5JR9A

Crystal structure of apo-nec3po
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
188
structure length
188
Chain Sequence
RGSMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEQ131
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
total genus 82
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jr9A00
5JR9C 5JR9B 3ZC0A 5JRCB 5JR9A 3ZC1A 5JREA 5JRCA
chains in the Genus database with same CATH superfamily
4CXWA 1UCUA 3RYCE 2IDOB 4P09A 5ABHA 3UFEA 5AQGB 4WBNE 1HF8A 2QRXA 2X9HA 3SOLA 3RC8A 2DWKA 4OFZA 4PJLA 2WB5A 1Y64B 2YDRA 3UQ7A 4HFHA 4QKNA 3C50A 3UU4A 3HKCE 1MMDA 4C90A 4ANJA 5ADXL 3KINB 3RGLA 5CA1E 3AEGA 3N9PA 3LSVA 2X0HA 2XZEA 2VK9A 2NR4A 4UVCB 4I4TE 2MBGA 2NTXA 5AQVB 3VKHA 3PURA 2H7OA 2NW9A 4CN6A 3ZMTB 2NWBA 2XQAA 4UV8B 3UUXB 5ABFA 3C64A 2UU9T 4DMVA 5LHHB 4KHZF 3E08A 3CIRA 1QUUA 4WW0A 4Z90A 2YK0A 3GMIA 3U3IA 4H9SE 2UXBT 3CX6B 4A98A 4U2ZA 3O1IA 4XAXB 4DBRA 4DR7T 1YQ3A 4PNIA 2LJLA 4WBOA 4PJMA 1IAPA 2Z6EA 3AEEA 4O8SA 3ZN0B 4YHHT 3P4WA 3E0ZA 3LBXA 4GK0E 4M1PA 3DTOA 2DWGA 4EEDA 5AQFB 2LEHA 4HWFA 5DJQC 3E22E 2C0SA 5AQMB 3CQGB 4NIQA 3H37A 3EAMA 4Z91A 4JUYA 4EYUA 5L3FB 3C4ZA 3PU8A 1U5PA 4UF0B 4BJMA 3PUVF 4XBFB 3ZMUB 2XQ7A 1X9BA 5FXVA 2YEVC 2CPTA 4H9RC 3CX8B 2KMFA 5HEUA 4J2CA 3ZSSA 4H9OC 4JBWF 1HG5A 2XSBA 4HGAA 4QXCB 4DR4T 5LBMA 2L9QA 4JI6T 5F5WA 2XAHB 5KXJA 1VRBA 4U74A 4X1YE 4JLEA 1LRZA 4X1IE 1SA0E 2BKNA 1BR2A 2XASB 3AA6B 4ZS3A 4A56A 4MALA 4U2YA 3KV6A 2JIWA 2IC6A 2NOXA 5LJNA 2WP9A 3RYFE 1X79A 3CWZB 3K1SA 4C91A 2L3LA 3FZMB 5LG3A 4QH5A 4X5TA 1L0VA 3AE5A 1MIVA 2CHOA 3MJXA 3W15B 3DJBA 4QH1A 4UIGA 2M67A 3AECA 2LSKA 3FB2A 4Q25A 2IHR1 4AKRB 2WMNA 4AKHA 4TWDA 1W0AA 2X68A 4YHJA 5CA0E 2NTYA 1W0BA 2Q9QA 3AAAB 2BZBA 2RPAA 2XPKA 4IDOA 2LKGA 5KX5E 2KINB 