5JQWA

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with adp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
365
structure length
365
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with ADP
rcsb
source organism Francisella tularensis subsp. tularensis (strain schu s4 / schu 4)
molecule tags Ligase
molecule keywords N5-carboxyaminoimidazole ribonucleotide synthase
total genus 112
structure length 365
sequence length 365
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2016-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5jqwA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5jqwA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jqwA01
4O2BF 1EUDB 4YB8B 3K5IA 3VPDA 4MV4A 4C5AA 2YYAA 4O82A 2NPOA 5JQWA 2XD4A 1BNCA 2V58A 4FU0A 4EGQA 1IOVA 1I7NA 3KALA 3V4ZA 1KJJA 3VPBA 5LP6F 2DWCA 4MV8A 3RUPA 4O7ZA 4J6EA 3I12A 4O7SA 4O7RA 3TIIA 2XCLA 3WNZA 2FP4B 4HNUA 4MAMA 1BXRA 1W93A 3VMMA 4MV1A 4O83A 2W6OA 3TIGA 1KJ9A 1KEEA 2NU6B 4EABA 4DIMA 3R23A 1KUTA 1GSAA 4HNVA 3KAJA 3K3PA 3WO0A 4C5BA 4FFNA 4FE2A 5LA6F 4FFOA 3U9SA 1A48A 1DV1A 1KBLA 4EA9A 2PBZA 4MA5A 3BSSA 3RV4A 4O7TA 4YBZB 2I87A 3G8DA 2W6PA 3NUAA 2R82A 2R85A 2Z02A 3LP8A 3MJFA 2YZLA 1Z2NX 1VKZA 4O81A 3MWDA 5I47A 3JRWA 4TV9F 2YW2A 2FPGB 3ETJA 2PVPA 2YWVA 3RV3A 2NU9B 5C1OA 2YL2A 1C30A 4WD3A 1CQIB 2YS7A 3GLKA 1W96A 2P0AA 4HR7A 5C8YF 4O4IF 2R7MA 1EZ1A 1E4EB 2GPSA 1IOWA 2GQSA 2W6ZA 1B6SA 2X0SA 3MWEA 2R7KA 2ZDGA 1JDEA 1UC8A 3K5HA 4YAJB 4XX0B 1KJIA 1M0TA 2GLTA 2IP4A 3BSWA 4O7YA 2QK4A 3HBLA 2CNVA 1E4EA 5J2TF 1GSOA 2CNUA 2I8CA 3QFFA 2W6NA 4IIJF 5DMXA 2W70A 4HNTA 4ZOLF 5GONF 3ORQA 2HJWA 5CB4F 5JVDF 1DIKA 4IHJF 4O7VA 1WR2A 3V4SA 1OBDA 4WBNF 2VQDA 3U55A 3N8DA 2R6FA 5BMVF 1GGOA 4ZHQF 4MA0A 5LOVF 4GGMX 2R86A 4FFPA 2NUAB 2PN1A 3KREA 3AW8A 4I50F 1M0WA 2YRWA 4ME6A 2YZMA 4O7NA 4EAAA 3HO8A 1SCUB 3R9RA 2SCUB 4EA7A 3KAKA 5K2MA 3BSYA 2R87A 4IWXA 4O4HF 4XYLB 4TV8F 2FPIB 5FNVF 2GPWA 2YZGA 2R84A 5CA1F 5D8DA 1KJ8A 4YAKB 4QSHA 1C3OA 4FFRA 5BPHA 1ULZA 1Z2OX 2FB9A 4MV6A 2Z04A 2YS6A 2C00A 4O4JF 4O4LF 4I55F 5JVLA 4FFLA 2R7NA 3TW6A 2FPPB 4FFMA 3Q2OA 2OLSA 2ZDQA 3G8CA 3OUUA 2DZDA 1GLVA 3RFCA 4C5CA 1OBGA 3LWBA 3ORRA 1PK8A 3E5NA 1JDBB 3UFXB 5J2UF 3ETHA 1GSHA 4EA8A 4EG0A 3N6RA 2HGSA 2VR1A 2CQYA 5CAEB 5HBRB 3R5XA 3GIDA 1UC9A 3VPCA 2ZDHA 5IYZF 5C1PA 4Y8VB 5H80A 4O86A 3HB9A 4M9UA 1B6RA 4YJ2F 5LXTF 3JZFA 2R7LA 2CNQA 4RZQA 2GQRA 1DV2A 4XZ3B 5HV6A 2NU8B 2DLNA 5CA0F 3Q1KA 4NYEA 4L1KA 4O7LA 4O84A 4M9CA 1I7LA 4E4TA 1AUVA 5EZYF 4M99A 3U9TA 4IZOA 1A9XA 2V59A 2YRXA 4XYMB 1KC7A 3R5HA 4IWYA 3AX6A 1M6VA 2I80A 3BG5A 3JZIA 5JQGF 4MV7A 1KJQA 4O2AF 4ZI7F 4HQ6A 5BPFA 5KX5F 4DLKA 1EYZA 4ZQIA 4TUYF 2YZNA 1JLLB 3BFPA 1T36A 2W71A 4MV3A 1Z2PX 1VBHA 4MV9A 4M98A 1VBGA 1CS0A 4EGJA 3VOTA 3VA7A 2WYOA 2DIKA 3R5FA 3TQTA 1CQJB 4FGRA 5KKNB 2CZGA 1PX2A 3WO1A 3U54A 2W6QA 2W6MA 4YJ3F 1AUXA 2NU7B 4I4TF 3SE7A 1EHIA 5JH7F 1EUCB 4O7WA 3TINA 2QF7A 2V5AA 2J9GA 5LYJF 2VPQA 3DF7A 3OUZA 2VHEA 1CE8A 1JKJB 3JRXA
chains in the Genus database with same CATH superfamily
1LPMA 3F5DA 4NBSA 4CG2A 5KNBA 3MFQA 1Q3KA 3N5KA 5JU6A 3I9FA 2G08A 4Q3OA 3K72B 1YZGA 1Z08A 4PC2A 3C6MA 3R6WA 3ZKWA 4ENTA 5EXPA 1NYRA 1ESCA 2BCGY 3ILHA 1ZX1A 2WIAA 4LGVA 4I2VA 4DIFA 1UK9A 3H6HA 4AWBA 1TCBA 4M53A 5JPIA 4JYMA 5CT4A 2VI5A 2CKZB 2WNSA 1R0YA 3IIIA 4FOPA 5KQSA 3GPCA 1PQ4A 3BIWA 4LXHA 1ZC4A 2Q41A 1C9KA 3AR8A 3TNYA 3NTVA 5L95A 3L4JA 4HDAA 1QU3A 3FUCA 3L79A 4HUQB 1E3MA 2GPJA 5ALRA 4DLNA 3U7QB 3DS8A 2A9JA 2P9FA 1GG8A 2AB0A 2RAFA 4LJLA 3SQNA 3K71B 4DIOA 1DTWB 3ZDAA 1MEEA 4WLVA 4PV7A 3ZWAA 2P2NA 2VKTA 5HE9A 4X7MA 1SM4A 3DCJA 2BR5A 4PIPA 1YK0A 4DL3A 2QL5A 5ALQA 4AUKA 4QBIA 4I5GA 3BQ0A 1VYUA 4NHOA 1NXPA 3ZHYA 4DREA 3KHRA 1SC3A 2EYUA 4IO1A 1NI4A 2JPDA 2PVCA 1SUEA 1VPLA 1PYDA 4HD8A 2V98A 3DBLA 8GPBA 2D4AA 2QJFA 1OQAA 2FP4B 3DBIA 4GPIB 4JODA 4GPBA 4NPCA 5DBGA 4MAMA 1XROA 4OV6B 2W58A 3CH5A 1U2DA 4XA8A 1CR6A 1Z4OA 5SZHB 1Y1VG 1A7JA 3PHLA 5K4GA 5LZ5A 2P1RA 4ILEA 2W6OA 2ZE7A 4GHWA 4DCTA 3VKFA 1GTSA 1XSEA 3BE8A 3N87A 2JHCA 3OZIA 2Y0BA 1PYGA 4HG2A 5KFPA 1HQCA 4JEIA 3THOA 1U63A 3M1YA 3OMWA 3QXGA 1A5TA 1AGNA 1JNXX 3GIKA 1GCIA 3GFGA 3JWGA 4ZVMA 1L4BA 3JYHA 5T6BA 1M2JA 4BB9A 1Z2AA 2AJBA 1PJZA 4R9RA 3LUKA 5KYUB 4QXPA 4DNPA 4V1CB 1RBMA 2O0LA 1DMRA 5JZMA 1J2EA 2EAUA 4Q9JA 4BMDA 3K3PA 2ERXA 1P5RA 1I1QB 4JJ8A 2E48A 2MT9A 4JL8A 2GA8A 4KKVA 3ZOZA 1TZKA 4WNAA 1EG2A 5C44G 2MTBA 2IBMA 1T0BA 2UZ3A 1Q1BA 4JB2A 4PZDA 3BMCB 1W29A 4Y0NA 4K9OA 1YVRA 2NO1A 3V7UA 3FNBA 3QXXA 3B82A 4EO9A 2XUQA 4LOJA 1V3QE 2CY0A 4MUHA 4PPGA 4TWBA 1JJAA 3M8KA 4EF4A 4ETWA 4HVLA 2K4MA 3FTDA 4XEUA 2I2CA 2OD2A 1DBIA 1O5IA 2J30A 3UATA 1DTEA 4F21A 3VMFA 4GZ6A 3DHEA 1BX1A 2AXEA 2YVAA 3O93A 3OTOB 1M1ZA 4QU0A 4REOA 2QJOA 1ZNYA 4L7QA 2FGJA 2VZ9A 1J2TA 1J9GA 3WAJA 3ZCXA 1U7TA 2W6PA 3D6HA 3NUAA 4FGSA 3QG1A 3VH1A 2FF5A 3E2MA 2OENG 3G1TA 4OLBA 3REQA 2O20A 5DM0A 3EPKA 1LRJA 4NXMH 3WB0A 4C3UA 1OWOA 2WG0A 2XQKA 3A31A 3LP8A 1XA3A 2PUTA 3RTBA 4CF6A 4CLEA 3GHYA 4CF5A 3ZLJA 2H57A 3KKLA 3SI7A 5THKA 5A9RA 1VKZA 1X70A 3RYCB 5HK9A 3E70C 1OI7A 3LDHA 3LPMA 3Q7TA 3K0EA 