5JQWA

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with adp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
365
structure length
365
Chain Sequence
b'MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide synthase
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with ADP
rcsb
source organism Francisella tularensis subsp. tularensis (strain schu s4 / schu 4)
molecule tags Ligase
total genus 112
structure length 365
sequence length 365
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2016-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5jqwA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5jqwA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jqwA01
4O82A 4O84A 3E5NA 4IWXA 2NU6B 2NPOA 1AUVA 5H80A 5BPFA 5JQWA 4FFPA 4O4IF 1UC9A 1OBDA 4O86A 1Z2PX 2J9GA 5GONF 1A48A 2DWCA 2YZMA 3AW8A 3ORQA 4O2AF 5IYZF 5K2MA 4HNVA 1WR2A 1BNCA 3AX6A 3U54A 2I80A 1CQJB 3K5HA 1JDEA 2YW2A 1EZ1A 2VR1A 4O7YA 2IP4A 3BG5A 4XYLB 3U9TA 3HB9A 3ETJA 3ETHA 1EUCB 3TIIA 1E4EB 3KREA 4WD3A 5FNVF 3NUAA 1C3OA 2WYOA 2R7NA 2OLSA 1W96A 4O83A 1CS0A 1EUDB 4EA9A 5HV6A 4HNTA 3VPDA 4MA5A 3Q2OA 2GLTA 3JRWA 3ORRA 4IZOA 1KJIA 2GPWA 4HNUA 2V58A 3VMMA 5C8YF 5C1OA 4FE2A 4C5BA 3OUUA 4YJ3F 4YB8B 4O7NA 4O4LF 3N8DA 1KEEA 2R86A 3R5HA 3WO1A 4I4TF 4WBNF 3GIDA 4IHJF 4FFRA 3U9SA 4MV1A 5JH7F 1KJ8A 1AUXA 1KUTA 2QK4A 2HJWA 3DF7A 4YAJB 2W6ZA 4EA8A 2XCLA 4HQ6A 1DV2A 4C5AA 5HBRB 5CA1F 3JZFA 4O7ZA 4MAMA 4YBZB 2R82A 1I7LA 2NU7B 5JQGF 2YRXA 3V4SA 4O7VA 1GSHA 4E4TA 1KC7A 1B6SA 3MJFA 2ZDQA 5BPHA 4TV9F 5LP6F 2V5AA 4ZHQF 2YZLA 2YS6A 4TUYF 3WO0A 4MV4A 1E4EA 1DV1A 4FFNA 3VPBA 3VA7A 1BXRA 4Y8VB 1GSOA 5I47A 2GQRA 1JKJB 1IOVA 2PN1A 2CZGA 2GQSA 2VHEA 2CQYA 2C00A 4FGRA 2FPPB 1B6RA 4EG0A 1PK8A 3I12A 1PX2A 3JZIA 5KKNB 3BSYA 5J2UF 1ULZA 3K3PA 4YJ2F 3G8CA 4O7TA 2R85A 2V59A 4C5CA 2SCUB 1KJ9A 2FP4B 4IIJF 5LOVF 3KAKA 4DIMA 4ZI7F 4O7SA 1EHIA 4EABA 1GGOA 4J6EA 4O4HF 1DIKA 1KBLA 1I7NA 3G8DA 4O7LA 1M0TA 3HO8A 4RZQA 2X0SA 2GPSA 3JRXA 3BSWA 4O2BF 1KJQA 1VKZA 3K5IA 3RV3A 2I8CA 4I50F 3BSSA 3LWBA 3MWEA 1KJJA 2P0AA 2YZNA 4I55F 3V4ZA 3R23A 2W71A 5EZYF 1CE8A 3TQTA 2YWVA 5J2TF 2W6PA 4ZOLF 4M98A 2Z04A 2VPQA 2NU9B 4GGMX 4O7WA 5DMXA 2FPIB 4MV8A 4ME6A 2XD4A 2YYAA 3UFXB 4M9CA 3N6RA 3VOTA 2R87A 3WNZA 5LYJF 4O4JF 4TV8F 2DLNA 2NUAB 2W6NA 4MV9A 3VPCA 2CNQA 5CAEB 4DLKA 4FFLA 2W6MA 3R5XA 2VQDA 5KX5F 5C1PA 4M9UA 3MWDA 2W6QA 3KAJA 3TINA 4M99A 1OBGA 1VBGA 3R5FA 2FPGB 2YRWA 2W6OA 5BMVF 2HGSA 2CNUA 1JLLB 4HR7A 2PVPA 2R7MA 1M6VA 2DIKA 2YS7A 2FB9A 4YAKB 4IWYA 3BFPA 4FFMA 3SE7A 5CA0F 2ZDGA 4EA7A 4NYEA 5LA6F 1SCUB 2W70A 1Z2OX 5CB4F 1IOWA 2YL2A 3RV4A 3Q1KA 2ZDHA 4MV7A 5JVDF 3R9RA 1W93A 5D8DA 4O81A 1VBHA 2I87A 4O7RA 4MV6A 1EYZA 1GLVA 4EGJA 5JVLA 3LP8A 2NU8B 3TW6A 2R7KA 3RUPA 1JDBB 3U55A 1A9XA 4XX0B 4QSHA 1GSAA 4L1KA 4FU0A 2R7LA 1T36A 2R6FA 4FFOA 4XYMB 3OUZA 4EGQA 1UC8A 5LXTF 3QFFA 1C30A 1Z2NX 2R84A 2YZGA 3RFCA 3GLKA 4MA0A 4ZQIA 3TIGA 2DZDA 3HBLA 4MV3A 2CNVA 4EAAA 2PBZA 3KALA 4XZ3B 1M0WA 2Z02A 2QF7A 1CQIB
chains in the Genus database with same CATH superfamily
2TMYA 3W3ZB 1PJ8A 1NBME 1H2AS 1ZM3A 3R5TA 2GN9A 2AN5A 2O8BA 4R1QA 1N2CA 2PT5A 4MUKA 3U1VA 3EMVA 2QE7D 4MUGA 4D0RA 5CXSA 1I0ZA 1PZNA 3HJHA 1HF3A 3GLRA 4PTYA 3SVTA 3L01A 2AXEA 3BFJA 3IMEA 1XNJA 4PICA 1BSVA 1I5OA 3ANMA 2HU7A 4D0GA 5ICSA 2PX6A 1U81A 3E8SA 4UAUA 3FNIA 5A4MS 2REQB 1BW9A 4L5YA 4V02A 3FBTA 3RHSA 4JB0A 4UULA 1Z0ZA 4EHFA 4FB5A 3TCKA 1SUSA 2I4RA 2Q7XA 2Z3ZA 4DNOA 4XIYA 1T5IA 3KT3A 5FNVA 5J5AA 4DNPA 1KH2A 3GA7A 3GLIE 4BZZA 4ZQEA 4ZTUB 3SF8A 3TGPA 2IGBA 4BB9A 3K6KA 3NTXA 4ZAGA 1VJDA 5ALIA 2WTUA 1CZOA 1XLTC 1YGPA 3N5KA 3H05A 2JCVA 2EZ9A 4TLDA 4DNQA 2V3WA 2VAVA 4NMWA 2AFRA 4YUAA 3SG0A 3DLIA 2YOFA 1ORWA 5CJ2A 2QWXA 2GVDC 5T8KC 1JFVA 3DJYA 3B1YA 2QSZA 4CE6A 1XCLA 1E4GT 2YIJA 1XRPA 4I50B 1OTXA 2VJKA 3ME5A 5HNKA 5JRDS 1XO1A 2QT1A 5BYKA 2A9VA 4ZRMA 5J4VA 3V5NA 1G5IA 1OA0A 1PWEA 2A59A 1CBUA 3G89A 2O3UA 1OXUA 3O0TA 4LJAA 4GBGA 1UPFA 2MHCA 2OH2A 3KD3A 3N2IA 2W8KA 3ONDA 2HA6A 5CE8A 4KWTA 1DKRA 1T8UA 3BDIA 3I76A 4TOIA 2V0CA 4JYZA 4I1UA 5FHRA 2VYVD 3E84A 5F7XA 1R2QA 3WKEA 3KLPX 4K40A 2QZ9A 4C43A 1EVQA 4JI6H 2AGQA 4RM3A 3LBIA 1L7EA 4BB5A 4RQTA 4P92A 2VDMB 5KYYA 1YE8A 5KT3A 1A8QA 2G08A 1VZ2A 2R8BA 2CJPA 1F60A 1QH8A 4FMBB 4HZGA 4EWLA 3SGLA 3TPFA 1TYDE 2JASA 3M6IA 1SRQA 2OXFA 5LB2A 1C7ZA 1L1EA 5DGHA 5BNIA 2YVLA 1S8OA 4EPTA 3ASZA 2QL6A 3PUKA 2I4IA 2P7IA 1Z4PX 1HNXB 3P0JA 4R8RA 1DB3A 3NDJA 2C29D 1U7TA 3HEBA 4F2GA 2CVHA 1V5GA 1U6IA 3ILSA 3OBIA 4L5CA 4C3VA 1AS3A 3ZH9B 2QGNA 3CIOA 4Q45A 2GILA 3FOZA 1KRWA 3VSAA 4WESB 2EGUA 1XB2A 3COZA 4MVYA 2BMVA 1RHUA 4IDGA 1EX7A 1DO8A 2H4ZA 1W4ZA 2H4HA 2BPOA 1CVLA 1RYRA 4DR1H 3R3WA 4M46A 1ZJWA 1DI0A 1MIOA 3GTOA 1UOQA 2IYEA 2AOVA 1C3XA 2DETA 1L8LA 5LA6A 5JVLA 4EFNA 3LP8A 5I9LA 1M76A 2JC3A 4YBZA 2UYHA 3C7TA 4OAQA 1H0SA 2E5LH 2GBPA 3EFOA 3SPXA 5HIIA 1WRVA 4DMFA 3ABZA 1U2DC 1EE2A 2X9VA 1LBSA 4GPAA 1ECLA 2EOAA 4M53A 2RCNA 3P97A 4DVGA 2ZRNA 5BV0A 3CG0A 5FKJA 2BBSA 2QTVA 3MBIA 2ZAGA 3I6YA 2FKAA 5BORA 4ARIA 4NCBA 3AI7A 1A9TA 2VRNA 3KSRA 1XZMA 3O3MB 1XZHA 1PQPA 1YD7A 