4QXBB 1J5WA 3UQ4A 2XUEA 2DNXA 3SFEA 2I59A 4PJNA 2B1EA 2XHEB 2XQ5A 3KVAA 2LLYA 2XY8B 5AFUL 1NAFA 2XM1A 5AQUB 3RRWA 1BR4A 3AVSA 3CPZA 5FVLA 3VR8A 3OYXA 4QHOA 2VVNA 5FL1A 3AEAA 1N32T 3OTOT 5DABA 4HFEA 2V7LA 3PDYA 5L4EA 2NP9A 2WDVA 2ODUA 4COFA 4K0UA 2W62A 3HA4A 3UFGA 3K3NA 1WR6A 4UVAB 5EK2A 1MMGA 1D1BA 2G0UA 1O3XA 2YU2A 4JI2T 4LFAT 3T1HT 4JI5T 2DL1A 4H63H 1GQEA 4HFDA 3B13A 4AQGA 5LGUB 2PG8A 4X65T 4TX5A 4ISTA 5HWYA 3NRYA 1E7PA 3RYHE 3PUWF 4MBQA 4TUYE 3GN5A 3N9NA 5LG4A 4HEAA 3IBPA 4KMCA 5LHIB 3ZYMA 4IE6A 3PTRB 3FBLA 3RX6A 2LSJA 5FY0A 3ZMSB 4DV2T 3UT5E 4U72A 2WS3A 2N9DA 4AQYT 2B76A 5ABEA 3A8YC 1KK7A 4ZS2A 2E9XA 3MK7C 3NBXX 4DUZT 3AA1B 1OEDB 3AA0B 2ACZA 3EDUA 3BQLA 4ILAA 4I0UA 4TV9E 2VASA 1JNRA 2QVAA 2XJ7A 4ZI3C 1H7CA 1KNPA 4A5XA 4YJ3E 4CI1B 3IEEA 4L5GA 3N9MA 4JI8T 5L3CB 4JYAT 5JDHA 2E5VA 2BG9B 3V5SA 1SUMB 3N2GE 3N2OA 3K3OA 2W2UA 3QUJA 1WYCA 3MKDA 2CLYB 4KX6A 5FP3A 2YDSA 3NKZA 1ZEEA 2V6YA 4LMLA 4WZXA 1T72A 3NZQA 3OYZA 2FJEA 4DBQA 3ZC1A 3ZJ2A 4YY3T 2CBIA 2FJDA 4O4IE 2KWHA 2PJQA 3B5MA 1WYBA 1T7SA 4GK5E 3LK42 3AE2A 2WWUA 2Q9QC 3P4SA 1CUNA 2WSSV 1HTJF 2XM2A 5AQIB 1WLXA 3ZT5A 2VURA 3HI2A 2KSRA 5H6RB 3R84B 2XQ8A 1XDOA 2LKHA 2LSGA 3GA8A 5C8YE 4OYJA 1M7KA 1KNZA 3OJAA 2JQQA 4DNDA 2LHNA 3B57A 4YJ2E 3AE8A 4A97A 2W0GA 1HCIA 3CQCB 5JVDE 3EHZA 4B3ST 2XQ3A 3AE1A 3R6NA 3ANWB 3C98B 4PK6A 2VQFT 1Z0PA 1YKHB 2KXPB 3AE7A 2MPKA 3G06A 3OPCA 4DV7T 5LMNT 5HWXA 2WM9A 2WQYA 1V9DA 3SRZA 2HH7A 3EABA 1G73A 3FHNA 3ONLC 1CHUA 3AE6A 4UEMA 1SHZC 3ZC0A 3AA7B 3JC6C 3H3AA 2KLQA 3TLVA 2UUAT 2WMOA 2EHOA 2W61A 3FZKB 4B3TT 4JV5T 1KNRA 3JADA 3ZMVB 1D0YA 3F2EA 4G2AA 2V1DB 2E8IA 5E0OA 3NWIA 5LCYA 3AE4A 2CA5A 2K24A 1MMAA 4HN9A 2KZ7B 2J47A 4ILBA 3VRBA 4UXNB 4LFCT 4GYSA 1US7B 2CBJA 5JR9C 2LSIA 4GKJT 2BVMA 