1ZISA 4K1LA 3VH3A 4BNUA 1JMVA 3TIXB 2EYQA 4N12A 2FLPA 2QTVB 1FTYA 1MB9A 3AI2A 1VG8A 2C77A 3GTMA 3BGWA 1U2RA 4L9AA 4J16A 4QPPA 4RTNA 2EZTA 3I62A 3AVXA 4MRRA 1SG0A 3I2JA 2HH9A 2W2LA 3BA6A 3DEYX 1DKOA 3VOSA 4JP5A 4A73A 1DC6A 1HDIA 5BMOA 2Y0CA 1KVTA 2AI1A 1D2CA 2CJYA 2X5JO 4UVIA 3PGMA 5FUBA 3V80A 3B2NA 3DAFA 2F1HA 5EWGA 1JEOA 3RVRA 3O21A 2DHCA 3HV2A 4JIMA 4OQPA 3QXSA 3QEAZ 4PX2A 4B3RB 1X9NA 1OCEA 1WVGA 3KKQA 1VFNA 4I66A 1NPTO 3MIIA 4WKPA 3V42A 7YASA 4RFSB 4EL0A 1RXUA 1DGSA 3FGZA 1EZ1A 1WCMA 4KXLA 4UQPA 3T9CA 1R6VA 1E5QA 4LXQA 4GM0A 4W7IA 2VTBA 4ZANA 1CUWA 3EZLA 3GQVA 2DQZA 1JI3A 4KBYA 1RKVA 4CI9A 1NBIA 4TWIA 3PXDA 1B6SA 3FVRA 3MWEA 3UM9A 4B3TH 1UXGA 3O3NB 4TTVA 3CH4B 3D4OA 2AYYA 1DBVO 5AKIA 2BE9A 2I54A 4MQFA 3HB0A 1N2BA 4D9KA 1KJIA 1FX0B 2YJNA 5CLIA 4DMLA 4RB2C 2J45A 4IDFA 3CBQA 3DR5A 1ZFNA 4BBSG 1JLLA 4PO8A 3H5TA 3A4NA 4MEBA 4PFQA 3RU7A 3RGXA 5DW3A 4BNWA 4MVWA 5LMUB 1IUOA 3ZNNA 4B3MB 1IZ7A 2Q9UA 3UHOA 1QLWA 1V4NA 3GJ3A 4KDFA 5D00A 4TMVA 3T8YA 1NASA 1ZI8A 3KU1A 3MT0A 1PWZA 1JBEA 3G3EA 4KR0A 1W0KA 3R41A 3PXXA 3CF6R 2WA1A 2I55A 2FWPA 1Y6RA 4MTDA 4RPLA 4QFDA 4RV9A 4YMLA 3IEVA 4BP3A 2O52A 5K0EA 2AOWA 2WM8A 4HNTA 1GQSA 1NBAA 2JLAA 3F6CA 1RLUA 2DUUA 1Z33A 3BCSA 3IQIX 4H6VA 3PQ3A 4MS3A 4N3GA 4PG4A 4WX2B 3TYXA 2IYYA 5A5VA 3NEPX 5KI6A 2B7LA 2Y8EA 3IXLA 3UAYA 3AEZA 3F8SA 4CR7A 5HCNA 2M9MA 2AL7A 1BGWA 4XJSA 3CLUD 5FWNA 3MTIA 1U5CA 3HVRA 1UZNA 4B0PA 1QRTA 2IXDA 4KBFA 4LZNA 1FMJA 3V4SA 4NBRA 3P4XA 4A2BA 2WTUA 1T5TA 1K98A 4E30A 3RBDA 2CYCA 5IJ9A 3ZNPA 1ZHSA 3BA8A 3EVNA 3FTNA 3KKNA 3HZRA 4WXRA 4EKIA 2J7PD 2H54A 5IDYA 1PEAA 3HXOA 3ZCVA 4I19A 2V55B 5EP3A 5DQHA 4LF5B 2GZSA 1QO9A 3EX7C 4UCUA 1JQKA 3UUWA 5EPEA 1OYYA 4HZUA 2R60A 3L1VA 2V9CA 4PICA 4PSVA 4RH1A 4QARA 5EWFA 2J3HA 2Q8PA 3NTOA 5BSVA 3FCOA 4NBUA 3K0BA 5C53B 2BFFB 2Z5VA 4YRFA 2VAMA 1F6BA 3KSZO 1MFZA 1XRQA 1PHPA 4AY4A 4Y3UA 4JBNA 4AY3A 4G85A 4BTLA 3EBPA 4EQ5A 4KLCA 3RC2A 1ST2A 3CUWA 2PEZA 2JK1A 2PXAA 1N2CA 4JNKA 4NEGA 1KE1A 3H5RA 3V7WA 1RLOA 4JNCA 1S8FA 1V6AA 1H0HA 1RYRA 2PV0A 3DDWA 4OHYA 4FGJA 2WAQA 1OZHA 3BSYA 4J0DA 1T5IA 4FIDA 4IQFA 4JX9A 4ZP1A 2JGJA 5EHZA 2BEVA 2PQ0A 2TSYB 3JQDA 5KHLB 3ZV4A 3QQPA 5HQTA 4TV8F 3ECCA 4DL6A 1MABA 4N7JA 1JKMA 4JDPA 2Q7XA 5HM8A 4Y2SA 1CFJA 3RFTA 4BQOA 2D3WA 1GLGA 3NAQA 4CL2A 5F9LA 3IQGX 1KVQA 4UOQA 1ZN9A 2HHFB 2Z8YA 3R0QA 2XXAB 2RSLA 2GRAA 2JA6G 1JFFB 5NULA 4IJUA 2ZYIA 3BXEA 3KUCA 3NHBA 5JQGB 2Y0SE 4FFRA 3E3AA 2ONYA 4DLYA 3VR2D 3W8EA 3DFZA 4YI5A 3WG9A 1Q7EA 1FRNA 2EZ8A 2YJTD 4COOA 2REBA 3B2QA 2UYQA 1QFZA 1W19A 4ZDJA 5EZYB 2XYGA 2Q9CA 1QIHA 5D1OB 1NLZA 3PV0A 4EJSB 4G2TA 5KPJA 1Q7RA 1V6CA 4KRGA 1U0JA 2BBWA 4O4JF 1RQGA 3HGTA 3OO1A 3UWOA 4CKCA 2X8JB 4H2DA 4RFVA 3WFIA 3ZCTA 1RLTA 4GMKA 4P1ZA 3GTPA 4OXKA 4FFLA 2BC9A 2V5VA 2AQHA 1T0UA 1QFXA 4OJKA 3U6BA 4GW3A 4IIUA 4Q1AA 2ZRFA 3BE6A 3GY0A 4LZAA 3C6XA 3OIGA 1IZ0A 3KZXA 3R7LA 4B83A 4DV4H 1PFUA 4DWJA 1PJTA 3OUUA 4YRCA 1M7BA 2Q29A 2CLDX 1ZJJA 1CEEA 3AINA 4KUHA 1P4RA 3L3BA 4Q0MA 4XARA 3IAM1 2I6UA 3PYLA 4HY3A 4I8IA 4TS1A 1WUIS 3WLIA 2R7AA 1OA0A 1OBGA 1R0RE 2FKNA 4U6NA 3VSCA 2CF5A 4JIGA 4LBZA 3IQXA 2NAPA 3WWYA 1NQUA 1RLIA 3CY6A 4AI6A 2P6UA 2BM8A 2Q1SA 1XTUA 3FYSA 2WHPB 1OH7A 3VOBA 2AMLA 1YZNA 2WFLA 5EZQA 2DUWA 3FDIA 3WL7A 4EAQA 3OEEA 5A4DA 4M8SA 1NQAO 5B1IA 2C57A 3SDSA 3STXA 2PWBA 1ZITA 4WHXA 4OJQA 4OLAA 4FZJA 3FCUB 1E3DA 1P0FA 4DILA 2FXIA 1C1XA 1G7SA 1M34A 3DDHA 3SJBA 1RWPA 3GJQA 4QRDA 5JTUA 3FWZA 4MQ5A 4BIMA 2JRLA 1GTL1 1EP2B 1YRBA 3GJZA 4B31A 1JSLA 1Z7GA 2D2XA 4DNOA 2FSUA 3RSZA 2WSIA 4O86A 3JATA 5G4KB 1K8QA 2BQUA 1E1RA 2AR7A 4JB3A 2ZRMA 1EVKA 3KT0A 1K68A 2CNQA 5AQEA 1E3WB 1G0NA 1W73A 2JHPA 2X0IA 1QRSA 1CUIA 3CRVA 3JTMA 4RKFA 4JA2A 1PP4A 1GNRA 4LE2A 1W1WA 3THYA 4F2GA 2HR1A 4JI5B 1VP3A 5KFDA 1DUIA 5KOJB 1H8EA 4KYVA 5DULA 2MCTA 1Z35A 4QFMA 4Q4AB 2VHTA 1AS3A 3LNCA 4GQIA 2ZOSA 4IKPA 5LVAA 4GXTA 4YO7A 4L07A 5IU6A 3K1ZA 4G5SA 2IA6A 3EIOA 1X7XB 3GEGA 3VC3A 4REQA 1XQ1A 2AFHB 2IZZA 2JGDB 1FMCA 3D3NA 1DCKA 4XKJA 5BSMA 1EVLA 5TT1A 3VYRB 4E2ZA 5IT5A 2QTMA 3MQ4A 4TLMB 3WIBA 4TMWA 2JGFA 4HLDA 4ZD6A 3STVA 2W2XA 1JL3A 1H9CA 4EY6A 4ROSA 2O3TA 5K20A 2W57A 2Z43A 1P7YA 1UZUA 3LC2O 1DEXA 1OE0A 4RQUA 2GRUA 4GWGA 2HK9A 3SBXA 5JAIA 4QVGA 3MF4A 3DULA 4FN4A 4FZ3A 3I09A 4MW7A 3ZWOA 2Y67A 2NV0A 5BOSA 5HKKD 3UAVA 2YRXA 4QXQA 1EP3B 5EZSA 3ZR4B 4RVGA 4DCMA 4ED2A 2B1GA 2PSHA 3UO8B 4EUEA 1QORA 1TMOA 4WIAA 5K3FA 3REOA 4TTJA 3OEED 2P30A 4DKXA 2NV6A 2AMFA 5CM9C 4YY3B 3QP9A 3U5ZB 4Y30A 1OKKD 1Z2DA 4B46A 3DJYA 3RKUA 1Q2XA 3RAFC 3NW9A 1TIPA 3KUUA 2YWCA 1N92A 4F2WA 1E1KA 1WAMA 2JATA 2MOKA 3GZNA 3H7AA 3NWOA 4TWRA 4CKEB 1DAPA 2DFTA 3TOXA 2ZQZA 5I6DA 4RB1A 3IKTA 3WKEA 4QICA 2PBRA 5BSGA 2WTBA 3G5MA 3HDYA 2XGJA 2HT6A 2P2YA 3MGKA 4X9XA 1ISHA 5FUXA 1KI6A 3X1XA 3T5PA 1IRXA 1A5BB 3NWEA 2ZT8A 1QIKA 4KJXA 5BSUA 1VBHA 4RJTA 1AK9A 1E5LA 5K6RA 3VBEA 4CEIA 1KS2A 2GBCA 1NVVR 4HDKA 1JDSA 5H9VA 8ATCA 2UVVA 4ECZA 1BGXT 1ZKMA 2CNLA 5F5LA 5AW7A 2GH1A 1W4LA 3JVIA 4MPPA 4F93B 1O57A 4QTYA 1DAGA 3UW1A 4DA6A 4HQLA 5ES3A 1C0KA 4AJ1A 1Q7GA 3U7IA 1IVSA 4NESA 1JYEA 1EDBA 3KQMA 4ND7A 2Z98A 4GR4A 2DC1A 