDA 3HKFA 1NCDH 1S7VA 2YMXH 4M8VA 1XR9A 4G9DA 1BVZA 1SY6L 4U7MA 1KC5H 3UDWA 2XN9D 1SYSA 5LBSH 4CU8A 1R3JB 3ULVH 2BVUA 3WIHH 3BWUC 3WIFB 1CE1L 1H8OA 3M8OH 2FHCA 4G6KH 4ZS7L 1JV5A 3HI5L 2EDRA 2NY7H 2W1NA 1EFXD 1AXSB 5DTFB 4I0KA 5HPMA 4QXGL 5E6IB 4HAFA 3QXTA 1XIWA 5E6IC 4N1HB 5E2UL 3HI6L 5F1OB 1P4IH 3GMMB 1CQKA 3CZFA 5GRVL 1FORL 3QDMB 1NCBL 5CZVL 1A6ZA 1UKTA 3V4VL 1S9YB 1ZEAL 3HB3D 1KXVC 4QHLA 1FP5A 5EO0A 2I27N 4OZFA 2WBJC 7CGTA 4M6NH 2HFEA 1I1YB 1NLDH 4FQHA 5EBWA 4NQDA 5LAXA 3V52L 1KIRB 3VFUB 3FB5B 4XBPB 5HVFB 3KLHD 2XTLA 1WV7T 4FFYL 5IB1A 3ES6A 5MEOA 4L5FL 4YAQB 4MMXC 3S35X 2DD8H 4LOUC 2BNRD 4K8RH 3FT3A 1PKQE 5L6YL 1KPUA 4LLQB 5J4MA 3DGCR 5D6DA 3QQ4B 1MHEB 1RHHA 1SVZA 3JTTB 5JDSB 5FHBH 4QF1B 1KENL 2OSLA 5T33L 5EO9A 3K74B 1VEOA 3WLBA 3G6JE 5CHNB 3UBXA 1AE6H 5KSBE 4GG6A 4GXUM 5CUSH 1YEJH 3UJIL 5T3ZL 4ZS6C 1S7UA 2YA2A 4PJFA 3UTOA 2WP3O 3W9EB 4XGZB 4YWGL 3Q6FB 3MODL 4N5ED 3I6GA 4IHOB 4JFXB 1V7MH 3U83A 2FJGA 4GMTL 1OCWL 1WTGT 5DI8A 5E2VH 5E8PB 3WUWB 5D6CA 1OP3H 4RGOL 3TCLB 1QSVA 3WO4B 3L95A 3QUKA 3AXLB 4J4PA 5DS8B 1INEH 1A7NH 3RU8L 3ZE2E 5GHWL 1UWGL 4CNIA 4Z7QE 1T21B 4W4NA 5E94A 2B2XL 4ODWB 2Z92A 1NBYB 1DZBA 3HE7A 3V4UL 2BOBB 2XQYG 3NZ8A 4PJ5A 1I1AB 1BX2B 2ZCHL 4WDIB 1I1AC 2VO5A 1IQDA 2C3VA 2L0DA 1R5VA 3L5WB 3V7MA 2HA1A 3BEVA 1NFDF 3QO1B 3VCLA 2DM2A 1U8KA 4X5XB 4GAGL 1DQQB 3VXPB 2EECA 1P4LB 3MUGB 4F57L 3LIZL 2NY6B 4D9QE 4PRAB 2NY6C 4P9HC 3MV9B 4NQDE 4XCYB 4G7VH 5JXED 4JRXB 3QPXL 4NQCA 5IB2B 4I0PD 3OKMB 2D0FA 1JL8A 5BS0B 1E6JH 4CVWA 4O58H 5BO1L 4ODUB 1MCWW 4HK3N 3W0WA 1CTOA 5HVGB 1AP2A 1MIMH 5HHVH 3PQYD 4HLZH 1FGVH 2F58L 4NIKB 3C6LB 5ANMB 4PGJA 1HSBA 2FECL 1A0QH 3QIBB 4XMPH 4DGYH 3QIBC 1B2WH 3UTTD 2VC2H 5K9QI 5CBAB 2DWDB 3BT2H 5T1MA 5IBLD 3X11A 5CJXC 5LWYL 5SWSD 4GG6E 1CS6A 1K6QL 2X1PA 1RVFH 1PZ5B 1EK3A 3KPLA 4P5TB 4PJFE 1FNGA 3QEUB 4P5TC 1DANU 2WQ8A 5KS9F 4PTUA 3DURB 1XCQB 2WINA 4FOMA 4OLEA 2VDPL 1NAMB 2CKBB 5LQBH 4YR6B 1HXMB 1FC2D 4MJIA 5FM8A 4HS3A 4BH7B 4XZUB 4YC2B 1TXKA 4OCSL 5DR5L 5FA3A 1MFCH 2K9UA 3CLEH 4X6DF 4PJXB 4HKJB 1OAZH 1JNNL 2BERA 1T7WA 4XPAH 5I1CL 5C92A 4YHPA 2YD4A 1ULVA 3JV4B 3VXQB 2YUWA 4PJ5E 3G5XB 1P5UA 3FFDB 4NWUH 4KKLC 1KB5H 4XAWH 4QXWA 1IAII 1RZKH 5F21B 1ADQH 1YMHB 1QSED 4JZNB 3LVEA 2ED9A 1UZ8A 1LNUA 1X3DA 3HG1B 1S7XB 1A9EB 2Y07H 4M7LL 5FCUL 4BQCA 3ULUF 4NQCE 1KJ3H 2FO4B 3KGRA 1F6LL 4PP2A 4XCFL 3CVHA 5J1SC 3STLB 3FQWA 3W0WE 4JCLA 4X7FC 4C56A 3HZYA 3HNTL 3P30L 2DQFA 4GKZA 2H6PA 2X4NB 2DQJL 4URTB 1EUTA 4Y5VA 5F7KC 2R69L 4UV7L 2R23B 3JXAA 3IS1X 4PJDB 3U0PA 3BSZH 4LLMB 4M4PA 3S3SA 2ZCKL 4NM4L 2H2SD 5INCA 4HCRA 5D2NA 3VGHA 3KPRD 2IMNA 2AEIT 1YMMD 1BQSA 1QPPA 2ZWLT 4AEFA 4K7FB 4AEIH 4TVPL 4JHWL 3LHPH 2CLVB 3PGCA 5BJTB 1MLCA 3U36A 3I02B 3RNKA 3N1GC 2BNUB 4MJIE 1IGIL 4ONFL 3RP1A 1N2RA 4ZOAA 4XPBH 1EV2E 1MJ7H 4P5KA 1VFOA 3P9WB 1G7PB 3GJEB 3U7YH 3PL6A 3FQUB 3RDTB 1WEJH 3RNQB 1AHWA 4ZQKB 1IZKA 4GUPA 5JA8B 4O02L 3F6IA 1UEMA 3WS6C 1OAUH 5KANG 3ZT6A 4O9HL 2ZG3A 4HQQH 5I8KL 1JGVL 5DJXA 4NO0A 2WAHA 2WNGA 3LKOB 2JK5A 5SV4A 3NACL 4MJ6B 5I1EL 3CH1B 4EI6A 4X6BA 2Y1VA 3KHQA 2NXYB 3DXAA 1G1YA 2NXYC 4HF5L 1IARB 3RRQA 3QDJB 5BXFA 4H0GA 4OLWH 2EYTB 3DLQR 3DUUA 2R39A 4ZTPH 1ZHLB 4XPTL 1SEQL 3QDGD 4C56E 5BZDB 1IM9D 4JKPH 4JFFD 1E27B 3GKWH 4PP1D 4P9MH 4OJFH 4E5XA 1A21A 3TYGL 2OK0H 3IDMB 1FV1B 3MTRA 2AI0L 3GHEL 2P4AB 4UIMB 1SY6H 3KXFA 3LQAC 2COQA 4PG9B 5A2LH 3IKCA 4LHUG 1KJVB 4OCXH 5A1AA 1OM3L 2HVKA 1F3DH 3MREB 2KKQA 3HI5H 1QEWA 3MLUL 4QRSB 3S6CA 2R2CA 2CD0A 5D2NE 1QLFA 2IF7A 1T7XA 4CDGC 3ARPA 4QXGH 3HI1A 1KSRA 4PUBH 4DGIH 2XFXB 4F58H 1H3WM 4NZTL 3RA7L 2W0FA 1CICA 3DHMA 5CZVH 3TBYB 3CX5J 3G6JB 4FQLL 3EOTL 3HZKA 4RQQA 5DRZB 3U30B 5HYQB 5KSBB 2FZ3A 4PB0L 2P8PA 3KG5A 3CUPB 4BFBD 2W9DH 1K3IA 4KRPB 3PWPB 4PRIB 1I7RA 4QOKA 4XI5D 3ILPA 2BC4B 4L5FH 5JR1L 3BHBB 3QIUB 5GSVA 2WUCL 3NFSL 3QIUC 1GGCL 2AJXH 5E9DD 5TDOB 1VENA 3EAKA 4NKDB 3ARFC 1S7VB 4ZG1A 2PTTA 3DX6A 4G9DB 1MFDH 2H8PB 4XNYL 4XBEH 1SYSB 3CJJA 3J8F7 1BFSA 1ITCA 1AR2A 2H3NA 4LASL 2VLJD 3DXAE 4GBXA 2DQIL 2HJLA 4TNVF 2DWEA 4TULL 2VXSL 1IC7L 4FNLL 1DUYB 3C5SB 5DJCB 3UJIH 5T3ZH 2X40A 3AM8C 4LDLB 5I1JL 5HHOA 3ARGA 4FXGB 4OGYH 4HMEA 3SE3C 4GLRI 1FLRH 4GG8A 1TQCB 3L1OH 3RI5F 1FGNH 1TQCC 2EH8L 5LCVL 4QHLB 1KGCE 1EH9A 4GKOA 3KWWA 3KXFE 5I8OL 5FYJE 2KQMA 4NQDB 4Z0XB 4MZ3A 4YHML 4JY6B 2BNQB 3SE4C 4IOFC 4XTRC 3SGJC 3Q5YA 3DVIA 4QRQB 2VLLB 5IB1B 3ES6B 5MEOB 3CFEA 