5JQWA

The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with adp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
365
structure length
365
Chain Sequence
MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKKLIALSEEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide synthase
publication title The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with ADP
rcsb
source organism Francisella tularensis subsp. tularensis (strain schu s4 / schu 4)
molecule tags Ligase
total genus 112
structure length 365
sequence length 365
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2016-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5jqwA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5jqwA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jqwA01
4EG0A 5DMXA 4MV4A 3V4ZA 2CQYA 4O4HF 2DLNA 1W96A 4O7LA 5CB4F 1A48A 3AX6A 4EGJA 1UC9A 4O4LF 2NU9B 1WR2A 1VBGA 2GPSA 4O4JF 4ZI7F 1T36A 1Z2PX 2YS7A 1M0WA 2YWVA 4M99A 4EAAA 2FPIB 2FB9A 3HO8A 1JKJB 2YZMA 2ZDHA 4XYLB 2W6ZA 2CNUA 3ETHA 3WO1A 4YBZB 5JQGF 2NU8B 5HBRB 4YAKB 4Y8VB 4XZ3B 3LWBA 4HNTA 3BSSA 3KREA 3RV4A 2C00A 2CZGA 2Z02A 2R84A 4IWXA 1IOVA 1KUTA 2R7MA 5J2TF 3R5FA 1B6SA 1C30A 4EA7A 3VPCA 1KJJA 3N8DA 1EUCB 3MWEA 1GGOA 3U55A 2PVPA 1AUXA 2X0SA 2V58A 3RV3A 4I55F 3JRXA 4O7TA 2GPWA 5EZYF 1VKZA 2NUAB 1IOWA 1SCUB 1OBDA 4O86A 4O2BF 3UFXB 4IWYA 5GONF 2NU6B 3V4SA 5KKNB 4E4TA 4EA9A 2I87A 4FU0A 4MV8A 3JZFA 4I4TF 2R7KA 2R85A 2FPPB 3K3PA 1KEEA 4O83A 1CQIB 5LYJF 3WNZA 3BSYA 4O7YA 2IP4A 1KJQA 5J2UF 1I7NA 3BG5A 4M9CA 1I7LA 4DIMA 4GGMX 3JZIA 3ORQA 3GLKA 3VPBA 1EUDB 4O2AF 5HV6A 4IHJF 2Z04A 3OUUA 4WD3A 1VBHA 2YL2A 3KAKA 4O7NA 1E4EB 2W71A 4L1KA 4DLKA 4O7RA 4FFOA 2YRXA 1E4EA 1B6RA 5FNVF 2YRWA 2HGSA 4O81A 1KBLA 2FPGB 1M0TA 5C1OA 2CNVA 3KAJA 5CA1F 1A9XA 2W6MA 4ZOLF 4MA5A 3Q1KA 2J9GA 5LXTF 2W6OA 3TW6A 3VPDA 2QK4A 1EHIA 2W6PA 4I50F 2GQSA 4C5CA 2YW2A 2W6QA 1KJIA 2YYAA 2YZLA 5LOVF 3TQTA 5BPHA 5H80A 2YS6A 2I8CA 2R7NA 5K2MA 5C8YF 3QFFA 2GLTA 3NUAA 4MV7A 1EZ1A 3N6RA 3RUPA 3TINA 2PBZA 4YJ2F 1KJ9A 4QSHA 4O7ZA 3VMMA 3AW8A 4MAMA 3G8DA 4XX0B 2V59A 2VPQA 3U9SA 2QF7A 2VR1A 4YJ3F 4O7WA 2ZDQA 5KX5F 5JVLA 2HJWA 1DIKA 4M9UA 4FFMA 3WO0A 3LP8A 4TV9F 2W70A 1GSHA 5BPFA 1JDBB 2R86A 5IYZF 2PN1A 4WBNF 2ZDGA 4C5BA 3OUZA 1UC8A 1CQJB 3Q2OA 3HB9A 3K5HA 4ZQIA 4TV8F 5LP6F 3VA7A 2R7LA 5LA6F 5JQWA 2NU7B 3R23A 1GSAA 4XYMB 4HNUA 1KJ8A 2CNQA 4MV9A 2DIKA 3BFPA 1GLVA 3U9TA 4ME6A 4HR7A 1JDEA 1AUVA 2OLSA 3TIIA 4IZOA 1Z2OX 2SCUB 4MV3A 4FE2A 3MJFA 3R9RA 4EGQA 4NYEA 3GIDA 4FFLA 1EYZA 4J6EA 4O7SA 1M6VA 2YZNA 3R5HA 5D8DA 1KC7A 1PX2A 5I47A 4IIJF 3KALA 4YAJB 5CA0F 5C1PA 4HQ6A 2FP4B 1DV2A 3DF7A 2YZGA 5CAEB 2DZDA 2WYOA 1DV1A 4O82A 2P0AA 4MV1A 3VOTA 1BNCA 4O84A 5JVDF 3RFCA 1C3OA 4MV6A 1OBGA 3K5IA 2R82A 3SE7A 3TIGA 4FGRA 4YB8B 3E5NA 4M98A 1W93A 3I12A 5BMVF 3R5XA 2GQRA 2R87A 3ETJA 4TUYF 4C5AA 4O4IF 4FFNA 3G8CA 1BXRA 1JLLB 3MWDA 4EABA 2DWCA 1ULZA 1PK8A 2V5AA 4EA8A 2XD4A 2VQDA 1CE8A 1CS0A 4ZHQF 3BSWA 1GSOA 3HBLA 2I80A 3JRWA 4O7VA 2XCLA 4FFPA 2VHEA 1Z2NX 2W6NA 3U54A 4RZQA 4MA0A 4HNVA 4FFRA 2NPOA 2R6FA 5JH7F 3ORRA
chains in the Genus database with same CATH superfamily
4CIAA 3NHFA 2NOAA 3LHSA 4KE9A 5LMNB 1JIHA 4YCNA 2J7PD 1OI7A 3UXYA 3ACCA 1DL5A 4YDHB 2BD0A 1EGHA 2E6KA 1QR2A 1L4FA 1ULTA 4UTPA 2BI8A 3QA9A 3TWOA 4KYIB 3IJRA 1PQWA 1SOWA 5EMHA 2ST1A 3IAM1 2DWQA 4TLEA 3UAZA 1ZIXA 1P75A 2AI3A 2EP5A 3IAUA 2JIDA 4D46A 4HWSA 2G9RA 3K2QA 3CUUA 2QN2A 1U28A 2GJ8A 3MW8A 1NIJA 1YR9A 4FBMA 4H7IA 2G76A 3UCFA 2FNAA 3GV8B 4DR6H 2E49A 3X3HA 1NNUA 1VKZA 3VI4B 3T1YB 5I5YA 2RIPA 3ROXA 4MPDA 4YTEA 1S0MA 3SGLA 5THQA 2DF8A 1NKSA 4A73A 2BEVB 3IUEA 3KTFA 1M1NA 4E08A 1M7HA 4KQHA 4B35A 3CUSA 1KTAA 1UQTA 5I9SA 1IN1A 2B99A 3NH9A 1E9CA 4DNPA 1U0NA 2R7KA 5JMOA 3LUGA 3EMKA 3OEWA 4ZVPA 2AZXA 2PRJA 3SKYA 4L4SA 1ORVA 4LX8A 3UB2A 3RSHA 4RNCA 2QQFA 4ZALA 2ANCA 4Q05A 1O77A 1ZM9A 4PRYA 5JCXA 1FS6A 3OJEA 4Q8FA 4GM4A 2WWRA 5K4GA 3NEYA 1QKIA 2GETA 1BN7A 4UJ3A 2Q1UA 4OJMX 1E4EB 3A1UA 3KEGA 1U8YA 1BQ4A 4JUFA 3RVBA 3DR3A 2YWFA 3MAAC 4PC7A 3K70D 3KDAA 2QZJA 4YR9A 4G5RA 1P5RA 3PGA1 3ZH9B 4NZMA 4AXBA 2AGVA 1GP2A 5LA6A 1V7CA 1L6RA 1I5RA 1OAOC 3ZH2A 3HRIA 2VF2A 3GLFB 3CT4A 1M2VA 2P1ZA 1JSRA 1EHIA 2EXXA 3I01M 1XDGA 4M86A 4A0GA 2QGZA 1NXOA 4JYBA 5K0CA 3NBZC 4EQ6A 4Z4EA 4XM2A 3O7MA 1N6KA 4IIJB 4J90A 3UBTA 3HU3A 3D8TA 2H1RA 3RS3A 4Z54A 5KPJA 4TLMB 1E2QA 4DCVA 4TROA 5EYPB 3RYIB 2EJUA 5IUJC 1F2TA 2GDZA 3O2QB 1HWYA 3K35A 5T4BA 1WV0A 1EGAA 421PA 4ZMBA 3RB8A 4C30A 3SSNA 3WK4A 4XFJA 2AOUB 3EZFA 1F0NA 4Y0VA 1YUNA 1LBIA 4BMSA 4XVHA 1RDFA 3LHDA 3GO4A 3L6EA 3QMMA 5KDOA 4WERA 3PEYA 2R93A 2Z3VA 4PLYA 4S0ZA 1W6RA 2HHHB 3BK1A 3SHTA 2OUIA 1H9CA 3M5CA 3K09C 4ZGGA 4K6CA 4UM9D 1I2BA 3WGHA 4FB5A 3K0CC 3QNMA 4F8JA 3WMWA 1YNSA 3M9WA 5CFRA 4KXUA 3GXBA 3M9OB 1EJ6A 1LC0A 1E3EA 2R1ZA 2VJDA 2ZJYA 4BV2A 2OMEA 4B6RA 3COZA 1PJLA 4GI1A 5TE9A 3MHPA 4D0LB 4ZV7A 4OYHA 2HNKA 2SKDA 2XMGA 2XTJA 5C32A 4RAYA 2XI4A 1MW9X 1SVLA 3ZWQA 2Z3ZA 1SGWA 2EFYA 4RK5A 4YALA 3AFIA 1V11A 2XVYA 2HN9A 1N32B 5DCLA 3LA6A 3E7FA 3C3DA 2YJ6A 4TLBA 4AUKA 3GK3A 4JC4A 4WXMA 4BUJA 2OBLA 