4II3A 2ETVA 4AO8A 3IXLA 1TADA 1PZXA 2IU0A 2YQ5A 4ID3A 2C2HA 3VC1A 4RFSB 3G2OA 5ICMA 4GI5A 4ZYZA 1CUGA 3RSQA 3TSYA 1LC0A 1SD5A 4O2AF 2CF5A 3A27A 1R0LA 4RHYA 3Q8WA 3G85A 1VGRA 3AJAA 4QYIB 2Z1MA 1N32B 3F6YA 3OSNA 5D1HA 3C7KA 4X60A 1Z29A 4KIWA 2ZI4A 3CT4A 3ESZA 2BMFA 4I6GA 5K8CA 5FYQA 1UC4B 1J7KA 4ETNA 2AEJA 1LTHR 4ZZIA 1NDHA 3FYCA 4O4JB 2YCLA 2FPIA 4HDAA 4PNHA 1I3OA 2C5FA 1L8OA 3C6ZA 2CKZB 3WAKA 3H2SA 3ZDAA 1HMPA 1O9BA 3SQLA 2GZRA 3ZCXA 2WJZB 4ZZ2A 2XMGA 1MEEA 1T5OA 1DRKA 2EF1A 3KB8A 3K70C 2UXCB 5B58C 3HCDA 3EIQA 1RYEA 4WNCA 3SIXA 1PT7A 3H5OA 5JCOC 3FCCA 3CS3A 4RBNA 1XMOB 3P0IA 3GF4A 2Z5GA 4DR7H 4PTZA 2R1UA 2ZSDA 2JAXA 5JAHA 1WXXA 3DE4X 3AOGA 1H4TA 1UBTS 3LJKA 3W6NA 3WLLA 1FTYA 2BFOA 5EVJA 5K0ZA 3D5TA 3NHSA 3OY7A 5FUYA 2FPKA 2W6IA 4RQAA 4ZA2A 3QLVC 1NUAA 2IYAA 4KFCA 2QJTA 3OF5A 3CB2A 5EJ5A 5DQGA 2A94A 2P9QA 1ORVA 1AK1A 5DKFA 5G0TA 4CNQA 4NS1A 4BWYA 2AW5A 3UKOA 1DQYA 1JNYA 4DV7B 1GL3A 1YDHA 3JZAA 5A4KA 1GTL1 1AK2A 1FNCA 1XF1A 4A10A 3QGMA 4Z4HA 3AFOA 2Y05A 1J1ZA 5JS7A 1VIYA 2HK7A 4Y6LA 4UPVA 1XMSA 3AM1A 1ZWKA 3RIZA 4CKWA 4PO3X 3DE3X 3Q0TA 2JCGA 2VVTA 3NBAA 4BFXA 2ENWA 1JLMA 1JX4A 1MT0A 2WSMA 1AKEA 5HE9A 2YV5A 4BUJA 1GGFA 3GGDA 2EBWA 5DYYA 1O6BA 1EEXB 5CRIA 3J80W 1HUQA 3R4VA 1ADFA 3I72A 3AP1A 1TUBB 1N56A 2A9KA 4LMBA 1CKEA 4FCCA 2CCKA 2W22A 3ZCSA 1L5HB 1Z22A 2E21A 1UK9A 5I5WA 1PFVA 3TL2A 2FE4A 4YRPA 4E08A 2IEYA 1ZISA 4QVKA 1NVKA 1A8PA 1YTUA 2FG7C 2WEKA 1OOEA 4R7GA 1H5UA 3QWHA 3PPYA 3OLYA 4DCPA 3RUCA 4DSNA 4G0NA 4EA7A 3KM0A 3A1NA 4DR3B 1DEOA 2WJIA 4JL5A 3REFA 3TRFA 2Z8YA 3ANLA 5BURA 1XD9A 4B7AA 3MOSA 1A1VA 3WMGA 2A14A 2ZYTX 3QVWA 4QU8A 4DLPA 2O2EA 2TMDA 4NHOA 3PFKA 3N5CA 3NEJA 3FD8A 4RDXA 1PD1A 1KK2A 3PN1A 4NBLA 1VI5A 2LTAA 1EBUA 4H7DA 3TYXA 2Z83A 5BWRA 4RESA 5AW1A 2BUAA 1Q11A 4TWRA 4CTOA 1ZUNA 4U2EA 1G2QA 1FDUA 1N6PA 2VI5A 3GDGA 3JVIA 4TTTS 3EVEA 4B3HA 2JLQA 4EMSA 4E33A 5D3MA 4JBLA 3O7MA 3O7WA 1TM4E 1W1IA 4DDMA 1IPHA 4WN9A 4XGRA 1K27A 4H6WA 3UKJA 1NI3A 2FWIA 1YA6A 4FKMA 3AB7A 3C3AA 3VZRA 4C7JA 4WZ6A 2AFHB 1KXZA 3U5TA 1PNOA 4NZOA 5GIOE 3N28A 1PQ4A 1KSFX 1SCDA 4PYOA 5ETJA 2J07A 4O3PA 5DBOA 1Q7CA 4WMLA 2IDMA 1SBQA 5I7RA 5LUAA 3WWHA 4KODA 3EE6A 9MHTA 3IG0A 1U3GA 1XCBA 3GA5A 1MJFA 1AQUA 4BVAA 4EVRA 3T5DA 1V8DA 4MQ6A 1CDOA 1WBJB 2QY6A 1U7OA 4B83A 3FNBA 3FROA 5BNZA 4BE4A 3HWRA 5A9RA 3W7AA 1WCIB 1E2GA 1II8A 3KU4A 2P79A 1M9NA 3CW2A 3L41A 3UMJA 2M05A 4BP8A 3ULKA 3PQ5A 3W5DA 4GC6A 1J0XO 3IBYA 4QUAA 1EMDA 1WHTB 1U1FA 1L5NA 3AR5A 3V1NA 3M1IA 1C4KA 2J3LA 2P4EA 4JCCA 3V2IA 1P77A 1DWQA 2WU8A 3LX8A 3GIKA 3TLXA 4FHZA 4E0BA 3QTBA 4HQ6A 4W8OA 3S40A 1X1EA 3GCGA 4MAMA 3F5DA 2G80A 2DCUA 1P9NA 4G5GA 3HYSA 3MJ4A 5FB3A 3PT5A 3VXKA 2ZWIA 1C30B 1XXHB 1AV7A 2ZM6B 1JFSA 2P2YA 1EGMB 3OQIB 2C9MA 1IJKA 2QRLA 3IQWA 4N54A 3G6YA 4WXMA 2J9ZB 3D6NB 3M9NB 3Q8KA 2I99A 2Z4RA 4EG0A 4X20A 3JZIA 4BDTA 1YUNA 4DIMA 4ZI7F 2B69A 4CI9A 1PWHA 2XX3A 1O4WA 2CD7A 2B99A 1WE2A 5IK2A 2FPXA 1GADO 4KWHA 4M49A 3CNBA 2A5YB 3TOCA 3WL8A 1P5FA 2Q7DA 3PIRA 1A96A 1MT3A 2L82A 4DEXA 8ADHA 1MAAA 3F4KA 3ZDCA 3BFVA 1GYFA 3EAFA 3QXCA 3ND7A 3GDEA 3BD7A 3H9JA 3KPVA 5AKYA 4JT2A 1FUIA 1GSIA 1HA3A 4N7BA 1UPBA 2NTEA 3Q3GE 1KKUA 4C6HA 2J6SA 2JAUA 1U1CA 3AK4A 3PFNA 4OMCA 4M7OA 3P20A 3IUSA 5KFTA 4ZAZA 2G6TA 2AGVA 5TVKA 4H59A 2ZYIA 4JJIA 3CCCA 4BY1G 3OIFA 3IURA 1TDJA 1M1YB 1QXSA 4IH1A 1I4EB 4MKGA 4DAOA 4B4DA 5JADA 4GVLA 4DCTA 4RZRA 4XGIA 4DR2H 4YT2A 1EJ6A 2PYIA 5IEJA 4JI5H 5FAKA 1WHSB 3ZY2A 3EVCA 2W70A 4WEQA 4F9TA 4YGYA 4XVCA 2JHGA 3TSAA 1N3IA 1J9EA 4JN6B 1Y1VG 3MB8A 4B47A 2ZDHA 1NQUA 3GCZA 1M8FA 1V4VA 2ZBRA 4A3IG 5IT9W 5A7HA 1UJCA 2J1LA 5TDHA 1FJHA 4DSAA 1VHQA 1HT1E 1XK6A 3N8KA 4GL2A 1Y4ZA 2WAQE 1NLFA 4Q12A 1GUZA 2XMDA 5LLSA 2VHUA 1GTVA 2Z57A 1USWA 5JAPA 1M0SA 3N0XA 4RHEA 4Q4CA 1YQQA 3C4JA 5BWLA 4OIFA 3AESB 1JEAA 4FGJA 1XKTA 5CTJA 2PMEA 1P9RA 1A9QA 3HMQA 4DV3H 4D42A 1JHMA 2JDIA 2QM8A 2YJZA 3A3NA 3TD6A 4GVPA 3HBLA 3UTDA 4D9EA 1E9SA 2WJHA 1JEJA 1MUUA 3FCYA 3WQHA 4OOFA 4NATA 5CB8A 2INGX 5DNEA 4L9SA 4YAKA 4NU6A 1DQRA 3WWDA 3N9IA 1QF6A 4E13A 2JRLA 2FV8A 2D62A 5DM0A 1PZMA 2XECA 1V3TA 3OKFA 4FCVA 1YBFA 2FW1A 1O3YA 5AHOA 1T2EA 1KC3A 2OD9A 1P1FA 5DYWA 1OB5A 1CV2A 1NQTA 4FEYA 1KI7A 2JGLA 1R8JA 3KVVA 2VQFH 2ODBA 2BZSA 3L0PA 5GTDA 1OV6A 5EP1A 2PZ8A 1YJAA 4EA9A 3EXIA 2DQKA 3PKIA 4AT1A 1F9EA 3MSXA 1QSGA 3SF0A 3EJ6A 4IDFA 1HEIA 4HLUC 1JWAB 1N2BA 2V58A 3LCUA 3KEMA 1QQAA 4CM3A 3AV0B 2P1ZA 5D86A 1CY4A 3U6BA 5FTNA 3K72B 1TL7C 4PSAA 1HZJA 4RLSA 3ZNOA 4DBLE 5CB6A 4AWBA 3PEWA 1P31A 3BD8A 5IAJA 3IERA 1OBOA 3PGKA 2Q3DA 4MIKA 1ODKA 3OU6A 5AM5A 4Y98A 4ZJZA 2IC5A 1PTJC 2C54A 5EXXA 1AKTA 3T5BA 4QJFA 2DKFA 4DAAA 1IUNA 2C94A 2NPFA 3ZZUA 4OGKA 2C5GA 3L93A 5HUQA 2GB4A 1L4UA 2LDBA 4IL5A 3PQ3A 1UKAA 4ECZA 1G4UR 2UZ1B 3SKXA 3HXPA 5CFPA 4OXKA 1DDOA 1FXSA 1RIIA 3DAPA 3V3KA 5I5XA 5JO0A 4DBLC 4ICIA 5B64A 4NV1A 4J7CA 1ZGAA 3PHCA 4R8VA 1VE9A 1QO9A 1A1SA 1ZO8A 2Q8NA 4LSAA 4XGQA 3X2EA 1VC2A 2DSTA 1KY3A 4GP7A 1K5GA 4L5IA 4JUIA 3UAVA 4MITA 1XMQH 4CQMD 3TW7A 3R0QA 2C0CA 2O7VA 3A05A 4EQZA 3N70A 5D1OA 3C8DA 2OFPA 2WUEA 4FSXA 4UPDA 1BO6A 1JXMA 2FDCA 4XUCA 3EMKA 1Z0UA 3MINA 