4Y0GA 3QAZB 3QAZC 2DQEH 1ORQA 1ZHKB 1AI1L 3V4UH 1HSAA 3EO1B 5C0JA 1WJ3A 2IQAB 4J3UA 5IFJB 2DMBA 2E27L 4OM0L 1ZHBB 5I66B 2AQ1A 2OSLB 1L0QA 1EBPA 5EO9B 5I73B 5ECJE 5I73C 3G5ZB 1F4YL 4Y89A 3S37X 5IJVB 3EFDL 2R4RL 3PWVA 3MV8D 4UV4H 3T77A 3MACL 1YEDB 4AM0A 1A1OB 5AYUL 5L8JB 1P7KB 1MCWM 1S7UB 4QOKE 3L5XH 3BP6A 4LHUD 2IH3B 2IFGA 1RZ8B 1SM3L 4RX4A 4Z76B 5BO1H 5JIIA 1F8TL 3K8LA 4G8GA 2VJXA 2P46B 4JG1L 5DI8B 1C7TA 1KCSL 5D6CB 3O6FD 1PW3A 1P2CB 1NFDA 3LCYA 1UADC 1Z9SA 1KG0A 1U41A 3FMGL 4FQ2H 3IAPA 4XHQA 4HFWA 5E94B 1K6QH 3RKPA 1FNSL 4U6HB 2X7LA 3WDJA 1YN6A 4EBQL 3NZ8B 5HHOE 1VESA 4HS6B 2C3VB 3DGGB 1R5VB 3W11C 1FZOA 3OAYK 3RL2A 3QI9A 3QUYB 4JGMA 3QUYC 5J89A 2E6PA 4IDJL 4P4KB 5T1DH 5I9QC 4OCSH 4P4KC 4NQCB 3HPJA 3QHTC 3MRCB 1MHHB 3TIDA 2F54A 1AP2B 2NY0C 1MVUB 1HI6A 1XGTB 2WV3A 3BZ4B 3PWLB 4JY5H 4RWYH 3JTSB 4M48L 5KS9A 5C09D 4GRWB 3S4SG 4HMDA 1RD6A 1A6UL 5FDWB 4UOW0 3R4DA 4S1QH 2LTQB 2VLRD 4M7JL 3X11B 3H9SD 3I84A 1UCBH 2DLFH 4X6DA 1MFBL 1T1ZB 3KPLB 4NJ9L 4N90E 1FNGB 2FX8L 3JUYA 2WMPA 1JF1B 1MEXL 1K4DA 1SBBA 5T5FH 1UH2A 5IW6A 3NCYS 3TJEH 4G8GE 3A6CH 3I2CL 5HVHB 4WRLA 4RBPK 5HVHC 3P30H 1MCOL 2X1QA 2VIRA 4RGMB 1NFDE 1I85A 4KK9D 2IGFL 4MJIB 4QKXB 4RGMC 4HS3B 2EC8A 2CO6B 5HYJD 1DP0A 4BZ1L 1G7MA 5EOCJ 3IU3B 4Z7WB 1DBKH 4M6MH 3FQRA 3LPWA 1T83A 3VH8G 3BPCA 3TPUB 1B0GB 2HFGL 2EZ0D 2Q7NA 1S9KC 1I9JH 4XVJH 2DJSA 3CFIC 3QXAB 3UPRA 4C58B 1IKNC 3BGAA 5FUZH 5JW5A 1YJDH 1P9MA 5ILTH 2FDBP 2YC1A 3W9DB 5I18L 4AQ1B 3I50H 3L3KB 4DKFL 3ZTNL 3GI9L 1G7JA 3UTQB 4F37K 4PP2B 1FVEB 3IDXH 1HHGA 2F54E 3FQWB 3MJ8A 3NIDF 4HHAB 1JRHH 2PXYB 4C56B 2PXYC 4Y4KA 1GZPA 3HZYB 5EU6D 5IBUB 2DQFB 1JTPA 4EQ3A 4OLZH 1AFVL 1T22B 2MHAB 3DROB 1BQLH 5KS9E 3P4LA 3O3DA 4NBYB 2FL5A 4Y5VB 5I74B 3LKPA 2XRAH 5I8KH 3IAGC 5F89A 2DQCH 5I74C 2BSRB 3O6ML 3T04D 1U91A 5DK2A 1MAMH 1A3LL 3O6LH 5J9PB 5DA0B 3U0PB 1TVHA 4JO2L 1A7QH 5AG8A 4XXDA 1YY8B 5DJAA 4HKZB 4HF5H 1YY9D 4X6DE 5FGSA 4FFVD 1CDUA 1WGOA 1MCPL 2JJVA 1W0YT 3LS5H 4Z6AT 2X10A 1L6XA 1SEQH 3X17A 5HDBF 1FNEA 1Y0LA 3L5IA 3NABL 1MLCB 1IQWH 4R90L 2YPVH 1CGTA 1JUFA 4NCC1 4OGAD 5HI3D 1T89C 2V5RA 2UZXB 1AGBA 4X6FA 3TO2B 3PL6B 2N56A 5FOBB 3PL6C 3S35L 3SGDH 1KTLA 3VFNA 1OM3H 1KJ2L 3ULUE 4GUPB 5A2JH 4BA8A 2A77H 1NEZB 3TH3T 3V7AG 3GMQB 5I1AA 2G2RA 4NP4L 3MJ7A 4OLVL 4M6OL 3EUUA 4EJ1C 1Z9MA 4HBCL 1PX3A 2X1OA 3AVEA 2R29L 3DVNA 3U9UA 1RUAH 2WP3T 3FN0L 4X6BB 4XB7A 1A3RL 2NY3D 2BOCB 2Z4QA 4BSWA 1UVQA 4AT6A 5SWZD 2Z35A 1AY1L 3EOTH 1MQKL 2BY3A 4LRIC 5IROC 4PJ8D 4RIRA 3GSNB 3DUUB 2X09A 1T80A 5DMGC 2UY6A 2X4UA 3FB8B 1GGCH 3HAEG 3VFRB 4M61B 3WHE1 4NYLA 4HSQA 1CXIA 4HUWA 1J9CT 1V3MA 2WLYA 3QQ9D 2APFA 2CLZA 3MSPA 1EERB 3GI8H 1MWAL 3S34L 1OD9A 2YD7A 3LMJL 5HHNA 3VFWA 5IOPB 2FEDD 4LASH 4HZLA 3MZGB 3RZCB 1RUPH 3MFFA 3RZCC 4K3EH 1R3HA 5C0AD 3L6FB 2AK4A 4FNLH 1WBXA 1R5WB 4MXVF 2OXGA 4V1DD 3R8BB 3WIIL 1QLFB 5ELIA 5TF1L 4DUXA 3HI1B 1T7YA 3ZKQD 5HHQA 1C5BL 3SPVB 1MCDA 1KCUL 2J6EL 1JF6A 3EFFA 3O3BA 3FQNA 1NMCB 4A6YL 3PHOA 4HJ0D 1ZTXL 2OL3L 3PV6A 3EYFB 2FZ3B 4LSQH 4YHMH 5DZLA 4M00A 1D9KA 2P8PB 3BDYL 5DQ9A 1INDH 3VG0L 1QLRA 4FTVA 1FL5A 1AI1H 3O2DA 4ODSL 3AY4A 1NGYA 1XAUA 2PYED 4OM0H 4NKMB 2HJKA 2P5WB 1LE5B 4JLRB 1X5AA 5DJ8B 4GBXB 3MV7B 1F4YH 2DWEB 2R4RH 5J06A 3A6BH 4NKIL 2AXFA 5AYUH 4L8CA 2WQRA 1L9NA 2F5AL 3MCKA 2AJVL 2GKIA 2C3GA 5F3HA 1ZLWK 1J8HD 4QRTA 5KOMC 4GG8B 2H41A 2PYFB 4F15B 5IB5B 1LQSR 4ACPA 4JG1H 4F15C 3I9GH 2FATH 5D7SH 1G9MC 5DD0L 2APVA 3EYQD 5JHLL 1QQDB 1H3UA 3LPFA 5DLML 3SJVD 3EDDA 1XFPA 1QHPA 1YPZF 1C5CH 1JTOA 4MHHI 3VXTA 2VKXA 4KJQC 3CFEB 4QRRA 2AK4E 4TVPD 3P73A 3P9LA 4Y4HD 1KIQA 3X3FH 5BRZB 1LEKB 4EBQH 3KPTA 4QTIL 1AXIB 1BD2D 3OKEB 2EDLA 1KELH 3L3OA 1E4KC 4PR5A 3GNMH 4KJYA 3REVA 5BV7H 3AU1B 4U0QB 3VXUD 4DVBA 5I76A 3H3PH 2Q86A 3ARYA 3PDOA 3VWJB 5DT1H 1X5XA 2VXQL 1EMTH 4LARL 3VWJC 5JOPD 4AM0B 1IC5L 5CZXC 1NAKL 1S9VA 4M9PA 4HPOL 4JG0L 5L2JB 1CVSC 4JQIH 1FSKB 2FX7H 1FSKC 3CDCA 4FTVE 4KRNA 3G9VA 1T1XB 3BGMB 4D3CL 3SCMA 2BHYA 5AWNH 1VADB 4QXTA 4L4VD 4M48H 4TNWK 1QHOA 1A1NA 1NFDB 5C86A 4LCCA 3C08L 4OKDA 4R4BA 2VZVA 2XXMB 1JP5A 5LGJB 2EDDA 5EOTB 1AGEB 1T3FA 4XCEA 1RJZA 5C0GB 4DAGL 3NIGF 5CJQH 2W38A 4ZFFB 3VXRA 5DJ2A 4YPGA 2EDEA 4OT1L 1J10A 1L7IL 1YN6B 1FPTH 4NJ9H 3D0LA 4R3SA 3N06B 1C1EH 3QFDA 1MEXH 1JPFB 5JOFA 1F3JA 3RL2B 3QI9B 3BZFA 4CU6A 2XTJE 1R3IH 2V9QA 1MCOH 3LKRA 2ENYA 5D7LD 5IT2L 1U58A 1N59A 1TVBA 2PW1A 5JIKA 5IFHL 2IGFH 