4IV0A 3ZS8A 1UMDB 4IRDA 2QTAA 2O03A 4EDHA 2Y27A 4BVBA 1A9TA 4A1FA 1RPNA 4K40A 3WP0A 1MN6A 2QBYA 5I5UA 1JG4A 4OJNA 4BWGA 1EP9A 4F45A 3LDFA 1LPAB 1PFWA 1PJTA 1T3LA 1H9AA 2ORYA 4KP7A 4QWDA 5E9QA 3T7KA 2QLLA 2FPIA 3LBAA 1KH2A 3CO5A 2HQBA 3I6BA 3RF7A 4R51A 4XFKA 5BN5A 3U3OA 3IN5A 1XK5A 4TWJA 7MHTA 4WCDA 3SN6A 1Q1AA 4CEIB 2FRDC 1DTWB 4HGQA 4RKFA 3TNLA 1XZKA 4I5IA 3INYA 4BLRA 4WVFA 2NWQA 5FNVA 4U5QA 4HN9A 3GD5A 2QRZA 5M7EA 1ZO8A 1OY1A 4BKQA 2YNMA 2R92A 3O9MA 2GASA 5CA1A 3E61A 3HI4A 3BERA 1MEOA 4PX5A 2V4UA 1R37A 4FNOA 4I50B 2ZI7A 4BECA 1ZL2A 4I2VA 3DFMA 1MX1A 5KFPA 2BR0A 1P4GA 2Q6LA 3D6AA 2EWMA 2H1LA 3UM9A 3VJKA 4MV8A 2AKYA 1CQWA 1ID8A 3QFHA 3M4YA 1CT9A 1NJ8A 2FG6C 4PVCA 3G79A 1EM6A 3R3YA 5IU6A 3HA3A 3BG5A 1NRIA 3H2SA 4HX9A 2AWNA 2NYAA 1P8AA 1K8RA 3DDUA 1YU6A 5EGNA 3QBTA 4C88A 4TTPA 4GOKA 1PNOA 3UK7A 3K6SA 2C96A 4M87A 3C3JA 3F90A 3K9BA 1L5HA 3N0RA 1SVMA 3TSZA 1BU5A 5JMPA 4KXMA 1W1WA 2YVLA 3WLNA 2JFWA 5GM2A 2VWQA 3ZTWA 1II0A 3EZGA 3Q9UA 2VDLB 1Q0TA 1Z5UA 4CLRB 1UUFA 3GEEA 3WJ1A 3B3FA 4OVKA 3GB8B 3KHUA 4FI3F 5DNVA 2AGQA 2VH2A 1LDNA 3HWSA 1GL6A 2ZRQA 3FVRA 2OPHA 1L9KA 3OP1A 3I0MA 1EZ4A 1UADA 2XA9A 3VU0A 2FR1A 3NDPA 3TINA 5ULLA 1OWOA 1B2LA 4XLZA 1HTWA 4J3NA 2NPIA 2ET6A 4LGMA 3GNQA 4OXKA 2XX3A 2QTWB 2C5GA 1HETA 2WAQE 1MJGM 3HXLA 3ZVMA 4TTSA 5C8YA 4F21A 3NUQA 1BS1A 5DM70 4DR3H 1V9LA 1E63A 3HXOA 3LCRA 2B8EA 1OB2A 3AXSA 1M2NA 2WB4A 3DZGA 5LIRA 1UC8A 2AUMA 4AL4A 3WY9A 4TUYA 2OG2A 3BMCB 3KQLA 3C7AA 3O1IC 1OWNA 3R23A 1XJ0A 3WRXA 3A4TA 4OO3A 3ZIUA 3DEAA 2D1TA 2ZPAA 1ZJYA 2EAUA 4KHZA 4YNBA 4DAAA 2VDMB 2QTVB 1KQFA 2ZETA 1GGHA 5I7VA 1KQPA 1SBHA 3KKZA 5HK9A 2IPMA 4OQQA 1EYZA 3DYIA 2CNDA 3B78A 3D5QA 3EQZA 1E2HA 1C9MA 2YY7A 3TRKA 4AW9A 4D81A 4HUJA 4YAJA 2BUBA 5EJGA 3AL3A 1QCDA 5F9FA 1KBOA 1X8XA 4F91B 3DQPA 4BFUA 4LFCH 1EK6A 1Z0UA 1KEPA 5DFAA 2UXDH 2ON6A 2Y1CA 1UEIA 3DTYA 3K8QA 1YDWA 2IDKA 1RIFA 2OZVA 1N25A 3E15A 3PXEA 4Z53A 2P9YA 5ERYA 2NVUA 3T3GA 4URYR 4AAYA 5KTKA 1NRJB 4U7GA 1FBNA 5JY6A 4PC2A 2Y1DA 5CXSA 4L08A 3HLTA 3KKEA 1CLUA 1ONPA 5C7IO 4HTAA 1I7DA 4MV4A 1NOKA 1N77A 4Z4IA 2F1IA 1JZSA 3U5ZB 5FI0B 2UVUA 1M72A 1ZITA 2FG7C 2FPKA 3ICWA 2RGNC 4FW9A 3RK4A 1BWSA 1ZY2A 2JD0A 4K7JA 1LK7A 2NO6A 1IBMH 2H1SA 2OGUA 1NMXA 3ECSA 4COOA 1JKJA 1FRVA 2WU0A 5IVKA 5T14A 4L73A 3OECA 3L1HA 3KTDA 1ZIOA 3LUHA 2IUFA 2Z02A 4DV1H 3IEVA 1M83A 4NHEA 5EOYA 5MDHA 4Z51A 5FV7A 3GHHA 1MD9A 3QRWA 1EJBA 4O3RA 3CF0A 5DWQA 3S8EA 4RK1A 2D0DA 2BGJA 4L6IA 5ARBA 5FAXA 3CM0A 5G0SA 1FJGH 2QRVA 1YQGA 2GNAA 4MB6A 1WXEA 1XA0A 4J0DA 5KJFA 1AM4D 2UUCB 4NEHB 1U1GA 3EUAA 4JYMA 2XB2A 4BGDA 2R8RA 1NMSA 3VGJA 1E3WB 1TB4A 4BVAA 2WIBA 5KNLA 2GO1A 3U7GA 4KUGA 2GESA 4O63O 1B93A 4Q9AA 5DIFA 1SM4A 1FP6A 2Y1LA 3FOBA 3Q3EA 3L82B 1OCEA 4I6JA 4UU7A 3ZE8A 3J7AC 2O14A 1P4SA 3OUTA 3EVAA 2VAMA 2VTDA 5JBIA 3B70A 2OYSA 1DBVO 1QWOA 3IPXA 4JLWA 4BL5A 3RSQA 2P67A 3GT0A 4ZOEA 3HVIA 1B1AA 1TAHA 3F8WA 2OZLB 2FX5A 1Z29A 2CLIB 2R1TA 5E4YA 4NE7A 4OQXA 1BWQA 3FZNA 1NUUA 2O3JA 3D6FA 3FCEA 4R71A 4G6ZA 3N0XA 3QZ7A 4KFTA 4D4GA 2ZXFA 4Q21A 5ARDA 2G4LA 2W6MA 1Z74A 4MIEA 2A1UB 1Y6GA 3TPCA 2GO7A 4JCCA 2HRRA 1HG0A 2CKZB 2CJXA 1Z75A 1LF5A 1XGKA 4ZK2A 2O8EB 3LGSA 3IQZA 2VUMG 5I4CA 4ZMSA 4WASA 4F9TA 2IZ6A 2R7NA 2YYYA 2P9HA 4UVEA 4I3HA 4QHTA 4B75A 2ZIXB 2BTOA 3E0QA 4YCBA 2PXAA 5IYDG 4Q3OA 1PGPA 2JPDA 2Q9BA 2H4XA 1J0BA 1ZAKA 4URXR 4C0JA 2COUA 4YUXA 3DV0B 5EIFA 4MUEA 1LI7A 3O8NA 4AKEA 2ZCUA 5E9WA 4C5BA 2I3AA 3Q2OA 4H31A 3VKWA 3N8IA 3FCXA 2WWTA 1KKUA 4GOND 3TM4A 1Z38A 2HRDA 3ED1A 3GUVA 2HT6A 4RA9A 2PMCA 4DV7B 3T9AA 1ZA1A 3NAZA 5K2OA 4KG7A 2Z5VA 3HDVA 3IKLA 3WIDA 2QMHA 5EP2A 1MXFA 5AW1A 4URWR 2QAIA 3TB6A 5CAEA 2PH5A 1VRVA 3TTVA 5B37A 3RFCA 1T3GA 3RGWS 3RU9A 3GTLA 4FC7A 2HMTA 5JXIA 4QYXA 4WXRA 1EINA 2HNAA 1SOVA 5AJTA 3ORYA 1UXHA 1FDSA 3W5DA 1I6MA 1ABEA 2CVFA 5IK2D 4K9RA 5EE9A 2DQZA 3GJRA 3Q15C 2I78A 3RHFA 1HZZA 2K4MA 1NURA 3ETGA 4YO8A 1H1LB 5J1SB 3D2CA 3IKVA 1YTLA 3RASA 1Y8RA 5DAAA 1TM5E 4D57A 4D5GA 3FZYA 1R10A 3D6UA 3R8FA 3RUFA 3RT1A 2Y3IA 1GTVA 1KI8A 3SJCA 1XNQB 1C1DA 4MVJM 4EWLA 1NT2A 3M8KA 1DBIA 2XKAA 4N4AA 4L8WB 2FW7A 2QB5A 3T9EA 2UZAA 4RPIA 3K31A 5F7ZA 4FYJA 3P1JA 4CE6A 1DAHA 1W35A 2QD1A 5BYJA 1LLCA 2BHTA 4Z9FA 1WDMA 2JGIA 4I8DA 1Q6ZA 4G09A 4FSDA 3FPLA 1EA7A 1XPJA 2OHOA 4RKEA 3AG6A 1OUMA 2XE8A 4TL6A 4ERNA 3LC2O 2O1XA 4ZQCB 2I22A 3TIXB 4Q3LA 5JE8A 5ALKA 3RUEA 1FVHA 3LOUA 2VQFB 3WWPA 4LYJA 1UBEA 1N75A 3IERA 3ZQJA 3QWAA 4O2BF 1UXIA 2BFNA 2NM0A 4QTZA 4HVTA 5DBFA 2R6DA 4GGPA 3PKJA 3UWPA 1BC5A 4GOLD 3K2IA 2IPXA 1Y14B 2X86A 3TN7A 2J6UA 3RAXA 4MLPA 1KAEA 1K5GA 1ZC4A 4HKTA 4EHBA 4MUJA 2A9PA 4CMEC 3O1LA 4UCRA 4M9SA 4P4GA 1HT0A 1WMAA 1Q0HA 1OTYA 5CLQA 3R20A 3JZIA 3OCZA 1MIOA 3QVWA 3RG2A 4NE9A 3HBJA 4QE3A 5KT3A 3NP7A 3W8RA 4ECWA 2RD2A 5FBRB 4ZIRA 2IPAB 3OEEA 1ITZA 4O59O 1YE3A 3BD6A 4P7BA 2WILA 3N75A 5GJVC 4Z0HO 4MVJE 1E94E 4O6VA 3A6DA 1CUGA 1J9GA 4JYAH 3O8QA 3NOXA 1YS1X 1KYYA 1QMPA 2QL7A 4ZRMA 4FP9A 5DHRA 3MWKA 1JX6A 1P0FA 3CMMA 1X80B 1XTJA 2R6R1 4YQEA 2QUJA 3TR6A 1J90A 1PL7A 1QYDA 5ALTA 4OLAA 1QG6A 4ADSG 5H80A 3K70C 3U13A 4ID9A 3AESA 3O8CA 2OGSA 4R8LA 1V51A 3RS8A 5JAIA 3HKZA 