4P4NA 5H4HA 3SHFA 3B36A 3F6EX 4J91A 4JI4H 2P6UA 2PMZA 2DR2A 3KDAA 5AOCA 4MSUA 1K7YA 1JG2A 1I2LA 1S10A 1BHJA 1J8DA 2C35B 1V39A 2WKQA 3JSNA 3UK6A 3EUEA 4IUBS 1M1NA 1ENOA 2Z0MA 3LW8A 2CY0A 4YLYA 1HGXA 4ZVVA 4PX3A 3G9TA 1JR3A 3ELDA 1DGQA 4KQJA 2R8OA 1HZZC 2R6ZA 4IQ4A 3R4CA 2G1KA 1BU5A 4XI9A 3B6JA 3ZKAA 1C8LA 1EVZA 4B48A 3WWIA 3H1PA 3B82A 1SVLA 4YAKB 1Z2EA 4JYBA 3S55A 3HLYA 4W5NA 1K63A 4Y2RA 2Z5FA 4PO8A 3QTLA 2OPBA 2BV3A 1DAIA 1RAGA 4H16A 2BFEA 4M1TA 4EUNA 3H2IA 1U8EA 3I83A 4GMDA 3QBTA 4OUDB 1Q7GA 2R7KA 1JDBB 4XLLA 3QXHA 4E7OA 1MLDA 4EUHA 2F3UA 3K2EA 5BSGA 1MN6A 3Q8MA 3HYLA 4HAYA 2VSQA 4OCZA 4BKUA 2IIBA 2W98A 1TQHA 4RTNA 2HDNB 4OHRA 1DTWB 4FYYA 3OZIA 1Y9JA 2IPAB 1DUVG 2NYRA 2O14A 4OJNA 2QN1A 4B6FA 4IO0A 1N2HA 2QRNA 4BQPA 1YS4A 2BKVA 2ZFUA 2MYPA 5KC9A 1U9ZA 4DPMA 4BV9A 2EG9A 4M6WB 4DS3A 5JXGA 1NN3A 1E0SA 4IGIA 5KQRA 4GKAA 8OHMA 2NVYA 2GF9A 4WKCA 1OFVA 4GKJH 4AMYA 1PJTA 2WTXA 5KTYA 2D3WA 2C20A 4CWAA 1RP7A 4W5JA 3OHPA 4M7WA 3H4DA 2F9MA 3HB9A 3BEOA 3TIIA 1C3OA 4IH4A 2XHZA 2B78A 2PBFA 2QJFA 1P4GA 3C45A 1Q1NA 4J9NA 4WGGA 1EFAA 3FPHA 4M1MA 4ZJUA 1L9KA 1VIVA 4KHZA 3B7PA 5AVKA 3A6HA 4ZYVA 4X61A 3LHDA 3RR2A 1YI8A 4KVZA 3QE0A 3AJ9A 3DZJA 3I45A 5IUKC 1MIHA 2JK0A 2X15A 3AVYA 1J9ZA 1NNI1 3FUVA 3WFIA 1ZXLA 4Q9NA 1KKLA 2YIVX 3TO5A 4CR6A 5B2FA 1P5ZB 1QIDA 4MYSA 1JIIA 3TDKA 4A2WA 4FKZA 3O91A 4ZK6A 1EP2B 3JR7A 3RC2A 2OAEA 3RIXA 1Q3HA 4H7JA 1M1XB 5MN4A 4YNBA 3RFXA 5FPOA 1JXLA 4DL2A 1IHOA 5H4GA 1EG7A 1YQTA 3JQDA 1HNWH 2PSHA 5ALSA 2COKA 4ZDJA 4Q6WA 5G02A 3MGCA 1IHUA 1P4RA 3JZDA 4JI0B 4BNWA 3U3KA 2ZE5A 1PJBA 3HCRA 3N0WA 4X6XA 1A7UA 3O1JC 1XCGB 1QFSA 5TSDA 4CLDA 4TGLA 4LF5H 5TR9A 1IVYA 3Q7SA 2FMXA 1D07A 4G6ZA 4MKZA 1F4LA 5LP6C 3A37A 2IQIA 4NYJQ 9LDBA 1SKYB 4ZN6A 4ND7A 4YJ2A 3BMCB 3DKRA 1YS2X 2ZUWA 2G72A 4WOCA 4I50F 1NONA 1VSTA 4N6GA 1KJJA 3KRTA 3IDZA 3K71B 2I1QA 3GP8A 4CVNA 5GGYA 2YWVA 4US2R 2DQSA 4JV5B 3I4LA 2MSLA 2W6PA 3P5SA 4FUTA 4MK4A 3W1VA 4OO3A 4MVJF 4URZR 1GUFA 1SCNE 2GXSA 5EZYA 4KIJA 1DLIA 3PZRA 1WEKA 1PJ4A 3IUEA 3ZOKA 4NG4A 4QRDA 3D4IA 4YA6A 3Q1LA 3SGIA 4BECA 3AIKA 2CZQA 3OICA 1X1AA 4H08A 2E89A 1E0DA 1GAJA 3I0NA 4J4BA 3PDJA 2EBUA 1ULBA 5BWMA 3VU1A 1UZUA 4QUJA 3QU2A 1FRVA 3WIBA 4WGFA 4C2BA 1RM0A 2RIRA 1C7FA 1H0RA 3V7UA 5IVDA 3K30A 4D46A 4EKNB 3Q1KA 3GH1A 5E6SB 1N7GA 3QPUA 4E12A 2QPAA 4RLHA 5KYGA 1KOGA 2BTOA 4G4SO 2FEOA 4S1NA 2DG2A 4MHOA 4XYGA 1B1CA 1Q6ZA 1F9AA 3WGLA 1Y8RA 3U55A 1JHPA 4HVLA 3C3DA 3DM9B 2JEZA 4RKEA 4YMHA 4GYYA 1SOAA 5A0TA 3HYCA 3L7BA 3CZPA 4GNKA 5K3FB 4FFOA 3RYFB 4KXWA 5LXTF 4TLLB 1YDEA 3LRPA 1UFKA 1G7CA 4RJLA 3S3TA 3ZW9A 4LTMA 4HN4B 5CPBA 3AM3A 2X76A 1M34B 1QH1A 3IIEA 3LKBA 4FEEA 3SBDA 1HX7A 2EKBA 1YCDA 4C06A 4UFZA 4GLWA 4KIFA 2JATA 4ZI7B 2PUVA 4XZ3B 2DBYA 3UHOA 1WY5A 3TMKA 4TPKA 1S2GA 4EUEA 2GO1A 4YCSA 3I2IA 2ZSAA 3DYVA 4UAVA 4MWSA 5LDGA 3BGSA 4HXYA 2DJ5A 3W5HA 3RBEA 3D7KA 4FZRA 5AW7A 5JWOA 2RBEA 5A4IS 2RDIA 1VSBA 4MYHA 4L51A 3U7FB 1CLEA 3GJQA 2Q2QA 2ZIZA 2YW2A 2C4UA 2V7VA 3MVEA 4UHHA 2PQ6A 5FTKA 5L3QB 3S5JA 1OV4A 3ZHXA 2WIKA 2IV7A 2Q5OA 2O8DB 3FXAA 3ZTTA 2HIHA 5FNVF 3GVPA 3GNQA 3ZLTA 3CNQS 1GYPA 5BWCA 1ISRA 5CK4A 1T4MA 4TQ9A 3A32A 2ZIVB 5CHEA 3UZBA 2J4FA 2P0YA 1PR4A 3AHGA 4PYLA 5A71A 3LO8A 1SKMA 2IFTA 3G59A 2XQIA 2EJVA 1G20E 3CSDA 3IIKA 3KZKA 2YWBA 4NI5A 2IRWA 5KSOA 3NO4A 3CUWA 5FI5A 4Y1EA 1VPLA 3BH0A 4RVDA 3ZCUA 3CEMA 4Y6OA 1X42A 4UOEA 2AOTB 1W2WB 4F72A 4IIFA 5JBQA 1NPTO 4Q1AA 4TTVA 2EX0A 1P3JA 3H87A 2HCBA 3FMGA 2OGSA 1ENYA 4RVCA 3S2UA 2E85A 2GAIA 1I6UA 2IEDA 4N01A 5D87A 3RHTA 3W1WA 4D97A 4HATA 5G0WA 2AF3C 4DV0H 3VAZA 2JHAA 4G5XA 4NXNH 2Y3IA 4BB0A 3MXOA 4FT4A 4R1PA 2FGKA 4A3JG 2F8SA 5K4AA 1WVMA 3BWMA 1A72A 2GCOB 5ADWA 2J9XB 3KUXA 1ULHA 4EABA 3ET4A 5DBHX 4ZDWA 3BERA 5BR4A 2UXBB 3HFJA 5FR9A 3FDJA 1W6UA 3KKEA 3R5JA 1ZM2A 3ZDZB 3IEVA 1NV8A 1YZLA 2J3KA 4EP1A 3HA5A 4ISBA 3L6CA 2P8JA 4ECAA 5A5VA 3D6JA 1WD5A 1OB2A 3V6HA 1CE8A 1NYLA 4I46A 1MVNA 1NV9A 2BSXA 4GGMX 2A0YA 2VPWA 5F33A 2QROA 5JDIA 1Z68A 4ZIRA 1W4CA 5JROA 3IOMA 2NIPA 3TQCA 5EWJA 3MWGA 1A98A 3O2JA 4DTCA 1YRWA 2PZMA 1UBKS 2LW7A 3RVQA 5L3SB 2WB4A 1EFDN 1ZMTA 3LQKA 4C0XA 2FZVA 3TZQA 2J3JA 1OKKD 1QIJA 2VBGA 3QXSA 2ZS8A 4W5TA 4EVIA 1KAEA 1J6UA 2XC9A 3N8HA 4OJKA 3LQ2A 2R66A 3C85A 2HYIC 1G4AE 1IZZA 4JYCA 2A9OA 2VJMB 4JBXA 1R0KA 4Q39A 4QDXA 5LA6F 2IUTA 2JFUA 3UJ3X 4KMOA 2NZ8A 2R6DA 2ONCA 4QOSA 5KNBA 3NYRA 5CHYA 2ZBEA 3ODPA 2JGNA 1AQ6A 3LT5A 1KQPA 1Q6YA 5EJFA 1JEQB 3Q7TA 1H1TA 4MPRA 3B3FA 1WCMG 2H59A 4C76A 3IDSA 3G0DA 4GRAA 4RVFA 2OXIA 4H1TA 3TDMA 3Q8PB 2Y99A 2IS2A 4L8YA 4OHXA 5FXMA 1IATA 4EARA 4MLZA 1T36A 1Z12A 1I33A 1C50A 3PGJA 4EJ6A 2QRUA 3K8QA 3ZY4A 5KU1A 1W4BA 5ICFA 2R6GA 4RA9A 4L2IA 4KDEA 4EAAA 1A76A 2XITA 2WE7A 3HJTA 1S3GA 5BXYA 2HMSA 4BQEA 2AMYA 1R6AA 2NYUA 3UPDA 3H75A 521PA 3GJ3A 5HFAA 4IZIA 1WSAA 1VLLA 4FGZA 3AOEC 4RAZA 1U28C 1EP3B 4C4PA 1DXHA 4JOQA 4BVHA 1W5TA 1G21B 5KFWA 4BEVA 3B1WA 2QYTA 5LQUA 4RL4A 3R0JA 4IVPA 4KH0A 2P9BA 5TXGA 3KJGA 3PXEA 1KMIY 3G5LA 3I9JA 3R0ZA 2JFBA 3IC5A 2CLKB 5AHWA 2QBYA 2OG1A 5C35A 5NULA 2CHQA 3ORRA 2FPRA 1KVQA 1XZAA 2ZRFA 1DLJA 4ZEWA 1VHLA 3FFWA 3JD2A 4OSPA 2NUAA 