3GLTA 3OPNA 2YZKA 1XJWA 4Q66C 4TL9A 4F6RA 4V0QA 4LY0A 5CW2A 1QDUA 3E7FA 4MB2A 4MVYA 3B1FA 3BE4A 4ZAGA 1RAGA 3QVWA 4ZCMA 4LTNA 4C14A 1ZM3A 3LP6A 3VYUB 3RLIA 5TMDA 4M3NA 4YDHB 4N39A 3ZTYA 2ZYHA 2GCNA 3LUBA 3NFYA 3VO8A 4MZDA 3A58B 1RXWA 2IEIA 2COEA 3IIMA 1SCJA 1E1LA 3QKSB 4G25A 3C14C 2HCTA 4MK4A 1RADA 1CF2O 4DFDA 3NDJA 5EVJA 5JADA 4BJ6A 2HNBA 1WF6A 4BE9A 4PTYA 1O89A 3OA0A 3ROXA 3SE7A 4M1ZA 3WMRA 1J42A 1M2HA 3HHEA 3H4BA 2GJ9A 3CLSC 4WLNA 5AW9A 1BVUA 4MR8B 5BWRA 4X62H 3WK9A 5D1NA 4D4IA 4Q7LA 4QDUA 4QOIA 1Z8FA 4BB5A 2VHVA 1IXZA 4ED7A 1X8JA 3CNEA 5BWOA 4C9BA 3BD8A 2Z1MA 3F6RA 2REOA 4Y6PA 3RFUA 2A92A 5EP4A 2NVWA 4BEBA 3ZI7A 1G4AE 1XVIA 1I14A 1T10A 2EX4A 2IIQA 1LZLA 3EQZA 1S2MA 2CE7A 3MXTA 5SV2A 4RNMA 4L4SA 3V6LA 3WL3A 5K3BA 2P9TA 5CXQA 2IK8A 5DEOA 3CLUC 3MGBA 1C8BA 3IR7A 1MGPA 3L4SO 3AVVA 1PEDA 2PX4A 3EWNA 1SVUA 4B3SH 3G6KA 3KR0A 1CUBA 4DR5H 1LBSA 1HT2E 1Z7YA 2QRUA 3JR7A 4ASUD 3WZLA 1AQIA 2G1AA 2GHTA 1I4EB 1X74A 3D5TA 3LWNA 4RVFA 4ED8A 4FTWA 4BO8A 3V34A 4D97A 3VYTB 3EPPA 3ZWCA 4R2HA 3T52A 4GRDA 1W4RA 3HDVA 4XLZA 1TYDE 1WY5A 2C99A 3D7MA 1M72A 1Z17A 3HN6A 4CMFA 1NVTA 3LYHA 2O4CA 4A1OA 2NOAA 2F1KA 2R93G 4PQEA 4H1WA 1N1GA 1C2TA 3BS4A 3UHFA 1VL0A 1X7YB 3OM9A 3RT1A 3K2EA 3SS8A 5A2QA 1EZ4A 3LS2A 1QP0A 1APBA 2OUIA 5BN4B 3I0MA 3PC8A 4DSOA 5AJWA 3G8AA 4HXGA 5NLLA 1CJBA 1N5JA 1PBNA 1ZUWA 2ZYSA 3KZOA 3OU7A 3T4EA 1XZFA 3O4IA 4QXMA 1BROA 4D02A 3TRDA 3W9BA 4YRKA 5GM1A 3GVCA 2EXXA 5LB4A 1N2OA 1QH1A 2D2VA 3HYTA 4RCYA 2PX2A 1FTNA 4EP1A 2OCKA 3MK31 4YRIA 1ZUD1 4EHIA 5LJLA 1M8JA 3JWEA 1ATIA 4UM9B 3OJ0A 4WRRA 2ABJA 3QF4A 3EDYA 1IHYA 4J6EA 1KDRA 1JR2A 2X1MA 1C9MA 1SEPA 3TD6A 4BXOA 3NXSA 1Q44A 2DRIA 2Q6OA 1PJAA 5A3RA 1E2JA 2XE6A 3SNKA 3RF2A 2BZGA 5CB4B 1XKLA 2FN3A 3M83A 4U7TB 3ANSA 3T94A 3AEQA 2IIPA 3EQ8A 3EZ9A 3NRCA 4QD3A 3ZVRA 1EG7A 1K6MA 4DBZA 2WZDA 1GDTA 2GX6A 2ICAA 4EDHA 2OHIA 1BWSA 4DM3A 3S8YA 1E58A 2F67A 4W6QA 4WVFA 2VDLB 4BFLA 5JRZA 1Z8HA 1GIAA 3HACA 5EHNA 3RB8A 1EA5A 2ON6A 2X0EA 4GC5A 5DI3A 1W4ZA 3ABRB 1KNQA 1N5DA 1WUJS 1Z68A 3H4VA 3UC9A 1LTKA 3KQKA 4HQRA 3TXYA 3ZCRA 1QGYA 4JBYA 3O8OA 3H5OA 5L1IA 4MRMB 5B58T 3ESBA 2X0DA 2CSUA 2L69A 3S28A 1P45A 1O94D 3PHGA 2Q2WA 2VYCA 3F7TA 3C43A 1G64A 5BURA 3AFGA 1HOTA 4QJ5A 4YJ2B 5SYMA 2AGQA 3N6VA 1V96A 2EZ9A 3PK0A 2C5BA 4KHZA 3K35A 5JH7A 4GOOD 2FFHA 1FUEA 1O8CA 2I6QA 4UVEA 5JAZA 3BCUA 3FXAA 4K88A 3H40A 3P32A 5HBRA 4ZU3A 4AKGA 4Q6WA 3OP1A 1GPKA 4J43A 3UA4A 9LDBA 5LA6A 2X77A 5TGDA 4DLVA 2BZSA 1NMZA 2RDJA 3E2PA 1XA0A 3IULA 3Q8PB 3LHDA 4BMCA 2OM6A 3WGMA 1J0DA 4H7DA 4IFEA 2W9BB 4R8UA 3N53A 4WN9B 1X38A 1XVLA 1TGVA 3UJ3X 2PUGA 3ZEIA 2B98A 5KB3A 3UWPA 4DM4A 4BO9A 4KUEA 1A7KA 4G5YA 2XMZA 2RHMA 3A1EA 1KMQA 4RK1A 2PJDA 5FNZA 3L0CA 3LXRA 2DKNA 4R7TA 5FPQA 3GH3A 4LW8A 5CYGA 3ZCPA 4KFTA 4DWVA 3KFXA 1CUZA 4IXTA 3LIPA 1XMVA 1YS2X 4HZIA 5TDHA 2UUBH 1UFKA 3MWDA 3DNPA 5I47A 4GNRA 3HGMA 2JA7A 3N2KA 2YW2A 2VUMA 1HE2A 9GPBA 5BNIA 5KYNA 3B38A 2FAXA 1EB9A 4PYMA 4J0CA 2VT3A 1DINA 1BA3A 1NQTA 2FPGA 3PFNA 3PO2G 2W42A 2O8DA 3K4QA 4I3FA 4BFZA 2WF6A 1OH5A 4RNOA 3WQRA 3WYNA 3L82B 3ABSB 3H42B 4X7BA 1GPMA 3IELA 5JSQA 3ZLBA 4EL5A 1CPYA 3VR6D 4CIBA 5IF3A 3DGEC 2L2QA 1PWHA 2WE6A 3UV6A 3O1HB 2YFYA 4OG2A 5F77A 5IVKA 1GKKA 4XE5A 3Q7RA 1Y8ZA 2ST1A 2HDKA 1YRQA 3INRA 4IW3B 3U13A 4CTNA 2Q2UA 3LCMA 3V1TC 2XQVA 1YDFA 3O03A 4KXMA 3EXAA 4RSMA 2CUNA 3R76A 4Y9UA 4K9KA 4B4KA 4DMKA 2ZB2A 4IVNA 2EC5A 2H2GA 5EMMA 3WDKA 5KNCH 3OHAA 1N36H 2IYSA 4M1KA 1WMAA 5KFXA 2XBUA 4E22A 1HR0B 1FK8A 1Z4KA 4ZVTA 4F91B 2XB2A 1A97A 1DEKA 1BVRA 4EQZA 3CJTA 3EGXA 2JA5A 3FVWA 4FSDA 3MOSA 2JGNA 2NZ2A 1IBKH 4I1IA 1AGYA 3RHSA 1H3FA 3KV3O 4JT2A 5EMJA 5JDCC 4HUTA 2QZ4A 2P9ZA 1JHPA 2C7GA 2D3TA 4TKVB 3U3JA 5I7FA 3GJRA 4FM9A 1G1AA 1V41E 3C8ZA 2WU3A 2QK4A 1B15A 3NYQA 4IRXA 4JASB 3HBLA 2QNRA 2CNVA 4G24A 3RJMA 3SSMA 2O1WA 2PM8A 1FUUA 5BYJA 4IRDA 3OOYA 1HFJA 2NTYC 2X8LA 4KMRA 3LLMA 3EA4A 1LF0A 4CCSA 1U9ZA 4EA9A 4LJSA 4V03A 3CPSA 3O94A 4IIJF 2XUJA 3IDOA 5HF9A 2JGIA 2YASA 1WPRA 1CZOA 3QVLA 4MS4B 1AZLA 2HJRA 3ORQA 2R1TA 1XTSA 2YWHA 3BCHA 3VHXA 4BWSC 4B3XA 2GAJA 4QU5A 1HE8B 3CIFA 1EJ0A 4MW5A 5EJ7A 1O95D 1N6HA 1U0FA 5FOWA 3N8KA 3QYFA 1N78A 1DIKA 1OLUB 2GETA 3HDGA 2Z6UA 1GGNA 3MMXA 2UUPA 4QE3A 1L4NA 1QHXA 4LGCA 1RAEA 2CVOA 1WMBA 4BBZA 4RC9A 4B73A 821PA 5JHGB 1J6UA 5JXHA 1XVAA 3D4IA 4UXJA 4UMEA 5EGSA 3EPLA 3R6GA 3CCFA 1Z0JA 1X1AA 2AN9A 2CJWA 5L6LB 2D1SA 1Y63A 4DV4B 3FYHA 4I6GA 4PLGA 4ZHQF 3L1KA 4C4XA 1BS2A 3W78A 2ZTUA 4DV0B 2C7QA 5HE8A 3WK8A 1GG2A 1DEAA 3PNSA 1QR2A 4LDNA 1F4VA 1GITA 1B2RA 2QNIA 3WIEA 3WQQA 2P4SA 2ACEA 1NFFA 1UAYA 4JYCA 1VJ5A 1M1YA 2XWJI 4WJKB 5BWUA 5FULA 2PAFA 1M0WA 1QHHB 3IXMA 1KDZA 3ZZMA 2YVQA 4B32A 1XXHE 3K31A 4JXZA 3KB6A 6GPBA 1P18A 3AY6A 1K5DA 1NL3A 2G5GX 3QFRA 2VBIA 4FSHA 2X5KO 1DKUA 3KLBA 3L4BC 4R16A 2SCUB 5HF8A 3G89A 1XLVA 1AGPA 5K2MA 3ERCA 3PNMA 4AUEA 2JGLA 1IOLA 2M05A 3AHCA 3CE9A 3IP8A 4LRSB 1KVUA 1SU4A 2BMFA 4DPMA 4F4DA 1KMMA 1J2RA 3HOWG 1UDCA 4KXYA 2VYQA 2GBPA 1L5QA 2FN4A 3IODA 4PCUA 2FTKE 2W22A 4RV5A 2VDRB 5EWMB 5HEKA 1Y5RA 2EJCA 2EJUA 1K75A 2B25A 3QLUC 1TUBB 2DMRA 1UNNC 5E3JA 4S12A 4TLAA 