4C7BA 1G5TA 1OHHA 4NS4A 3GMDA 1BGXT 4C7OA 1ESEA 3WOVA 3NETA 3S28A 2VPQA 1FDIA 3PRKE 2HHFB 3PC8A 1UKAA 1V4NA 3P9RA 2M6KA 3U31A 3IDAA 4C2AA 2HB6A 4D8TA 4TM7A 4YACA 2JEOA 1RM5A 3A9CA 4DIUA 3W8DA 3HY6A 1ZRHA 1K3UB 4JI5H 5TF0A 2WE6A 4DTIA 5JQWA 4XYMB 3AV3A 3MR5A 4KMSA 4BIIA 4D6YA 1B76A 1QH9A 3LUKA 1A8SA 2ZIEA 2Z09A 4CC6A 1P18A 3OE7D 4XJVA 4P4SB 3SJUA 3LY9A 2JEFA 3GTGA 5FO1A 1I30A 2H06A 5BR8H 1RJGA 4WADA 3GUCA 5C18A 2YZGA 1I5EA 4NYIQ 1MU0A 1XNRH 2FF5A 2OP1A 4NCJA 2P0AA 2QYTA 5BRAA 1XZFA 3CSSA 1OXVA 4CV0A 3MERA 4YRGA 1EXMA 4OY3A 2HIMA 1P2SA 3CG4A 4GP7A 2XQVA 3LE8A 2HPZA 2CXXA 5JAQA 4AO6A 5HM6A 4JSRA 5AR1A 2JBAA 3EGXA 3G2NA 5IVHA 2FMIA 4DBLE 3HFSA 3CG0A 3NHYA 1JJFA 4O08A 1QG2A 3F5MA 2I3DA 4FUTA 3FVVA 2ZB7A 4I55B 4HAOA 1ZXLA 4JV2A 1ZGHA 4ECXA 3GGGA 4OJTA 1V1JA 1KEEB 1PZHA 2DT5A 5ENVA 5JH7F 2HRQA 1UJBA 1Z07A 4FBLA 4QQKA 4LXXA 2F3SA 4AMZA 4XDGA 4PBTA 1ZK2A 4FMBB 5J3JA 1DFHA 4IMIB 1GA1A 4AG6A 1XAGA 2PKEA 5EVJA 4R31A 2X1VA 2Z2XA 1EVYA 3WNVA 4DB4A 5HDQA 2Z43A 2XT9A 1XYGA 4UFZA 1IZ8A 1Q7BA 1ESDA 1YJAA 4F72A 3EGOA 1R4NB 3JVVA 1EE1A 3H75A 2O3QA 2UKDA 4XQCA 4R2KA 4HBZA 5BUSA 4MR8A 3M6VA 3ZZUA 5JQGF 1ZRMA 3AUKA 5FA5A 3TRFA 5T6BA 4ZD6A 2DSNA 2Y77A 4JLPA 4XRGA 5ALGA 1ORHA 4EYQA 3BHIA 2PMZE 4UCXA 4O29A 2XRFA 1F6WA 3FDZA 5KTTA 1YONA 2VJKA 1JHRA 4CEHB 3IVCA 1VE7A 4LECA 3DBHA 3TD9A 1LBQA 4KFSA 4X5OA 4DY4A 2XXBA 1QIEA 5FDFA 3QF4B 3V1MA 4QM6A 1NU6A 3X2FA 2AQ4A 1SXJE 3W5AA 1KWKA 2PGLA 1OH6A 1R4MA 4JV5B 4O0MA 2UUAH 5E6SB 3O4IA 2PUAA 1KZ7B 4PLPA 2C07A 1XOIA 3PEVA 1BE0A 3IESA 3QLUC 5J47A 3DW3X 1TCUA 3CU5A 3ZHZA 3TR0A 3ORQA 5JCOA 2IBMA 2PAAA 1B41A 3GLKA 2A92A 4KHPH 4B85A 4O1MA 3WV5A 4FBGA 3EGWA 4XB1A 4PYOA 4QUDA 3IIEA 2R5FA 3QX3A 2QW0X 4E51A 1O6FA 2RK6A 2OB1A 3S99A 4TYNA 1XQ9A 1SD1A 5B2FA 1RU3A 4YMHA 1EX7A 3DWGA 2EZUA 2Q8PA 2P9ZA 3JYQA 4MKRA 3TSYA 2B92A 4U6SA 2QAGA 1SEVA 2OB2A 2GQSA 4CKZA 2HPHA 3TNYA 1H2AS 4CU5A 4IDEA 2QTBA 3OI7A 4NZ9A 3T4UA 4B3DA 4BFZA 4D80A 4I6GA 1HQYE 4FWTA 3NOQA 5ALQA 3EF0A 1HDCA 4WA7A 1JSZA 3SVLA 2HF8A 5LZ5A 4HDKA 4D9JA 1Z63A 2QRHA 721PA 5CK4A 3ZOKA 5LNK6 1PT8A 1KQNA 1A8QA 2W90A 2OO5A 3UGKA 3WWEA 1E9BA 3SI7A 3JQAD 4V0ME 1ZCFA 2HF2A 1V8DA 3IAS6 3KEOA 5F12A 4NMXB 5I8ZA 4ZI3A 4E5SA 1M6WA 4OXIA 3T94A 3Q5EA 5E7MA 3NBYB 4BQPA 5REQA 2VRCA 2RG7A 1V5GA 3CCCA 4GSKA 2XCRB 4JBIA 4CTNA 4CM1A 1FNSA 1QQ7A 2FW9A 1XXHE 5I47A 2VQ3A 1YB5A 3MWYW 4IVPA 1I2MA 5L7WA 4CN9A 5EIXA 1C8KA 3CBQA 4AMUA 5DSXA 1OX6A 2EKPA 3QZ8A 3QNWA 1AQIA 1ODLA 5FP0A 4KVGA 3NVAA 5G3ZA 1IG3A 3GFQA 2IL1A 1NPYA 1HNNA 1Y6JA 2W9CA 2CXTA 4BUZA 3THOA 5IJ9A 3MWJA 1JFFB 2I9PA 3CV3A 4XWGA 3L7IA 4B4KA 2IK8A 1ZDMA 2JEYA 3TI7A 3EUFA 2UVVA 3GRPA 2DWCA 1IE3A 5CH5A 3WICA 3TY8A 3N8KA 4R2WA 1JI0A 1F20A 5IAOA 3RTEA 4LJ5A 1V4BA 5CBKA 3VISA 1XQYA 1M6HA 2BMEA 5G0UA 3NWOA 1TIKA 3GV0A 2X3FA 3DFUA 2UYGA 1CZNA 4A0QA 1RAAA 4HQFA 4RMJA 3UJCA 5YASA 4BIMA 5FFNA 5J59A 1HFEL 1PD0A 5A0VA 4ZGWA 4X7MA 3PZBA 1YA6A 1AC5A 3EQ2A 3OT5A 3URKA 5BR4A 1RQRA 3W4JA 4QQNA 4KITB 4EATA 1S2IA 1YZKA 1E1RA 1BMTA 5ED0A 1PVDA 2BR3A 3R7LA 4NATA 3PNBA 5HBRB 1PZMA 3OZVA 1SVIA 1R8QA 1RHRA 1O8CA 1K0UA 4L2IB 3RYTC 1G20A 1N2BA 1LPOA 2FZCA 4U7WA 2LXNA 2V55B 3HGQA 3IT2A 1XZDA 3SQDA 3TUZC 4RL4A 1R0ZA 1QXSA 3O3NB 6Q21A 5BVHB 3ITKA 4BCBA 3DE5X 1U9ZA 2VOEA 2IS4A 2NP6A 1REQA 3I39X 4MUXA 4X66H 2IVFA 2N9UA 1QQ6A 1R6XA 4B1FA 2JDID 1JIVA 4CCWA 9ATCA 1YA8A 1G9XA 3D0KA 1ZHOA 3A0RB 2GFIA 5LYYA 4R54A 5JRJA 4MRRA 1K2VN 5IDXA 3ZJYA 1DQRA 2C7VA 2O4CA 2RCYA 4RHCA 3E9CA 4G07A 4QXAA 1VCNA 2Y99A 3ZZ1A 3JVDA 2FEXA 3OF5A 2H4JA 1TK2A 5KX5A 3TNFA 2PX0A 2WU4A 1T6YA 2QDXA 4U39A 3A10A 1NA5A 4X20A 2J32A 3F97A 4MJ7A 1M6VB 5KQSA 2EJBA 1MRSA 2FRXA 4RFVA 2X0NA 3F71A 2G9NA 1XKTA 3RRFA 2W9XA 2ZJ5A 3BYZA 2C9MA 1TKRA 3GCXA 5HKBA 3KTAA 5CGZA 3K5PA 2PZAA 2IYVA 2XQGA 1GTJ1 5FORA 4CQLB 1T6ZA 1JDJA 2ONYA 2QRGA 3B3QA 4R0NA 1G4HA 2IRWA 2Z83A 4J1QA 2FLLA 4R9SA 2E85A 4JEIA 1EWRA 4UTRA 4L27A 3VPAA 1BE6A 1N7IA 3K16A 3MF4A 5KNDA 2HT1A 4J29A 3V8EA 4M0LA 1OXTA 2A2ZA 3IXLA 1K92A 2AL7A 1DIAA 4RZ2A 1CRWG 3P96A 3KHSA 1ZSYA 4UMFA 3ML1A 1JFSA 4Y2JA 1I1MA 2AA3A 1UDAA 2V0GA 3DPIA 1OB5A 2E4YA 1DRWA 1JEJA 4YIHA 5K8CA 4WNIA 3DM5A 3S2YA 3BMNA 3H3VH 1JYSA 4MARA 4JI7H 3NYWA 2W6JA 4Z4GA 5HPYB 1KXZA 4MW5A 3TQSA 1OROA 2QMUA 1D2GA 4M36A 2B1JA 2P5UA 1YVRA 4ZZ2A 4JBGA 4TVSA 4ND8B 2V65A 4A15A 4G1MB 2A9FA 3DFIA 3ADBA 3O8OA 1Z45A 4X1IA 2KBFA 3M6WA 4UEWA 2R6GA 3R3JA 3NM4A 4CHGA 4NE2A 2OL4A 3B1VA 2HLDD 3VYSB 3T0GA 1NVFA 4ARSA 1PQUA 2FKNA 4TTRA 3QPBA 5AM5A 3GX1A 1YV9A 1J2RA 3QUAA 5KT5A 4L85A 2VJNA 2RSLA 4ESHA 3KLOA 3ZU6A 3O91A 1RXEA 4NF2A 1KC1A 3G1UA 5GY7A 4QGSA 1I7SB 3OWHA 2WUDA 2QR2A 4RFSB 3GU3A 2GT1A 5D5HA 5J43A 2HRBA 1D3AA 5B6IA 4NDNE 3EWAA 5DLPA 3UF0A 1ESZA 1EKVA 5CURA 4JKYA 3E9MA 2P0YA 4WZ6A 2XBMA 2JIOA 5AESA 4PAWA 3HHEA 3QVLA 5JZ9A 4ZTZB 2GHIA 3KZ1E 2PL1A 1HDOA 1KVQA 3DF9A 4KACA 5DHTA 2REQA 5T3YA 4Z8YA 1PVOA 3T38A 1G8HA 4RMGA 1P6XA 4YDSA 2DR2A 3TNJA 3P0HA 4S1TA 2QOEA 1I1HA 4HAZA 2ZM6H 4IWXA 1TAGA 2CLDX 4RX1A 2J0QA 4P34A 4ABYA 1T8SA 4EKGA 2KWIA 3RS4A 1EDBA 4U9HS 2WDPA 1OR8A 4TQGA 5JQGA 3LMKA 4Y3UA 1TWFA 2R62A 1JXOA 4M0JA 1ZUNA 4H17A 4ZHSA 