1JSXA 4ZODA 3LUDA 2FK3A 2C92A 2FEMA 3CNLA 3U2QA 4OHPA 2A92A 2QRVB 1GM5A 1NNUA 5HKLA 3OPYB 2NNLD 1OY1A 4Z86A 4FBLA 4MVJP 1FMLA 3RS2A 3Q8SB 3N3AC 2XMSA 1NI4B 5M5BA 3CO5A 3V4SA 4FYJA 1SK9A 4D3YA 4F5WA 4CIXA 1VJ5A 1PFKA 1EUCA 3FM9A 2JA8G 3BCSA 1E1QD 1P4HA 3H6HA 5DW0A 1M2OA 4XDYA 4NG5A 5FWYB 2GD1O 3ASYA 4HDKB 4B8ZA 4Q00A 2B37A 1JWBB 2XCQA 3RT7A 5DGXA 1H2BA 4M9QA 3E1GA 4XARA 4TUYA 2EW8A 2I4TA 5CXUA 1X7XA 4CLOA 3I6ZA 1FX1A 1GRVA 4O29A 3DAAA 3V6KA 4YVFA 2QTZA 4C14A 4QBFA 4EMUA 1U8TA 4KX3A 1XQVA 2HHHH 3KVNA 5JNWA 2FSGA 4XKJA 1CZKA 3GTKA 3HO6A 1JXQA 4MRPA 3PHHA 3L92A 4BN5A 1SZJG 2YFKA 4R0MA 2JH9A 1AM4D 2QDXA 6NULA 3GY0A 5JARA 3R9WA 2XCUA 2HSZA 4TT3A 1BAPA 3RS9A 1RM4A 4R2IA 2ZYUX 5DMHA 3RFVA 5JZOA 4JVSB 2WB1A 3D9QX 1X92A 1VM6A 2HX1A 2VYFA 4PZ0A 3J7AK 2FG5A 3EGXB 4ME6A 4DM7A 4Q3AA 4R3WA 3BK1A 5FYDA 4CKYA 1TM1E 2HRCA 2ZWPA 2FJUA 3Q5GA 4HY3A 3U56A 5CNKA 2WSSD 3MGAA 3INGA 2I62A 1T36B 1GFIA 4MW6A 2POQX 2YWDA 4OQPA 1TA8A 4AKIA 5F78A 2I7DA 2W8BA 1DCFA 2GMWA 4AKTA 1V9SA 4QOIA 1JIVA 4R16A 4Q05A 3EULA 2Z8XA 2R93A 3LKZA 5TMPA 3CA8A 2QN7A 3SM9A 4X54A 1JFTA 3BMQA 3TQFA 3B7WA 3DAYA 1HE8B 5J9FA 2ACVA 1S0NA 3VO2A 2BH9A 1SQ5A 3RF2A 2VF4X 5TGZA 1E18A 4G36A 1DPGA 1YJQA 1MD9A 3OAAD 5JSZB 1QTNA 2R96A 1RBQA 3ZV7A 4P4GA 2XT6A 2FMFA 4QXAA 1UJ6A 2A6PA 3KTDA 2R6FA 2J45A 4UFOA 2HUPA 2G09A 1BVUA 1SBNE 3UUGA 1O94C 1VKOA 5J4KA 2XNHA 4XIIA 4CT5A 4S24A 1UP7A 1JYEA 1D2CA 2GD6A 1Q0QA 3PEEA 1AC5A 3VH4A 3L8MA 3QTTA 1RKVA 5D5HA 3PD1A 3TW8B 3HV2A 2VJQA 2JAOA 5HKKD 4WLFA 2Z9CA 5FD5A 1AURA 3O47A 4XSGA 3RG8A 1T2UA 5HIAA 5JYBA 3OCWA 4UHCA 3V46A 3ZS8A 3SSMA 1N9KA 2ZM5A 1GEEA 2WVAA 3GXBA 5KU7A 3QK7A 4CV3A 3ASUA 4EF5A 1E1RD 2DTXA 1A5ZA 1YB5A 4ASUD 2X8JA 3IT2A 3ZU5A 5L1LA 2VH5R 3CUTA 4UCUA 1B15A 4CXMA 4UAJA 1EUCB 4QUDA 2ZQ5A 2HADA 3NOVA 1TC2A 4MEAA 3PFGA 2W2PA 3E5MA 5FLMG 6AT1A 2AEFA 3QLTA 1JT9A 3IUBA 1HI9A 3VPDA 3N39C 3DTYA 5B3AA 3VU8A 3BUSA 1R5BA 1DKQA 2P8SA 5HF8A 1AGNA 4DBZA 1XZEA 5DX8A 3KJQA 4ZVNA 3FLEA 1U1DA 4B2IA 4XFDA 1S4MA 1G8GA 4JA2A 3BXFA 4RIIA 4WLOA 1QKJA 5BWOA 4V0RA 4MROA 4P8RA 5A0FA 4NU8X 2I2WA 2YN4A 1KEZA 4QRIA 1G5RA 3VKWA 2IYWA 1NQOA 3QOYA 3LA8A 4MI3A 3GDOA 3GV5B 4ZO6A 2IDJA 4Y6PA 4MQEB 4MDEA 1XDSA 4CBVA 3S8YA 2RHCA 1U7UA 5BN3B 3KDPA 3PC8A 3MT9A 1NN1A 3PXXA 3NVDA 4GRIA 3LDUA 2AX4A 4L95C 1VPEA 4ZGGA 2C57A 2RSLA 3KL4A 5A9SA 1FS6A 4B4VA 4K9LA 5LXTB 3JRNA 2DPJA 1AQNA 3UYKA 4X62B 3K9NA 4R51A 3V4OA 3KSAC 1RJFA 2ZTMA 3FSGD 4MI6A 1AZLA 2O8BB 4BMPB 2FRXA 1N2CB 2AU0A 1Y1KE 1SXJE 1I1MA 1RABA 5HEKA 4G4SP 4ED6A 1XP8A 2WIBA 1WG8A 4LHVA 2ZUCA 5TPZA 1JW9B 1U3UA 3T1YB 1FNMA 2C4NA 4JBHA 4YMSA 2W6CX 3LUJA 1GARA 1PJSA 3E1SA 5KTNA 4GSKA 2IZ5A 3V3TA 1BW9B 4CTNA 1HRKA 3AF6A 2O48X 2RI6A 5GM1A 2ZIXA 3GWGA 1VBMA 3MFYA 2ZBGA 3U6KA 1RXUA 2B7BA 4WZZA 5B12A 3AZOA 3HSYA 3JQAD 5FNVB 1XU7A 3SQDA 2MCTA 2KQUA 3TEMA 4GPZA 4H27A 1SCJA 3SF8B 4UTNA 3BGOS 2GN0A 3X0DA 3OD5A 5EOVA 1X38A 5I7FA 4KVAA 3KAJA 1GG2A 3U13A 4J9OA 4QUBA 4M87A 2KLBA 1DAAA 3DNPA 4PRYA 4LDQA 4IGAA 1MKYA 2EWMA 4OL9A 1KGSA 1VPWA 3EVZA 4JKYA 4XJTA 1I5EA 1TZMA 4TLCA 1L7VC 2XVYA 3NHPA 1IHDA 5H3LA 1IPEA 2HIVA 3DE0X 1TJPB 4FYIA 2A57A 4NCXA 3Q5EA 2NUTA 1X94A 3IEXA 3F47A 1SA0A 4OAPA 1Y6GA 5BW5A 1X8KA 4JYAH 5A4AA 4X6UA 4JHXA 1WXFA 3H0KA 1TI7A 1UDCA 4KX5A 2J6CA 3SR4A 2P5SA 5F5NA 2ATIA 1SVWA 2V0NA 4LBVA 1MEOA 3TIGA 1P9LA 2HLDD 3DLTA 5KTRA 1FFWA 2ZRBA 5F2NA 1CCWA 2O05A 2GJSA 1MPXA 4LZPA 1AQYA 2Y1DA 5KYYB 3D6VA 2B7LA 5IUJC 1E3JA 4FEAA 1DRJA 1XCOA 1ZD1A 1M10A 2IHKA 1GUBA 2WZBA 3DOHA 4PC7A 2MSEB 1QH8B 5BSWA 2A9JA 2GFHA 1B7GO 4HUQA 2EFDB 1M6EX 4HFRA 1ZZEA 1N0WA 2EZUA 2WWVD 2O0MA 1V5EA 4A3MG 2GAAA 3FNQA 3HKDA 4RHUA 1DWPA 3O82A 1FQOA 1YULA 3TG2A 2VWHA 4JI8H 3WG9A 1ZGBA 4R8KA 4I3GA 3MS2A 2A7XA 4QJ5A 5BYJA 5FPRA 2QM0A 3IMKA 5AVTA 5C3MA 3UFXA 1HKUA 1EHCA 3KOMA 3IS3A 3G1TA 4M7PA 5KG0A 1GXSA 3VSCA 3DWIA 3EIOA 1KJWA 4L73A 1I4OA 4CC5A 3L7AA 4LV6A 3OTOH 1CKMA 4JL6A 4RQUA 3VR2A 5AYVA 1ZETA 4C7OA 2VSFA 1YAJA 5JNVA 5DCLA 4BPBA 5BNFA 1MIOB 4QBGB 5HKOA 4PLPA 5LA6B 1O9HA 2UZIR 4B7UA 1PEKE 4M8IA 4NC9A 5C34B 1YZYA 2VCEA 5I4CA 2DWPA 4YBZB 1CJSA 5TLSA 1WAMA 5BN4A 2YRXA 1MOPA 3EFOB 5DTIA 1OQAA 4PXSA 4OK5A 1MXHA 4P4UA 3EMBA 3DO6A 3OIVA 3CXUA 4KBGA 1IBRA 5LQKA 2JGDA 1ORTA 2QTVB 1Q2XA 4YV7A 1ZCBA 1E0KA 4A91A 1G3IA 1I3MA 3AFIA 4RV4A 2WG2A 2YVUA 2EKPA 4XOIA 1H42A 4HDOB 4Y7DA 1RE1A 1HC7A 4RPCA 3EZNA 1JEYA 3NBYC 2A3NA 4QO7A 1M0TA 3LUCA 3CEPB 4R2WA 2YWGA 4N5MA 1XEAA 2Q28A 2VOEA 1GRQA 3WIEA 3JV7A 1ZICA 3BSSA 4PZ7A 4XWKA 5HUJA 1L0BA 2NZXA 3BCUA 2AQKA 4KEAA 1NHWA 5LL6P 4CM1A 2FN3A 3QVTA 4UBNA 2IEBA 1D6MA 2FPIB 3ZWAA 2GJKA 4AO6A 3KJIA 1QNFA 1U11A 3RJ0A 1ONBA 2WLTA 5KSWB 3DT9A 3PO3G 1G6KA 1SA0B 1EVKA 2CSXA 1K0UA 1XDUA 3LFTA 4IZ6A 3RSSA 2HHCA 5IASA 5IMSA 2XVXA 2W9AA 2OCLA 3N42B 4OLAA 3NBZC 1RYFA 2GN6A 16PKA 3I5AA 4F45A 3CRW1 4UQPA 4EA6A 2RB5A 1ZNQO 4AECA 1LRKA 2CLIB 2W6OA 3NVKI 2AG5A 4B6SA 4P35A 4R3NA 4NBSA 3WZ2A 1NM5A 3SE7A 2C4MA 3ZIDA 5DYTA 3LY5A 3CEAA 1H85A 3PEYA 3NCHA 1F5NA 2VFAA 1OYVA 3FGPA 2XNDD 4MEJA 3IOEA 3WRXC 5MHTA 4KGZA 5DGCA 2QRKA 1TCUA 3RUPA 1G2WA 2CL7X 3IAFA 3V7YA 4GKBA 3LIPA 3H13A 4Y9SA 