4LF6T 4EZHA 4LMJA 2A2FX 3BQIA 3T1YT 3ZJ1A 3KBTA 1YD8G 4XZCA 5J2TE 5HXHA 3X1DA 4LF5T 3AE3A 2J1DG 2C5JA 1XWMA 2MAWA 4I50E 2E9XC 1YQ4A 3ZYKA 3RLFF 3CMLA 3RIUA 2X0LB 2YDQA 1NWMX 4KUMB 2W00A 4G63A 2CWOA 1W9RA 1D0XA 2P9BA 2SPCA 2VWAA 5LB7B 2A72A 2LT3A 3RHWA 1UGOA 5TAOA 3HKDE 3FBZA 3S4UA 2XAGB 2V7KA 1XMQT 4JEUB 2JQKA 5A1LA 4H9NC 5F3JA 5JRCB 3MACA 2I0MA 3RF1A 2ZM6T 4AXPA 4KI0F 5IYZE 3AXJA 2GK9A 4H9PC 2QYWA 4HFVA 3O1JA 3Q5XA 3JCFA 4HE8A 2D0TA 4LF8T 2FUPA 4ZXLA 3L8RA 5FL0A 1NENA 2H89A 2V26A 1ZHCA 1M62A 5FYMA 2D9DA 5AQKB 1AJ3A 1MIYA 3CK6A 5HCMA 4DIDB 4HFBA 4BJNA 2JJ9A 1UK5A 2X9YA 1FIOA 4EV6A 2XAJB 4ZI2C 4QXHB 3ZYLA 4O4JE 3QC9A 4EOZB 5LMUT 2LE8A 5LBQB 4GIWA 2X9WA 2YINA 4L9IA 2BKPA 4ZZBA 5FNVE 1KFYA 5HEHA 3ZSTA 2VKJA 2XQ4A 2LHRA 1UX4A 2LSYA 3ZKRA 5BMVE 1IBMT 2ACXA 4OYKA 3UU3A 2QA7A 5DQWA 3BQKA 4X64T 2DCFA 5FY1A 2UUCT 3RQUA 2R6GF 2JRKA 2DLRA 5ABFB 3H3MA 3ZMZB 2W4XA 4U7YA 2LOPA 3K8PC 2AE9A 3TLWA 3HKEE 4PFOA 3ESLA 2EHOC 2PBIA 5AQPB 2K9AA 4IE4A 4WYVA 4YTPA 5FKYA 3PJAA 1IBKT 1LVFA 2XQ9A 3IA3A 2CXLA 5J2UE 3EDVA 3AEDA 2BS3A 3KBUA 4PAGA 5HXCA 1XDPA 4DR6T 4TN7B 4OK0A 2CRBA 5EK3A 2E5LT 3LBXB 3CQXC 3ZCJA 5CB4E 3FZFB 4I55E 4HWIB 2V7IA 5LOVE 3ZN1B 2KNDA 3P4PA 5JQGE 2RA1A 5IWAT 5C2TA 4ILCA 4NPPA 2KT9A 3LFMA 5FY7A 3AB3B 4ZI3D 1ZP0A 4OHFA 2WZIA 3RIUC 5LXTE 3C51A 2V7MA 3PUYF 2HPLA 3T8OA 2K5BB 2CXFA 3Q5WA 2XTLA 1FMWA 4PFPA 2C5IT 3N9QA 2J62A 4TWHA 5J0ZA 4HFCA 3FZHB 4Z8XA 3PJAJ 3EVYA 3I0OA 4DV4T 2WDRA 3Q5DA 5JR9A 4TV8E 3GWHA 2JMHA 4EZ4A 3BK9A 3N9LA 3CKDA 3RC3A 3VHLA 3NZPA 1S94A 3JAEA 3ZT6A 2Q9QD 2LM2A 5LGTB 4ISSA 1B7TA 5LA6E 5FXZA 2FJAA 4CZZB 2M6BA 4MFRA 3LK3B 2IW5B 2LM9A 2HN1A 3FZLB 3LDQB 1EZ3A 4UR9A 4CN4A 3EUHA 2BKOA 2LRKA 1FMVA 4UVBB 3RPUA 2MTQA 2CHNA 1D1CA 2JMKA 2Y48B 2V7JA 2Q9QB 