1ZGZA 2XE7A 3JWEA 3L4EA 4X95A 4Z0NA 4MROA 1UWKA 1EFRD 2AFIB 2BQUA 4R98A 4DPLA 3DC7A 2VWHA 3TXYA 2C94A 5C7OO 3H0KA 1VZ3A 3EYWA 5G1PA 3IUNA 1YZUA 5DWDA 4PG6A 1Y1WA 3VKUA 2HCRA 3RSOA 5DLFA 3TLCA 1O95A 3NC1C 1QNLA 2Q6KA 4DC0A 4JVSB 3V7UA 3M82A 1PD1A 1VFPA 3F6CA 3UH0A 1AMUA 1V5FA 3FLMA 1U7DA 4OHPA 4GMXA 4ZYUA 2W2OA 2NXEA 4JBXA 3RAEC 3DZFA 3QVMA 1JALA 2BLNA 2GEUA 1CU1A 1N0IA 1XU9A 2FPGB 5FTWA 5K6RA 2C2HA 1J5EH 3F4LA 1NTRA 3HJBA 1MC8A 3E1SA 3E53A 4FOPA 4OP2A 4BVFA 1Q7GA 4C7VA 5JV5A 4BN0A 5SY9A 4FD3A 3TGWA 3FIJA 4HHEA 2O2JA 5FWXA 4J0EA 5G4KA 1VMKA 5KYWA 3O38A 3QBEA 3N6RA 3CH7A 3PD0A 1G3RA 4NL4H 3IIKA 3GRKA 3Q3IA 1MVLA 1WCYA 2HLHA 3GLGE 4BYMA 5L3VA 3EY9A 1SCJA 1PO7A 5ELXA 1H1TA 2RB5A 3LQSA 4D56A 3DMTC 2VZEA 3EIHA 2EKLA 5C5DA 4HAVA 2DFNA 4C0AC 2V7QD 4V0KA 3JQ8A 3TSWA 4ASUA 4DLXA 1JXQA 3TLGA 1PGJA 4O4IB 4EY8A 1DKRA 3TQ1A 2I0FA 2Q5HA 1UWCA 2KMLA 1URPA 4K6FA 3TQFA 3DEFA 5HZGA 3AWDA 3NNSA 4GI2A 5ALHA 1JTFA 4F04A 1QQTA 3ZW8A 1EBUA 3R0ZA 2RCNA 2VDWB 4HDOB 1PTJA 5BMOA 1WSBA 1SG6A 4X62H 3NTQA 4N0EA 2O2SA 4OGWA 4V3CA 3HACA 1NU8A 2ZJOA 1PJSA 1S1CA 4J9RA 4DFDA 1A9OA 4BGIA 3UMFA 2EG5A 4RF5A 3VOAA 1VECA 4ZAFA 3NIWA 1I94B 1JDVA 3HJRA 3QNUA 4EB8A 2QMZA 5TQ0B 1IVYA 3ZDZB 4XPIB 3TMYA 2X6TA 3Q12A 1OPXA 4C4PA 4JVNA 4QGAA 3TF5A 1AKQA 4RM2A 1XMVA 2XZDA 1Z0DA 3BUSA 4BGVA 1F9AA 4QATA 3DGEC 4BUCA 3KJXA 5FLYA 3CKKA 2WAMA 2YJZA 1NVMB 2R7AA 5J2TB 5H0IA 3T5CA 4D0SA 2OAGA 4DBVO 1XDZA 4MPTA 3AK4A 3BSWA 5BRJA 1DAOA 3AR5A 5EZYB 3TXXA 1C9NA 2H16A 1X1RA 2O50A 4IIYA 3H8WA 2D1QA 4HNVA 3JVIA 2XSZD 5TQ2B 4KE7A 3RAQA 1PZFA 2ZPTX 1FP2A 4EGJA 5HX7A 1M34A 1LTHR 3M4NA 2B1IA 1G8PA 3QYFA 4L75A 5LR6A 4ZTUB 4R2MA 2OK7A 3I58A 5ADVA 3UG6A 4JEMA 3RFFA 4RGQA 3HP1A 5CB6A 2G28A 4HN4B 1QORA 1SXQA 3S68A 3WL4A 3GLTA 4IF4A 5FCDA 1ECCA 4CG3A 3OT1B 3MT0A 4D42A 3SIXA 3FYCA 3VHRA 3G0HA 1W5BA 3PZRA 3F3YA 821PA 4JT9A 3JU3A 3IMKA 1N6LA 2JA6G 1EAMA 4HH0A 1P2TA 1JNXX 3NYIA 4DMUB 3ZNPA 2AFRA 4BNXA 1KJZA 3PJFA 1Y1KE 4MLZA 3M6UA 4CMFA 1YQDA 2HQSA 5A6SA 2VBFA 4TQUS 2WHXA 2W7OA 3G6VA 4AYXA 3ETEA 2G40A 4I4NA 2CUTA 1Q1QA 3G9QA 4RVUA 5JXWA 4ZOLA 4QJBA 5HS4A 4FZJA 4IKEA 4RNOA 1WR8A 5ALRA 1NNI1 1T9KA 2DPXA 5LOVB 1JMVA 3OFND 2IWRA 4PYJA 1VE9A 3E35A 1Z4JA 4N01A 2AEEA 3LVQE 2H7YA 3M33A 4NTZA 1L8OA 5HQJA 5JWOA 4IUYA 2C3YA 3QXSA 1W19A 5FTNA 1DUSA 4LNUA 5J2UF 2Z3WA 4OXQA 4DIMA 3FD8A 2Y0EA 1GG2A 4QHSA 1WBBA 2CZCA 1MB2A 1EVLA 1V1RA 2A35A 5SY6A 1BEEA 2AZ4A 4OL9A 4UEKA 4LFBB 3HCPA 3UB3A 2JZOA 2NYVA 2YRXA 4FEEA 4DUYH 1YI1A 2VF5X 2DEUA 1E2DA 3IT1A 3T3HA 5KC8A 4I4LA 3UK6A 1FMFA 1ZH2A 1LFDB 1RYHA 1X92A 2HREA 4NFHA 1CR6A 4R69A 4QOEA 4UCQA 1YB2A 4TL9A 2FQXA 5KT2A 2DRIA 3BIOA 3FOWA 4N82A 4X6LA 1CNEA 3A7DA 4PYKA 3OTHA 2B4TO 2RK4A 3LSTA 2HIVA 2OBFA 4Q47A 3HKDB 2B69A 4K5QA 4POAA 1BXKA 4WINA 4L4XA 3T1QA 2V6IA 2QLFA 4JU8A 3PX2A 4K88A 1DHTA 2L69A 3HRKA 4M9ZA 2JCYA 4Z4QA 5CM8B 4OG2A 1TGVA 4BRWA 4CMDA 1W5SA 2C9OA 3R41A 3VJMA 2O0MA 2CNKA 1AA6A 4IG4A 1IBRA 5IBQA 3WYFA 3WDSA 1DIOB 3VR6H 5K0GA 1ZOSA 4FYMA 3EXHA 4CJXA 3R9RA 1XV5A 2E3JA 1W4BA 4DRZA 4Y2VA 1G6KA 2C92A 4CIWA 1G21E 3KSDO 3N5CA 2JFUA 2WMOB 5C1PA 1W36B 1MB3A 2YYZA 3V6MA 3WWCA 1QUFA 1NQVA 3RJ0A 4IVQA 4YMTA 3RD5A 2ZANA 4BY1G 4GKKH 4IG9A 3RRZA 4PXYA 4ZOQI 3ONEA 1G1AA 2C29D 3EZ9A 2H4YA 4J9KA 5KFAA 4NZYA 1PVVA 3IAHA 1B6TA 2D4HA 1MJ5A 4RMIA 1WEKA 2W43A 5CNKA 2CK3D 3CPSA 2PTGA 4RQAA 1J9ZA 2Q9AA 1M0EA 4HYEA 3ZVNA 2VCEA 2X1MA 4LOLA 4BPBA 1A04A 5C9ZA 3O4FA 3WMGA 1LLUA 4G0QA 1NAHA 4ZHQF 5ECWA 1FW6A 3U0VA 3DDCA 4FFPA 3GUHA 2AI2A 2XMBA 3OBIA 3DE3X 4AX8A 1EE9A 5GGXA 4QREA 4D3YA 2DLNA 3RIHA 2XNDD 4YPFA 5CB4F 2UUPA 5LWQA 1U2EA 3ZDCA 2ADFA 3S2FA 1F06A 3BPSA 5HBGA 2CKMA 3MJVA 4DUGD 2D62A 3EK2A 1S7CA 3E5HA 4ZAVA 3Q0IA 3EOBI 1FKAH 4WY5A 2ZZNA 4W1PA 4MEJA 2O8CB 1M0WA 4EAAA 3MTQA 2OCAA 1DE0A 4I6EA 2J3KA 3PC4A 4LCBA 3SBOA 2BZSA 5L7TA 3PEWA 2WM8A 1QANA 4YAKB 4NCIA 2WIDA 2PUVA 4HNTA 2WV7A 1VLZA 5H5JA 4F4WA 1Q1BA 1CZLA 1JX4A 1L5VA 1H8HA 2CZGA 1GNVA 2QAJA 5JBQA 3CRMA 1Z7BA 3M34A 5PGMA 3L84A 1MPXA 1JXAA 4Y9RA 5AVSA 3SDSA 2R1VB 5A71A 4C22A 4BQIA 3T3NA 5FD8A 1NI4B 2B98A 2INGX 5LXTB 1UMCB 3BC1A 1IY0A 1VL8A 5IVPA 1DOHA 4MUIA 1NPDA 4XB2A 1L5SA 3SC2A 2Q6OA 3ER9A 1C3JA 2YJ4A 5D3QA 1GRVA 4KAAA 3ICVA 2H1IA 2C7GA 3IL2A 2WTMA 3GH1A 4R1LA 3NJ4A 4Q4CA 3LIPA 4F6LA 5KG0A 1Y0BA 2BPOA 5FB3A 2C0CA 1UMKA 3MUEA 1UIRA 4XH9B 1NW4A 3AG5A 1SUBA 1N8NA 3MFYA 1CZUA 2VRBA 2Q6VA 5JWHA 2XLBA 1RKBA 2IBKA 4LZJA 2XGMA 2BLLA 1VMDA 4EJFA 1YFZA 2BMVA 4Q03A 1S3IA 2CXSA 2V3CC 3PUXA 1NN1A 4JJ4A 3FIUA 2QZPA 1YJXA 4LDAA 1T0IA 2JCGA 4RHTA 1ZVMA 4ZKEA 1FSPA 3BMXA 2PMDA 1ZEMA 1E9DA 1GXSB 3H17A 1BQEA 2UZ1A 4LG1A 4J7XA 5IKPA 2O8DB 1E6CA 2ZSJA 2QJTA 4P0PB 4DV2H 3I62A 1UXOA 3SZUA 4N54A 4HQOA 1WL8A 5SZJA 2ASVA 3MT8A 4GX5A 5ADHA 1EI9A 4L16A 4MCIA 4DEYA 2CL0X 1GJRA 3GJ7A 2JAUA 1E0AA 2XMDA 5DLDA 1TZKA 2FPLA 4TTJA 1MENA 2Y76A 1T9AA 3U7QB 1PR0A 2E5FA 2F4VB 5KINB 4Z5XA 3RJ9A 3K53A 3FI0A 4I14A 4ZT5A 2WJ4A 2H9YA 4X6YA 1SQ5A 2QTRA 3WA7A 3QXGA 2Q3DA 4KLNA 4PGAA 2Y0PA 5HIIA 4J16A 2PGIA 3NIBA 4HNAA 1KXJA 1ONSA 4CKCA 4NCXA 1CXZA 2W4IA 2A84A 1TFRA 7REQA 4LDJA 3UA4A 2EWWA 1VGVA 4ZI7B 5DNUA 