4EENA 4PRZA 3VR2A 3UNXA 1GADO 4YACA 2O8CA 1WY7A 4QAQA 1LLUA 1YB4A 2IVZA 1VE9A 2YU9A 2KLHA 3BDIA 1IG0A 1V5FA 4GICA 4HBZA 3CNNA 1AM4D 3R6LA 4DLPA 2CB9A 1JYSA 1Z07A 2C4MA 2KWIA 2DTEA 4DV6H 4F97A 3UB4A 2Z2YA 2PDAA 1VSVA 1T25A 4JI3H 1V1MA 4L51A 4AP6A 4I55F 5FXMA 3KJGA 1F1BA 2WTAA 3SSAA 3ZGLA 2GT1A 3DKIA 5D5HA 2O3QA 1R9JA 2GEKA 4H7FA 1GHTA 1PGQA 2SECE 3UMSA 4RVDA 3VSBA 4TM8A 2ZS8A 1Z6GA 2F3TA 5EL0A 3E58A 1TEVA 4RIFA 2YXLA 3HA2A 1A3GA 1EA7A 3OFSA 3LHKA 1RRMA 4H0NA 1OUMA 4IR7A 2NXCA 2ZJ7A 1AZSC 2XX3A 3ELDA 3IAM6 1Y3CE 1J70A 3SZGA 3E9RA 5I8WA 2DBRA 1XE3A 1UAAA 4K81B 4YBZA 2A9OA 4DWWA 3BB4A 3BCRA 1EM8B 1ABFA 2CNKA 1U8CB 2J4DA 3W5VA 3GFTA 4PXAA 3AKCA 3W3AA 1N2JA 3EDOA 1OWLA 3ITNA 4G0OA 2ZIEA 4NQRA 1MAWA 3MUFA 4FGKA 1ESDA 5TPWB 4W5RA 2QL9A 4XFDA 3Q11A 5AI8A 1IONA 5A6SB 5B4VA 1AK2A 1GUZA 2KM1A 2B20A 2CZCA 3GIDA 1LNSA 4F71A 3T5JA 2J4FA 1Z2CA 3TOCA 1YL7A 1FFHA 4IV5A 2M6LA 4BAGA 2DY1A 5JY6A 4EUSA 2XD9A 2DPLA 1P5JA 3D2LA 1KQ3A 3DLPX 4L7VA 2V6IA 3PFGA 1DX6A 3K6SA 1QYVA 4Y2UA 2WWVD 4P34A 4U7WA 1URPA 4O2LA 4R81A 2P11A 2WINI 4NEQA 4XTRA 3ZK8A 4WY5A 3FOFC 3UKJA 1XMOB 5I5EA 3IV7A 4L22A 2ZT5A 4PHHA 1SC6A 4DV3H 2GFIA 1T29A 2CWWA 2Q62A 5TEVA 2WUEA 1R6DA 3HCBA 2GQRA 3RIZA 1NF3A 2IYQA 2QR5A 3BRWA 4HLNA 5CA1B 5KQLA 1UKAA 2P69A 2FX3A 4XZ3B 5HV6A 2R6CA 3O9VA 3SSNA 3D8UA 3ZCQA 5CA0F 1B42A 1P2TA 2W2PA 3PF8A 4DJAA 4RX1A 3TMYA 2ISCA 4I9HA 5E4TA 1IIBA 3FMPB 4RL6A 2ATXA 5KS2A 3M6WA 3KRTA 3Q8KA 1NAIA 2PKYX 3A3PA 4XSGA 4C4ZA 1YZQA 2IYNA 3DMHA 2XQGA 1H5UA 1W9MA 1KP3A 2A5FA 2IYWA 2AU0A 3WL6A 1I7LA 3TQOA 3UBTA 4N65A 1OVMA 2IV2X 3BF7A 3O75A 4G41A 1F8YA 1U28C 1XFAA 2XV1A 1FKAH 3KSMA 1L1FA 4LJ8A 4RPHA 3RUCA 4AIIA 3WAGA 4L4ZA 2IRWA 1MR3F 1LVGA 4JS0A 3QLEA 4L16A 2CNOA 1M5UA 1SQSA 5EERA 2IUEA 1PZGA 2EL7A 4W9NC 3BWCA 4DQVA 2ZXUA 1M7HA 3MCWA 2Z2ZA 3BFJA 1F5SA 3QXHA 5EE1A 1I94B 5JQGF 3EZ7A 1L4EA 5GAJA 2Q4TA 3WRXC 1QIMA 4BVLA 1BMQA 4YV7A 4RDXA 1OR8A 2HRZA 3KXPA 2R66A 3A37A 3OF5A 2ZRGA 5M5BA 1W2HA 3G82C 3OX1A 1PT5A 1GZSA 4JB0A 4IOKA 3TXAA 3D1VA 3F9CA 4YHHB 1TTHA 2HHJA 1JEJA 4AROA 4CLDA 2XUDA 1TC1A 3H0EA 3OKPA 4KQCA 3ROFA 3VAZA 2IMWP 2Z3WA 4N49A 1VHDA 1FSPA 3RIXA 2W71A 2OO7A 3ITEA 2O2EA 1BMDA 2VK4A 4YJGB 3HOUG 5K0LA 3WLQA 3H5NA 1MEJA 4G4IA 2RHDA 4OQDA 1VHWA 5KFMA 3F97A 3OPVA 3PL1A 4EUHA 5K0BA 3T3PB 1SPXA 3WGOA 3L8CA 4IZIA 5KFHA 1KK2A 1FC0A 4PBTA 4G9EA 2ZR7A 4C3OB 5LXTB 1OF1A 1E0KA 1Z5WA 3P9QA 3IT1A 4EYGA 2RBGA 4FLMA 3NALA 3AETA 1I1MA 3I37X 2Q7OE 2OG1A 3MB8A 4O5AA 1JDTA 3OJWA 3ST7A 1QTNA 2GTPA 2HDNB 2V7QD 4QKQA 1XAGA 2A84A 4HO1X 4EW1A 2VJAA 1P7ZA 2CXQA 4EVIA 1XC7A 3TTTA 2YINC 1VJRA 3H9QA 4G4JA 1T36B 2ZI5A 2FHSA 3AEUA 1TQHA 2IY7A 2QGFA 3RTEA 3SVZA 4ND8A 4UREA 1HYEA 4P83A 2P9YA 3CF0A 1XMXA 4JXUA 3FNRA 2I6SA 1KDYA 4DCSA 4LECA 2FF7A 3EZGA 2VDVE 3CNLA 3N70A 1HE4A 2EATA 2ZATA 3U54A 4K7JA 2AG1A 4LHSA 2XT9A 3UG6A 5TARA 1W5SA 3IVRA 3DUWA 3AJRA 3LSYA 2O1XA 3MFIA 1KMHB 3E81A 3CUUA 2W6QA 3IQWA 3LYAA 3MUOA 4LNUA 4MS1A 3VV2A 621PA 1P39A 4G2NA 1JHMA 1PQWA 3GQBB 2WVHA 4YR0A 4CM6A 4DG8A 4GPTA 4QOSA 1VL8A 2YCLA 4N8EA 4DS3A 3WQHA 3BIXA 4WK2B 3DV2A 1HT3A 2O57A 1UFRA 2VDWB 1UIMA 5IJ0B 5AKJA 2C8KA 2H1VA 4QWWA 2A3NA 4FDUA 1ST3A 1XLWA 2HJ9A 2YUIA 3ENVA 1JAYA 1C7IA 1XZBA 3H1TA 4I5DA 3GTJA 2Y4RA 4TLDA 3WTCA 1Z12A 1I2LA 2H7CA 2ENUA 2PAAA 4RMGA 1YH3A 4H60A 4KE6A 3T7EA 2VPSA 2BCEA 3EXHB 4IDDA 1Z0DA 3WIVA 4EJSC 4JJ6A 2O3JA 1ZUIA 5F9MA 4ALIA 3B89A 2B6NA 3HXTA 2NX2A 3NJRA 2P2GA 1OFHA 1DBQA 3DXFA 1FFCA 3P0RA 3GNSA 4M0UA 6CHYA 3GXBA 2QRZA 2W9CB 1NOKA 1R6UA 3DVQX 2QQ5A 4Q45A 3M9XA 3TW0A 4E46A 4CIAA 3Q2IA 2V97A 5HHTA 3LX4A 3VHRA 3M6MD 5JBQA 1Z0ZA 1JAXA 2EW2A 1Y8QA 2VIIA 4RGYA 5TQ0B 3BJRA 1I6LA 4C2AA 3SBDA 2ET6A 3N86A 4J90A 1PHRA 5DW0A 2FSGA 3HO1A 2JA2A 2NUTA 4RY9A 4WECA 1SEIA 1XWIA 2G80A 3ROMA 4ZDWA 2FQXA 4LX0A 3V7YA 4EJFA 2QKYA 1ONSA 3DC7A 3TR5A 3E53A 5FWDA 4D6PA 4JVMA 5IKPA 1EIZA 2H1CA 4I46A 2Y76A 1E18A 4L95C 1UJ4A 3A6ZA 4NCBA 2BSAA 3NC4A 5L3ZA 5IZ4A 2WOJA 4YDRA 2HA2A 5KPDA 2Y77A 2FQYA 4U2FA 2PSDA 1I1LA 4QJBA 2HJGA 2YFQA 4RABA 3DE6X 1KI1A 2R6GA 4EFLA 1Q14A 1S3FA 3GJSA 2ZM5A 3BWEA 1UC5B 3L8DA 4CEHB 3KLPX 1N3LA 1GYRA 2W8LA 3AKZA 1JHOA 4OFZA 1EZZA 3T38A 4EYHB 1PJBA 3NCHA 3R6TA 5F21A 4QBFA 4J07A 3EYAA 1S68A 4X90A 3GD7A 4WINA 1QB7A 4EBCA 1UBGA 2NQ8A 4J2OA 3GMIA 2O6LA 1P6QA 1AHIA 2NUPA 4IIHA 3SLKA 4PBSA 4CQMB 1FFYA 4AM8A 1FRZA 3C16C 3QGMA 2G9QA 1BOFA 3MM4A 1F2TA 2VDMB 3OWOA 1OVGA 3H84A 4MKHA 4QYIB 5TMPA 4GPD1 3Q15C 5K3OA 3SIWA 1E1QD 1NSYA 3KR9A 4ZYWA 5FP0A 3MHTA 3TI7A 3HA7A 3FMFA 5T8KC 1FDRA 2NP7A 4BQFA 1ODFA 2YWFA 3UJBA 3GI1A 2WJIA 5EUMA 4BLUA 2V4UA 2XEXA 3KM0A 1COWA 3KR2A 2XODA 4HNVA 2ZIXA 1I0LA 3GRYA 4LC1A 3IAEA 5K51A 2A3RA 1W0CA 4LQCA 4P38A 3B1YA 4D4GA 4RL4A 5H83A 4DQUA 4CI0B 3DZCA 2IU4A 3RRZA 2NXJA 3OC0A 1LQ2A 3K6JA 4FHCA 1ODTC 2PBZA 1E2PA 2TYSB 4G26A 3NNDA 1IMOA 2BEWB 4UMFA 2R65A 1OJLA 4EATA 3UYLA 4DF3A 4DR7B 4E88A 1GAQA 3LSTA 5LWQA 5H4HA 1HKUA 4JBXA 4YJFA 3BJIC 2C3UA 1PDVA 4MJ3A 1P4JA 1DCMA 3G8BA 4XIJA 1BW9A 2NTEA 3UMBA 3ES9A 3WGZA 1Z0IA 5DNEA 5C5IA 3G8DA 3VZSA 4CMJA 3ESYA 2IW3A 4O3NA 1VDMA 4I5EA 2HMWA 4GM4A 2WTFA 4E11A 3MCTA 