2QUIA 4M9XA 5BR8H 5C8ZA 3AETA 4H4DA 3UMCA 2GD2A 3NR2A 1KFJB 1RXCA 3HBJA 3WIDA 3K0SA 2Q5CA 4LNUA 4IIHA 3GYGA 1O8BA 3ND8A 3EF1A 3VNNA 3AY7A 1K8QA 5ECYA 5AKHA 2EQBA 3KXIA 2R60A 3ZGNA 2CEAA 2J41A 4NOJA 1GXSB 1QE5A 4CKWB 5DGDA 3FYSA 3JQBA 5K0TA 2G0AA 4UUNA 3UWOA 3KT8A 5ES3A 3AT1A 3BQ1A 3AJ8A 4AF7A 1LC3A 5F76A 4Q3EA 5I7AA 1QV7A 3Q3HA 3EBOA 5EXSA 3P9KA 3DLBA 3K9GA 3LFUA 4HNVA 4LYDA 1E3MA 3E2PA 3J7TA 5K4GA 3CX4A 1S2LA 1PNTA 2XUOA 3UGKA 1R64A 2MMCA 1Q77A 2W00A 4A8TA 1V7PC 1KVSA 4YALA 4C0QC 2I2DA 3WMRA 4M83A 1EVYA 1U2RA 3GEBA 5K4HA 3EZYA 1LDNA 2CL6X 1T1GA 4MS3A 1I14A 5HV6A 4ENRA 4X65H 4HPXB 2G9VA 3QVKA 2HLHA 4IQFA 3WB2A 3EDOA 1KAOA 4EEQA 1QFZA 4OJQA 2GPWA 1ZK3A 4HNUA 3CJTA 2NGRA 3G2MA 3ZY5A 1TAHA 3UIEA 2WHXA 3D0KA 4LBZA 4UE3S 3BS4A 1WD7A 2BKXA 4OXIA 4PVDA 3ZJUA 1IEVA 4MIOA 5KSZA 2QX6A 1Z62A 4M36A 1J8YF 4RD2A 3ZEAA 1CJTC 2J5KA 1XQ1A 1EPUA 1IN8A 1RJQA 1W44A 4FVTA 3VVMA 3LUKA 1ZUNB 3ST7A 2FE3A 1RTKA 3QMWA 4Q18A 2ODWA 2WJVA 2VUMA 3SSNA 3VR6H 4V3CA 2ECKA 3P26A 1KI9A 3FI9A 1W9MA 4CQMA 4PZYA 4OHZA 5D3MB 5CLJA 2ZB8A 5DCYA 1MRZA 1E2KA 3VR4D 4WN9B 2YW9A 3GJ0A 2HOQA 3BJZA 1RMTA 3TMAA 2HLPA 1RADA 1C7IA 5KDDA 1NW9B 4J16C 4YJ2F 3FR8A 3RRFA 4A92A 1JSZA 5KTMA 5ECWA 3W1BA 3NX4A 2O3TA 4RMNA 1GTJ1 4EEZA 1VI2A 3G8DA 5KOHA 4COOA 4RZQA 2AW3A 3FFBA 1ISMA 3RS3A 3GJTA 1NFFA 4IIJA 4EITA 3TEJA 1AB6A 4MUMA 3DVQX 2WJJA 1U9IA 1VLVA 4K0RA 3VR5A 4M1KA 1R8QA 1VDMA 5EZYF 2CFIA 1XEXA 4MR7A 4HGPA 2R2AA 3K0KA 2A1UA 1ICIA 1Z34A 3CFYA 4PYQA 4K8OA 3VVLA 3UC5A 1G8PA 3AF5A 1II8B 5JFGA 2OUKA 5IM4A 4QA9A 4ZGBA 2XLCA 2DLNA 1JBQA 1ZLYA 2AEMA 1JQLB 4CUKA 4Q24A 5INTA 3DMDA 4C0KA 4S05A 4IGEA 2G3YA 2VDWA 4IGKA 4AMUA 4EHDA 5DP1A 5ALJA 5HUHA 2BGJA 4JODA 1ISHA 4HNGA 3ZH2A 5I5EA 1TC1A 5DXAA 3PW5A 2B94A 3AR7A 4ITRC 2JBWA 1SCQA 5T6MA 3OF2A 5JXIA 3OLWA 3MPOA 4L4XA 4IW3B 2ZYDA 5IW8A 4MKFA 3TL3A 3HGQA 2FPUA 4Y6RA 1GKYA 3UH0A 3LFHA 2IHBA 4X7PA 4BXOA 4C3ZA 1SZPA 3OFSA 3UZOA 2EHDA 3TOXA 2AE2A 4DW8A 4KIUA 1LBTA 4IG9A 3GRKA 3MQFA 1P5HA 3U19A 2WILA 1JQ5A 2IE8A 3BRCA 3H5NA 1YQXA 4U7FA 5CA0A 2XCTB 2L19A 4B45A 3A7DA 2ZBFA 3ONNA 2VT6A 3TIVA 3T5PA 5FEMA 5JJBA 3DFMA 4YCCA 3ESAA 4X20B 5I48A 4K2HA 1L7QA 2BRUC 2HGXA 1OIXA 3HLTA 1C80A 1IY8A 2IJGX 2B4AA 1TJYA 5BV1A 2RONA 3D7LA 3UK0A 1BFDA 4ROSA 4G0UA 2RKOA 2DWUA 2GZSA 1T43A 2Q1TA 1CIPA 1NBWB 1TYAE 4D99A 3W9SA 2JJ1D 1G38A 2CKDA 1I7PA 1CUSA 1TCCA 4E3ZA 4C4TA 2WAXA 4I4IA 3UAYA 4B6GA 4JNKA 2Y9MB 2FFHA 4K1XA 2GK4A 1RPZA 3FMVA 2HVQA 2J3EA 4H4CA 4EPWA 5IJ9A 3MR3A 1U7HA 4MHTA 3BHIA 2ORVA 2P9FA 4BKPA 3W6ZA 1VJGA 3IAEA 3FYUA 4RCYA 3BG5A 4Q7EA 4IR1A 4UUBA 3CLTC 3I9NA 3LPCA 3WYNA 2IYTA 5TS3A 2R6HA 1XELA 4P98A 1N8SA 2WDTA 3MTEA 3GRFA 1WU8A 1UZNA 2B9VA 2CDAA 3A11A 3F97A 2C07A 2GEBA 1S6YA 3VRHA 5LZ9A 3EVAA 3ZGLA 2PZFA 2QHXA 4LOKA 4BV2A 5L6MB 3WO1A 3DCYA 2QGZA 3A28A 3RADC 2BI4A 3FGNA 4QHTA 3KYJB 3JW8A 2YH2A 3WZLA 4MWDA 1T0UA 2XCLA 2F9LA 1KK3A 4BBJA 4CU2A 1FFBA 3OM0A 3O21A 1KSJA 4AQ7A 1YJBA 4KMSA 4MR7B 3IAS6 3OLXA 4D4LA 3R0VA 5J47A 3RKRA 2F90A 2J6BA 3RS4A 4O25A 2G70A 4R01A 1QZ3A 3JAMW 3ETEA 2JIMA 4E2WA 2W2KA 1OAOC 1FMCA 2DHQA 1XAHA 1DV1A 1Z4KA 2PYZA 3UXMA 3G8BA 1W47A 3MG9A 4N0MA 4QTYA 3BB1A 4DLZA 4OXRA 3I1FA 3M6FA 5CFMA 5KKNB 1F6WA 1N1MA 3FMFA 3HGTA 5HJ2A 4M0EA 4U9IS 1D7OA 1K8ZB 4X24A 4EGFA 3WYDA 2VF5X 4JI2B 3QSGA 3RBXA 4MCAA 4DTIA 3SKVA 2IY9A 5MGNA 2UU9B 4DNFA 4DARA 4D1YA 3WP0A 4O4HA 1FFCA 4DSTA 1XPOA 2CJWA 2IXGA 3KQVA 1ZN9A 4OYLA 2FWMX 4IDQA 2HSGA 3IAAA 2VPQA 3EQ8A 5CA0B 3FY4A 1E6WA 3KSZO 3KB2A 5FUBA 3UPUA 2XMZA 4MPJA 3EXIB 3BJYA 1GZHB 3DW1X 2ZQZA 2ZUDA 5FR1A 1K6XA 2APJA 1I3LA 4GXTA 1IBLB 4KHPB 2OO7A 3ICWA 2HA4A 3RC3A 1P61B 3NIFB 5KNCH 1UPUA 2FCAA 4TS1A 1PR2A 2JHCA 4V0KA 2C9ZA 5DSXA 3PZPA 1YMQA 4KP7A 4AG3A 4AMGA 5SICE 3WGVA 4ETIA 4U8HA 1KC1A 1MF7A 4IFIA 2KS6A 4IMIB 1SRRA 1IYDA 4MZXA 4IIEA 2V9PA 4UKDA 4PHFA 3KFLA 4YP3A 4HZUA 4Q4DA 1F8XA 1SU6A 3K6JA 1SB8A 3JVEA 4YUWA 4BVFA 4B6EA 4URVR 2L2QA 4YAJA 3ITDA 1F3OA 3GLSA 2MR6A 2PPVA 3TSOA 1H8HD 2WIJA 5B7NA 3ZGVA 2H4JA 4PFQA 1P7ZA 1ZVQA 2HMWA 1VI6A 3E7WA 1VE3A 1G5HA 3O2SB 4CG0A 3WK5A 4N5HX 1F2UA 5E6UA 2AMLA 2RC5A 3HKCA 4LDJA 5FD8A 3FN4A 3KEGA 4DCVA 3T4UA 4WADA 3MLAA 4MGKR 2HZ7A 1UWVA 2BMWA 5FF9A 4JMLA 3TXAA 4NQRA 4Q7QA 3JASA 1NDUA 3R40A 1A8SA 2O2GA 2D0DA 3L8HA 3SQMA 2ZJ1A 3M4YA 1R5OA 3MUOA 2VWQA 2G8NA 4GZMA 4BQSA 5D1OB 3BN3A 3FKIG 4I1RA 3FGOA 1T8YA 2NX2A 1SU4A 621PA 3MINB 2OR3A 3PCXA 1R4ZA 4V39A 3UOAB 5KYXA 4OB7A 4IJMA 3INYA 5ALKA 2O6HA 1Y14B 4MJLA 1Z6TA 3OMWA 4YRRA 1NMEA 4EHJA 1M1NB 4IKOA 3RBAA 2QP3A 1PLKA 3RK4A 3FVTA 2ZYVX 1EBFA 4HB2A 3AI2A 3QBEA 1RKUA 1YS6A 4A8JA 4HDSA 4XVRA 1VLHA 5KFEA 3B3GA 4MS4A 1ZM7A 3JWHA 3GC6A 2VA2A 1GFSA 1X7ZA 1JQ3A 1SHUX 5CFRA 5IJ0A 2FQXA 4Q3BA 4GGPA 4QPNA 5JE8A 3S44A 3MCWA 1SQFA 1UZMA 2NSLA 2GN8A 3FTEA 3R3XA 4CFSA 1N4DA 3ND6A 4LXTA 4PFJA 2BFEB 3FETA 3K9FC 3H1AA 2OAP1 3OHSX 1Q0HA 2XMQA 3O3CA 3F4LA 3PQFA 1KEPA 2CJWB 2R47A 1GN9A 4F71A 1CF9A 1KOLA 1PS9A 4K9NA 1A2BA 3JWGA 2WSLA 3RUAA 2WAOA 2JGMA 4UZEA 4FLEA 1YB4A 4KQ6A 4XGKA 5KAPA 3HCWA 5TQJA 3I8SA 3KSBC 1M7GA 2A2ZA 3NS7A 3DHEA 2YS6A 4TUYF 1CHNA 5KSYA 3VUFA 2Q4OA 1MENA 4NCIA 3OF3A 