2JI4A 2TMYA 4E0BA 2E5LB 2Q5EA 4A3DG 3L4BC 1D4ZA 3W05A 2ZAMA 3CLRD 1JQKA 4CCYA 5KPDA 4BLSA 1E2BA 3R6DA 3AU9A 3G9TA 4O1IA 3V8MA 4DQKA 4WEQA 2XE6A 8ATCA 4D9IA 2XUHA 3SNHA 4PO3X 2OSVA 3AUTA 2GEDA 4MRVA 4YN3A 2VPYA 2OXEA 3JYNA 3ZWOA 3L2OB 3RGXA 3PKIA 4H7PA 3HBLA 3GBPA 1EDZA 3OZGA 3SIWA 3ZLUA 2GCOB 4CLHA 2CNOA 5TIIA 3R09A 3QTTA 2HCFA 3ED5A 4AURA 1IOZA 1ZR4A 4EG0A 4BQOA 4ZVRA 1EQUA 2FMUA 2LIPA 3K92A 2H59A 5C4GB 5TB5A 1XEAA 1D1QA 1W76A 4YROA 1JLRA 2H2GA 1X77A 5AM0A 5T57A 4C3VA 3BXFA 3HK2A 4BQQA 4RCVA 3SNKA 1S10A 3RYFA 5KFWA 3ROKA 3V7NA 1RQNA 3V1UA 1F0YA 3F6BX 3OOYA 3L7AA 2FRVA 2ORED 4D5EA 5I9TA 1IXRC 5GOZA 4JL5A 5GZ1A 2IEAA 3EDCA 4BZWA 2R84A 1F0PA 3PQEA 2GHQA 5IKOA 3C4QA 8LDHA 1ZI9A 4TKVB 4RTPA 3JSXA 4QTXA 1M5TA 1SNYA 1ABBA 3A6HA 2OGWA 3RR5A 2PZJA 4MGKR 5BXYA 3QFTA 4H0FA 4QX6A 3B1JA 3QFSA 4TLLB 1DLJA 2BTEA 2QV0A 1TOAA 2WTUA 3NPAA 1VKNA 4Z8XA 4F97A 1TZBA 3ESYA 4HGNA 5JI2E 5FYDA 4DEVA 1ZCZA 1K5HA 1Z82A 1G42A 3GEIA 3M5WA 5BR7A 4BNFA 5HUQA 2GCEA 2V9CA 1CQIB 4M22A 4GOXA 3LZ6A 3RU7A 2OBYA 2CLLB 5HKKA 4M49A 4PCUA 1SVNA 1YMQA 1DC8A 2QTHA 1E9SA 1P3JA 1ZUIA 2VHXA 2CKDA 2WVHA 3IP3A 1DRJA 5ALLA 3DB2A 4QGFA 2C2OA 5JNRA 1TA4A 4V02A 3K0HA 1CR1A 3IXMA 3QM1A 1MGOA 1HZJA 2VPTA 5CVTA 2P1DA 1P1FA 5J2UA 3RS7A 3C1AA 3ZXIA 4YY3H 1M0TA 1Y4SA 1EG7A 5LSAA 3B9PA 4C0WA 3MNFA 1XLVA 4JWKA 1D7AA 3TFQA 1XEWY 2CL7X 3TIFA 1NZDA 5F5XA 1QC5A 4GUAA 1IM2A 1PR5A 2DGDA 4QOIA 4UTNA 3ENQA 5ENDA 4QHYA 3RVQA 4YR2A 3COYA 2XTNA 2FLNA 5EJFA 1A8HA 3QGMA 1WB5A 3IUYA 5MHTA 3WWOA 1E8MA 2J9FB 4K1XA 2VHUA 2VT7A 3MEQA 1C29B 2X5NA 2UZ0A 4MUFA 3R7AA 2PQ0A 1EK2A 4OUKX 1ND6A 3AR4A 4KR6A 2PX5A 3GGPA 1VMAA 4MEAA 1E5LA 4ZAWA 3MTIA 2HZ7A 1DGQA 1RMYA 2IU4A 3GNTA 3PW2A 3GR6A 3IUMA 1K89A 3PXBA 4LWZA 4DA8A 4NVRA 3C3EA 4MDHA 3HYSA 2HPVA 2ZGIA 2JGNA 3DMNA 1YDEA 5ECYA 1K97A 4BNNA 4LZWA 2VDQB 1A2QA 3OM9A 4R2JA 1ECJA 4C03A 3EFHA 1VPDA 4D9EA 3VVCA 5BVGB 1B23P 5LMUB 2JBHA 2ZT7A 3G5AA 2OLJA 3E9EA 1HYBA 1P8LA 3H4BA 1U3DA 3OCXA 2IEIA 5JNTA 2YXLA 2IS6A 1PQPA 2IYLD 1JXLA 5IUKC 1DHRA 3D8HA 3T5DA 3DBIA 5K8LA 5FL3A 4MV1A 1UAYA 4WLUA 4AY5A 2WSSD 3UY4A 1DC6A 1U1CA 1LTKA 1WPQA 1R2QA 3VAYA 2AMLA 2ZWOA 3OHSX 1U8UA 2WKRA 4ETWA 5KYNA 1CUEA 4FW8A 1UPXA 2A88A 2JFPA 1K7YA 3ISTA 4X1YA 3WHIA 1F51E 1NWHA 2UUBB 3HXPA 1SU4A 1JHOA 2WPDD 3N86A 1YJQA 1T4CB 3BE6A 3PWKA 4WOCA 4P2BA 1OASA 2IEGA 1CY6A 4I46A 4LISA 1H42A 1K27A 5KFIA 1QFYA 3OLWA 4YRQA 2NPFA 4K9DA 3NRJA 4A26A 1BIFA 5JSQA 4C6SA 2IV7A 5GOTA 2IDJA 4PNPA 2YJ5A 3GP8A 4R2XA 1YZVA 5JI3E 4MJ3A 1H3EA 2E4XA 1DIBA 4BXXG 4ZHQA 3TDMA 5KMGB 3FTNA 3PU6A 2HLNA 2C58A 4FYVA 3R24A 3E6AA 3VDMA 2ZUEA 1EFUA 1PEYA 4K6NA 1KZGB 2B20A 1QKJA 2M6SA 3V46A 4AVYA 3RBVA 2CNUA 3KKOA 5B12A 2G1KA 1AQUA 3V2UA 4YBZB 2YY6A 2DTXA 2CZQA 5J5VA 3C6MA 1FOEB 2FQWA 2ZSFA 5GJBA 2LWIA 2AOTB 4DARA 3KREA 1N3LA 4C07A 4A3FG 3K4PA 4KW7A 2E82A 2OAQ1 4P58A 2TRSB 1AA9A 2QTLA 3RTBA 3L5KA 3H5VA 1VGRA 1Z16A 1UC4B 1I4LD 3X1KA 2ORWA 2ETXA 3ERCA 1FFWA 4BWYA 1U94A 2R48A 2JFQA 3WK6A 4XEUA 1CDEA 2MSEB 1FVXA 4JL8A 4P7FA 4D4KA 3EUWA 1X2EA 5DGCA 4D3ZA 4TN5A 2XA1A 2H8KA 1C41A 2BGLA 5FUQA 3O73A 1RBYA 4G3IA 2I67A 5KYXB 3TW7A 1SQ0A 1UT8A 1TD1A 2F7SA 4DJAA 3Q7IA 1CDOA 3OQOA 3AEUB 3V4PB 4BNDB 2Q1TA 4RU1A 3HYLA 1ESMA 4JNCA 3RK0A 1CUFA 3ITEA 3RB0A 2NZWA 4F6RA 1IJBA 5KG1A 3OOWA 2CYCA 3NT4A 4KQMA 1Z6XA 4IIVA 1TM3E 1DP4A 4CT4B 2JK0A 4LOHA 5JALA 3DBRB 5JJKA 2NO1A 1H05A 2AE2A 4IFTA 1WXXA 5E6RB 1DAPA 1IMJA 5K3FB 3USZA 4U5XA 1EIZA 4IS2A 3E3MA 3P5SA 3EUEA 3KEMA 1N7HA 3KPWA 1YJ5A 1GFSA 4U2BA 2HGZA 5TXGA 3UXHA 1VG9B 4N49A 3T41A 4RNDB 4OFWA 3IAAA 4PGHA 1IQPA 3DNPA 4ZVUA 3AJAA 4GRDA 2HUPA 3OSNA 2PLWA 3SEQA 4AULA 5AVYA 2CXPA 1RPTA 4K03A 2BQRA 2VI5A 2H5IA 4QW9A 4BAZA 5IT9A 2M2IA 1Q0UA 4BX8A 3F46A 2YWXA 4C4AA 3FMPB 1CJKC 2PWPA 1Q1NA 4OL0A 4G8BA 5JNSA 2WLTA 3EIUA 3DLTA 4P5EA 4YRLA 1I14A 2OT3B 5FI5A 1XG5A 3BWVA 1QIIA 1FFBA 3I04A 3LCCA 4H59A 3KQOA 2PHZA 2HVSA 2VUMA 4GC7A 4YH1A 4UM7A 2EKDA 2FK3A 4HEQA 5KEIA 1BJKA 4LYEA 5IXYA 4CMIB 1CUJA 4UD6A 4JDUA 2FVXA 5HS6A 4E5UA 5IJ0A 3QV1A 4N3NA 3X1DA 1JSCA 1K4KA 1X6VA 3DVSX 4IMJB 3VR6A 1PF7E 2DE0X 1WPGA 3WQHA 2BY4A 4TMWA 4EI2A 4BPRA 1VJGA 4B3RH 4IL5A 3OD5A 3EGCA 1BVRA 1NSFA 6AT1A 4D9HA 1GCOA 4XOIA 4WKPA 5I9MA 5SYAA 3KSUA 3GGDA 1B0AA 1ODIA 3KQUA 2L2QA 4DJ5X 4M4SA 2JARA 4E5KA 5G0TA 4FYYA 5EWFA 3T9DA 5B6PA 4FGZA 3AVPA 5J4LA 2VHZA 1T9DA 1LI5A 4TVOA 1B43A 1X8LA 2ZSKA 4HMOA 5CVDA 1L5GB 2NTJA 5IANA 3AY3A 1FUKA 4EJ0A 4YPVA 1W52X 1E1DA 3LQ2A 4N0DA 1E4FT 2RHCA 1CB0A 2JHGA 5K0FA 1EFAA 3GRFA 4FFRA 3LLVA 1US8B 3SX2A 2FDXA 1M2WA 4XGQA 4HCJA 1WCIA 3JQ9C 1I2AA 3V55A 2IPOA 1RBMA 1Z4QA 5JJCA 1KZ9A 1AJEA 1NI5A 4LF9H 1DIRA 3ZJTA 2Y6VA 3T61A 1ZWKA 1SQ6A 1L5ZA 1E98A 3SR0A 5C7LO 3JZDA 3V33A 3T52A 4QWCA 4D9NA 5CJPA 3BJYA 3OSPA 3KWJA 1IL0A 4OAOA 2PMEA 3CX4A 3A7EA 3F96A 5LU8A 1FFXA 3IVAA 2GSDA 2XDQB 3BIJA 4K2AA 3QVVA 4C3UA 1FRZA 4REMA 2OYRA 4ZODA 3NNDA 5IUNC 1T8RA 2Z5GA 1W2WB 1TPZA 4W5TA 4R1SA 1KIMA 5FWAA 3FCSB 5AICA 3AUXA 3BQMB 4D26A 4NMHA 2A5FA 2AIRA 1Q2XA 4ICIA 2DSTA 4FSXA 3T5HA 1P7VA 4DL9A 2RKOA 4I4TF 3AVVA 1JR6A 4G1EB 4UMDA 2XGJA 1DQSA 5GV8A 3W5JA 3EX7C 3WWYA 2XCTB 1IJKA 