3R4CA 4N47A 4QG3A 4HHEA 1VYTA 4HWTA 4E5NA 1RJWA 4EBFA 4H7JA 5HKLA 1P72A 3DBHB 1X1SA 4UCVA 1XCLA 2G77B 3IDZA 4FQ7A 4EIWA 2DR2A 3W1GA 3ZV6A 5DG7A 4N9QA 1QANA 3EQ9A 3JQ8A 4XD7D 3I2IA 2Z3VA 4R40A 4JJZA 3K9HA 3OAAA 4X63A 5ALWA 3C3JA 1WVMA 5L4SA 4RTLA 2H1IA 5JUMA 1X1QA 2PYZA 2H07A 2VYVD 1OLOA 3I1YA 3UT0A 2ZJ6A 1Z88A 1JV2B 1P9LA 4G9GA 2GCEA 2H4YA 4KXVA 4BLTA 1RRPA 4IJKA 3W2HA 2DT5A 4E7OA 1B43A 4YAJA 3IEPA 2I6FA 2Q2VA 2XUOA 1CQIB 3GDEA 4Q15A 4X1IA 3JARB 2NV2B 1W44A 1KOFA 4IGEA 1RWOA 3U2QA 4BEJA 5KZMB 4HR7A 4F4FA 2J0UA 4PRLA 2R7MA 1IM8A 1XI2A 3KQTA 3N39C 2GN0A 4KMMA 3M9NB 2WJJA 1EFAA 4TLLB 4JR1A 4C76A 1KK3A 4X24A 3KL4A 2I4OA 5ETJA 4BFXA 5BRJA 3ESQA 2XKJE 1LRLA 1QLJA 3II6X 2XYQA 3W5OA 4B2PA 3EULA 1KZ6A 1OX6A 3OHPA 4QGFA 4S2UA 1J0BA 5I5XA 4PLHA 1JEQB 2A1TR 4GX2A 4LRXA 4Q7EA 1TC2A 3UTCA 4BN4A 2HHHB 3BILA 1HDZA 1JLSA 4QWCA 2GVNA 3O4JA 4KQHA 1I9GA 4G8JA 3PO3G 2IITA 1FNBA 2JEGA 4D7AA 5DBIA 1L5HB 3K30A 4G8BA 1YMUA 4D57A 4KAAA 4DW8A 5LJIA 2WV9A 2W2OA 3EGDB 3O95A 4TX1A 4MMXB 4WZBB 1U2QA 1Y4AE 2C58A 5I7UA 1IZZA 1DWOA 3LUPA 1K2WA 3QIAA 3KSRA 3PUKA 4AX8A 1TM2A 1NWHA 1Q95A 5WRFA 1HDYA 1OGJA 2AQIA 2QPLA 3CTPA 3P0FA 4MGKR 4XW2A 4IS2A 2OHVA 4O02B 1T4CB 4GF5A 1I4LD 1MB3A 1D6NA 1Q0ZA 3AT1A 3C3MA 2PO7A 2GERA 1C7ZA 3O8NA 3NH6A 2RK4A 3BB3A 3SZLA 1U31A 2ZSAA 3QE3A 5HIKA 5I7WA 4B3FX 3HKZA 3W5CA 2F2TA 3UZBA 3QHPA 1SO8A 1XZIA 4J0GA 1DFGA 1W4CA 3OLWA 1HWYA 3CPEA 4IHJF 1E9AA 3I9V6 5IASA 3CXUA 1A82A 2OFWA 2P4EA 1V16B 1Y8RA 3HOZG 3JQBA 4KQJA 4DV5H 4MR9B 4L4XA 3WRYA 1WJGA 2RJNA 5KU1A 1JFRA 1MT3A 2WAMA 1N9KA 2BGUA 5JCOA 2F9LA 2JCVA 1WR8A 1GYPA 1P1RA 2BRUA 3N8DA 2P7HA 3HI4A 3LFUA 2HIVA 4I8XA 2VEOA 5KFVA 4U63A 3LJKA 5JRJA 4MHTA 3WLEA 1VMAA 2JW5A 1YACA 2O7SA 5BWXA 4UEQA 3D3KA 3CX7A 2QD4A 2ATCA 2QN7A 2QHXA 2C8VA 4PQGA 1YR3A 3N9IA 5IFLA 1BCRA 4FFPA 1X94A 1WKBA 1U99A 2FW1A 4K1XA 4CMGA 2BFEA 2I6XA 1LFAA 4R2IA 2IOHA 4M0MA 4UHHA 3VR0A 1IBLB 5BXYA 1KOJA 2AKYA 4YRDA 1DL5A 3AW8A 3GG9A 2JJ1A 1K8XB 1TVCA 4OHPA 3UUGA 1UDWA 2CFMA 4X62B 4QHYA 2RI6A 3GFBA 3K70C 3E03A 3H1AA 3TLKA 3EEIA 3PNOA 3OZUA 3HCFA 2D2IA 3IS3A 3NYRA 4QBGB 4CDGA 5ICMA 2NYUA 1WBJB 3Q6MA 5J1SB 4F50A 2KYRA 3P2YA 5TVGA 2VH2A 4D2IA 3UWDA 4LF7H 3W6UA 4B5KA 4YCDA 4K9NA 1NVGA 4IWXA 1Y4UA 2I4RA 2QI9C 4RHEA 4XYLB 2JAPA 4D9CA 3KOZA 3AEKB 1U1EA 4D80A 4WZZA 2ODWA 1OIXA 2G0TA 3DXXA 2BEKA 2FPIB 2I2FA 5TGTA 4NEHB 4YRLA 1RP7A 3OZEA 3CVUA 3KYBA 4W9NA 2FJPA 4X44A 3V1NA 4IR1A 5D8DA 3PW2A 4Y6OA 1ENPA 1KJ8A 1H5NA 2WBLC 1K86A 3EPRA 2CV0A 4UMDA 4BAZA 4MPTA 1GDHA 4D6YA 3U4MA 3UZUA 2C7OA 4KWIA 1CFZA 1G9XA 3VKGA 4OQZA 1DO8A 4YR3A 4UUMA 3R7DA 2XGPA 1GPWB 4YMUA 2JFQA 4OIFA 1R5NA 3E9MA 3EASA 3FX2A 3RGZA 1JIJA 2VSQA 1PSDA 1E5DA 3FG9A 3FPJA 4Z9XA 4ZMRA 4PO1A 2QQ0A 3MINA 3GN1A 5IC5A 1WHSA 1WX1A 3DAAA 2Z04A 1R9MA 1GV0A 4F2PA 2C00A 2DP4E 1QXSA 4QEKA 2ZJ5A 2EHDA 1PNVA 4L3OA 5ERGB 4RTMA 4YAEA 2UUAB 1C4KA 4KQ1A 1OT5A 2O5EA 1Q0RA 1NX9A 1M83A 2HQBA 1VPEA 1ZH6A 3HYLA 2J0VA 4JI6B 4GI5A 4HNSA 2P6NA 4BNDB 4K0KH 4MRPA 5AXAA 2PRSA 3D6NB 3GGDA 4EM6A 2UXCB 4QQRA 4MQ4A 5HBGA 4BUZA 2X9LA 2FPUA 4AQYB 2J9YB 3QPCA 1RQLA 4IDQA 4RZXA 4WCDA 3ELYA 5T4EA 3ZLVA 5FPKA 2QORA 4NZMA 2B37A 2ERCA 4RKYA 5DB4A 4ZT5A 1NUSA 4YDQA 3QTTA 2HIHA 3AZOA 4HSEA 4LN1A 4BNKA 5K6TA 1EVYA 3FPHA 1XZEA 3VR1A 4X91A 3H9EO 4IDBA 1IULA 3U3OA 3T5HA 2C54A 2XMPA 1MOPA 4A2WA 2JARA 1W1UA 5AHWA 2R1ZA 3RANA 1CUCA 2R9VA 5D85A 1YA8A 3AUTA 5JFTA 3OCZA 2AXNA 1CKOA 2AX3A 5KX5B 3KJZA 4RY8A 2V6MA 2F7SA 2WR8A 1K6EA 5LQNA 2XKBA 3OE7A 5LKAA 5F5NA 3W5UA 2FZWA 1YZKA 3K9CA 2R11A 3R5TA 5CAEB 2VXOA 1W76A 3O38A 3QUSA 5EZ5A 1T34A 1CB0A 1E4VA 1NR7A 1QQTA 1ZY2A 1L5GB 4D3FA 2OGTA 4CKWB 4EHBA 4NH0A 2FX5A 2NZXA 3A6PC 1E9CA 4C2TA 5TJHA 3UGKA 1V3TA 1GXSB 3TI9A 3GYGA 1FS5A 4FCTA 3BK2A 1UK7A 5L8VA 4PFKA 4ZDKA 1POWA 2JDID 1KK1A 1SXJE 1U11A 3C15C 4JLKA 1C7JA 4P08A 2I6GA 1UADA 3NDPA 3WMXA 1Z37A 1F8FA 3SN6A 3KPUA 4GNKA 4ZAXA 1JTEA 4CGZA 1OAOC 3IPXA 4DMHA 3B8EA 3L8MA 4YHBA 4PN7A 2FI1A 1QTQA 2GNOA 2XW6A 1W88B 2IEAA 3E5RA 3N2EA 4JI6H 5DGBA 3BRWD 1H2FA 4US1R 1SXJC 5JNWA 1T2DA 5JAQA 1B8NA 1Q3TA 2HBQA 2B0JA 2EV9A 4TV8A 2ZT7A 3SHWA 2NO0A 3BQ1A 2PGIA 3IA7A 1L5WA 1KF0A 4NJEB 1D1TA 2PS3A 5COAA 3WHKA 1ZM2A 3PX2A 4ZZ3A 3H17A 1N2XA 4CLRB 3LCUA 4HEJA 4WXEA 5LQAA 4DLAA 3DOHA 1I6WA 2OC9A 1P8JA 1G20A 3NT4A 3QKWA 1O77A 3MNFA 3M6UA 4O7LA 2Z4TA 3H5AA 1HFKA 1YDEA 2JIQA 4QPJC 4RVHA 2AFHE 4FYYA 3QNUA 2QVLA 4G1MB 1QE0A 2IF0A 3M5CA 4HMOA 4Q05A 4QJ4A 3T61A 1GY8A 3WMFA 4B3CA 1IEXA 5GZ1A 3L0IB 3KYDA 1AKEA 1OPXA 1K3TA 4PWQA 4ZQCB 1A77A 1C5KA 4H77A 5HCIA 1JQ3A 1QJ4A 4YJ3B 1A9XA 4Q4LA 1IFXA 3OQHA 3WHLA 2FZGA 3I2HA 3SBEA 3AQ4A 2MSWA 3NEYA 4J9VA 4YP1A 5KWIA 5JJLA 4D0SA 3FZGA 4JYAB 2OLEA 1C14A 2LIVA 2RH5A 3TTVA 1DBPA 3K32A 3PTLA 1XL1A 3S2FA 1XF9A 2JJ2A 1SMKA 1QTRA 1NLFA 1S2NA 4S0XA 2F43A 1NV8A 4YPFA 4K9RA 5LPNA 2XRZA 2AMYA 2D6FA 4ZVNA 3DZBA 1EJ2A 5D3MA 3F3SA 2W8BB 2RDMA 3INGA 4MWEA 4CKBA 3IMGA 3HJGA 2DX7A 1A1SA 1SEVA 4AN1A 2EARA 3M5PA 2LCFA 1T3LA 1B6GA 2R751 1BDMA 4KMOA 3UAOA 3OG9A 3Q0TA 1TTPB 1NVKA 1HZJA 2Z8YM 3E2IA 4JP3A 3W4IA 3WGYA 1WSCA 1GUDA 2X1VA 3LCJA 4B75A 3PR1A 1RVDA 3V1YA 