4DDVA 2XLBA 5IFKA 2ASEA 3RTDA 4RX1A 4HQOA 2B1JA 4LF9B 1GQ2A 2P3SA 5TY0A 2IS4A 4FP9A 1QAMA 3F5QA 1MAVA 4M60A 1P0IA 4J4HA 1ZP6A 2FN7A 1LV8A 1UOEA 4GVXA 1RK6A 3I0ZA 2YV3A 3C3EA 3CLSD 1EBBA 2SKEA 1MPTA 3GIQA 3RVOA 2GCEA 1SQ6A 1UK7A 1TAUA 5ES4B 4C0AC 1NF3A 3F98A 4EYKA 4UVIA 2JKYA 3SVLA 3W3AD 1CQIA 3NHZA 3IIMA 3CLRD 2OZEA 4KSYA 4DFDA 4ZDIA 5F9FA 3T9BA 4BDSA 3Q3IA 5BWTA 3VHXA 1D1QA 3GJXB 4WUTA 2DFPA 4M98A 3CUSA 5EEHA 2VDLB 1C3OB 1Z07A 1KAGA 1NMXA 3Q5DA 1D0SA 1UIRA 3F9IA 5LB4A 4OBBA 1HBJA 1OBVA 4Q7MB 4ECXA 1F2UB 2NXCA 1UBCA 2H3HA 3G2JA 3U9LA 4TYQA 4D7AA 4ADSG 1F38A 5GQSA 3BXHA 1ZSNA 4L78A 1DAPA 3P96A 1LD3A 1WUTA 2C2KA 2A9PA 5A3VA 1A5SB 1USIA 1Y1QA 1J07A 1Z7YA 3FZEA 2XGGA 4B44A 5K8TA 4BB6A 2PX8A 1OPXA 4DDWA 2FB9A 3RB0A 2PKWA 1MTZA 1JIKA 3B9PA 3KCNA 2PKCA 3IUNA 4QPJC 4KNVA 3FKSA 2BY4A 1TMGE 1FP1D 1KOJA 3QJYA 4DY4A 2JK1A 1D0VA 1XC7A 2DUJA 4YMUA 5KJEA 5BSHA 3PU6A 2SKDA 2WD7A 3UWSA 5CVCA 1Q0TA 4EFKA 1VS0A 4J0DA 4MV6A 3LSYA 4OX9B 1TT5A 1NC1A 3SYMA 3RSFA 3D2LA 4RB3C 3AHDA 3EXHA 4AY5A 1ZQ1A 3K35A 4YJKA 3SJZA 3IPAA 4PQGA 3OCUA 1GQYA 2OCBA 1FP7A 4PU0A 2W2XA 4Y0VA 2Z95A 1O03A 3ML1A 4C7MA 1FFYA 2R84A 1GZ3A 1HT0A 1MBZA 2J3IA 5G40A 1LZKA 3MUFA 1PWYE 2WTEA 4UMEA 4YJ2B 4DNXA 4I1PA 2IZ0A 1U8CB 1MO4A 1YIDA 4J9MA 4OI2A 4RM2A 4YO8A 4FHDA 3FSEA 1L8XA 3OZCA 1A9ZA 1OI7A 2ZTVA 1P81A 4LJ7A 1T35A 5B1SA 4UM8B 1Q14A 2Z8YM 3E7XA 1A97A 3EZXA 1NYQA 5EZYB 4BO4A 1OA1A 4XR9A 4ESVA 3QQMA 5KG5A 2G6BA 1Z4JA 3GRPA 3PIIA 3B5EA 3WRYC 1C9MA 1JDEA 4B3CA 2PV7A 2JIBA 3B1ZA 3MOGA 3W2GA 2RJNA 1KMHA 2VH2A 2ZJ8A 4KQGA 4IM7A 1RQGA 3PPVA 5FPQA 1JAHA 4PZPA 3CISA 2PGOA 1N92A 3CUUA 2A9QA 2NU9A 4ZYXA 4IHQA 5GOTA 3FRIA 1QHSA 5CLHA 1N57A 2GYVA 5EIBC 2OLEA 2XUIA 1Q92A 3OOWA 3ZHVA 3TUZC 2BM1A 2EC5A 3F96A 3ZV3A 4M8NE 4G9GA 4C2AA 2WTAA 1L3BA 1QPBA 5CVEA 3IUYA 4DV2H 1T2VA 2YFHA 4ZEOA 2VSOA 5DN6A 2ZSIA 2CVPA 3DEAA 4RMIA 4LZJA 4CODB 3FMOB 1VG0B 1HDRA 4DJ5X 3Q6MA 3W6PA 5IXJA 1Y8RB 5TIIA 2QI9C 2JFQA 4HJXA 3A6FA 3ZI0A 4YT4A 4FINA 4G3IA 4B3RB 1C1HA 3N2ZB 2BFAA 3VZQA 3QKIA 5JSUA 3OMXA 1KYYA 2VK2A 3H3XA 1KJNA 1T5DX 1XFAA 1XYYA 3C3MA 5I9TA 2Z4SA 1UJ4A 1QH1B 4AYXA 4CV2A 2VUUA 2V45A 3ICOA 2XZDA 3BE5A 2QW8A 1FYDA 4H3KB 2E4WA 1ID1A 4QHSA 2L69A 3U4MA 5CPFA 4D41A 1MZVA 4G0MA 3U0GA 4QDZA 4BC1A 3SNHA 5A06A 4KZKA 3SHTA 5JU6A 2D5AA 4Y1RA 1CB7A 4LVUA 1KARA 4U9HS 2RGDA 2X1VA 1DFGA 3FTPA 3QMPA 1D5CA 4DV4H 1D03A 3G9UA 1USKA 4KDCA 1B8UA 1C0PA 3ZHYA 1RKXA 2UUCH 1XCMA 1JZQA 4YT5A 2QE7A 3PDIA 2WD7B 3TK1A 2YCBA 4PLGA 3JQGA 1EFUA 1ZGJA 4YHHB 5B57C 1TT5B 5LJIA 5D6OA 1G16A 3VAYA 1L2ZA 4YCLA 4CEJA 3MQ4A 2VNIA 3MUNA 4KUGA 2AOUA 3BWEA 4BNLA 4X00A 4NV0A 1XFDA 2N47A 4BVJA 4FDTA 2GZDA 1VE1A 3G5MA 4PC6A 2ADMA 2AWNA 3CRRA 3O1HB 3AV3A 5H0IA 1P19A 1RRVA 1Z13A 3GX1A 1B14A 1VBGA 1P8AA 4YASA 2G4LA 4HR7A 1JIUA 1ZYUA 4QXPA 3OZUA 1L5VA 4KE8A 2WOJA 5BSEA 1HKHA 3ORYA 5LMUB 3IQZA 5CH3A 3OY2A 3I4NG 3A6GA 1YQ9A 4R8UA 2OC9A 3UJBA 1U1GA 4OQFA 3BIOA 1PN3A 5IKOA 4I81A 5CDGA 2QJRA 3DAGA 1RXVA 5HKKA 5L3VA 3HE3A 4C6SA 3FOEC 4CTMA 3FNEA 3A9CA 4II2A 3QNUA 3EEOA 3KB6A 5K99A 2ZB2A 1RR6A 4L07A 1ZVJA 1BC5A 3F90A 3OMLA 1BH6A 4JXJA 4KFSA 2SECE 3FNHA 1ADCA 4ASUA 1H2EA 1CRLA 1K4YA 4P4TA 4A03A 3AYXB 4A3BG 5DLEA 2Z6QA 3U4AA 4Y2QA 3ZXXA 4WCFC 1DJLA 2H4WA 3SSAA 1N75A 1BX1A 3ZE6A 2UDPA 4BGVA 3HHEA 2WKPA 2VYVA 3PC3A 1CE8B 4Y0NA 5A05A 2NZ2A 3BH6A 4RPIA 3I01M 3D02A 4E5MA 1JHAA 3MRSA 5HWSA 2QP9X 2P4HX 4AJLA 2HGWA 3HCCA 2ZIWB 4ZIRB 2I71A 1ZW6A 2HWXA 3B2EA 3E9YA 1BDIA 5EWJB 4FNMA 5JAUA 1ABFA 4HN9A 3TZEA 4EGCB 3G23A 4OL0A 1X9GA 3TPZA 2QEQA 5DDIP 2C96A 2HNAA 4J0EA 1EFTA 2ID4A 4NS4A 2JD0A 4WZAE 2Q5FA 3N59A 2WSIA 1D3AA 4CJXA 1WL8A 2CK3D 2K2WA 1P17A 5AW6A 1TVEA 1VL6A 5A3QA 1VL5A 2EP8A 5FL3A 4JEHA 4BLWA 3TECE 3AW9A 1NIPA 1T9GS 5A6VA 4CF7A 4YY3H 4BMDA 1N5LA 1FS5A 2IPLA 2R11A 2BR0A 1WUIS 4CMEA 3F6SA 4ZAYA 2QTAA 4DL5A 3IN5A 4B82A 1RVDA 1JLLA 3HRKA 4I5DA 4Y6QA 5TMEA 1JTEA 3UMBA 2R1ZA 1KKMA 2FG6C 1W52X 5HJEA 3PDIB 3CV3A 4BQOA 1U94A 1IEWA 1KC7A 5ADHA 3OLQA 3JQ9A 4ATNA 1U0HC 1E4EA 1QB7A 2C28A 2O06A 3TW0A 3KJEA 2WQ6A 4RA9B 4L2IB 2YWCA 1UFVA 4UBIA 1E62A 4JBIA 1Y48E 4NYJR 3UJPA 4ZI2A 3I5XA 3QELA 4BQIA 2EEPA 4ZMBA 2DMRA 2Q6LA 2I6TA 3E1KA 2G17A 3PE3A 2FRDC 4ER0A 5HIKA 3AG6A 2ZSBA 3S2GA 4D4HA 3QWIA 1FMJA 4RKFA 1M8PA 5EE5B 1XRSB 1NKSA 4EM6A 5PNTA 4TTRA 3AIOA 3RJZA 3G88A 4BVLA 3ZWWA 1QGYA 5KFLA 4GLXA 3Q40A 4J76A 1RXEA 1F5SA 3U3RA 3F73A 3CCFA 2I33A 1TJNA 3E03A 3LQYA 2IBKA 5H70A 2YC2C 1FK8A 2EQ5A 4CDMA 2O7QA 2RHBA 4FYXA 2QBYB 3SVZA 4KC0A 5K6AA 2NUAB 3V2HA 4LY9A 4ML3A 4ZREA 3ZIAD 4BQNA 4BLQA 2QOEA 1DSSG 4HWOA 2O3JA 2WD8A 2VAPA 4B7XA 5K1ZA 1L5YA 1Y3AA 2W0MA 4KQWA 1E2PA 1M6VA 2YS7A 4G1EB 1ZA2A 5FPHA 1D09A 2BAGA 3Q7RA 1ACJA 4A23A 1OJLA 1OX4A 5AVQA 4GLJA 1O6FA 5KBYA 4RH1A 2XKAA 3C6YA 1BN7A 1FQKA 2QTHA 2P0EA 2JJQA 1M2OB 4XH9B 3ZK8A 4TT8A 3A36A 3ZE1B 4DLBA 4RV5A 5BSMA 3GFVA 3HU5A 1VG9B 4EJ0A 4TUYB 3GJZA 5JC1A 4IUYA 3J7AC 2YIMA 3M3PA 1X7XB 4Y9RA 4CLOB 4PZ6A 3U3ZA 3GLHE 4J9SA 4B33A 3BTSA 3ZHQA 3AVXA 2RF4A 1IVNA 3KSMA 3I04A 1RU3A 3DDNA 2DZDA 2GCNA 3I62A 4ZJYA 3KALA 4I9UA 3H17A 5FOUA 1ST2A 2G9ZA 3DL4A 4LK2A 3QEAZ 3MRXA 