1KLGA 2GTWB 1O7VA 1MRCL 3DETD 3U4AA 2Y36L 4YE4H 3U4BH 1RZJC 4QRRE 1UGNA 1IRAY 5HYIA 5CD3A 2FIKA 4D0CA 2GCYA 1JI1A 4W4OC 3P9MA 1UB5A 2EDJA 1VFBB 5KS9B 1I3RA 2P5ED 2BVEA 4XX1E 1Q9LA 3MRBA 4Q2ZB 3O8XC 1H9VA 4UOJA 4CAGA 1WVZA 4F7PB 4JREB 5JLZA 3UX9B 5GS0D 5I18H 4JREC 2DQTL 4NWTL 3C2AH 4XVUD 4EDXA 4LSVH 3FO1A 4GJTB 3W2DL 3ZTJG 1OW0A 3D85D 2MQCA 4X6DB 1AGCA 4KKCD 4IEFB 3T4YA 1AGDA 1G7QA 1P7QB 4YFEA 4F33A 1WFNA 4M1CD 3N1PC 3CFKA 5IW6B 3GUTB 3IFOA 4MXWH 1JGDB 2EXYD 1KYOJ 2FX9L 4W6XB 3TVMB 3HCVA 2VIRB 1CK0L 3TVMC 2QKIA 2R9HC 4HPYH 4QTHA 4FQCH 3EJZD 2DLGA 4WY7H 4F2MA 5KJRL 1WUNT 1A3LH 4WEBL 1JPGB 4ZO7A 3VXRE 3SKJL 1MVFA 4R7NA 1QFHA 1ZHNA 3FQRB 2H26B 4N8CL 1MCEA 3A67H 4P3CL 1L7TH 4M1GH 3GSWB 4L3CA 4BUGA 1RZIA 3SDCB 4KXZH 3MRHB 4KI5E 5TQ0L 4PGEB 3SDCC 1SMAA 4XAKE 3UPRB 3ZDXF 4JN1L 2XWJA 2YC1B 4X4YB 5C0CB 3WFDL 1KTRL 4X6CF 3VXMD 3LKNA 5CSBA 5BQ7A 3TA3D 2VSDA 3D1MC 5TGBA 1DE4B 3UPAA 3CZJA 3H3KA 4M3JA 5HHXL 1CXKA 3GMRB 3B9EA 1UACL 3S35H 4OCRL 2GJ6D 5HTSA 4EN3A 3MJ8B 4JCMA 2FJHA 4Y4KB 2XWBA 3OAZH 4Y4KC 4Z7UB 5D70L 3HNSL 5KZCB 4H8WC 5KG9B 1D5ZA 3TZVB 1Z2KA 4M6OH 5SX4H 4TRPL 5DK2B 3LRHA 4X80H 3TZVC 3MROA 1N5AB 3BDBA 3FN0H 1WICA 5FKAB 2D7QA 4CUCA 5DJAB 4K9EL 1AY1H 5MP6H 2XNAB 1MQKH 1QSFD 4MD5A 3T2PA 5F9DC 3VGGA 4LAQL 1SMOA 2J4WH 5DO2C 3K8MA 1L9MA 5CSZB 3R06B 2GFBA 1FNEB 5CGMA 2ZG2A 5DGRA 4ALAL 4RFNB 4RFNC 3BUTA 3HUJB 2CKBH 1LE9B 4MD0A 4Y2DA 1EFQA 4APQA 1VGKA 3HLAB 5GRJL 1F3DJ 4JO3L 1BLNB 1KTLB 2Y06L 4J8RA 3VD7A 2P24B 1U95B 5GGVY 1TJHL 1FE8L 1CWVA 1NH6A 1WCBA 2ICWB 2HTKD 4OFPA 3EOBA 2H9GA 3WIIH 3NIDE 3DX8B 1RURL 5E5MA 2VN4A 2R0ZH 1JIBA 4G8FA 3U9UB 3BX7C 4QRPB 3E3QE 4U0RB 1KTDB 4U0RC 2LE9A 4G6ML 1CZ8L 4RRPG 4AT6B 3HRZA 4OBSA 1EXUA 5CEZH 2OL3H 4EXPX 1R24A 4X6EB 4PRHD 1H3VA 1O5DT 2ID5A 4HWZA 5KBNC 3ARRA 1QG3A 1FN4B 3EZJB 5CJOH 4D8PB 2I24N 3RIAF 1TZIA 2E6JA 1U8JA 4H1LB 1LDPH 1UJTA 2CLZB 1JPTH 4G9FA 4ODSH 5HDBE 4RFEB 2IANA 3WNLA 3OV6A 2CIKB 3DRQB 1WSST 2GK2A 5HHNB 1KCVL 4RNRB 3DI2B 4GRLA 3VFWB 2E9JA 5EBGA 5D96B 1FAIL 1MCCA 3C09C 3QJHA 5L9DH 3GRWH 5D96C 2FR4A 3RVWC 4XPFL 1JK8A 2H2PC 5IMMB 3IDJB 2Y25A 3VRJB 1ZT4B 3VXNA 1UH3A 3BMWA 1GC1L 2F5AH 4MNGB 2AJVH 5ADPL 4JPKH 2F8OA 1YC7A 3QRGH 3QPQD 3BESR 2DDQH 4R2GD 1RIUL 4WV1A 1QFUL 4KDTA 3O3BB 5I1KH 1IVLA 3KPSD 1MRFH 4J1UA 3CDGA 5EB9A 4OF6A 2D0GA 1VGEH 3UO1H 4S1DD 3G6AB 5DLMH 4X4XA 2CXGA 2CDGB 5DQDH 1NBVL 2XG5A 1DDHA 1XF3A 1JCKA 1FO0A 4YGVA 1QLRB 2XA3A 4EI5D 4L9DA 4FTVB 1FL5B 4MVBD 1VFMA 3VDAA 1IAIM 3CVHL 4TUOB 3VG9B 4R7DA 5ISZB 5HDQH 1JZ5A 2FNBA 3VG9C 4QTIH 3QHFH 3F7VB 4UU9A 1F11A 1W0WA 3MRNA 1J87A 5GS3A 2C1PB 2HT2C 5CEXB 3OGOE 4OLYH 1ZSDA 4ZD3H 3EYUL 3OB8A 2VUOA 2VXQH 1RUQL 1OAYL 4FN0A 2QQNH 3LN5B 1IC5H 1M71B 4L8CB 3QUXD 1YPZA 2BSSA 4NQXA 4TPRL 1A4KA 2ADIB 4UDUB 3FO9B 1Q8MA 3B5TA 1CXEA 4QRTB 1XZ0A 1U8OB 2V2TA 2YZ1A 1J11A 4MXVE 3DYMA 5D1ZB 4JFHE 2E5EA 4NSKA 5D1ZC 3UTSB 4DUVA 4G9FE 5DHXB 2IANE 5DVLA 2DL9A 2OP4L 3DPBA 3BKCL 2YHGA 5TE4L 1OTTC 3LQAH 2I60H 2MCG1 1MSPA 4AMKL 4DAGH 1J18A 5ENWA 2XN9A 3QHZL 4LQFL 3TO4D 4M3KB 1FHGA 1EEUA 3T0EA 1L7IH 1PYWA 1QOKA 4WUUB 2V5MA 3VXOB 2YA0A 4RISL 2F15A 1OP5H 3BAEH 1DANT 3H9HA 4PR5B 5FUCE 1M1SA 1EFXA 3EHBD 4KJYB 2WK2A 5J6GA 2X4TB 5A40E 1O7SA 4UZGA 2Z8SA 3FT2A 3HMWH 3NCJH 3RGVA 3ROOA 3K1KC 3RWEA 1T1WA 4DW2L 1YYML 3D5OF 1GGIH 2JE8A 5F9AC 2PW2A 3V0VA 4O00A 3RWHB 5IB4A 2H32A 5EZJB 1IM3B 1FG2B 2UZIL 4WVRA 3TPKA 2DJUA 1LO4H 4DN4L 4UQ3A 2A83B 1JMXA 3N1QC 3L3DB 1CL7H 4LCCB 3RBSA 4PLKD 4MCYA 4PB9L 4DK3A 3SDDA 4PJGF 4R4BB 2ADJA 1WQVT 4FXLA 1QO3A 4KRLB 1CDJA 2VLMD 3LPGA 4XCEB 5FYJL 3FOLA 1NLBL 2EEDA 1W8NA 1XCTB 1X4XA 4NWTH 3W2DH 5C2BH 2ZUYA 1JWMA 1YPZE 1HHKA 5A2KH 5HI5C 1XGUB 1I4FA 1KB9J 3NPZB 3OKKB 4R3SB 2GI7A 2XKNA 1K9TA 2X42A 3S8WA 1J5OL 3BZFB 3WFBH 4Y5YA 1NMBL 5BVPH 5B38A 3BEWB 1B4JH 3KNBA 1D5XB 4FFWD 1N59B 2PW1B 5EU4B 3O6KH 1AQDA 1KLGB 3HZMA 3IT8D 1AKJD 5IR1A 4JFZL 1UXSB 5KJRH 2R4SL 2FH8A 4NZRL 3VRIA 1JWUB 1UXWB 3KR3H 5FA4A 3EYOA 2IC2A 5I1HH 3SKJH 2XN9E 5IHZB 3MOBH 3T0EE 3VGFA 1J8KA 2O5XL 4D0CB 3U79A 4OIAA 4P3CH 3IU4L 4U1MA 3N85L 5I6XB 5F1SA 1SJXA 2XA8L 1I3RB 5TQ0H 5I6XC 4YHYB 1Q9LB 5DFVC 3MRBB 5GIRA 4ZXBB 2XWTA 4MQ7B 4ZXBC 5A3ID 1UJ3A 4KUCD 3BI9X 1QACA 1OT1A 4EDXB 3FO1B 3UJTL 1NFIA 2P8LA 1BBJA 1U8LA 3T4YB 5LKNA 5FCSH 3EDKA 3NIGE 4NC2B 2Y9RT 5D7JB 3CIQA 3QWOB 1CT8A 4RFOL 5D7JC 1CFQA 3RWJB 3RVTC 1N6QL 1IAIL 1ND0A 4I0PA 1NCWL 4UDTA 4GS7B 