2V7GA 3C3PA 3OCCA 2WWYA 4DOMA 2HA7A 5C37A 4EFBA 1B7GO 4FJ1A 3ZDRA 4EGJA 2P1ZA 2VYVA 1R0SA 2Z1DA 2QD2A 2FE3A 3UWMA 3BKWA 1V0JA 3J81W 1VYVA 5L3SA 5IRCD 4EG8A 1YO6A 2YBEA 3CWCA 3EGCA 4YCCA 1NQVA 1TVEA 1CQJB 1RU3A 4NYIQ 2RGNC 3V4FA 3ZIDA 1PR6A 5JTTA 1QNLA 3RVLA 2BBSA 1DMSA 3RHZA 3VDMA 1UP7A 1LJ8A 4C4AA 3T9AA 1MLDA 1N8SA 1ZJ5A 5E25A 3OIWA 4MKIA 1YRWA 4KZKA 2WU0A 4B40A 2IH2A 1ZXBA 1K7FB 3S1LA 1I6KA 4F92B 2AK3A 4UTPA 2OD7A 3VR6A 2O8BA 3WIDA 1R0ZA 1TJ4A 1X2BA 1TAEA 2IELA 2OGWA 4RA6A 5IKXA 3WLTA 1MB0A 4Z7NB 3OQBA 4IUCS 5I8ZA 4B9AA 1OAAA 1G291 1T1JA 4BV3A 4HDQB 2WJZB 4HLUA 4IINA 4LISA 4BAUA 4YJ3F 2O8EA 3TCNA 2FZCA 2HIMA 3ZZ1A 5K0CA 1QJCA 3TX6A 5F64A 5ALNA 4CKXA 2FMHA 5JH7F 2VK1A 3AUUA 4AFNA 3G2IA 4O7WA 1NI5A 1VBMA 1YVUA 1N6IA 2E4ZA 1KMCA 2V45A 3IOYA 1KYYA 4Q39A 4I4CA 4URYR 3RAPR 1VI2A 4HVTA 4HGYA 1UEXC 4IH9A 3PWKA 5KDDA 3TLJA 3TKAA 5ALPA 3SYLA 2DKOA 2ZBDA 1WXFA 1HG0A 2OBMA 3KZVA 2DR0A 2G72A 3LCVB 3OUZA 2PWYA 3O8RA 3PX7A 3WWPA 3WLNA 2AEEA 5JALA 1SQ6A 2GTHA 4NZPA 3GFFA 4UULA 4JV2A 2J5QA 3H16A 5TPZA 3UOAB 1KMNA 5ERXA 4D0NA 2J1LA 4N3NA 4X94A 3U3ZA 4II3A 1E3LA 1SBIA 2ES4A 3KBBA 4IAOA 5IX8A 5JS6A 3JRXA 1DKNA 3P9YA 3T1NA 2PUAA 1JG3A 3T5DA 4UD2A 4QYMA 4FS2A 3ICEA 2WDZA 1TMYA 1Q1ZA 2FMKA 3TSCA 3NCTA 3VGJA 3WDMA 1CNMA 5BVHB 2VZ8A 5KYXA 2YYAA 1G6Q1 1Y1LA 3E9ZA 1SIBE 3JWHA 1W5TA 2XHZA 4GXQA 4DT1B 3TCKA 1KEWA 3ZJ5A 1PV2A 3EXG2 1EINA 3FYCA 1XKTA 4O3PA 3K92A 4HNAB 3HU3A 4R1TA 5DMHA 4QUEA 1VAJA 1T24A 3V4RA 2QYOA 1EHCA 4YCAA 3EDRA 1IBSA 2B78A 1QPGA 4YCSA 2V9PA 4F4JA 3PC8C 3HLYA 4GLJA 4H16A 3LL4A 3LRXA 5IHXA 2O03A 1JDBC 1D1QA 2M1XA 4B43A 4DLRA 1LBTA 1NSTA 3V4ZA 1ZGBA 3ORYA 4CMEC 1U3WA 1WV0A 5B1YA 4RTSA 2BFCA 2OO5C 3DTVB 2R8OA 1AIPA 3S2IA 5DK4A 4C6TB 4XVUA 5CX4A 1EM6A 3CNBA 1CWUA 4OU5A 4D3YA 5DHUA 3UMYA 2Q5FA 1PZFA 2ZE8A 4GP7A 4J9OA 2OLJA 4J7AA 4ZJYA 1N33H 2B9VA 2FW9A 4KRYA 2AHRA 5AIAA 1QHFA 2QLFA 3I34X 3OCJA 2R25B 4B6OA 3SWWA 2KBFA 2RARA 5EHQA 2OHHA 2QENA 3PWTA 5MGNA 1T1SA 4LV8B 4M7OA 1V2HE 2GYVA 4C21A 2XNHA 4TQSA 4ODIA 2YFHA 1U2SA 3H87A 2XWSA 5FRDA 2RGVA 3OI7A 1VE7A 3CLHA 1G3UA 2QUAA 3MLBA 4KX5A 1GL9B 3EPJA 4MI6A 2XNDD 4PY2A 3RUFA 2DPHA 1Y1SA 5B36A 4BBPA 3WYGA 5DXJA 3H2YA 2FEKA 3TIGA 5EKDA 1VG1A 1SGWA 1UXHA 1OFTA 2WWXA 3IPLA 4M1QA 4MP6A 5DAAA 4PQYA 1GL6A 4PGFA 3ZWDA 5AVWA 4D43A 2Q9AA 5FUQA 1RE0A 3MSXA 4L02A 3GROA 4OFWA 2VPXA 2JGRA 2PX8A 3C8DA 3DDNA 3N2NA 4UOEA 2Z09A 2O2GA 3FSEA 5CX1A 2I34A 4MAFA 5KYWA 1ORVA 4DUGD 3TJMA 1QNFA 3VNSA 3P45A 2HSZA 4FFNA 2ODAA 3W1BA 2WPDD 4BRSA 1FSZA 1T6XA 3HU1A 3RVMA 2XI4A 3JX9A 2R8JA 1LEHA 4GR9A 4HDSB 1FXWA 1ZCFA 4RZSA 5G3ZA 3RLFA 4BFTA 4F46A 1QYCA 4BPRA 7AT1A 3K1JA 1KDOA 4CCYA 1X9IA 1SYXB 5ILGA 4US2R 2GD1O 2QTFA 3CR3C 5D1PA 5IK2A 3JALA 1C3JA 3TMKA 1BJTA 3TY5A 1NW6A 1BOOA 2DPIA 1PV1A 1UDXA 1XTKA 3DA8A 3NIGB 4PG6A 2AJTA 1N2EA 2F1IA 4QDJA 2I87A 2FJUA 3T5CA 4B3HA 4B3MH 3EUEA 2Y2UA 4KG7A 1SKUA 2VOJA 2XQIA 3PXAA 4CKYA 1C0IA 2GLXA 3C3CA 4OSEA 2W48A 4OJYA 5DTIA 3X1YA 5HKAA 4DADA 4YXFA 3G0HA 1CLUA 1A88A 5E7MA 3F78A 4GKBA 4R9NA 3PVSA 3VR5D 3K8YA 3FVQA 3RYFA 4DMRA 1ZH4A 2HDOA 4G6ZA 3HJNA 5DTRA 1NPDA 1J23A 1DAKA 5LUBA 4YXWD 2FRXA 2H4XA 4S1NA 4IJMA 3R8XA 3HEAA 2QTZA 5FOQA 1S4QA 3INYA 4IQGA 4EHDA 4A15A 2ATIA 3PRKE 1M0EA 1US8B 3FMGA 5GONB 4CCWA 1NULA 1ODSA 1ZK1A 1FNCA 1A9ZA 2MSCB 1RR6A 1GA4A 4JI4H 2BFBA 4XFKA 4P58A 5L3RA 1H5QA 2WWTA 3RVOA 3BGIA 3S81A 1CUYA 1WM1A 3VC2A 1U8EA 4ED3A 4MKFA 3F5MA 1GKIA 1YIDA 2Y2VA 4ZMSA 4BBRG 1N3BA 4LYYA 2W2NA 2FG7C 2OCPA 2XB8A 5CA0B 3MYYA 4TLCA 2F1JA 2FXVA 1HY3A 2XHEA 3R7AA 4M6WA 2KS6A 1MAUA 2P0AA 1P2VA 1RCUA 3JQFA 3BHIA 3V6JA 5C8YF 4MA4A 4IOJA 4UEJA 4BNTA 4KQXA 5K8LA 1QQ6A 3EG9A 5CRIA 1OI2A 2NMVA 1DADA 3TOSA 3IV9A 4G9BA 3NX4A 1SJ9A 2GPSA 3BAAA 3LUCA 4WQMA 3N8NA 4L85A 5K4HA 4JT9A 1TECE 3IMEA 3K94A 4KXWA 4OJNA 5EJ2A 2W6ZA 1ZI6A 4N40A 3ZHZA 3S68A 2G76A 4AG5A 4EMTA 2ZDGA 5IDXA 1PNTA 1I2BA 2DHRA 2Q1XA 1LPOA 1TAQA 5EC8A 1BAPA 3D5QA 2D1TA 4MPJA 2Y93A 4P7KA 4V3BA 4XX0B 2CXRA 2X3YA 2H2FA 5AKZA 1HQKA 3BQ9A 2QTHA 2Y1GA 5HQ3B 3B13B 1GNQA 1RMTA 2HFJA 2O48X 3DYIA 1THMA 4O7YA 1UWKA 4U6QA 5JT1A 1J1UA 2RKWA 4ITRC 3ICPA 4I36A 2VF8A 4W5WA 1XALA 3IO5A 5EMKA 5BNZA 3ZCUA 3T9EA 3L1HA 1L4KA 4B4UA 2FUCA 1MT0A 1Z5UA 3M4JA 4JEUA 3T0GA 3UAWA 2BGNA 1Y9EA 1GSOA 2CNUA 2BR0A 2I5PO 3ONNA 4D0LB 4DG5A 4LEIA 4C0BA 4CG3A 2ATLA 4MIKA 2WU1A 1H8HA 2VWQA 2GD0A 4GX5A 3REGA 3F6YA 2J5KA 4HXYA 4URWR 2QMUA 4S2EA 4XIYA 1GG5A 2H08A 2QJRA 4JHLA 4RANA 4XB1A 3M89A 1U6JA 3BOSA 7REQA 2R62A 3L0OA 1P0QA 4CM8A 5GJVC 4LVCA 1E79A 4NS1A 2QM3A 4PHCA 1TCUA 2C22A 5LUAA 3OIDA 1AF7A 1G3MA 4QOEA 1MPTA 2Q8NA 1EWVA 1AU9A 1ICIA 3DOUA 3OKFA 1WR2A 5C7LO 2J6SA 2BLNA 4BBAA 1OBDA 2NZUG 1U3GA 2FLWA 4RSGA 4DG9A 2I2WA 5ICFA 1ANKA 1AXGA 2XQJA 3THSA 4V0RA 4GH5A 4BMPB 2XCPA 4QIHA 2EBWA 2ZLBA 1WSDA 1ADCA 2J0SA 3TL3A 1QAQA 2VTDA 3PNBA 4QELA 4XD2A 1NFRA 3M6XA 3OURA 1AC5A 1IHXA 2RGNA 4GGMX 4ND5A 4Z5XA 2AUNA 3GVXA 4NOJA 5DXFA 2W6IA 3DQPA 1Z5ZA 4DLSA 1UXOA 2I4LA 4I9NA 4GMDA 3EOZA 3QPVA 1W52X 1Z26A 2D0IA 3EUAA 3ND7A 2EWWA 3PDIB 4B35A 4JI8H 5K05A 4M8IA 3MW8A 4G56A 1X0XA 3UKOA 2G9RA 3HN2A 4HDOB 3B3GA 