2P77A 4H6VA 2DVMA 3DPIA 4M0LA 4ZEVA 4Z0NA 3OZRA 3THSA 2PDAA 3FZYA 1KEVA 4OBWA 2I7VA 3UJHA 1MHTA 2OK7A 2Y1EA 1QHGA 4EATA 4RMHA 1M33A 4PQYA 4DR6B 1KU0A 4FQ5A 2J9FA 1X15A 1NUTA 4ARCA 3MCVA 4AJNA 3PHLA 4XVHA 3VYUB 1RYYA 3UQZA 4DDUA 1UODA 1D8TA 4Z51A 4JEMA 2TSYB 1I5RA 5KOIA 2PL9A 1SUIA 2RDMA 4NMHA 1JQKA 3JAKA 4JASB 5JWRA 1MAUA 1E4EB 2ZU6A 1TMYA 2REXB 2ZETA 3RGGA 3JTMA 2W8BB 3PYLA 3DOUA 5IJWA 1UEJA 4KO2S 4Q34A 2IF0A 1GZDA 2V4UA 5LL6b 3K0AA 1GZ4A 4V0MA 3FOWA 1L3IA 4OFZA 4P83A 2QLJA 1P72A 3BMQB 4JI1H 4JLSA 3WQQA 4GOMD 5E7IA 4H35A 2XDWA 2QVYX 4GF5A 5IMBA 3IILA 3EOBI 4TMXA 1TWCA 1T24A 3BMXA 1TQ4A 3EDMA 2ZSFA 2VWPA 4F91B 4YACA 4OQNA 3NXSA 1BJKA 1UPTA 3A8TA 1PWZA 5GJCA 2Q4TA 2RGNA 4KWIA 5DEOA 3O6VA 5LSAA 1SXJC 3VISA 3QFRA 2ES4A 3L4BC 3NH6A 1ZD9A 3D2AA 4UQOA 4HN2A 1W85A 5KCMA 5KAMA 1KI4A 4H1UA 4L9AA 4A7PA 3A7EA 1BE0A 4DCOA 1F12A 3ASVA 3CSUA 4LXUA 1XWIA 4JGGA 3SZLA 1C5KA 3K3PA 1E8DA 4A82A 1OT3A 4HLDA 1HE1C 4IIJF 2AMJA 2QL9A 3MJVA 3OIDA 1DMSA 2ORIA 5J2UA 3RVSA 1BWRA 3IA7A 3IV7A 1OGJA 7MDHA 5LOVA 1AHNA 4AJ1A 2BTEA 2LCFA 1FVFA 1CX9B 3U61B 3ZU4A 5HMMA 1GPJA 5EPEA 4C08A 2X8JB 2FX5A 4MWGA 4II7A 5IM4F 1UOPA 2FWBA 4IUDS 2V3VA 5MF6A 5FBKA 4Q5IA 3IHKA 4C07A 3HVUA 1A88A 1P2VA 4DLTA 5KFSA 1MH9A 1KI2A 4HS4A 4DL7A 5KYWA 1FFDA 5AKEA 1M2JA 4BKQA 1Q91A 3CLUD 4CF5A 3CBQA 5AIBA 3QIAA 4BASA 1SC3A 4LSXA 5U4QA 1C4OA 2RH5A 4ED3A 3D8UA 2F3TA 1EVEA 1Z5UA 3IAS1 5LYYA 4ZKDA 1MXFA 1QKIA 1YNOA 2O2YA 4KCGA 1JLKA 3PXAA 1E6EA 1I0IA 4TS4A 3QRWA 3NT2A 4AYWA 2QVLA 4UHBA 4Q7KA 1EAYA 3EA4A 4I14A 1DELA 2PZLA 1LI5A 4I2NA 5CA0F 1GZUA 3DD1A 2HU8A 5CB4F 2I1LA 2I4OA 3GJ5A 2H1HA 3FUWA 4QJIA 1WV1A 5BW4A 4CIWA 2ZSJA 2J3QA 1L1FA 2PY6A 4X85A 5A9SB 5F35A 3E7DA 5H16A 3LNCA 1BMFD 1H1LA 4WFJA 1GL7A 3S2FA 3NIWA 5EWLA 5EERA 1GDHA 1UDWA 1W76A 3IAHA 1U0RA 2F3PA 3KKPA 1NLYA 4MDHA 1OSNA 3DFZA 2BF7A 3GU3A 4R54A 5E1BA 1RYMA 5HZHA 1RYNA 4A15A 1Z16A 3KTOA 3LNTA 4KFRA 4LOIA 1BEUB 5TMBA 3H42B 1NBAA 5EKDA 2ZJOA 5KEIA 1ATZA 4MCIA 4AJJA 3ZIUA 4FX5A 5DVZA 1GHTA 3WDLA 4IMJB 1LI4A 3A3KA 2Y0EA 3KQYA 3VZDA 1T9KA 1QIGA 4OI1A 1UXIA 3KKZA 1PL6A 2ZIXB 4CFZA 1P3Y1 1VL2A 2XYGA 1Z5NA 4XJSA 1ULAA 1PR3A 5F73A 2V3CC 3GV0A 1PG0A 3HP1A 3UAXA 3QYPA 5KTKA 5IZCA 2CXHA 5AM0A 3B20A 2M6RA 4DG5A 1YKFA 1QC5A 4O2RA 3WBJA 4QM6A 5G0UA 3D8RA 1SUAA 4KVGA 3WDMA 1V1RA 4X63A 3W6UA 1WLSA 4TVBA 3IV9A 1O8CA 1AKQA 2DUMA 5AJZA 1CUEA 1W36D 2Y0BA 1CEEA 1F2VA 3RWBA 2XMCA 5JD5A 3K8OE 2F8TA 5DWQA 4YCDA 3IR5A 1WQ4A 2DPXA 4YRZA 4M0FA 4ARVA 2OTCA 4AYBA 2H1RA 4KPEC 2P3LA 3PUXA 5A3RA 1E2EA 1UT8A 1ODCA 2NUTB 2PO7A 5EIEA 3GG2A 1B26A 2PJUA 4JSTA 1ZMOA 4C1NA 2JPDA 2VYND 2AKEA 2VTKA 3BREA 1QVVA 4ZXFA 2IIPA 3TNFA 4OHVA 3LH5A 3N8IA 5KWSA 1EFRD 1YSCA 2I3AA 3W04A 5BQOA 1IOVA 3I2KA 1P5JA 1Z8NA 4RJTA 3PNVA 3ZCRA 4EPYA 2YWRA 4ALNA 1JQEA 5LZ7A 5E0KB 4PCAA 2AQIA 1TF7A 5KDOA 3RRJA 2XQFA 3E61A 2PR2A 5EQJB 1T8RA 1NQ5A 4O4HF 4CU5A 3QW4B 1X2BA 4AROA 3BCRA 4HUQB 5HF6A 2JLUA 1ND6A 1FMTA 3IEUA 1OLOA 4EF4A 3PEVA 1YHNA 2CCGA 1N2GA 2YZNA 1NPYA 2C58A 2HJGA 1EB9A 1CUYA 3HKDB 3WGNA 5E2IA 2XAAA 2QVCA 1VQ1A 3FCEA 4L3OA 5CVTA 3B3QA 4FCTA 4F1JA 4V0SA 4YRAA 5KQSA 1R4MA 4XDHA 3GUCA 4LF4H 3UFXB 4LOAA 1CPYA 3N6RA 5JATA 1XJWA 3KYDA 2H11A 1JWLA 3TRHA 2X3FA 1KI3A 3DAOA 4F4HA 4NZZA 1ZH6A 2F2TA 4C7OB 1THMA 5HDQA 3H9GA 2E4UA 2JI4A 2YZKA 5KCZA 2PLAA 1AKVA 3LOPA 4E31A 3PHBE 3HB4X 3ZLJA 1VKJA 2BUBA 3ZC3A 1AUPA 3SN6A 1N33H 2O5VA 4FLFA 4IBOA 3CT6A 5BN4B 2OBBA 1VHJA 3OC0A 4GU5A 1QPGA 1X9HA 4EW2A 4R68A 2JJ1A 1RAEA 3PFHA 3IEMA 5LCXA 1CR2A 1RJPA 2AK3A 2JGDB 4GZLA 1OZAA 1WKVA 4W1PA 4TRJA 2OO5A 1HDZA 4R9VA 1Y6QA 1ZI8A 1DGSA 4R2XA 3DPUA 2XMRA 1UOOA 4MH0R 4DWVA 3T15A 3NJ4A 3GZTB 3GW8A 5H9VA 3KETA 4PBTA 2YIDA 1JEYB 1E3EA 2FSVC 1X7YA 4FHFA 5DTJA 4Q1DA 4WRRA 3LCRA 5EGNA 5K0EA 3U5ZB 2IHTA 2H1WA 1GNQA 1R18A 3B6IA 1RRMA 2P2CA 1FLDA 1YFKA 1SD2A 1Q16A 4WHXA 1XMIA 2SCUA 4QUEA 721PA 3PF8A 3Q6IA 5LMNH 3DV2A 4URFA 5C37A 4JMPA 2Q4RA 2VJOA 3UJ9A 4A4DA 5JZBA 2C0PA 1CP3A 4YIKA 2VDKB 5LU9A 2NYVA 2B4RO 3EVBA 4M0KA 3IQIX 3IH5A 3CEHA 2IP2A 1ILEA 1Y1LA 2B3DA 2IHYA 3D7SA 4G67A 4DQVA 2NVBA 4B34A 1U5CA 4R3UC 3PVSA 4ER3A 3HP4A 4YDQA 2R7NA 4EEKA 4QGSA 4OU5A 1EKPA 1N36H 2W9BA 1NTOA 4OEHA 3RGXA 4JH0A 4EHNA 4AM8A 3G8AA 5C31A 4WK4B 4YK7A 4MYUA 4J07A 4WZBA 3IHTA 3CEBA 5JDCC 2BOVA 1Q0ZA 4NVRA 1B3BA 1Y5RA 3OE5A 1ZIPA 3EF3A 4IEFB 3E9RA 2C9CA 2X1MA 1PWXA 3BA8A 2E87A 3DLHA 4D74A 2YWEA 1P2SA 4NICA 4CLHA 1R27A 5J5VA 4I4TA 2JFHA 2QMZA 2OV2A 3IB6A 3E58A 3AETB 5BQ3A 1J24A 4Y9UA 3GAFA 4LNUB 2GPJA 3PVCA 4L57A 5JQGA 2CMGA 1ELOA 2CUZA 2G0TA 4GBED 4IF4A 1ZIDA 4C03A 3M4JA 4YJFA 1B6RA 5DQHA 3I12A 4LDPA 1BFUA 4NFSA 1R3DA 4FHCA 4RK7A 5A4FS 3P4UA 2BIFA 1NF9A 1PUXA 4ND8A 2IZOA 1NGSA 3KV3O 3I92A 5I01A 3KZXA 1Y7HA 3H9QA 2QJWA 4FFBA 5E4YA 4TL8A 2IHJA 2Z5VA 1RAAA 1J23A 1PT6A 1BHO1 3K9QO 5CB4A 2X1HA 4UNPA 4P36A 3UFBA 5FTMA 3V2UA 4MWTA 1U2PA 4MVJM 3EIXA 2X6RA 4ENQA 3ABSB 1J2EA 3ZX4A 2P9JA 1UL1X 1Y4DE 5BSFA 3PYXA 3D8SA 4MS3B 5IVIA 1E2BA 4ANFA 1U5BA 3UJDA 1U0FA 3BGWA 2ZEJA 1RRGA 3L0YA 2CSUA 3HL0A 3C7CB 3FR7A 3HTXA 1V8OA 1S2NA 1EGQA 3PDWA 1RPTA 4UCFA 1A7AA 1ZG3A 3HDGA 1T0PA 1K3TA 