3IFOB 4U3CA 4NGHH 5CINH 1RZFH 3DUSA 4PBVC 4GS7C 2X4RB 1KT2B 4WO4D 3HNSH 3QWRD 3LRSA 4KK8D 3PQYA 2V6HA 5D5MF 3L3GA 5JQHC 3MA7B 4X6CA 1FZJA 4JQVA 4R7NB 4X9FA 2C7UB 1KCKA 1OY3B 1F42A 2AEQH 3GJFK 4OZIF 2ZJSH 4I18A 4OFDA 2RJMA 1RZIB 1NANI 3LEXA 2DQDH 4PLNC 3ZYIA 5JHDA 2OXHA 3SDAD 4QHUA 2E7CA 5IFAL 4CL7A 2ENSA 4ALAH 5E70A 1VEMA 1NDMA 5EU5A 2R2BA 1MLBA 3ESUF 4WI6A 3GO1H 2VDRL 1J1XL 1P1ZA 3C60D 3FN9A 3MLTA 2CK0H 1NGPL 3V9FA 4G43B 1BZQK 1PLGH 3Q0HA 3QUZB 4HUKB 4JO3H 3QUZC 1CLYL 4R26L 4RZCB 1TJHH 2D7TH 1QSZA 5ERWB 5BZWB 1KLFA 1HKLL 1E28A 4J3WA 1XF4A 3MROB 1CD0A 3LQZA 4GRWH 3RAJH 3S37H 3K4DA 1GOHA 2CR3A 3DRTB 4NO5A 4HIHB 4G3YH 5E4EB 1MCKA 1CZ8H 5CGYC 5CWSA 5E4EC 1QSEA 2N4IA 4RMQA 5D1QB 5D1QC 2J8OA 3AFLA 3BWAA 4N0CD 4OCLC 2Q6WB 5FDYA 1UFUA 2JTDA 4BZ2L 1TZGL 1I7UB 5DHVA 4UNVA 4O51A 3O41B 2ZSWA 3C5ZB 3ZDXE 3C5ZC 3PQYE 1JPSH 1YYLL 1IEBA 4MD0B 4U33A 3OTTA 2OCFD 4X6CE 3GSVB 3TT3L 3EO0A 3T2NH 4QT5A 1G7HB 3Q6GH 3ZKSD 3BPOB 5KSAD 4JKLA 3TYFA 5FF6B 1WCBB 4WFHE 3EOBB 3T0VA 1IKFL 1T0PB 4NPYA 4GRMB 4NNYA 5ADPH 5JHDE 2IADB 4JVPA 4P23A 3F7YB 4JJHA 4D2NA 2CUHA 1X4YA 2HMID 2YPKA 3MA9H 5C0IB 4QNPF 1RIUH 4G8FB 1Y6MR 1QFUH 5AUMB 3K1DA 1OWWA 3HRZB 4WW1A 3QIWA 2DRUA 3JV6A 4TSBL 2VDML 2MQ3A 3WXWL 4UI2A 3TT1L 4MB5A 4S1SH 3V6OA 4HWZB 4OZHF 3L3JA 5KVGH 5HGAB 2X70B 4P59L 5ICZB 3AAZA 5JPMB 1CBVL 1INQA 1TZIB 2EH7H 1U8JB 4PV8A 2IANB 4YXKH 5HHPA 2DAVA 3UP1A 4WU7B 2DL2A 3QJHB 4AEEA 3VWKA 1QSEE 3SDYL 3EYUH 4ERSL 1BFOB 1OAYH 1WTLA 4QY8B 4HX1A 3G6DH 1EVTC 1XIWD 1M05B 5LGHL 3NFPA 3MX0A 3ULUL 1QRNB 1Y18B 3K4ZA 5HJ3B 4HCRH 1E0OB 1S78C 4HS8H 4WV1B 4D9QD 5IBTL 4WV1C 1CFVL 4PJHB 2I9LA 1IM9A 4J1UB 3CDGB 3OR6B 4FQ1L 4I9WE 5E7BA 1FH5L 5DUPH 1AR1C 1HINL 2OP4H 5DD5H 5D93B 4U1SA 5F8QC 3KPPB 3S3JA 4YGVB 2AS5M 2YWYA 1CDCA 4FG6C 4LQFH 5D72H 5J3HC 2DBJA 2UYLA 1L0XA 1JHKL 4GAYA 1D5BA 3NFNB 1K3ZA 1TCRA 4UU9B 3MRNB 1ZMYA 2HWZL 4KKNA 3V5DA 3HZVA 5GGSY 1NGXB 4UUJB 5TPWH 2X4PA 4P4RA 3F62A 2SEBA 5HI4C 2NR6D 1A22B 4WHYG 3V6OE 2BCKB 3MLSL 1PEWA 5HHMD 2IPKA 3WKML 2V2TB 3GSXA 3KYNA 4J4PD 5F1IB 5E6ZA 2IWGA 4PRBA 4DN4H 4F8TA 2OQJB 4PB9H 5SWQA 3S7GA 3X12A 4AZ8A 1VERA 3GSQB 2VXTL 1XF5B 1ZLUH 3HE7D 4JVUA 4CN4A 5C0DA 4TSAL 5FYJH 2ZUVA 2VLJA 5JZ7D 4K7PL 1CD1B 2CSPA 2C4XA 3H9HB 1EFXB 2GSIB 5J6GB 4JZJB 4JZJC 3FT2B 4KZDL 3VI3E 2EKSA 4JR9H 4D0DA 4MDIB 4XC1H 5B39B 4PJGA 4GT7A 3QEHA 3RWEB 1T1WB 1OSZB 3WNMA 4WI4A 4NZRH 1LK2B 3HB3C 4Q6IA 2B20A 3OSKA 3V0VB 5IB4B 2H32B 4V2BA 1CCZA 3MRJB 4YDIH 1EEYB 3RVUD 3DMMA 4IIQA 3IU4H 1SYVA 4UQ3B 2BNRB 3OKOB 3ZYZA 3QXVA 5E8EB 1QO3B 3HE6A 1J1OH 1FZMA 1JGUL 4PJCB 3QDAA 1DBML 1C08A 4JHAL 3LH2L 5F3BB 1NJ9B 1A6WH 3TBVB 4Y5XC 2QQKL 5KW9L 1URLA 2J8UF 3QISA 3O3AB 4BYHA 1WT5A 1P6FA 2ORBL 1K5NA 3MV8A 4N0FA 4UT6H 2UUDK 2XKNB 4RFOH 3BYYA 2GJZB 1N6QH 1B9ZA 1NEUA 5ID0B 4LHUA 5EO1B 2OTPA 1CF8L 4N5EC 3QEGL 1ZLSL 1G9MH 1AQDB 3K2UL 2DKSA 3HZMB 3QXWA 4R8WH 2VAAB 2PTUA 5IR1B 2YBRB 3OAUH 1K2DA 5JNYB 2Z91A 1PSKL 3O6FA 1S7TB 4JAMA 3AREA 5I75B 3O81A 3MNZB 3E0GA 5T3XL 5I75C 2APXA 2VLJE 4Y4FA 4XNXH 4M6AA 4KQ3L 4U1MB 1TCMA 4I48B 2BZDA 5IG7A 1G6RA 4KY1L 3O2DL 3T4AA 5TFSL 2XWTB 4KQ4H 3I3EA 1UJ3B 3DV6B 4CDHA 5DC9B 2WIIA 3FQXA 1NGZA 4ZAKD 2AV7B 5ADOL 5MHSE 4PJGE 5D5MA 3LEVH 4YDVA 3RPKA 1BM3L 1J1XH 1BBJB 5K9QG 1H3PL 2F8XC 3CVIL 1TJIL 5FECA 3PG2A 3B2UC 2AJYH 2NZIA 3THML 5F1NB 5DRNB 2NY1B 1A4JB 2NY1C 4OZIA 1ND0B 4F7MA 3T2OA 2UWEB 4I0PB 5JXEC 1V8HA 4UDTB 4PGDB 3VFTA 4I0PC 1NUFA 1TNMA 4HIIB 1MJJA 1EJOH 3UZQA 3BGFB 4NBZB 3LRSB 3BGFC 4S1RL 4LNRA 3PQYB 4PRNB 3OAZK 3IB4A 2UY7A 4H5SA 1S7RA 5C09A 4X6CB 1FZJB 3U0TB 4UILH 3P4MA 2EYRA 1OF2A 3BE1H 3ZL4H 5BW7C 3UTTB 1YNTA 1WFOA 2VLRA 4YHKL 4I18B 1A7OL 2Z8VC 3MV8E 5DEGA 5IBLC 5SWSB 3IVKA 3UC0L 3LEXB 3AS1A 2CIIA 1BJ1H 4QHUB 4JKWA 4V2CB 4JY4A 2XZZA 2A74A 2MWCA 1NDMB 3CSYA 4P57B 4L8SB 1MLBB 2JJUA 3HHRB 4L8SC 4R4FL 1R0AH 4KTYA 1U8MA 3T8XA 1F6AB 3ULSB 1KIPB 2A2QT 4AH2A 1ZANL 4JRYD 4MSWA 5A16A 5F9JA 1RZJH 4L8BB 3VFGH 4NO0D 3DX9B 1CE6B 5KVFL 5I1DA 2ADGA 5C07A 3STZA 1JGEB 1E28B 1K85A 5IMKA 1XF4B 3V6FA 3DXAD 4XWOD 3LQZB 3WUZA 5GSRA 4JFQA 1EGJH 5D5ME 5T1KB 1AJ7L 1OD7A 5EZIL 5KSUA 2VDMH 1BFVL 4OCMC 3MLWH 4LEOA 5GISH 3L3HB 3X3GL 1YEEL 1W72L 3TIEB 3QQ3B 4OZIE 1HH6A 3L3IA 4F7EA 4P2QB 3KXFD 5DYOA 2B1AL 3U7AA 3B43A 5EU6A 3CSPA 1IEBB 3H9YA 2I25N 3ET9F 3ULVC 5C09E 3C9NA 3MFGB 3D3VB 3Q48A 1X6NA 4K23L 4QT5B 4ZOBA 1DR9A 2VLRE 1OAXL 1D7FA 1OGTA 5LGHH 3ULUH 