4LY9A 2HBRA 4YYEA 1A4UA 2BMWA 1FLVA 4KK3A 5BT8A 2N42A 5CCXA 1EXWA 3NTQA 1IK4A 4OK6A 4WA7A 1Y37A 4QYXA 3AOEC 3AR6A 2ZJ8A 2D7CA 5AI4A 4A27A 3HTXA 3LUAA 3JYOA 1JHQA 1PZMA 3GGGA 3LQFA 3ONWA 4KOAA 1NNI1 2ZVDA 3PPVA 1UPAA 1AOXA 1KP9A 1YZFA 4Y6GB 3UJ8A 3W4JA 2W0SA 1CBUA 2B4AA 2JCGA 3HABA 4KV9A 4OHBA 4OYRA 5ALKA 3W9SA 2IXTA 3D8RA 3MWLA 2R84A 3EXEA 4UDXX 1KSFX 4K6FA 2OPHA 4NCIA 4RWEA 4W5TA 5TS3A 4OQXA 3V5NA 3OJCA 1HE3A 4U0KA 1O0CA 2XGOA 5ALTA 3AHIA 4BJHB 4ZK2A 2QAGA 1GDDA 4DL7A 3A1UA 4ZT3A 1ZZEA 1XFDA 4PCLA 4UM7A 1GPUA 1KETA 1OFGA 2PLNA 2ZULA 3MBOA 4AMGA 2EGUA 1QRUA 4EZIA 2VCHA 1WOYA 1E1YA 4DL2A 5AOBA 5I4BA 2GVZC 1V9PA 3MIZA 4NBLA 1Y3IA 1Y3DE 1T2AA 3GCXA 1R4NA 4HATA 7ABPA 3ADPA 2P4HX 3FZEA 3CWZA 2YS6A 3F2VA 2IXFA 3LI2A 1QGOA 5C3MA 5ED0A 1GA1A 1OXMA 4CVNA 2DVMA 4RQAA 3ROQA 3ESRA 4J9LA 4J9KA 2GEUA 3TZLA 4ESEA 1HC7A 1JQ5A 2BP7B 4IKEA 2DAPA 5JQGA 4LFBB 2FPPB 2L82A 3O4HA 5CDTA 2CJPA 4F2DA 5H8WA 2XRYA 2ZRQA 2HO5A 4BNZA 3NT5A 3VBCA 1MC5A 2W7PA 4PPFA 5DM1A 3W2FA 2C5LA 2VLBA 4R7GA 5ALYA 1QSGA 4IGFA 1AKMA 1SVMA 4RY0A 4IDEA 4WGGA 4M83A 4DDMA 1QHEA 3UMMA 2IU6A 1ZCZA 4KDCA 4LPSA 1C9YA 2EEPA 2YYYA 3CT4A 1KEZA 1XDBA 2C2RA 4ND2A 5HFJA 2Z4SA 4OCZA 5U4QA 2WFZA 3G9ZA 2YDXA 1VGRA 4KACA 4TMYA 3VOAA 3WBFA 5IDVA 1M1NA 1ZVMA 4HDNB 1D2GA 4CV0A 1C3VA 4KQ6A 2CHUA 6AT1A 2QLLA 1CJMA 1W47A 2B1IA 1DIHA 3NIFB 4QTUB 5ICEA 2V03A 3F2IA 3QHQA 5J2UF 4EA8A 1GSHA 1U3VA 2C7VA 3NUZA 1JKXA 4CPDA 5IC4A 2D8AA 1USWA 1UBFA 4BY7G 4LYAA 2AZDA 5EQDA 2I7DA 4B33A 3KQUA 3NEAA 2QVXX 3EVGA 2VF7A 3CNHA 4PIVA 3P52A 4Q43A 4M38A 5LWHA 2PUFA 1ZMXA 3KXKA 4B2IA 2IXGA 3ZG6A 1DUVG 3GOHA 1GTZA 2RGDA 1J2YA 1UC9A 2LWIA 3FPSA 2XOKA 3HU5A 4CEJB 5KTRA 1PKEA 2C61A 3JYPA 4R6WA 1L8XA 3T3EA 3N41B 4J0KA 2VYNA 1IHDA 3EF3A 2GM9A 4RNNA 1FP4B 4UJ5A 4BN5A 4NZYA 2XVMA 3DTVD 5KVCA 1YKFA 3OFJA 1DOAA 4IHJB 4RA9B 3PLRA 3UPTA 3QQ5A 1PUJA 1IQUA 1N32B 2Q0SA 3MBKA 1J97A 3TW8B 5ILOA 4H1TA 4J7XA 3FDJA 5CFOA 1WSBA 1MUUA 1LSJA 3QPUA 1I1OA 4HQNA 3AYHB 1YT5A 5AI9A 5BSWA 1QTIA 3RC8A 1OPRA 4GKVA 1BQEA 4NENB 1H3EA 5H82A 4F11A 4IDNA 2Y1WA 2AFVA 2IXAA 1FF9A 4FB4A 2I3ZA 2FSVC 3D3WB 3DCNA 3KSDO 3PNVA 4RZHA 4PHFA 4CQMD 5F2NA 2CNNA 1RPNA 1L7AA 2ZIUB 4QA9A 4UW9A 1Q92A 1IJBA 2QVGA 2VQ6A 3K0AA 3EYWA 2R68A 4MV0A 1C30B 4BVKA 4HQOA 1T9CA 3FUXA 3A2MA 4UZEA 1SVKA 1H1LA 5KT7A 1ZEMA 3PNLA 2EFEB 5EWJA 1K7CA 2WSMA 3PHHA 4U7PB 1QC5A 5MF6A 2PGNA 3L2OB 2R00C 2ODTX 1YU9A 2JEFA 1NSFA 1N0HA 3WRYC 1EVEA 4NFLA 5BRNA 1DC7A 2AN3A 2DBQA 2QQGA 5FT9A 4W99A 4MH0R 4C03A 4Q4AA 5EJ5A 1DWUA 2DSNA 3OZ7A 2XUAA 4FWBA 1G42A 3MBIA 1AKUA 4KGXA 4O6VA 1FFEA 3UMCA 3C45A 1FUIA 2J3LA 3Q6IA 3BG5A 4R8MA 3ND5A 5G0WA 4HAZA 3SFTA 4MVJM 2YOGA 3QXJA 1VMDA 3PS9A 4CTJA 2VJMB 1WXHA 4XWOA 1RQXA 1JR3D 5CFLA 5EUCA 5KX5F 1QR6A 4HRAA 1E61A 4D4LA 3FOWA 3EY4A 4DLKA 2VA3A 1YBFA 1I2CA 1L3CA 1YQ9A 4IS3A 1OH8A 1OYVA 3VVBA 4YJHA 4J2HA 2WZCA 1E6EA 2AV6A 4LSZA 3GLGB 1FQOA 3S40A 3ORFA 3QVOA 4YAKA 4A3JG 1FYXA 2CMDA 2QBYA 3EE6A 3LVFO 3UHPA 3UGTA 3MAGA 5JNVA 2R6AA 4IIGA 3NBYB 3KL2A 3ODPA 3C8HA 3PXEA 1PD0A 2AUTA 2ZR9A 3JQEA 4W8HA 3IILA 4MQEB 3DO5A 4X41A 4L9WA 3PL5A 1TTTA 2JFXA 2VJKA 1WA5A 2QDKA 5A3QA 3URMA 3S24A 4H7KA 1W48A 1R5OA 4ZPXA 3LX6A 3SICE 1SD2A 4GOKA 4YT2A 3MEQA 3PEWA 2CHGA 1Q1GA 3S99A 1DFIA 1R1DA 3DKVA 3FFAA 4CKEA 4Q4DA 4E2XA 4KNVA 5BN5B 4ARZB 1VI5A 1B3RA 4N0QA 4DCCA 3DE2X 3KXDA 3REFA 3BL6A 3HXMA 4FMDF 3GJ6A 1J1IA 4LDAA 4NCHA 1QZTA 2DY0A 3G0CA 1XPJA 2JEOA 5JO0A 1SNYA 4JFAA 3E1SA 5JRDS 1M2KA 4C0WA 2CFOA 5FR1A 2X3UA 2JS7A 3LCCA 1PWEA 4I4TA 4IOMA 4LZPA 3W9YA 2ZZMA 4QWMA 2FGKA 2ROQA 4OL9A 3KPWA 4OPMA 1I8TA 1PEYA 3LDAA 4Y0VA 4CUJA 1X7WB 2GBGA 2DR3A 1K1EA 1RSZA 1YULA 4NABA 4YVFA 4H08A 4LQ4A 4DIEA 4AJPA 4AQYH 4ZRNA 2EJ2A 2DWQA 4NJOA 1D2NA 1N1MA 1OGIA 5DGCA 1J8QA 3C3EA 3GAFA 4COKA 4K9PA 1E1NA 3BREA 4K9LA 3GDWA 5CB8A 3PW5A 1FBNA 1I5OA 1VCHA 2VHWA 3FPFA 4B3JA 4YT8A 5AQ1A 1NKVA 3DNMA 1AS2A 3LXMA 2H7VA 4J94A 4ECRA 5EJ9A 2HFKA 4ZCLA 4FYVA 3GNLA 3PKIA 4E6NA 4WNCA 2FR1A 1QVZA 1B8VA 1FU8A 4MCIA 4TS3A 4WERA 4H7IA 2CYBA 3BUSA 3E22B 5LBTA 2WD8A 2IT1A 3I2FA 4ZO6A 3FWHA 3TQQA 3ZTTA 2OQVA 1XVTA 5HZKA 5HMLA 4L0DA 4JGBA 2Q1WA 3AOEA 3T1YH 3PW7A 2EX0A 2XF8A 3AIMA 3H19A 3JSLA 2WSYB 4R9UC 2VF5X 4URHA 1TQ6A 4FXOA 1AY0A 1EUDB 3W2TA 3DOOA 1ZW6A 5IBCA 4P7BA 2XYPA 1QUFA 4C5AA 2GCGA 2G9UA 4PC1A 4HYQA 5SZIA 1Z6XA 4D45A 5ITZB 5IXSA 2IEYA 1JECA 3QYAA 1Y7TA 3U40A 4GVLA 3G49A 4J03A 2G17A 4GYWA 1DDIA 2QRVA 4G23A 5EXXA 3TQHA 4NZZA 4B74A 4CF7A 3ZJVA 3GH1A 1QH8A 1YJAA 3LT0A 5J5CA 5DNUA 4CC6A 4GO1A 4IXNA 1XZJA 3KIPA 1QHYA 3TXXA 1KS9A 3AUFA 4YNBA 2FDCA 5ARBA 1AD2A 1LPNA 1OWNA 4KGDA 4C20A 3AR3A 3TLAA 2WTXA 4DN6A 1QOZA 1ZJYA 2BHRA 2O14A 4LY3A 1NN3A 2VATA 2R47A 4NMWA 3I6QA 5JYCA 4A7PA 2E5LH 1KJZA 3RYHA 5TIIA 2VDQB 4EMBA 3GEPA 4M7EA 1JEYB 2IU3A 4XGIA 1YZLA 2HK6A 2J85A 3QBVA 5U4XA 4HMPA 3WTBA 4DUYH 5IC6A 2OOSA 1E96A 1PFKA 2AOXA 2A5YB 2DEUA 3K73O 3X2FA 5A9SB 1II8A 3MAJA 3QUCA 4JJGA 5BW5A 5FAKA 4A6DA 4DAEA 1VMKA 2VBCA 1M7GA 2JIBA 1R3DA 3VU1A 5C2JB 1L7VC 3IJPA 4RD3A 2EW1A 2HA0A 4MWSA 3SBOA 5JROA 5FKJA 2YC2C 4RF5A 4WOPA 1RYZA 5ENZA 1FCJA 2G04A 1W93A 4RU9A 3GNTA 