3AEFA 1ZV4X 1MMNA 5JDGA 4YFSA 5JREA 3SWHA 1NEKA 4FJOA 4IE7A 3SS1A 1HFAA 2LRLA 1YXRA 2RP4A 2E2AA 4ASKA 3VRAA 5HAXA 4DV5T 4QH4A 5KMGP 4JI7T 4H63V 4CI3B 4GKKT 5JDFA 2WDQA 1MIWA 3N9OA 1OEDC 3JC6D 5HXSA 2CXDA 2VVSA 3FXDB 5FXXA 3DP7A 4GOUA 1HNWT 5EZYE 2ES0A 3LK2B 4V1Av 2A3DA 5JDLA 4U3CA 4NUVA 2ZM0A 2JQHA 2IMLA 2IIUA 2X0YA 3ZLIA 1VOMA 4HWCA 4IDNA 1KEYA 2BDEA 3VR9A 4LFBT 2N2NA 4B3RT 3MA9A 1R8IA 2H7VC 5LNKA 5JDMA 4H9QC 4U31A 4UF0A 1LVKA 3J7Yq 4F6RC 4DO0A 5AQNB 1WR0A 5FMNA 2AXDS 3QK6A 1DU2A 3M3ZB 5AQHB 3N5LA 3I9YA 2PFVA 3A7MA 1G8XA 3GN5B 4DR2T 2E9XD 3L09A 2UXNB 3RKOA 3UTKA 2IUBA 4F8HA 2V5CA 3A5XA 2D2SA 3JAFA 4ZOLE 2UXCT 4O4LE 2FBWA 1D0ZA 1IZNB 1VCTA 1OWAA 3PUQA 4HKAA 5HXRA 1OEDE 5AQRB 4EEBA 2E9XB 4P1NA 4HFIA 2LOSA 2W67A 4LMKA 2VKDA 5LJMA 2XQ6A 1VCSA 2N1GA 3K3QC 2F4VT 1S35A 1U4QA 2UXDT 2H3RA 4ZZCA 2L8KA 3PU3A 2WU2A 5L3DB 2BG9E 3J9X1 4YT0A 3KDSE 4JEHB 4UV9B 4X66T 2I6HA 3ZEFB 1UUSA 1FEWA 5AQQB 2V8SV 5M4YA 3LJCA 4L0RA 5L47A 4DV6T 4AQFA 1JNZA 4O4HE 2K48A 2V6YB 1KF6A 5HXEA 2J4GA 4YSXA 1T8BA 4EXTA 3RIFA 1ZKEA 4CN1A 2X66A 3PUSA 4ZI2D 2A9UA 3AEBA 3WAKA 4IDPA 4LF9T 5GONE 3PUGA 2ZM8A 1I6ZA 4PJJA 4TNVA 4U33A 5AQOB 5L3BB 4CXYA 1IJ6A 2JPFA 3RI5A 2VB6A 3UUMA 4EYYR 1QLBA 4TZ4C 5LP6E 3SFDA 3RIAA 3UU8A 3P7IA 4IDQA 4TNWA 4HWDA 1HG2A 2CCQA 3KV4A 2BS4A 2XSAA 3IF8B 2NW8A 4AKGA 4CI2B 2XQYA 3CVRA 3O9XA 5AQSB 5AQLB 3OKQA 3PV0F 2OA5A 2Y8DA 2H88A 3AAEB 4O2BE 4ADZA 5KDMC 3EI0A 3RKGA 2EHOD 1N33T 4ILUA 4NXMT 2MOZA 2ODVA 4HTEA 1Y01A 4DR5T 2WBLA 2UUBT 1HX8A 1MNEA 5FXWA 4KP3C 1SE7A 4NUUA 4CQIA 3C4WA 1MNDA 5EK4A 1BR0A 3IHRA 2CWYA 3F31A 4DV0T 1HR0T 3UULA 3P4RA 3OVUA 2X67A 3PUXF 1IJ5A 2EHOB 5C3JA 3L3PA 2CEAA 1XNRT 4LF7T 5CJ5A 4N78D 2DI4A 4TWFA 3P50A 1I94T 5L3EB 1IBLT 4PK5A 3TLTA 5DQVA 2VQET 3WAJA 1OEDA 