3OKYA 4BZYA 1CICD 2HVJA 5ETUA 4XT1C 2YPKB 4OZHA 4DKAA 1UM6L 1T4KA 4LSUL 3BPNB 3KPRB 5IBTH 3BPNC 1YMMB 4HUMB 2BVYA 4WW1B 3MBXL 3LN4A 4QOKD 3O2WL 1HINH 1FFNB 1T04B 4IRSD 4L1HA 5AEAA 3VJ6B 4CW1B 2BY1A 4HGWA 3B9VA 3IJYB 4HJJH 1AD9A 1BQUA 4K8RC 4UT7H 1XT5A 5I2IA 2D03H 3L3JB 5C07E 5HDOA 2EDBA 4LLDA 4FXKA 4HUXB 2NW2A 4AG4L 1N7ML 2ICEA 4NT6A 1LO0L 5IJKA 5DD3L 1ITBB 3KPQA 4H8WH 2J7LA 4F9LA 1FDLL 1MF2H 5EC1A 2DQGL 1LK3H 5IQ9A 1ETZA 4EIZC 1N5YL 1D5IL 2W07A 5JUEL 5HHOD 2VABA 3ARGD 4HX1B 3SDXB 2QLVB 1I8KA 4FP8L 4E0RA 2ERJB 4K7PY 5KOVC 4D0BA 4X7EC 4OD1H 4NKQB 2IAMB 2IAMC 1DQML 4IS6B 3QDGB 1YDPA 5EU6E 4JFFB 1U36A 4OM1H 2AW2A 43CAA 5HGHA 4QNPE 4UAOB 1OGAB 4UAOC 3KYOA 1KBGH 1DN0B 2VXTH 3CU1A 4U1SB 4TSAH 1E4JA 3WFEH 5CD5D 3TC9A 1LO2L 3ZMRA 2Y72A 4ZDHA 2WW8A 1P4BH 4ZUTA 2BVPB 2EDNA 4U1HA 5C0AA 4DEPB 3IJSA 4GAYB 1TCRB 4DEPC 4OZHE 1M7IB 3VDCA 5EUOF 3P77B 2QSCL 1FFPB 1IFHL 2NYYC 2X41A 3PWUA 4G6JH 4ZODA 2X4PB 3Q1SH 1M7DB 4JDZB 1DBJL 3S36X 3MBEC 5TE7L 2SEBB 2A9NL 5GGRB 3CSBA 1QBAA 4JANA 2VN7A 2QQLH 4KVNL 4G8GD 4G8IB 4IMLB 1REIA 3PHQA 2X4SA 1C16A 3IGAB 3QFJB 1YEIL 3KYKL 2D7MA 5E9DB 2PCPA 4MQXD 3LQMA 2R0WH 1QLEH 5EC2A 4H1LH 2AJZB 5GJSL 5F8RC 1DVFA 4JHAH 3LH2H 3O4LD 2PYEA 3FB7A 2JJSC 4HG4J 3NMEA 5GZND 1G9NC 1YQVL 4NUJA 4U6VH 5KW9H 1S3KH 4LPTA 5MENB 1NQBA 5TDNB 5EPMA 4EDWL 2ORBH 3G5YB 1MI5B 2YSSA 1OLZA 1YZZA 3QEQD 1BIHA 3CK0L 2X4QB 4XMLL 4HH9B 1IBGH 2YD6A 1J8HA 4YHNA 4OUUB 1CF8H 2HT3D 1VHPA 3QEGH 1VFAA 3K2UH 4PJGB 4WI8A 2W0PA 2Q76B 5H8DA 1K8IA 5CMAB 4Q6IB 4DJMA 4Q6IC 4GKSA 5T1LA 3KPNA 2PF6A 2J8UA 2OR8A 3RGHA 1ZE3C 3D39B 3OX8B 1IC1A 1I7TB 5C0AE 4KQ3H 2VR9A 1RZKC 3IFPA 1MUJA 1CTNA 1N8ZB 4KY1H 4PLOB 5IWLC 1FZMB 1WCQA 3B3IB 4PTTB 4P0DA 4U7KA 2GAZB 2DTMH 3PJSA 2PTVA 2EYSA 4WGVB 3VXUA 1NGWA 3ZE0F 4RWHA 1BM3H 3HAEA 3OL2A 1F00I 4UQ2B 1QZ1A 5TE6L 3IDGA 3MV8B 2ZOKB 1ROWA 5D9SA 2RAMA 3G04B 4M43L 1KXQE 5HVWA 3MNWB 3HNVL 1XGRA 1M6OA 4LHUB 3EDJA 3WJJC 3L7EA 2GITB 5DWUL 4S1RH 4BK5A 2Z91B 2VE6A 3O6FB 2PYEE 4ZUVB 4JAMB 3O6FC 4PJEF 4GXVL 5GS1B 5GS1C 5DC0A 1FO0L 2VMFA 5CBEA 5FEBA 1FL3A 2E7MA 1MRDL 1JNLL 3UC0H 1NCNA 3EDFA 4LPVA 3FZUD 5JW4M 1RK0B 3D48R 1G6RB 3C6SA 3GBLA 3W82A 4OB5L 4QLRA 5B8CA 3CDFA 3WFHB 3K46A 5EOQL 2WIIB 2CR6A 3GKZA 1J8HE 2R0LL 4M8QA 3LKSA 5ITBH 4HKBA 2WWMD 4R4FH 3EYSL 5D7LA 3RWIA 1AXTL 3D25A 5FECB 1QNZL 2J8UE 1A7RL 5CGTA 1FBIH 2ZUTA 3MRMA 1Q0XL 4YDLB 4ORGA 4YDLC 5KVFH 4TVPE 1YEGL 3C8HA 1K4CA 5I1LB 3WUWG 5DHYA 4OFIA 3DV4A 2C1OB 2G60L 3U9PL 1HHJA 2ZNWA 1KFAH 4H5SB 2OJEB 3ABZA 4KHXL 4ZPVB 3P4MB 2EYRB 5E08L 4NC1C 4LDEB 3VXUE 4LMQI 4HDIA 3H9SB 3RFZC 2O5YH 1T5WA 3TBSB 1Z5LA 4JJ5A 2CIIB 4KZEL 3MRDA 3Q3GA 4JY4B 3HC3H 5C08A 2G75A 1UA6L 3CMOH 1GAFL 3T8XB 3U2SA 4ZFOA 1EA9C 3ZYOA 2XKUA 4YQXL 3TNNB 1WZKA 4HC1H 1DL7L 5HYJB 1I9IH 1YEKH 4LF3B 3IFNL 3BN9C 4KC3B 4WJ5A 1P7HL 1YUHA 1KN2H 3UTPE 1I8IA 2DB8A 3B9DA 4DTGL 3M45A 3FONA 1GZQA 3V6FB 4ODTL 2FB4L 1D6EA 1XH3A 5I30H 2DMCA 2CQVA 2EZ0C 5GSRB 4WNQB 3MLXH 1IGML 5TH2B 2Q7YA 3VFPB 1DQLL 3U6RA 3OXRB 4U1JA 4DZBB 2VQTA 2WBJD 2GHWB 1RV6X 3DX7A 5D7LE 3VXMA 2A1WH 1CGSL 2KDGA 3O2WH 1X5JA 3KLSA 3BPLB 3BPLC 4JPWL 1FFOB 4LPYA 5L7XL 4P99A 3VD5A 4YEFA 4LOUD 5I1IL 3RUGB 2PN5A 3C87A 5HD8D 2GJ6A 1N0LA 4KKAC 3WNNA 2GUOB 4HFUH 5J8OA 1D6VL 4X99B 3SGEH 5EU6B 1N7MH 2IJ0C 5E1HB 5DA4A 3ALXA 3KYMA 1A2YA 1FNHA 3IRZA 5LXGH 2AK4D 4BSJA 1Z9LA 1N5YH 1D5IH 1J7VR 4DOHE 1G0XA 1KCLA 3IF1B 2A0LD 5EFIA 1MCRA 5C2UB 4ZS6D 3MJGX 2APTA 1YY9C 4FFVC 1FLTX 1QBBA 3NCYP 2A6KB 4LSTH 3LD8C 2IMMA 5C0BA 5E56A 4KRMB 5C08E 1DQMH 1Q38A 3CFCH 2AGJL 5T3XD 1D9KD 1CGUA 1FVCB 2NPLX 3AMLA 5J0BA 3OXSA 1CLZL 2GTZB 4OGAC 1QFPA 3X14A 2YKLH 2FGWL 2MPAH 5HI3C 1OAQL 3S4SB 4OLUL 4NNXA 5F6IB 5F6IC 1CLOH 4H88L 3STBA 1NBQA 4QHNA 4TNWF 2N7BA 3MLRH 4BELD 4FXKB 5DJZA 2NW2B 1P69B 1VA9A 2GY5A 1JBJA 2J8HA 2QSCH 5HYSG 4P2CG 1DQJA 1FNAA 2IBZX 5EC1B 1MPAH 5IQ9B 4NCC2 5EIIA 3CPLA 3I6LE 4R96A 5EH1A 3D0VB 3VFOA 1KNOB 3VXME 2HTLC 3WO3B 1R3KA 4HH8A 2A9NH 2GSGA 1X7QA 3SKNA 2V7HA 5SWZB 1WF5A 1A7BA 4MAUH 3MNVB 5JORA 4U31A 5BMFL 1BQHA 5BS0D 1ZT1B 4PJ8B 2UVFA 5FV2A 4PJ8C 2GJ6E 3RX8A 2E6QA 1V05A 4XHJD 1YDPB 2IALA 2OJZL 1BECA 3KYKH 4GKNA 5EUOA 3VH8B 3DO7A 3Q2CA 3QZWB 1EEZA 4QRRD 1AGFA 3AS3A 3DYPA 3WJLC 5GJSH 2KZ1B 3MCLH 3NGBB 3QQ9C 5FYLD 3NGBC 4M4RA 4JQXC 3HS0A 1QTYT 5IESL 4ZDHB 3CXHJ 1YQVH 1P84K 1MFEH 2FEDC 5GGQL 3W39B 4K94L 4GFTB 5I0DA 4P46D 4UOW1 3NAAL 5ACZB 2EDYA 