2IHUA 3N0VA 2IYFA 4YJ2B 2D5LA 3ZKWA 3TLKA 1KP2A 1NPTO 4FCWA 4PTYA 3UQ8A 2Q21A 2FEKA 4RCZA 3N6VA 5BUCA 3ZVRA 3ER8A 2CFRA 2YL2A 3ZWXA 5I45A 3VH4A 5A2QA 1W0KA 4A8JC 3N2GB 1KWGA 2KHZA 3OQVA 1B6RA 4TRJA 2Y05A 2LD4A 1N0HA 4NXNB 5TV2A 1N9GA 1ZGJA 4LX0A 1M7GA 1T8TA 3Q5GA 4QM7A 5C1OA 4BNGA 3JASB 4V03A 2IZ0A 5A6VA 3D3JA 1UPAA 2IF2A 1SCQA 3A4MA 1QHHA 2BKXA 4YRCA 1Z6AA 4NS1A 4AQYB 4C5CA 1RWNA 1NR5A 5LZ2A 3TBHA 3UENA 3QKSB 4UFOA 2LKDA 4TQRA 3L0CA 4NH4A 4WX2B 2OCDA 2PRSA 4BO3A 1FY2A 3K70B 2I6TA 3I5UA 2O1EA 4O7ZA 4V2UA 1SCDA 4X3CA 2VS1A 2ZP1A 2EVWX 3EZNA 4L78A 4H7EA 3RADC 4RPGA 4E7PA 3ZBQA 3PW5A 5BWNA 3I4MG 4NZPA 2P5TB 2IP2A 2PN1A 4F2GA 2GM4A 5F5LA 3F67A 2BHNA 2F1HA 5HKOA 2XD9A 1D8TA 4WOJA 2C7PA 4RWZA 1IEXA 1KDYA 3K2BA 3BGSA 5TMEA 3MB5A 1QE3A 1IXZA 4J0KA 3NMUF 3I37X 2EHDA 4FK8A 3E05A 3O21A 5EP4A 3IRVA 1SA0A 4QRHA 3VR1A 4Q12A 4F8YA 4CDGA 1VA4A 2GJSA 5K4AA 3G1WA 4KB5A 4HQRA 2FP4B 4QEDA 2O8BA 4LF8B 3LP5A 1QVRA 4P7JA 2WP8J 3A4VA 2XB4A 1SOUA 4YLEA 4R40A 4N03A 3WISA 1YRYE 2JKYA 1HLGA 3S2UA 3ZJVA 3M6LA 3U4AA 5CYOA 1M2OA 2HU5A 2UXBH 4BCCA 4PLCA 3PQDA 5T64A 1BHQ1 5H4GA 4JUIA 4JC0A 4BJ1A 1NL3A 4HDNA 3U7IA 5ESWA 2X0EA 2ZUTA 2GZDA 1JLLB 3LLMA 3CLRC 3LF1A 1VPEA 3BACA 5AW2A 5JWRA 4DR4B 1G6OA 3ESCA 1MHPA 1OWLA 4WBXC 5F2NA 2JIBA 2ZWAA 2WVAA 1V8FA 5LLDA 4RXUA 4O2BA 4A3LG 3VZDA 5K51A 3IJEB 2X0DA 3U7RA 2IIQA 3FNQA 4BVEA 3PF9A 2GA8A 1W5TA 1H0HA 3R7DA 5TR9A 4DLVA 1QIFA 4WZAE 3BEOA 2DH5A 4RPLA 2HI0A 3ZD7A 1TE2A 3HXQA 2X5KO 1HNWH 2YWVA 5EFZA 5G4LA 5F52A 2PJDA 4WVLA 4PC6A 1XALA 3RF2A 1JPUA 2J30A 4IXTA 1QH8A 4MAAA 1T26A 3JZAA 3FWKA 3NEJA 3P0JA 4A6XA 1VB5A 1UBGA 4N5HX 3CRQA 3IHTA 4R01A 3UC5A 2PMFA 5DTRA 3SE0A 4YT5A 4GZ5A 1N2ZA 1RW4A 2Q1YA 3FSRA 1T1IA 4KN9S 3GY0A 5MFZA 2WUFA 5DW3A 1KDPA 4NRDA 1L1RA 5MN5A 1G63A 3AVTA 2Y67A 2C7BA 2TS1A 1NVDA 4N6OA 2GM9A 4BFYA 5LBTA 3VJLA 3PUHA 3IT3A 1GWNA 1YRHA 2CFMA 1N1MA 3VTKA 2XKJE 4KE8A 1X1DA 4NFYA 5DTJA 3VR5D 4EBDA 1IHUA 4E22A 3W2TA 3PIIA 4AKTA 4WJKB 1SIUA 3ZGLA 1GPNA 1SMKA 4AROA 3UHFA 5IKEA 2UVPB 1ZQ1A 3MWMA 5EKSA 1SULA 4OIFA 3WSVA 1OOEA 2X9GA 5GM1A 4EK9A 4F1JA 1JJ7A 1JAIA 2H1OA 1A5AB 4HN2A 4P7GA 2Z04A 5D6NA 1JIUA 2GX6A 4F4FA 3D8UA 2QTFA 3TJZA 1OWTA 3RAFC 2NUTB 2EBHX 4AZTA 2D7CA 3CUYA 2O2YA 1WHTA 2NTYC 2P77A 2ZK7A 1E66A 3OMXA 3AERA 4LRSB 1XQXA 5EIWA 1OH8A 1TVKB 3KU1A 1RACA 2R8ZA 3H19A 1IYZA 4K28A 1W0JA 3DHVA 3ECAA 5I5SA 1ZMOA 3C87A 1VPTA 2ZBRA 2QL9A 3EWNA 1M1UA 1JEDA 3KJNA 2OAP1 1YZNA 3MFHA 3PITA 1M8FA 1ORDA 3KD3A 5AVXA 3GIKA 1GDDA 1M10A 2P4UA 4ZWNA 3CW9A 3S2ZA 1FW8A 4RB0A 1GZ6A 1U4NA 3LL4A 1J0AA 2IHJA 2EJWA 2VDJA 3QLJA 1UF9A 2R4TA 1JEQA 3IQGX 3EQ9A 4WFKA 4BU1A 2QG6A 3STVA 4EO9A 1KAOA 3K5HA 2GKGA 3OU7A 1ZKDA 2ZYUX 3AR9A 5KFOA 1KYZA 3PA8A 5SICE 2FZVA 5TQJA 3ESXA 3KB6A 5AI8A 4RPCA 1Z22A 1U7TA 3Q98A 2PLNA 3K0AB 4YXFA 3VU8A 2DFLA 5JH7A 5DM60 3GTMA 4JI6B 3F78A 2P5YA 4EVRA 2SECE 1U0EA 3QENA 4KV9A 1JUDA 2YWRA 4LYDA 1EP3B 3BULA 2RFLA 2ZRIA 2O4UX 4A6EA 3SHVA 1V4YA 1LK5A 2XAAA 3TW0A 3UJNA 4KC0A 2WFZA 2D7DA 4ZT2A 4JC8A 4LF5H 1C3VA 2PD6A 4C76A 4N48A 2PR7A 4QZVA 3HJAA 5EKUA 1NMYA 1AY0A 2IUEA 1NG1A 4EJSA 1SXGA 2JBWA 2G83A 3ZX4A 3JQ6A 2NQTA 1A97A 2VUIB 3RS5A 4BNWA 1SKQA 4G0NA 3LVBA 4DDHA 3OA0A 5HGXA 4HGPA 3JSNA 4HY3A 4RQUA 5JAOA 3JQFA 1V35A 3JQPA 1NUAA 1O6GA 1ZK3A 1G7TA 1RHUA 1IBLB 3N2EA 2PSDA 3V3KA 3I83A 5CNJA 1X86B 2Q3HA 3R3UA 5F2KA 2D5IA 1RADA 1WIWA 1YCDA 4KPGA 3ZE2B 3VX3A 5FFMA 4QVIA 3NHUA 4YT4A 5J23A 2NACA 4K6GA 4IJ6A 4PZUA 4IQ8A 3C3CA 1OT3A 1JE1A 2AEMA 1NM5C 3GJYA 1BE8A 5K09A 3QEKA 2ZRCA 2IQ5A 4IHJB 1KI6B 4IFIA 4MI9A 2DU8A 5ABPA 4PLFA 3GT7A 3JQ7B 4MWGA 4H1TA 3S40A 1YB4A 4WA8A 1AU9A 1J97A 2JI8A 2YWHA 2Q6IA 3KRTA 4PINA 3K6RA 2IV3A 3GIQA 4NCHA 2J5BA 3V1YA 4OUDB 2ZRFA 4Q4JA 1GOTA 2OECA 3UW1A 4NBUA 1J2EA 2WI8A 1BW9A 2K5UA 1QLWA 3TTYA 4ZJYA 3KSBC 3AHGA 1Z6PA 5DJ5A 1P7WA 4FKZA 1HNZH 1G4UR 3OEHD 3MOGA 3GPCA 3TEMA 3CSDA 4GPEA 5JSHA 3OTQA 1ZESA 3JS5A 4UPVA 3WNZA 5DLYA 3RQSA 3HCDA 2IDZA 5UKDA 4GVPA 2B5VA 2G09A 1ZEJA 4LVOA 1A7AA 3RAGA 4YUVA 2QD2A 3ZDDA 1RI1A 1F14A 4BLPA 4I4TA 2ZVJA 1FSGA 1GEGA 3ZHXA 3TK1A 4ED1A 4GBMA 5TGZA 4XOUA 2P41A 1U7OA 3DMFA 1PT7A 1X7ZB 2GAOA 4U2GA 2C2MA 4B3MB 3H13A 5D3MB 1DKLA 4NMLA 5AW4A 5L45A 3M9XA 4IRKA 1GPH1 2NU8A 1X1TA 2P3OA 4D4LA 1W0CA 1IBSA 1IN4A 1JAHA 2AQIA 2YVQA 4ENTA 4R8VA 3TPZA 4FIDA 3HA7A 4IILA 5FOXA 2X58A 5A4AA 3C6QA 4NQZA 3REOA 4PZPA 3VYRB 4MUBA 2V7TA 3OLVA 1DKOA 1V41E 1NXWA 3E9ZA 3DHYA 1YF3A 4NJEA 3GLFE 2AR0A 3ICPA 1C7JA 2C8KA 2WF7A 3OZWA 1GV1A 3RAPR 3EXFB 4Q7JB 3B3GA 4B0PA 1JTEA 1Z4MA 3A6ZA 2C4NA 5GZ3A 1Q0ZA 4KRGA 5SZHB 3FRJA 3OO0A 4BMVA 4NAUA 3NBMA 5ALVA 1C1XB 1IDOA 4JT2A 5HF5A 4DSZA 1FLNA 5AM3A 1BOOA 3ZI4A 1GCIA 4RDHA 3FUXA 1RCUA 2DX7A 4RVNA 2AFHA 1T9BA 1UKBA 4X97A 1K06A 4PZLA 2R86A 4WY8A 3O82A 1TWAA 1ISJA 5C1BA 5JUMA 1B0ZA 1DMRA 1E3SA 2HTEA 2QXTA 3F74A 1FFSA 1KI9A 4E32A 3LX6A 3L7NA 3KVVA 1T5LA 2X14A 2PUHA 3T9FA 4MV3A 3R7BA 3ORHA 1QJ4A 1Y9AA 3C6YA 1MAVA 2J7KA 2FUKA 1YJBA 3ZE6A 3UPTA 4AYBA 2NQ2C 4HRXA 2OOSA 4XUEA 5IC5A 4D9MA 2OZPA 4CQMB 4FYHA 1YC5A 4ZOBA 1C2TA 4YWJA 4FGKA 1XKXA 2XUQA 4PBCA 4URUR 3KWFA 1GL3A 1UJ2A 1NN5A 4MSUA 3II6X 1ZOPA 