2WABA 2VUIB 3PPIA 1H8HA 1EXNA 3QPCA 2CV1A 1WXGA 1B16A 3K96A 1UKYA 5FPSA 5HFJA 2QD3A 4FMCB 2ALZA 3PRHA 5DG8A 3TINA 2IOHA 3M5PA 4M7EA 3S2YA 3QX9A 3GP3A 4F7WA 1NVMB 4S1PA 4ZQCB 2P41A 3NHFA 4ZMRA 2C8KA 3OT5A 2ORYA 5FA6A 3HU2A 1QOZA 3SBOA 2J67A 5E6RA 4CQMB 1FSPA 4W5OA 3CRZA 1GLVA 3FMAA 2ATEA 5GVSA 4W6QA 2VJDA 1I01A 1NUPA 3QLEA 4PFKA 2HMUA 1AKWA 1S8AA 1ESNA 1YA4A 4B87A 2QAIA 3QKWA 1KHHA 2NO5A 4J0IA 5TNXA 2GAOA 5IFLA 3GFOA 3ZKWA 1VCHA 3H2ZA 4RZXA 4INPA 5EXPA 1G291 2NM0A 1C1XA 4WFIA 4PPYA 2JLVA 3AI1A 2PLRA 3T5JA 3E7PA 1AXEA 1IBSA 5KOHB 5JUWA 1J21A 4RNCA 2ZJ0A 1PJZA 3K0FA 4IIJB 2P65A 2ZR9A 3WA7A 4WOJA 3OESA 4YP6A 4OLJA 1O58A 2HIXA 4LI0A 1XEXB 4FQ8A 1ACLA 1UEXC 1EWYA 3UG6A 4UM7A 2A1UB 3L0IB 4LMRA 2F6RA 3W06A 5FL7D 3VU3A 1FSGA 3MQ2A 3RUEA 4HPWA 4XRRA 4L8VA 4J29A 3MILA 1N5RA 5AVUA 4GPTA 3E8XA 4CI0B 2N46A 3CR8A 1E2MA 4A0FA 5FFFA 3JPWA 1NIJA 1Z7GA 5LD2B 2WUFA 1A04A 4DLRA 1TD1A 4HWTA 1FXUA 2OV4A 1O5IA 1AO0A 3G2QA 4WXEA 2ZRDA 5AW3A 2VDWB 4REMA 3W4KA 3AC0A 5THKA 3HP7A 3C7DB 3PNOA 4LZNA 3N58A 4ZAWA 4N0QA 2IYPA 4KUEA 3QX3A 5ITZA 1EWQA 1QQBA 5JJIA 4BXOB 2IZ1A 3GBSA 5HPYB 4XSVA 2HF2A 4QICA 3KBOA 2R86A 3UGQA 3DSRA 2JJYA 1YRAA 3AUJB 4DSUA 2E4AA 1DBIA 1Y8CA 3CX3A 4MXDA 3BVPA 1G2OA 1ZRSA 1NR1A 2XCPA 4RTSA 3SK0A 1JUDA 4O8CA 2PS9A 1MO3A 2C2ZA 3GFPA 4EIWA 5CB4B 3ANNA 4WXPA 4YRSA 4PYRA 4N12A 1ESDA 4CCSA 3L7CA 1SBTA 4LC0A 3LW7A 4QOFA 3IUQA 4MPDA 4GECA 2F7SA 3Q2KA 3NM5A 1YF3A 1FQWA 5KQPA 2RI1A 5BRAA 1G55A 5BN1A 2Y68A 3MAAC 2XGQA 2XNCA 1N2ZA 2ISCA 3W3AA 4EECA 1KQ3A 1ADBA 3IKTA 2BGIA 5F9MA 1B2LA 3AFHA 4WFKA 4BFSA 5E3HA 3GFRA 4LJSA 1GFZA 4M3NA 1QYVA 4LJRA 4L4UA 1OZ0A 2VNKA 1AOXA 3LZCA 2H08A 4HGOA 3NALA 3UJ8A 2BGMA 2ONYA 2JJ8A 4B4OA 2FLPA 3RS7A 5K3EA 1Y3HA 2FUCA 2TECE 4YRMA 5EPUA 5IJ9B 1L7DA 3UWDA 1FVOA 4GOXA 5BW8A 2R48A 1P7CA 2GBLC 4LRSB 4BL5A 1LY1A 3FYUB 3CKKA 1OZFA 2RDJA 1JZTA 2Y1GA 1FS4A 1ZIYA 4TQGA 5E6RB 3GZ4A 4XOUA 2ZS7A 1YC2A 3SDBA 4UBJA 4FGLA 5TT1A 3DBHA 3L05A 2VXYA 1E3QA 2YYAA 1G7RA 1T0JB 3RVJA 2ST1A 1P3DA 3NJRA 4D9CA 4UMVA 4FT2A 4RAYA 4ZAXA 1Y1VA 3EIEA 1LSOA 1NU8A 3IKLA 3N75A 3OEED 1PU2A 3HLKA 4G0VA 2V7GA 1C1XB 2QD4A 3WX0A 1KY2A 4TWIA 1ZI9A 5FLXW 5FTJA 1G4HA 3KPWA 1XA0A 3T7CA 1DADA 1GFWA 4CPDA 4DM4A 4GL4A 5H02A 3ZV4A 3PD7A 3UMYA 3DDHA 5GPBA 4LKOA 4I5FA 2AFIA 2H1SA 1PVOA 2P5UA 4BGUA 4W9NA 3W4JA 1BQ3A 1GPBA 3WGJA 3KVYA 5JTUA 5ER9A 3RB3A 4PRLA 3UB4A 5C2JB 3OJOA 5A1TA 3G0HA 2W2KB 3WGMA 5BWBA 2JLRA 4ZICA 4ED7A 1UIMA 1YOBA 3FPEA 3TQIA 3X1KA 3K2IA 4AZSA 5DBFA 4D0SA 4PIMA 1FVXA 2FY8A 4KQIA 1CDZA 3KAPA 4LK3A 1FBTA 4QSHA 3H8WA 4FU0A 2J30A 3T5TA 3UHAA 4YWJA 3RRNA 4C7KA 5TMDA 3LECA 4DR5H 1U7ZA 3NBMA 3O93A 2ZXFA 1AN9A 4YIHA 3SWWA 3NBXX 1UQRA 3SIWA 5ESWA 3LL7A 6LDHA 5DX0A 4O4HB 4MKRA 2JGRA 1W4LA 4IWXA 4RPKA 1E20A 1E3DA 2O1XA 7REQA 5LQAA 4ZOEA 2I2FA 5JR3A 1DIBA 2D5BA 2GYUA 1RWKA 4TYMA 1OREA 3KAQA 3RVRA 1NLUA 1V9PA 1TKAA 2FEPA 3FOFC 2VRBA 2OXCA 3PQ7A 4ZT7A 5D2CA 2VPYA 4RH3A 3NHRA 1CR6A 2XUDA 4QQKA 2H5JA 3SJUA 2Y77A 4TMYA 4G41A 4GPIB 3WKAA 2GA8A 1G60A 2IVZA 2YDXA 2ZREA 4YONB 2MR5A 3AHJA 1RI4A 5DCUA 4WD3A 3TTSA 3PQ4A 1HSOA 3H4MA 3F8SA 4A2QA 2FZKA 1YCFA 3R3VA 4Q8FA 4F7DA 4KOAA 4B3XA 2B4YA 1IBMB 3FIUA 9ATCA 1GR1A 4LQ4A 3GRCA 2PUTA 3VSEA 3AF4A 1RMQA 1IZ9A 4HZUB 4FHEA 1OKKA 3GARA 2DU8A 3O5AA 3WQBA 1GVNB 3BAAA 2HWYA 3VR0A 3DS8A 3KT6A 2RGAA 3SQWA 1OBCA 4M9ZA 4YAJB 1BWPA 2LPMA 2ODNA 4G0WA 3SC4A 3EIHA 1ONNA 4O7ZA 5EXEA 1NVXQ 3R7NA 1FTGA 3TE7A 2VP5A 2MSCB 5E6UB 2RGGA 1I3QA 1YKSA 2AVDA 4MW9A 3HKCB 1FIUA 3DBHB 4Z0PA 1XTTA 4Z4QA 2IHVA 5IXSA 4GH5A 3SEQA 4J9RA 2CYAA 4AICA 1UC5B 4EBEA 5BSUA 4CG1A 4C0HA 2ZBQA 3JASB 4N0DA 3ZHSA 3C16C 5E2BA 4KE6A 2V7PA 3OX4A 1Y1RA 4FFSA 3UO8B 2D2FA 3IVMA 2HBZA 2OILA 3C1OA 3WJ2A 1AXRA 4FOPA 3GI1A 3JATA 1QHNA 5LZ2A 5ARDA 2EQAA 1PNVA 2B1GA 3R7LA 2DFDA 2O0JA 5KYXB 1NWHA 4HGZA 4DABA 5L40A 5DRTA 2X7JA 3E7FA 4MUFA 5J1SB 1YS1X 2V1XA 3PPXA 3NUGA 3R76A 1QBGA 4B3IA 4MCHA 2GUGA 1DOHA 3GNTA 3B51X 4YFYA 4HDSB 4A8JB 4DDKA 5LQMA 4A3DG 1TUGA 4PGAA 4MS4B 4J9UE 4OJTA 1X7ZB 1JKIA 3L4KA 4M9CA 5IJ0B 4BXXG 2QZPA 4EO4A 4WPGA 5DLYA 2DLCX 3GWZA 3TKYA 2AIRA 3WNCA 1DAEA 2V5VA 1C7EA 4RHCA 4WT7A 1CXZA 2DB3A 5KG1A 2PUDA 3B6MA 1ZPDA 4R8MA 5CDUA 5KUTA 2AG8A 2XE4A 2VQDA 2FFRA 3UYYA 1FZTA 1RE0A 1E9BA 1Y42X 4KPFC 1D2GA 1AKUA 3BF8A 1X7GA 1OBGA 3ELBA 1KE2A 4GIBA 1SWVA 4ZO8A 1TYCA 1RI2A 3B1FA 4PN3A 5KX5A 5KQLA 1YZKA 4QWEA 4FN4A 5CBKA 3KC2A 3QUCA 2POCA 3TWOA 3KWFA 3OFND 1Z2OX 1TPZA 3HYTA 3GPIA 3GAZA 1XTIA 3OKAA 5H82A 1VIMA 3I34X 4IX1A 3GEPA 3BMNA 3NUZA 4LAFA 2A0FA 4KJZA 2PQ2A 4Z8YA 5A62A 3PQ8A 1GD1O 1BH2A 3O4RA 4PXAA 5JJCA 1X39A 3HOWG 4G5HA 2O1WA 3CX7A 1ODJA 3C5VA 1SC6A 1E1QA 3I5YA 3NVMB 1XAJA 4CMKA 1W59A 4PM4A 5B2ZA 1ZDMA 2FTKE 3GLKA 3P7MA 2QTLA 4N65A 3IP6A 3STHA 2NO9A 4BWGA 5F1PA 4RB0A 5ALNA 2ZP1A 3ZGZA 2PD3A 3MGBA 4QU0A 4GMFA 1CQIB 4OJYA 1NN0A 2GF0A 2PGAA 4Y2TA 3ED5A 4QTZA 4TWAA 3I9LA 2CXRA 4DQLA 3B12A 3VHXB 3VYVA 3RTBA 1UC9A 2Z58A 2Q6TA 1N0IA 1H9AA 4QYTA 2BFBA 1SJ9A 4N3AA 4BO9A 3LPMA 1TT7A 2G5CA 1KU6A 2OG2A 2AI2A 3PJDA 2IYQA 4ZQGA 5AI0A 2B98A 3K32A 2ZRAA 2C03A 4LDZA 3UF0A 4JI3H 3NONA 4NU0A 3ROMA 3L5KA