2R2EA 3WHXB 3PWUB 4GXUN 3QRFM 2NZ9D 4V1DB 3V8CA 3QG7L 5C0BE 3CK0H 5CAYB 4JPIA 1IC4H 1A6AA 1NCAL 3K3QA 3I75A 4K3DL 1A7PL 1KJMA 1J0ZA 4TUKL 1OPGL 3ZHDA 3SCMD 4EXKA 1SEBB 4HJ0C 2AJUL 3PHQB 1FJ1B 1WFUA 1C16B 1U93B 2BVQA 2A6DA 3CMGA 3IXAA 4KKLD 1HWGB 5EU7C 1MNUL 3JUZA 3QSKB 4I3RH 2CRMA 2FEEI 2V2WA 5DD1H 4U6YB 3VXRD 2IH1A 3Q5TA 3GSUB 4KMTL 1OQOA 2HRPL 5IVZB 5JOEA 1NCUA 3FFCA 3MRGA 4ZTOL 4KI5D 1DQDL 4XAKD 1BZ9B 3PXHA 4MHHG 3VD9A 2ZCLH 5EBMB 4PYHA 1S9WB 1ODAA 4G80B 3QUXA 4M43H 1KEGL 3ZT7A 3TN0D 4CBPA 4OD3H 2Q8AL 4YHNB 1WBZA 1M4KA 5EUOE 3RIAK 4MA8H 1VFAB 3B9KD 3BISA 1LEIA 5IP4A 3DBXA 4KAQH 4XBGA 1NMAL 2A38A 1RJYA 4M5YL 1I9RL 2DBLL 1ZS8A 3EYQC 4GKSB 1EAPB 4GXVH 4OF3A 4MJ5B 2J8UB 3SJVB 3MRPA 1PDKA 3WFCL 4XMKH 1IGTA 4CVZB 4KMLB 1MRDH 5CP3A 4B5EA 3IFPB 4RRPA 3TO4A 4ODHL 4Y4HB 2BMKB 3BRFA 4Y4HC 5E8DH 3WSQL 4OB5H 1XF1A 1BD2B 2FD6L 2ATKB 4CKVX 3PNWB 2R0LH 3QNXA 2IG2L 3PJSB 1NGWB 3F7PC 4DQOH 2G9HA 2LABA 5I8CA 5EU3B 3FL7A 1KJ2A 3GIVA 3IDGB 4L8DA 2R0KH 4PJEA 4QCIA 4Y16B 5HDLA 4Y16C 5D9SB 1IE5A 3OKLA 1CFSA 2D31A 1QFWM 4NM8H 4TUJB 5CS7A 4IBLT 2A9ML 4N0RA 4NUGL 3OJVC 4ELKA 3NN8A 3RY6A 4KK6D 2G60H 1T2JA 4L4VB 3WE6A 2IPTL 2YD2A 1QYGH 4AENB 4YHOL 4L3ED 5E08H 3FFCE 4NDMA 2NXYD 4MA7H 1GGBL 4ZUUA 3QDJD 2VXUL 5GZOC 1BJ1J 2B1HH 25C8L 1HQRA 4AIOA 2NY4D 4LKXA 4KZEH 4P5MA 3C6SB 5B8CB 2ZUSA 4JDVA 5B8CC 3DSFL 1OL0A 3BYTA 5BCAA 1MWAA 4HUUA 4Z0BL 2E9BA 5F7HA 5IM7A 4NKOA 5HXMA 2FJFB 1LO3L 5E2WH 4PJIF 3X13B 4EN3D 1N26A 4LRNL 3D25B 4PS4L 2P42B 3TWCL 1BOYA 7FABL 3M1BB 2O61B 3ZE0E 1DL7H 4LSPL 4NQVB 1PFCA 5DC4B 1ACYL 3D18B 3NPSB 3DETC 3PF2A 1Q9OA 2H32H 4ODXB 4YHLH 4R6UA 3NPSC 4NQEA 3FTGB 3TBWA 5I19H 2MOVA 3WXVH 1DFBH 1KPRB 4DTGH 1NC2D 2F9BT 1HHJB 2D4FA 3QNZA 1TZHA 2ESVA 5DDHB 4A6YA 3GBMH 3BIAX 2P5EB 1YECL 4JM4L 1DQLH 3RWDA 3V4PH 5JQ6H 1EVUA 3BZEA 5C0ND 1HIMH 1DBBL 1HH9A 4DOHB 2ZPKL 1MCNA 3INUH 1CGSH 4QYOA 4PJEE 2B5IB 2CK2A 4KPHH 2EDTA 5D71H 2F8VA 5IKCA 2B5IC 3B2VL 1U92B 4JJ5B 4OAWB 1TETH 3D85B 3PWPD 1UM5H 2R56L 3BKYL 3VU2A 4KKCC 3RX7A 5I1IH 4Y2DD 4M1CC 4APQD 2G75B 3ARFD 1DEEA 3V2AR 1F58H 2Z8RA 4C57C 4OFVA 2V7NA 4NN6B 4B41A 1OTUC 2F5BH 1NSNL 1LILA 4NN6C 3H7BB 5FFLA 2V17L 1QRKA 4JM2C 2VH5L 5EWIH 3FQTB 3LOWA 1HZHL 1I8IB 4FQXB 2RGSA 4FQXC 3FONB 4XVSL 4I8DA 1C5DB 3CLFH 2DLIA 5HGBB 1JPST 3SDAA 2HH0L 2Q7YB 2X6MA 3TH4T 3CH8A 4PY7B 4U1JB 4CVXA 1RULL 3DIFA 2FH6A 2NTFA 3DX7B 1N4XL 1JI2A 3VXMB 3BKML 1CLZH 2XQBL 5ESVA 3TA3B 4HT1H 4ETYA 1HNGA 3TA3C 4X4MA 1UQSB 2FGWH 1GHFL 1HOCA 5DMKB 2A6IA 4OZ4B 4JFHD 5I15H 3C60A 3BZDA 3SE8L 1Q9WB 4NQEE 4G9FD 5J1AA 1NGQL 2AABH 3IYLW 4GRLD 2Y5TB 4N9GB 3RY4A 1EIBA 3AS2A 1FG9C 1RQ5A 1MHPH 2ESVE 1T0MA 1Z3GH 1ED3B 3KYMB 4OCWL 4Y8AA 3BQUC 5F96L 5IIEA 1MJUL 2QL1A 5FYKU 3MRRB 5JW4Q 3PUCA 1NBZB 4JFOB 1MREH 5J13B 2WWKO 4MAYC 1CDBA 1IAKB 1I3VA 4Q0XL 4DCQA 5HGDB 3LS4L 3MLYL 4NZJA 1QSFB 1BAFL 1BP3B 4J3OC 1A3QA 2LVCA 4UIKL 3T65A 4NHCL 1G7IA 4Q7DA 5DMIH 3EYVB 5EUKB 2B0SH 5MEPB 4P2OC 1BOGA 2BRRH 3CFBB 5I8EB 3EO9H 1T1YB 5F1KC 5I16B 1FZKA 1MCHA 1TMCB 4X0KA 1T20B 2ITCA 1G6VK 2EIEA 3UJJH 4G8EA 1SVCP 2AAVA 1KPVB 4FZ8L 1NUDA 4NNXB 5KTEL 1FCGA 3TNMA 1CXFA 2RB8A 4OF5A 4YUEH 5GGQH 4Q74A 4DZ8A 3M07A 2EICA 5KSAA 5DJZB 3AC0A 4DUWA 1X6LA 2WSKA 3U4EB 4M62H 4OSUL 4NJAH 5DRWB 5GGUA 3ECBB 4XC3L 5ALCL 2HTKC 1MCIA 1NKOA 4OFYD 5E99H 1LP9B 4QHKJ 5INDA 3P0VL 3VXSD 5IUSA 3WL9A 1A7PH 1U8NA 2RFXA 2E3VA 2GSGB 1BZ7A 3KLAB 1CIDA 2V7HB 2QHLA 3OBAA 4I3GA 4X4ME 1OPGH 3SKNB 2QADD 3K7UA 3TH2T 3MPCA 4PRHB 1WZMA 4X7SL 3O9WC 2AP2A 2NY0D 4YHIB 5CLWA 3EBAA 2QEJA 1UWEH 3R1GH 1NFKA 5DHVH 1GPOL 3RL1A 4NNPL 3FO2A 2P7TB 4GKNB 5EUOB 2I26N 3OJ2C 3BUYB 1KB5A 5D8JL 4MB4A 1ZAGA 1EEZB 3SO5A 3HR5A 4H0HB 2R1WA 5C9JA 5JXAL 1ADQA 3T0ED 2YUZA 4Y1AB 4EOWL 3HS0B 3IETA 1MHCB 4HIJA 4Q97A 1JZ8A 3IJHA 1JHTB 4BM7A 2Q8BL 2JCCB 1HHHA 4K3JL 4JDTH 1J0IA 2R2EB 4LLVB 2XZAL 1VCAA 3RGVD 5FGBA 4Q9CA 1MJ8L 4QRUA 3MR9B 4ZFGL 1EO7A 1A6AB 1JYNA 4PG2A 4R2GB 1EUUA 2GW5A 3QPQC 5FO7A 4R2GC 3SBWA 5EN2A 2JIXA 4XNQA 1KJMB 2YRLA 2MCPL 3FRPG 4JPVH 2YS4A 3E2HB 3KPSB 4M5YH 1DJSA 3DVFA 3E2HC 5F9OL 3SGKC 3MRFA 1F13A 4JO4L 3MGTB 2N7AA 3BJ91 4N0YL 3H8NA 4S1DC 4MA3A 3UYRL 3QO0B 3QXUA 3GMPB 4JFED 3SDDD 1KEMH 5I17A 1RIVH 2A6DB 4EI5B 5L2KB 1RIHL 4ODHH 2KH2B 4EI5C 3ARSA 1WFTA 4MVBC 5EIQA 1GCFA 4HUNB 1G7LA 2V2WB 2YRPA 5ICXB 3U0WL 2ATPA 4RA3A 4M7KH 2PR4L 2IH1B 1JF5A 5GJTH 4LDOB 2NW3B 1R3LA 2APWA 2V2XA 3MRGB 4JZOB 