1P1IA 4O83A 1A8UA 4U6SA 4CTKA 2VPWA 4HAWA 1F48A 1Y1PA 2CEAA 3HMQA 4ALKA 5KSZA 1SAYA 2EFGA 3RAXA 2BWJA 2NXNA 2F59A 2IA5A 4DQDA 4MI3A 2QD1A 2Z95A 1K9SA 4IHQA 2NNWB 1KEEA 1MN6A 1R4MB 2OBFA 5KKCA 2FPXA 4G01B 2UYOA 1U3DA 4X64H 2QMZA 4LZJA 4Q4HB 1AN9A 3M3HA 1WDLA 3D7NA 3KLMX 3NHFA 4OB6A 4PS1A 4RGVA 4DYDA 5GVSA 3KTAB 1NJ2A 2WWIA 4FMCB 3KAJA 5LL6b 1C9DB 4L8FA 5FLKA 2F8TA 2P6MA 4TV9B 2O2CA 4KIJA 1RZUA 2H2IA 5HSGA 3AYZB 2D4HA 4TKUA 2WTEA 1DV1A 3FKQA 2G1JA 1Y5IA 4JEHA 1XUOA 1ZH2A 3GWGA 4E2WA 1SKMA 1SU7A 2P3OA 2WF8A 5CURA 1AH2A 1Z9BA 2QTBA 4HDMB 3EB9A 1NDHA 5A71A 3U4GA 2XB6A 3V7NA 2E4VA 5IH3A 3SXUB 1YVPA 3IH5A 4ZFNA 2B1RA 3IAUA 4HV4A 3GJ5A 4DRYA 3VDNB 4AULA 1RJ9A 1EKPA 1PJSA 1XMPA 3UB2A 4DCPA 1MHTA 3PIRA 3A4IA 2GN9A 1PV4A 1XMJA 2ZKLA 3JS5A 3QOFA 4QQKA 1HBJA 3GRKA 3ISJA 4ZAWA 1BWRA 1BFUA 3NETA 1TU0A 1W5EA 5EZ6B 2Z02A 4E5PA 5J5VA 3NNNA 5K3EA 4A2CA 1V8BA 2YXNA 4CN9A 4KYTA 5D6NA 1XEXB 4ETSA 2AN4A 4N5IX 5BQOA 3M49A 4XYEA 1SIWA 4N1AA 3ADCA 4EEQA 2HCRA 4LDQA 2JIRA 3BXPA 1CS0B 3LT2A 3IUMA 5CH5A 1TAUA 4BGIA 3Q72A 1SU6A 4TRRA 3HBNA 1L5NA 1AKNA 2ADFA 2WMNB 2I2BA 3TTWA 2VP6A 4QHSA 1T3NA 1TRKA 2DF8A 5EIBC 4AF8A 4C0HA 1GQOA 3PJGA 2VSOA 5K0ZA 4OOFA 1QRDA 2PY6A 1AHNA 2B61A 1OZAA 3KSUA 2Y9MB 2Q4RA 3SK0A 2XT0A 4X65H 1QIIA 4TXNA 5FPTA 2F1OA 4F86A 5DLGA 1ONBA 4E5DA 2Q6IA 3ANXA 3CN7A 3DVAA 3JZDA 4CDMA 4GG1A 3FROA 1WU7A 1MH1A 1W87A 1TMGE 1QLHA 2PSSA 1N0WA 3F4LA 3KFVA 2PKEA 1FYFA 3NUGA 5FPRA 5ADWA 1ACMA 3DT8A 2VQFB 3EZXA 1AKYA 1F51E 5CR5A 1IY2A 3U7FB 4RV4A 3UUEA 2FRDC 3JQ7B 1GPNA 2J9FB 1TYAE 4BEWA 1RRFA 1IOWA 1TWCA 2XDQB 4KSYA 1ID1A 2NU7A 3WR5A 5CXUA 1XTBA 1H6CA 2GPYA 2Y1XA 4DR4H 4EH1A 1N5LA 5BSFA 2OD9A 3HNPA 2HMVA 4ZVVA 2PXHA 1XKQA 2FPWA 2JA1A 2EKQA 4CR8A 2VJNA 3GA0A 1S0NA 1NUQA 2E18A 2VJYA 1IY0A 1RRKA 5KJCA 5A5GA 3DMFA 4R2WA 2B63A 4RLHA 4WKGA 3AC0A 3SF8A 2NSHA 5G0TA 1Y4DE 4U8HA 3ENQA 3GWZA 4XQGA 1YVEI 1EFVA 2E6UX 3L8HA 1D8TA 3NWBA 5CM8B 3M33A 4KCGA 5ADHA 2JFPA 4H15A 3B7PA 4B4VA 1UPUA 3SX2A 3N2GA 1GPH1 5C7IO 2CV2A 4HK4A 1GL3A 3EZ6A 5FWYA 1KYQA 5CJJA 5J2TF 2MYUA 2FEOA 3OE1A 1BDJA 1YIAA 2P9BA 2DGDA 4KODA 2P65A 1HNZH 2Z9CA 2DBVO 5ALGA 1ODJA 1Y80A 4MVJI 4F4HA 3FAZA 3PGKA 3HKDB 2H9AA 4K05A 1UMBB 4JR2A 1RBZA 1Y3FE 2FV8A 1H4TA 1FFGA 4TMXA 4Y2JA 4BKMA 4KXXA 3F96A 1NBMA 4PFSA 1AX9A 2A9KA 2YJ6A 5DOZA 1E6CA 4P3XA 3EC2A 5ESWA 5CVJA 3NTLA 3UJDA 3L06A 5FX2A 1GQYA 4C2UA 1R0KA 1RJFA 2FWNA 1HDGO 1SA0B 2PCJA 1V1RB 3DDZX 1NP6A 1P5FA 2IYUA 2XJ9A 4K6CA 2ZYRA 1ND6A 4LA4A 1SHTX 4UZSA 3A4YA 4IQ4A 5DNWA 4O7VA 2X8WA 3ZWBA 4UHCA 1MX1A 4XDHA 1VCNA 3O2NA 4IIFA 4BFUA 3BHNA 3MJSA 1X9GA 2GRJA 1FDVA 4DCGA 3OIUA 2JJYA 5DN6D 2R6FA 4YJHB 4QVKA 1CUHA 3QF7A 2D00A 1ILWA 2OXIA 1GGOA 1V5GA 5I60A 2PFSA 3H11A 1CJCA 3H9UA 3PNPA 4YWHA 1L5KA 5JAMA 4XIIA 4QO7A 5JSUA 1SUCA 3UQ8A 2PZJA 4OXQA 4HYTA 1VECA 3PDUA 1U2DC 4QIWE 2JDIA 5AD1A 2HADA 3AB8A 3D8TA 1TK9A 4YGYA 1UMCA 3FMOB 3Q88A 2N46A 2GXUA 1QQ7A 2JGMA 2C2GA 4ECUA 3WIOA 3GA5A 4PPNA 4R01A 4Y0AA 4N6NA 3UHAA 5ALUA 1EWQA 4KNYA 2EP5A 4S1OA 4NX2A 1YNSA 4AZWA 1CKNA 1ENYA 1BXZA 2YIVX 4P4UA 4P4SA 5JNUA 1SCUA 3LQ1A 3I61A 3ZS9A 3LGSA 3FCYA 3LX8A 5EJAA 1KWKA 2R8ZA 4OD0A 1X8XA 5CP8A 1PGOA 1Z13A 5LMNH 4LGMA 4OB8A 3W90A 2GPWA 1P6UA 2AN1A 4Q82A 1LU9A 3RRNA 4DHEA 1A2QA 3RS4A 3GUUA 1X3SA 3M6LA 2W2KA 3VVLA 2G70A 1EEXB 1ZIPA 3CXRA 1F1JA 1JT2A 1T5HX 3ILXA 4NATA 4CW7A 2GHRA 3F6PA 2IYAA 3H9BA 3DLTA 3VDQA 1ODLA 4X61A 2FEPA 5JXGA 4KO3S 4KSBA 4BX0A 1U7ZA 5B1EA 4N76A 1OLXB 3CVJA 2WG2A 1EXDA 1PJRA 2G82A 3LHIA 4GXNA 4P3NA 4EF6A 1IBRA 1V7QA 4Z54A 2J46A 5KFEA 2XVXA 1PSWA 1SULA 1J20A 2CC2A 2GJ8A 3MJHA 1JDPA 1UJ2A 5JSYA 2JGEA 3DWIA 3A28A 2B30A 3DV0A 2VPTA 3L8YA 1JE0A 3NVAA 4X54A 4WK4B 2WJHA 1N6NA 2QI9F 4O4LF 4TMKA 5MGBA 3WNDA 1WVIA 4G97A 2TS1A 2ID9A 4W7HA 4DRXA 1PT6A 2HIXA 2HZ7A 3ECAA 3V9AA 5A5DA 1WPXA 3IOEA 4IR9A 1MJNA 3P9XA 3GEMA 2OWDA 4HCJA 3QUTA 721PA 2ZRHA 2PUDA 5DN6A 4YWJA 4EECA 3COVA 1TZ2A 3NDIA 2PX5A 3LKVA 5CNKA 3ZE8A 3TFOA 2IBSA 1D5WA 2G8NA 2H0QA 5AMXA 2G6TA 4MUYA 2O7RA 4X95A 4HUQA 5CDFE 5HDBB 1YS7A 3D1JA 1QVVA 3ZXXA 1J0AA 4B6QA 4BGEA 3TEJA 2FPRA 2MIIA 5TF4A 2ZRAA 1BJKA 3K05A 2PUBA 5AKXA 2VXBA 2ACVA 2QJWA 4IBOA 5ALEA 1P2GA 4RLFA 2IYLD 1KT8A 2HSGA 5JYEA 1E0SA 1T8SA 3PQDA 3ZW7A 2ZYAA 3FDSA 2XUKA 3N0WA 4N0EA 3TKYA 2BFDB 2QP4A 4IMIB 3U37A 3E4CA 3UFXB 2BM0A 3WB9A 2G1UA 4LNAA 3NYIA 3OHMA 1KRXA 4Q7JB 1TW2A 4ARIA 3IVAA 3EK2A 4UPDA 2B1JA 3BXOA 3P26A 3HBFA 2HWUA 5TMEA 1RYEA 5FOVA 1ISIA 2VR1A 3OE7D 4W63A 3WGLA 3WICA 1QK4A 1NHWA 2VWGA 5C35A 2QLTA 1L5YA 2YJZA 1QZXA 5L7YA 2MINB 1GEGA 2OB1A 5MFZA 4JFRA 1CZNA 3NM5A 1ARZA 1PWXA 5C1PA 3I04A 4RZ2A 1CHNA 4IEIA 4KQIA 5DCUA 4Y8VB 2UVWA 4FNAA 1FOEB 1FDIA 4YMSA 3CSUA 2WJVA 3WQSB 2WAXA 2NAFA 3E8XA 4Q3DA 1H2HA 1T8TA 1UM9B 4QNRA 4YMIA 2DT8A 1DAEA 2ZTSA 2OYRA 3ER9A 4U7HA 1TGYA 4Q93A 4AYWA 1SQFA 4UNNA 3O3CA 3IGFA 2P1DA 3KJIA 3OZRA 4LVNA 1FMFA 3FZNA 5BSRA 4KHPH 4EFDA 2A88A 4UM5A 4B6GA 1I80A 2EL9A 4LWOA 5LP6B 3UZOA 2NVOA 3K0FA 2CXOA 3P9PA 4DYHA 2VUUA 2ZS7A 4M8LA 3IBFA 5KG2A 4KWEA 3U49A 1GPLA 4JI2B 4DV2B 2PZGA 3BH6A 1JIQA 1MH9A 4IGKA 5C81A 2FFRA 4EFEA 4HOYA 4P7JA 4PR0A 4RMJA