1B4DA 1U0TA 4EECA 5DULA 1R0KA 4OB7A 4PHTA 4DMMA 1ZD1A 3FYUA 2VBIA 4TQSA 1GL7A 3DLHA 3G7NA 3ND9A 1I1LA 3RIXA 3PUKA 3LY7A 3FBGA 4RTMA 1T0JB 1TJ3A 3TYXA 5F1YA 4ED2A 2FGKA 1E77A 2IYSA 3NTUA 3DT8A 1K8XB 1A9YA 1KT8A 3I0NA 5K8VA 1M2GA 3DAFA 5K03A 5DMXA 5CYPA 2RJNA 4C04A 3OICA 5CT9A 2I99A 1T4DA 1GKUB 5FT9A 5CDHA 1O96B 3NB0A 1I2ZA 1VBGA 5EJIA 1R0XA 4B80A 3MS4A 5NULA 3EDMA 3MTEA 1KO5A 1TT5A 2CDNA 4PGFA 1MOQA 2BGRA 2DR0A 2AUNA 2COJA 1XJWA 2B8TA 2FSVC 2WC1A 1NASA 1IM8A 2O2GA 4BMDA 3H3FA 4X65H 3KWMA 3IAEA 4G5YA 2R6JA 3PJGA 3RV4A 3R7WA 3V1KA 2F8SA 4LTNA 1XT6A 1T3ZA 3D0RA 1WHSB 3MWEB 4GX1A 3KJEA 5HW0A 1XNHA 2RGBA 1GGOA 1W5EA 3HKCB 4M8KA 4MW0A 2X6RA 3O95A 3ON5A 4GBGA 3T1HH 1L4KA 2B4KA 2P9JA 1N34B 2SKCA 4MHTA 3NBFA 5CFLA 5D1NA 2J9YB 4LI0A 1CZOA 2O0LA 2XT0A 4JB2A 3UZBA 4E4TA 4E6NA 4CN8A 2BHRA 4RD2A 2KLHA 1Z83A 2Q07A 1WUTA 3DBVO 4U6PA 1PWZA 2GI4A 4JR2A 4EI7A 3UW3A 3BSYA 1EFHA 4A2BA 3EZYA 4O5OA 1Z73A 3S70A 2G08A 3BCUA 1KZYC 1XTUA 4G0VA 1JTVA 4PNEA 3PDWA 2GTIA 2ZS7A 3KKMA 2WY2D 1P72A 1HT2E 3PXXA 5L1LA 4ZZ3A 1UZNA 2AK3A 3I4LA 3L4SO 3R7FA 1Q17A 1SBQA 1KMQA 1MC1A 2HA6A 3UPUA 4UXIA 3TB4A 4DW8A 4WBNB 2MCFA 1EIWA 4XAQA 4KE6A 2CUNA 4AJ9A 2Q2NA 2Q3JA 3I28A 3BRSA 3UK1A 3U4HA 4G26A 2GVZC 4YI5A 2GUWA 4JI8B 3GFSA 3KNZA 1OFGA 5E0KB 4YDQA 4GU5A 3EMDA 1R0CA 1QCZA 2JNWA 1HNXH 2DQSA 3ASUA 3BD7A 1V26A 4L9SA 4QUHA 2FPWA 2HHJA 4HYTA 3LRTA 4LE0A 3JX9A 4LQCA 5CA0B 5CCDA 4IR9A 4CFZA 3G2PA 3O26A 4W5RA 3NTVA 2GTHA 1HEIA 2ZS8A 1P0PA 3AW8A 4AT1A 2AXQA 1M73E 3SXUB 2V59A 3RROA 3VTFA 1RZVA 5BWUA 4YJKA 2X76A 2CY0A 3B12A 5EXEA 2BF4A 3ILXA 3BRCA 3CVOA 2BFDB 4BNVA 4AK9A 4LWQA 1YZQA 3DW1X 4ZJUA 1K3FA 4YRBA 2C1ZA 4MVXA 2GUGA 1DAKA 2R7LA 1S1MA 2QUBA 1X42A 2PKRA 1VIAA 1MPTA 4J0QA 1RQXA 4KWEA 3W5HA 3CLTD 4C6TB 1GTRA 4G4SP 1QK5A 5LP6C 1I4WA 2MINB 2P2YA 1B8UA 3NYRA 3PHCA 4TYMA 2HJSA 4CKEA 1IUNA 2FOLA 3PDIB 4IDNA 4E6EA 1RM0A 4O4JB 1L3BA 4REQB 4G1CA 1SCNE 1JJIA 1W4ZA 3FSEA 2XQKA 4XE5A 2BV3A 2FMTA 2IXBA 3ZZ0A 3GIWA 4BFWA 5C5EA 1I0IA 1Z5WA 4G8JA 4WLOA 3E5NA 4QWBA 2Q3FA 4YRFA 4TYQA 2B7BA 1T2DA 1PUXA 3DO6A 2X3YA 3E9RA 3FNGA 1I51A 5B3JC 2AQ8A 2NZ2A 1POXA 5DGHA 3Q10A 4AN1A 1W30A 4BE9A 3AYXB 1E20A 4TKZA 4XX0A 2OKCA 1XHLA 1V37A 1CCWA 1SUIA 4DZZA 3K8OE 2VHQA 1OD6A 4HDSB 4RY9A 1VLHA 4RTSA 1PP4A 1LPMA 1P33A 1F7VA 3OQIA 2GRAA 3G9XA 1UT5A 3KEFA 1WA5A 4G84A 4TQAA 3WIEA 4KR9A 1KMIY 1YMUA 2X8BA 4B2PA 1WLYA 3BL8A 3QF7A 2H3EA 3PLRA 1L7VC 4DLTA 3MUOA 1HKHA 2IHKA 2QROA 3DDNA 1FQKA 4Q3CA 3EMVA 4EHNA 4KXQA 2JLRA 3H11B 4LSAA 2FU5C 2Q50A 5BV2P 1R12A 1RXSA 4UDYX 3WRYA 3LQYA 4RVHA 1X70A 1TTPB 5BQPA 3VXKA 2Q99A 4PRKA 1ZH6A 2YBEA 2QLBA 3G0IA 5ALEA 2ENWA 4U1RA 2X0SA 3CF6R 3ZV7A 1YR6A 4BFCA 2IKQA 1TO6A 4E31A 2R11A 2WA1A 1BTOA 1ZI8A 4JX9A 5BWVA 3NBZB 4S2EA 3N0TA 3WB2A 3PVZA 3Q3CA 1FRFS 2IU0A 6CHYA 2C2KA 5AWFC 1NJFA 2VHJA 2JA6A 2CJWA 3R9XB 2FPRA 2XNSA 5KDDA 3I9V1 1IBKH 2PBLA 2ACKA 4NLLA 2PS3A 2RBEA 3GV7B 2VPZA 4RA6B 4ZO9A 3HB0A 5JO0A 5DCUA 2E9SA 2CD7A 2GXSA 1R6BX 1O9GA 1G5RA 1N2OA 5K5EA 1E3TA 1N4DA 1IG0A 1XR3A 3P27A 2GB4A 3TTXA 2C1XA 4ED9A 4MYCA 4GMDA 3BWXA 4HB2A 3OAAD 3E81A 5A7GA 1PZXA 2XCSB 2RGRA 2COIA 2DYKA 3BJMA 4OGGA 3C3AA 2OYCA 4GLXA 3ZD9A 1TM2A 4GMKA 2O2DA 2ZE8A 4UEJA 3X44A 4JOQA 1OC4A 2QVGA 2IA6A 4B9EA 3ODPA 4ENWA 2WIKA 4GKJB 2W6PA 1AN0A 3I2JA 3R9IA 2RGEA 4R6WA 2QX9A 1IEWA 2WBLC 2J07A 1GYFA 3UJ8A 2WYHA 4HB3A 2ZIGA 4J1TC 2PM8A 3TXAA 2NTNA 3UMYA 3NUAA 5KQGA 2OH2A 1KARA 3BILA 5JC8A 4PHGA 3C6XA 1YB1A 2V4QA 3UGJA 3ZIDA 2HCTA 4H4EA 4LVCA 1S02A 6PFKA 3U19A 5I5EA 4UNNA 3BGOS 1SUSA 2CN1A 2J4DA 2VVTA 4L51A 2R0QC 4LK2A 4YCSA 2A7XA 3EAQA 1E2JA 2QJFA 3KZCA 2YWCA 3QHQA 3F5QA 4PRLA 3I2KA 4QDKA 4MS1B 1MZBA 1NBEA 3ZGVA 4AZWA 2J67A 3C2QA 4HWOA 1EUQA 5KVAA 4PSVA 2G9UA 1IY1A 4W7SA 3IV7A 1K7XB 2A0YA 3ENZA 1C7FA 3AF2A 4ME6A 1M7JA 5CLHA 3D64A 2PS9A 2JAHA 3AJDA 2C78A 4DR2B 4J6EA 3W6ZA 3EDQA 1JRLA 5EKTA 1ZINA 2OHFA 3N2KB 4BP1A 4MQ6A 4MYSA 2G8NA 2OD2A 1SIOA 5IN5A 4MRNA 3CEHA 2BGNA 1QFSA 1HRDA 1RE1A 3SQWA 1BNCA 2I6GA 3GNSA 1WO8A 1XP8A 2QZ4A 2QR5A 4OF4A 1QP8A 1UM9A 1Z25A 3ET4A 1XRNA 3I1YA 1YB7A 2VYNA 3UHAA 3LQRA 1LJ8A 5E1MA 3WB1A 2J31A 2QG4A 1VI2A 4EITA 4HADA 4EUEA 1QVVA 2OQVA 2D0PB 4WCFC 1A98A 5IULC 1TCCA 3BH7A 5KFCA 3LCVB 1AZWA 3D5EA 4AZ0B 3IOMA 3KFVA 1ZK4A 4QUEA 5EOVA 2E37A 3OZEA 4ZEOA 4GHWA 2ISQA 1SHUX 2QL6A 2FMAA 2I1VB 4EEZA 4GE0A 3PENA 2OQ2A 4MRMA 4QQFA 2LPMA 2H7VA 4MWZA 3M6IA 5L1KA 2RMKA 4YRDA 4Q1AA 4FDLA 1Z2PX 4HH4A 4JS0A 3CTMA 3ZWBA 4NBLA 3WLKX 3N42B 3ZV4A 3BORA 3EGDB 4PLTA 5IXSA 4Y2SA 5AK6A 3K9NA 4NY1A 4Y8VB 4OH7A 1L4BA 4QJ3A 2IXEA 1IHYA 2BMFA 1YB6A 4M8LA 4X3PA 3HU1A 3WK8A 1Y3IA 3N8DA 5D1HA 3WZLA 4XASA 2YV4A 3SYRA 2AN1A 3HNPA 4DY6A 1LDMA 3P9IA 4OFZA 4QPNA 2JGDA 4MZDA 4TS9A 2VHVA 1HE3A 3ZDYB 4IS3A 1WDLA 1U2ZA 5BV7A 3VRHA 3WKDA 4GF5A 4Q93A 2OCGA 2HMYB 4BRUA 4R1TA 4BOYA 4ZPXA 1NJGA 4A9AA 1G38A 3GFRA 4LSWA 1QH1A 3M49A 3UG7A 3WBBA 2WAYA 4IXDA 3PNQA 2IV2X 4WHXA 2QL5A 1EA5A 5I7UA 1B16A 1DJMA 4ZAXA 1MBZA 4MWCA 3WWJA 3N2ZB 3CIFA 1JQ3A 1OXUA 2RGCA 3GLHA 1NGSA 1G8FA 4LUCA 5BV0A 3INNA 4LXQA 1G5PA 1N9ZA 2FK7A 3SR3A 4EQZA 3O4HA 3ZU3A 5AUOB 2BISA 1USIA 3TZBA 1QGUB 5IT4A 