1XGQB 4KVCL 5ESQA 4MNHB 1MH5A 3HPLA 1U2CA 5C0RL 1MCLA 2JB5L 3DECA 4OQTH 4PRDA 2ZOLB 2VDLL 4U05A 4K71B 3BP4A 1IGCL 4K71C 2PXYD 2HT4D 3BH9A 2VR4A 3ZLQC 2EEAA 2VL5A 3HC4L 4WW2F 3T0XA 2OTWB 4PD4J 2DQHH 3V5HA 1RY7B 5ALBL 3WO4C 2M1KA 3AROA 4J12A 3DBXB 4XBGB 3SKOB 5E1AB 5D7KD 1H3TA 1A14H 4LSRH 5DRXA 4FZEH 4B53A 4XNZB 3PWNB 3CCHA 4HULB 1RU9L 3MRPB 3SE9H 4TQEH 2VXUH 3F58H 3WYRA 1DUZB 3U46A 1QFOA 2ZUXA 1N0XL 4I77L 4FQJH 1X9QA 3C8KA 4ZFZA 1OLLA 3O4OB 4Z0BH 3EHBC 3O4OC 4DGVH 5DFWH 2G9HB 3RJDA 4PREA 4I4WA 4K3HA 4L8DB 1KJ2B 4PS4H 1JWSB 3KPMB 3TWCH 3SOBH 1T2QH 7FABH 3OKLB 1CFSB 4OLXL 4LSPH 2D31B 4Z78A 2OYPA 1DBAH 4BSVB 3QWQB 1QVOA 1IGFL 3NN8B 5FIEA 3C6LC 1QBLL 5C8JA 3JSSA 3U1SL 4CADA 3MRQB 3KAAA 5DURD 4JM4H 3HMXA 2NLJA 3WFZA 4WFHD 4OZGF 4PJIA 5FXCH 3CFJA 4ZUUB 1DBBH 1G9NH 5JHDD 1H5BA 3MUZ1 4X8JA 4G6AD 1RFDL 1R5IA 3B6SA 5DMGD 4KTEH 2R56H 1B6UA 2CGRH 5ICYB 3JZ7A 2RCSL 2AXGA 4JDVB 2IQ9L 2YA1A 5HHME 1F4WH 5DVKA 1MIEH 1X5GA 1MWAB 4HUUB 1LMKA 2XZCH 4NKOB 3B5HA 5H2BA 1L0YA 5DEZA 5FO8A 3S88L 1FVDB 3OJDA 4ZOEA 4U2ZA 1EHNA 1BGXH 1NSNH 3QJFA 2I5YL 4HXBH 3OHXA 4HV8B 4HGMA 4YC2C 4FFWC 3LEYH 4WUKL 1AKJB 3SQBA 2BXYA 8FABB 3RZCD 5CILL 5D2LF 4I2XA 3RKDD 4LLWB 4XXCA 1P53A 1HZHH 2DIJA 4WHCA 5EA0L 5HY9A 1IEAA 3FOMB 4YXLL 3RWGA 5GQBA 3NA9H 4XVSH 1UYWL 3QNZB 1HXYA 3GIZL 2YUXA 4A6YB 3VMNA 1ONQA 4J6RL 2JELH 3S36H 2OL3B 1IMHC 3RVXC 1JRHI 1WITA 2HKFL 4F80A 5A3IC 1HH9B 4PGBA 1N4XH 12E8L 4ZAKA 1T7VA 3GMLA 1HN1A 2CH8A 3H42L 1BVKB 2NXZD 4NO2B 1CDHA 1OARL 3OF6D 2VDOL 4I9WD 3T0BA 1NGQH 1JHLH 4AIZB 5ACLA 5TJWK 4AK1A 1U8IA 3MJ9L 3O45A 3GBNH 4RAUA 2V7NB 2HLAB 2F53B 1DSFL 4O2CB 4WO4B 2NCMA 1A1MB 2HN7A 4WO4C 4JHBA 1IT9L 3D87B 3E8UL 3UTZA 4XP6L 4KK8C 1QR1B 4PJIE 3ETBF 5JIHA 1F3RB 2OX5A 3RTQA 4F7TA 4P23D 4WWKA 1U3ZA 2CUMA 4QHMB 5J1TC 5L0QB 1R6VA 4LU5H 1I7ZA 1ZT7B 1QFWH 1SJEB 5IGXL 1A8JH 4TSCL 3QIWD 5IEKA 2MKLC 1G6RH 4H25A 3SGDI 3WN5B 4GMSH 3SDAB 4EVNA 3JWDL 3WN5C 4OGXL 2X05A 3DIFB 2NTFB 1FRGL 3MO1A 3FB6B 1EO8H 1E4XL 1ZWIA 3L7FA 4K2UH 2P8MA 4N8VA 3RDTC 5IK3A 2EE2A 1PQZB 2VDNL 3MRLB 2ZKHL 4I2XE 4OIIL 3IFLH 5FB8A 1X5ZA 5BRZD 4JRYA 5E5UB 2M8XA 3V6BR 5DJYA 1OAKL 3VWKD 3UPCA 2BP3A 5ALCH 2DI8A 5JO5B 1CDGA 2XY1A 2E7LC 1XGYL 2EC9T 2OZ4H 2BVOA 5GRXG 2JJWA 5BVJA 5J6HA 2OTUA 2H1PH 4BKLA 3WS3B 2GQHA 1F90L 1BIIB 1CFTB 4N0CC 3P0YH 1HILB 1KLUB 4U1NA 4AJ0A 5GGSA 4F7CB 1I8LC 5GRUL 1G1CA 4F9PC 5SX5K 4X5WA 4X0KB 2ITCB 4EUPG 2EDQA 1SJHA 1CE1H 4ZS7H 1IEHA 4KUZL 3ARDA 4XP1L 3VE0A 2HAZA 4DKEL 1PKQB 4ZO9A 2HLFD 5KSAB 3DVGB 4K3JH 3ZDYF 1PG7L 5GGUB 2F74A 3O0RL 5E2UH 3HI6H 3TBTA 5CKGA 3TP4A 3T0AA 2YPLA 1FORH 1NCBH 3V4VH 4ZFGH 1ZEAH 2CLRA 3LKQB 3BW9B 1C12A 3LZFL 3U30C 3QNYA 3V52H 4GSDL 5GS0L 15C8L 2YOCA 4KRPC 3MXVL 4FFYH 3DNKA 4N0YH 4IRSA 3CX5K 2WZPD 3JVGA 4U1KA 4ETQB 4WHTB 4JRYE 5L6YH 2XZQL 4YDJA 2EIZA 1XR9B 4XPGL 3DO3A 1WAAF 1KENH 3F5WA 4XP4L 3O8XD 3HR5B 2CRYA 2PR4H 4KU1A 3UDWC 4NCDA 5T33H 1S5HA 5C9JB 3S96A 2DF3A 1M7XA 4LEXL 4ZFOL 1PY4A 3U82B 1JV5B 5ID1A 1I8MA 5MEQA 5HPMB 2EDHA 2VDLH 1XIWB 4YWGH 3MODH 4MCZA 1XIWC 3N50A 1IGCH 1RZ7L 4Z7VA 5MHSD 4GMTH 3CZFB 1OCWH 1A6ZB 1UB6A 3D9AL 5EO0B 5FKPA 4OZFB 4RGOH 5CIPA 5D1XA 5EN2B 4LCYA 2HFEB 4FQHB 5EBWB 5LAXB 3RU8H 5CEYA 5GHWH 1UWGH 3VA2C 3H6JA 3DMMD 1NUNB 3GJFA 1T66D 2Q3ZA 3BFOA 2B2XH 2J1KA 4KJPC 3FT3B 1KPUB 5GRZA 3RWCA 5I17B 3HE6D 4XP5L 3ARWA 2ZCHH 3ZO0A 4RSVA 5KSVA 1CU4L 5D6DC 1RHHB 2OMNA 5GS2D 4P3DA 4MXQD 2ATPB 4FFZL 4GAGH 3K4AA 3PV7A 2YPLE 3TCXA 4GQ9L 2C26A 5H37H 4WW2A 4XWGL 3WLBB 4F57H 2DLEA 3LIZH 1JZ6A 3PP3K 1AC0A 1RK1A 35C8L 3H2WA 3UBXB 4U6XA 4GG6B 3WD5L 3B5GA 4NBXB 3HPLB 1ZA6A 2R8SL 2MKWA 3QPXH 4PJFB 4RMUA 4M1DL 3BKJL 3I6GB 4W70A 2NR6C 3IDNA 4L4TA 4ZYKA 2FJGB 4DN3L 1V7NL 5F7DA 5FAAA 1FIGL 2F58H 2VL5B 5JDJA 3L95B 3ARED 3QUKB 3V5HB 4JFDA 4DKDC 4J4PC 3N9GL 4KROD 4HIXL 3U1SH 4Y4FD 4CNIB 3AS0A 4QXUL 5DRXB 5I1GL 4K9EC 5LWYH 3CCHB 2Z92B 3GSRA 5M94B 4DK6A 3HE7B 5E2TL 2FYYA 3O4LA 5TQ2L 3HE7C 5IVOA 4PJ9A 4PJ5B 4PJXF 3GK8L 1IQDB 1CD9B 1RMFL 3NZHL 2BJML 3BEVB 3VCLB 2C4FT 5JZ7C 1U8KB 4IRZL 8CGTA 4OD2A 4Z7VE 5C1MB 4MDJA 1YQ2A 2AJSL 3C8KB 2VDPH 3OKNA 2CJUL 3QEQA 4DVRL 4X8XA 5EORL 3S88H 4LCWD 4N0UA 3CGTA 5DR5H 4PREB 1GIGL 2I5YH 3PGFL 1UZ6F 3QH3A 1JNNH 5ACMA 3H0TA 4Y88A 3EOAA 5I1CH 4OZGA 1KACB 4KI5F 3BH8A 3QUMA 3W0WB 4Z78B 3MOAL 1MCSA 1VKXA 1U3HA 1NDGA 1PJ9A 3BN3B 1C7SA 4YXLH 1QVOB 2AKRA 1HSBB 3WEXA 2WWKT 5C8JB 2NY5L 4CADB 3BP5A 4J6RH 3CX2A 5T1MB 2DIBA 2LTQC 2F19L 1FL6A 2O5ZL 4M7LH 3CFJB 5FCUH 3V5KA 4HAGA 4MD4A 1H5BB 5HYEA 4XPHL 1WZ1L 4XCFH 4YJZL 4PTUB 3RWFA 5D2LA 4L4TE 1J1PL 2WINB 4O2EA 1OARH 5FYKL 3HNTH 5K9KA 3K8KA 4PRPA 2DQJH 2JB6A 3E6HA 4JFDE 3O11A 4HZAA 2R69H 1IAOA 1NC4A 5FA3B 4UV7H 1E6OL 1I3GL 3OHXB 4R4ND 3BOVA 4KXZI 4WEUD 4U1LA 4XP6H 2LAAA 4YHPB 5IMLA 2GK0A 1DLHA 5J11B 5C07D 2QQQA 2H2PD 3D69A 3O4LE 2J88L 4I2XB 4KHTL 4CN6A 5IB3A 5J11C 2ZCKH 5FO9A 4NM4H 4IRJD 1K8DA 4XXCC 3MYZA 4JFYA 5HY9B 1W0VA 1IGYA 1Y6NR 4TVPH 4JHWH 4TSCH 1PGRB 3QEQE 1GOFA 1H0DA 1UZ8B 1LNUB 1IGIH 4OTXL 4N0UE 2W65A 3OPZL 4ONFH 2JJTA 2B4CL 1FRGH 3TV3L 5AD0A 1E4XH 1Q1JL 4R0LA 4OF0A 4OZGE 4ZUSA 3CVHB 3EJJX 5SX4I 2OLDA 1J05A 2VDNH 4HWNA 5B3JF 3ME0A 4NQSA 4O02H 4GKZB 2H6PB 3SKUD 1LDSA 4O9HH 1JGVH 4Y5VC 2IFFL 4RA0C 3NACH 1TTUA 2HN7B 2P1YA 2HT2D 5I1EH 2ZZUT 1XGYH 1JN6A 5F72S 3LAFA 3OB0K 4F7TB 2E7BA 2R2HA 2CRIA 5INCB 4TTGA 2I9TA 5D2NB 5D2NC 5D2LE 2ADFL 4Q9RL 1I7ZB 4D9RE 4XPTH 5FM4A 2A73A 3PGCB 4YK4B 3U36B 3ZHKA 3RNKB 4H25B 2AEWA 1HCVA 4PRPE 4YK4C 4UBDD 3TYGH 4EVNB 4ZPTA 4IMKA 2AI0H 3GHEH 1TTFA 1N2RB 1AD0A 4YLQT 4P5KB 3ELAT 3U7WL 2BX5A 2QHRL 2VDQL 1ZWIB 2Z8WC 2BFVL 2P8MB 1AHWB 1W2KT 1AHWC 4KUZH 4WU5A 4TOYL 5FB8B 4Y19D 3MLUH 4P2RD 2JLLA 1AQKL 3K2MC 4WUUD 3QCTL 4KTDL 5DJXB 4NO0B 1CDYA 2HJFA 2JK5B 4JB9L 5B4MC 4YBQD 4EI6B 4NZTH 3RA7H 5DTFA 5GGTA 3DXAB 5E6IA 3MRKA 4MB3A 5BXFB 1CR9L 4FQLH 4XWOC 1JYWA 4YZFF 3GMMA 4OF8A 3K0WA 4OF7A 2OTUB 4PB0H 4BKLB 2YD9A 1YC8A 3JWOL 4D9LL 2WBJA 5GS0H 4IDLA 15C8H 4N1CA 5JR1H 3NFSH 1UCTA 2WUCH 1KIRA 3VFUA 2ZSVA 3EJYD 3FB5A 4XBPA 4E5XB 1A5FL 5GGSB 4KDVA 4Q9QL 4YAQA 3KXFB 4XNYH 1CXLA 4X5WB 2AEPL 4XP4H 4YDKL 4LLQA 2GEEA 3IKCB 3PXJA 1NCDL 2FRGP 1LWRA 1SJHB 4LEXH 2DQIH 3QQ4A 2HVKB 1E4WL 4TULH 3JTTA 2VXSH 5JDSA 1IC7H 1QEWB 3VE0B 4K07A 5HI5D 3WIHL 3M8OL 1RUML 3WDIA 5I1JH 4OGZA 2Z31D 4G6KL 2NX5D 2W9LA 2F74B 5IQ7L 2NY7L 3TBTB 1CG9A 1UENA 4YXHL 2W0FB 1CICB 1U3JA 1CICC 2EH8H 5LCVH 4HWEL 2Y5EA 1NMCC 3Q6FA 1WAAA 3HZKB 4RQQB 4X7DC 1P4IL 4IHOA 5I8OH 4JFXA 1CFNA 3MUJA 3GM8A 1MCBA 5AYQA 5E8PA 3WUWA 5GGVL 2AQ3A 3PIQA 3GMNA 4ONHA 3TCLA 1I7RB 4QOKB 4M6NL 3ILPB 3AXLA 1NLDL 4IRSB 5GSVB 5DS8A 4YHZL 3VMOA 4XCCL 1FIEA 4F3FA 1T21A 3G08A 3QR2A 2PTTB 1DVFD 3DX6B 1CU4H 2E27H 2DD8L 1NBYA 5DFVD 4FFZH 2BOBA 2H3NB 3S96B 1BX2A 1FNFA 4WDIA 3P3YA 2HJLB 4GBXC 3L5WA 4UMGA 3EFDH 5FHBL 4L1DA 4X5XA 1I8MB 3MACH 3WD5H 2DKMA 1DQQA 4W68A 2PO6D 3MUGA 2R8SH 5HHOB 3ARXA 4LFHG 4PRAA 3ARGB 1AE6L 2OR9L 3MV9A 1W8OA 3ARGC 1SM3H 1WWBX 3RVTD 5CUSL 4MCZB 1YEJL 1F8TH 2FEEL 4DN3H 1RAMA 1V7NH 4JRXA 1TJGL 5IB2A 1FIGH 5BS0A 1UB6B 1KCSH 3ZDYE 4ODUA 5CIPB 3KWWB 4LCYB 5T1LD 1V7ML 4POZD 5E2VL 5CEYB 2ZUUA 3FMGH 3FN3A 1OP3K 4QXUH 5ANMA 1TIUA 3GJFB 3QIBA 4U7SA 1INEL 1A7NL 5L8KB 1Z6JT 1FNSH 1ORQB 2DIAA 1HSAB 2DWDA 4GW1A 4ENED 4HEME 5CBAA 5CJXA 5C0JB 5CD5C 4RMWA 3HC0A 3SEPA 2K1MA 5DJ6A 5KSVB 2BJMH 5CKAA 4YFLF 2YXFA 3OAYH 3ZTJH 4P46A 1PZ5A 4P5TA 3PABA 3QEUA 1ZK9A 1T03L 2CJUH 4XNUL 2Y6SD 1WAAE 3PWVB 1RK1B 4GRWF 3DURA 4U6XB 3T77B 1XCQA 4IDJH 1YN7A 5T3XE 3L5HA 3PGFH 1NAMA 2CKBA 4OBRA 4PLJD 4YR6A 1HXMA 1CL7I 1RJLA 3M17A 3BP6B 3BRGC 3QUZD 5DJ0A 4ZYKB 4G7VL 4G8GB 2ITDA 4PJXA 4HKJA 1E6JL 5HHVL 1P6AB 1A6UH 3VXQA 2NY5H 1KG0B 2ARJA 1FGVL 1OQXA 3FFDA 4M7JH 1AO7D 4HFWB 3UTPD 3BO8A 1KXTB 1A0QL 4XMPL 4DGYL 1YMHA 3O4LB 2X7LB 2VC2L 5D1QD 1MFBH 4JZNA 3BT2L 1W72A 4XPHH 2FX8H 1WZ1H 3MV9E 4YIQA 1FZOB 1S7XA 1A9EA 3HG1A 4Z7WF 4OD2B 3I2CH 3ARTA 5ITFA 4JRXE 4MDJB 3QI9C 4RBPH 3VMPA 5BS0E 2I07A 3QEQB 1X5HA 3STLA 3TN0A 4KKBD 5LQBL 1MY5A 3HPJB 5ANME 4BZ1H 3K81A 3B9KA 4OIBA 3TIDB 3H0TB 4OZGB 2V5SA 2F54B 3BH8B 5FYLE 5HYSA 2DKUA 2R23A 1HI6B 3PP4L 1VKXB 1OAZL 2HFGH 4XPAL 2XXCB 4LLMA 3UBXI 1X5IA 2WBWB 4WFFE 1KB5L 4OV6F 4XAWL 3BRDA 1RZKL 4OTXH 1FL6B 1ADQL 1FYTD 4K7FA 3OPZH 3V5KB 4MQSB 2CLVA 4LBEA 4DKFH 3ZTNH 3GI9H 5LVEA 3I02A 1Q1JH 3DYOA 2BNUA 2HP4A 1K4DB 3N0PB 4YBLB 4C4KT 5C08D 1FAKT 1HQ4A 1TENA 4O2EB 3QDHA 4PJXE 1KJ3L 3EW3B 3FQUA 2NNAA 1AFVH 2JB6B 2GT9A 4ZQKA 2AK1L 1I85C 1JMZA 1BQHG 5B39G 5DMJB 3O6MH 3WS6A 4E41D 1OTSC 1G7MB 3B4NA 1KYOK 4JO2H 4OKVA 5F7YC 2GK0B 1DLHB 5JW4R 1UZ6E 3BPCB 4MJ6A 1T83C 3CH1A 5CEZE 3ULUC 1K8DB 1MCPH 4L3EA 4J7RA 2LU4A 2CKNA 1HNFA 4MNQD 3HG1E 3BSZL 4K7PX 2ADFH 3QDJA 5CP3H 2OBGA 4B0MM 5JW5B 3NABH 3I6LD 1P9MC 4R90H 3FZUC 5JMOC 1ZHLA 4AEIL 5BZDA 3LHPL 3OR7A 1E27A 4WI5A 4YFLI 4Z18A 3IDUA 5CFHA 3G9AB 3U7WH