5H8WA 4ZTBA 4UHBA 2ZZMA 1KBLA 5IARA 1PWEA 4U7PB 3GJ5A 3B1FA 3JTMA 3ZPXA 3V1LA 1RJ9B 1ZVVA 5B1DA 2O8NA 5L3QA 2XUKA 4MA5A 4GPIB 4GW3A 3DZKA 6YASA 1ENZA 3UB4A 1PS8A 1C9YA 4BLQA 1P9WA 2R9VA 2J48A 3PWZA 4IJWA 3I2GA 2YW2A 5DSTA 4MP8A 3QUCA 3K1YA 2POQX 3LM8A 2ATCA 3T1NA 5AUQA 4WN3A 3GNLA 5FPHA 4DC1A 1WUKS 5KG6A 1W88A 2B25A 1BCSB 2XQIA 4DL4A 2H1HA 3WGIA 1O5IA 2P78A 4LJLA 2JGKA 1ODTC 3H7AA 3V9AA 4TS4A 3SFZA 3FGNA 3PVSA 5E2IA 2XYHA 2AVNA 4J9SA 1ULBA 4LSXA 3UOWA 1CQJB 1P0CA 4NOMA 4RD1A 2A9QA 4ZCPA 1JPJA 4NBRA 3HPRA 1RJPA 1EXWA 3WK5A 4M1ZA 5GWXA 2ACVA 1ZHHA 3ZY5A 4HLNA 4KI7A 5KREA 3GEPA 3U4DA 2NSHA 3DCYA 1DI0A 2J0VA 2MOKA 2CDRA 3OC0A 5CB4A 1S01A 3EIEA 4MMZB 3R2JA 2YIMA 2HWWA 5JD3A 3AT1A 3OC6A 1MT0A 1BDHA 5KG3A 3OE1A 1OKKD 1DB3A 5B7PA 5E95A 5EMMA 2HBQA 4KAXA 3A11A 1PFKA 3PYMA 1Q22A 4IX9A 1YVPA 1HDGO 2Y66A 5BYKA 3WLJA 2PGJA 2P68A 2UYHA 4RK6A 2OHHA 3QKIA 1WSDA 1SD2A 4MDEA 4EA8A 4W5JA 3L7YA 2VEOA 4B09A 1W2GA 4I7EA 3WLSA 5LU9A 1GDTA 4PO1A 2EU8A 3FRHA 2TMDA 4MA0A 5BQOA 1IWBB 5DP1A 4F7DA 1LF0A 3FB4A 1N92A 5JR3A 3N0WA 4Z6KA 2C9YA 3W04A 2QMQA 3P9SA 3IV9A 3LKDA 1RJDA 1UR5A 2CFSA 2E0IA 4HH3C 4XR9A 2LZ0A 3JPWA 3T4PA 3JWPA 1YS6A 4ARCA 2ZTLA 1L9XA 3BD9A 4A3CG 2Y4OA 3BS4A 4OHUA 3E3OA 2HKIA 2Q6TA 4YXWA 4F2DA 3BE5A 3PE6A 5C1IA 2MU1A 1USVA 3I8OA 4FOSA 1UK8A 1Y5MA 4QUJA 2PUFA 3Q72A 2AHRA 6REQB 4NG4A 1UBTS 2GK3A 4L5IA 5EQJB 3FPHA 4AJ1A 2ZYGA 1XTTA 1KZ1A 1WMSA 2CXHA 2YHSA 1CUIA 1AHIA 1E1NA 5BSFA 3ELWA 3LQFA 1FA9A 4DJEC 2KBEA 1LZKA 1RYEA 2P6OA 1TDJA 3A0UA 1YCFA 1BMFA 1CPYA 4UU8A 4EMUA 3PQCA 2AGPA 2GN6A 1PZEA 2X8JB 1FYFA 2WSYB 4FFSA 3WLTA 4MVJH 4MUAA 1Z15A 4P5DA 2VYCA 2B94A 4JMLA 4EENA 4ESVA 4DM7A 3AOEC 2IXFA 2EFDB 5IM5A 4DMRA 3MILA 1K9SA 2IPNA 1EUDB 4RESA 4JJFA 1NJ6A 5KNBH 1KY4A 4Y6LA 5I9NA 1OXSC 1WSCA 2MSCB 4ZAYA 3BFKA 5ITZB 4UDOA 3TTTA 1FS4A 3PDHA 5EHIA 2VP6A 3BKXA 5F1OA 4DCOA 1QHXA 4PQFA 2W6OA 4RJKA 3N41B 4B3JA 1U2DC 4UXJA 3O83A 3BZBA 2WNSA 1IPEA 1K1EA 3CNLA 4X0EA 5LKRA 3ORFA 3FBWA 1ODKA 4I1VA 3FROA 3AI2A 3ZW7A 2WFMA 3ZWDA 1Z4LA 4PM4A 2JLBA 4DUZH 1Q57A 2AN4A 2G0NA 3LUJA 5LM3A 1T2VA 4Q3DA 2QLMA 3PFHA 1CIVA 4DR1H 4MVYA 2QI9F 2WNIA 1P1RA 5JVDB 3QOFA 5K3DA 1G2PA 3KZXA 4HXYA 4WK2B 3AR3A 3ZVKA 2Z4SA 5BMVB 3QPAA 3TE7A 3DFZA 3EXEB 2QUZA 1GU1A 3COPA 1NHGA 1UODA 4FLMA 2V9ZA 3QU5A 5I5TA 3QVKA 4A7PA 3QUBA 1HDYA 4UFPA 3RRJA 4FFVA 3NQ41 1OA0A 1S68A 3AUYA 4MS4B 3MLEA 5C80A 1XA3A 2G82A 4UM5A 3MJFA 1EVKA 1M2FA 5IKMA 4AN4A 3C1TA 4GZLA 1HE2A 4ZRDA 4ITVA 1VP9A 2PLRA 1L3IA 1WB9A 1SZDA 2YZNA 2GD0A 2YYSA 1N5DA 3AJRA 2JFXA 3PPIA 3DF7A 3GLIB 4ED3A 3CLTC 3AFGA 4QNNA 2EBFX 1NE2A 4JSYA 1FNBA 3FA2A 4JLKA 4V24A 3RSZA 3HUEA 2VSYA 3BWEA 4E30A 1S7GA 4GZ6A 4RSGA 3I01A 1EWQA 4RZSA 3A2KA 1TVCA 4UTVA 1ZD5A 1ZM7A 2AK2A 5T8KC 3AVUA 4R1NA 1V7QA 4HSGA 4JJAA 2C5EA 5AHKA 3WXMA 2BIFA 1PK8A 2C03A 3LT4A 2FPMA 2A0UA 2KS6A 3TLMA 1JEAA 3AMVA 4KWTA 4DRXA 3CVJA 2W6NA 5D3KA 3X1MA 1H5QA 3KKQA 2VFAA 1T43A 4DMKA 2WZDA 4D3DA 2YV1A 4DLBA 3V4ZA 3ZNQA 2PL5A 1ZCAA 2BI4A 1H2XA 4R2IA 4NXMH 3AOGA 2UXCB 3KQHA 3U39A 1N7JA 3DVAA 4YAGA 1UJMA 5TPZD 1J22A 3MLAA 4LMAA 1OIXA 1SJ9A 4DSOA 1BDIA 2ZI5A 3P19A 1MH1A 2X8WA 2AS0A 1PGNA 1LBEA 3SXJA 3NWPA 1P19A 3Q0EA 4IDBA 1ZNXA 3PYXA 4FYXA 1PL0A 4JEUA 4BS9A 3P0IA 2D00A 3D8BA 3I3SR 4CR8A 2WU1A 5JXGA 1TJYA 5IWAH 1X1BA 3MA0A 1AKWA 3G8BA 2P91A 4BGUA 2FH5B 1J8MF 4BQSA 4PLZA 3AONB 3AZQA 2JJ1A 3NTXA 1A27A 4KRXA 4BEBA 1QQBA 4B5LA 4YJHB 1DUIA 1F6BA 4LPSA 3CNHA 3JQCA 3D54D 3TBKA 3HADA 3A4LA 3C15C 4TSKA 1TW3A 5KTRA 1NW5A 3V4VB 2CVHA 4PG7A 1NBME 3A36A 4RDIA 4DCGA 4BVHA 1OWMA 5A7HA 4MVJF 3O0TA 1GPLA 4DQNA 4F6CA 3CVZA 3GZJA 1IY2A 4ZVMA 3A06A 3SHWA 3G0DA 5DF1A 3M89A 4I4CA 1MAHA 3QBDA 4DANA 3Q8RB 1GQ2A 3ROTA 3CEJA 1E1QA 1SB9A 1Q1ZA 3NBKA 1UPTA 2QSZA 3Q87B 2HNBA 4PO9A 4RW0A 4LYYA 5TGTA 4BO7A 5AM2A 2QRJA 1EJ2A 1X7HA 2MT9A 3KR1A 3HXKA 4HB0A 3V32A 4BBPA 3A4YA 4R9NA 1GRQA 4QO8A 3WYNA 1L7QA 4UNSA 1D1TA 4UU1A 3UV3A 3KAJA 3FWPA 3ELYA 3SJAA 3I30X 3OM1A 4ZICA 2G1UA 4ZVNA 3FR7A 1UBHS 2ZJZA 4L3WA 1S2OA 1CUCA 5H59A 3DTVA 3DTGA 4KO4S 4JBLA 3R6LA 3KXYT 1IB6A 5FWYA 4UM9B 4JV1A 2BN4A 4NENA 2WAQA 1HYQA 5P8WA 2ZBQA 1QO0A 3RKUA 1RI5A 3AETA 3BJZA 3G23A 2EF0A 4YMGA 4WK6A 1UWVA 3KYCA 2HZBA 1KDRA 5AXCA 3ONFA 1YS4A 1XDSA 2Q2UA 2ID4A 2JEZA 4ZCQA 5KTOA 1FCJA 1JU4A 2FHPA 2ECQA 3ZY3A 4Q3BA 2DFTA 3IDOA 4MWOA 1DBPA 3P8ZA 2FOIA 5BSTA 2ONZA 2VSQA 1U81A 4XQ9A 3GDFA 1PTKA 1WVIA 4L76A 2CCGA 1ODCA 2IP1A 2HHCA 2VIIA 1ECGA 3AEXA 3OTIA 4IEEA 1TC2A 3HV2A 4P6VF 1SU6A 1B15A 4YRNA 3Q9NA 2ERYA 1F17A 9MHTA 2XECA 1PAUA 4UEQA 4KQEA 4CI9A 5F5NA 3AEYA 1XAIA 3L93A 2FZLA 1EDDA 4MUGA 5JYBA 5EMKA 1P17A 4ECSA 4HG2A 1CR4A 4B44A 1TF2A 3E7PA 2DKOA 1AKMA 4GXNA 1MB4A 4Y6RA 4QJFA 3O4GA 4TMVA 1KIAA 4LF7H 3DB1A 3U56A 1JWAB 4BKOA 5LLSA 1KTVA 1Q0PA 2VJYA 3F1LA 1P9LA 4D41A 5L9AA 2CV0A 2IUTA 3U16A 1E7YA 4ZYYA 4UHEA 4ZYWA 5B1SA 4FFNA 4P93A 2NTVA 4MVJG 2B7LA 1T8PA 5BWMA 4TVIA 2EHJA 4EEKA 4CG1A 1Z6QA 1MJGA 2FSPA 2FSIA 5FNZA 3D7NA 2X1HA 2J3LA 4B32A 2EZ8A 4OQMA 3AF4A 3IP9A 5DKFA 2FKLA 4UCVA 3BB3A 1P0QA 4A3SA 3KK0A 3ZCXA 1K2WA 1P16A 5GPBA 2H08A 2YJGA 2W7PA 4FHGA 1W4LA 2ZU0C 1E60A 1JDTA 4AICA 4PZEA