3LG7A 1BR1A 2QGSA 4DR3T 4JI1T 4QX7B 2YOEA 5J1GA 3VKGA 3HR0A 3AE9A 3OBVE 4PW8A 4B6XA 3TKLB 4ZI7E 3I0QA 3WI3A 5IHYA 2WAUA 2V6XA 4YSZA 3F57A 2VKHA 2BG9A 5HEOA 4IHJE 4HWHA 2CM0A 3N2KE 1WRDA 4EB6E 4KBMB 3UUBA 4O2AE 3ZPOA 3MZKB 2FJBA 4EAHA 3Q5EA 4AKIA 4X62T 5JDQA 2K3WA 4IE0A 3M65A 4DUYT 3ONJA 2IC9A 3HL6A 5HEJA 3PE0A 5CGMA 5HYAA 2WY2A 5AQJB 4AIUA 2YU1A 5IUXA 1UURA 4UELA 4WNKA 2VL0A 1J5ET 2VL8A 4AQFC 3V5UA 3UUNA 4YXDA 1D1AA 3AXJB 1XNQT 3O1HA 5L3GB 3TLSA 5JTGA 4YTMA 2D0UA 1YW0A 2M6IA 1HS7A 3CX7B 3I1AA 3ZCIA 5JH7E 5L2LA 4AI6A 1HX1B 4QX8B 4MLKA 4IE5A 3ANWA 3U78A 2KWIB 3C4XA 4JI4T 2HN2A 2W66A 3UU5A 3KVBA 2DHRA 1T98A 3KFWX 1E2AA 5F8PA 3RYIE 5LGNB 5HEGA 3P4QA 4IIJE 4DR1T 4X1KE 2WWVA 3Q9DA 4IDZA 5CFBA 4YLHA 1HNZT 2WU5A 4EIWA 4JI0T 4NXNT 4DV3T 1LKXA 2CMRA 3AVRA 4CXXA 4QWNB 2ZMAA 4BAYB 2OLTA 3Q2MA 3ZT7A 3RH3A 4GYRA 3I9WA 2V5DA 3NRXA 1XMOT 3PUAA 2NW7A 2ZLYA 3ONXA 5L4HA 2YN6A 2D5UA 4KHPT 5ETWA 1UX5A 1FJGT 2W63A 3ETVA 2WCAA 1QSDA 4YSYA 3TLUA 4ZHQE 2XAQB 4U7IA 3P8CD 2PTFA 5BR8T 5FVKA 2UXXB 3UU6A 2BBJA 4P0BA 1J1JA 4I43B 3QB5K 1HNXT 3QNUA 2MYSA 2IAKA 5AQTB 4IGUA 1WCRA 4B3MT 2WZHA 4OX9T 4EGWA 3D0TA 1E1HB 4IT4A 4P0AA 3KV9A 4E7ZA 2XAFB 4DMWA 2X51A 3O4XE 1XZYA 5HCJA 3MXZA 4PK4A 1WFDA 4E7SA 4IREA 2HHHT 2Y6XA 4AKLA 5H6QB 2HPJA 2X9XA 4ERRA 2YKSA 3ETUA 1Z8UA 1ZOYA 3FXEB 2CE7A 2BBHA 2BG9C 3ABVA 1W09A 5JRCA 2CLYC 4AISA 3RRCA 4FI5A 1N34T 3NVOA 4JI3T 4K0KT 4DVDA 4MHCA 2C5KT 3L39A 5ABGA 3QB5A 4IL9A 1OXZA 4YTNA 1YKEB 3HKBE 4LF4T 2VKOA 5JDNA 5LYJE 4BA9A 5JR9B 3QOFA 2JQ9A 2BS2A 4IL4A 4ZEYA 3PUZF 3RQWA 3VU7H 4DV1T 2BVLA 1N36T 5LHGB 2OV9A 2ZM2A 4X20E 3KV5A 3AAIA
chains in the Genus database with same CATH topology
1H7CA 4CXWA 4TN7B 4YJ3E 4OK0A 1UCUA 4O2BE 4ADZA 5KDMC 5EK3A 3RYCE 3LBXB 3CQXC 4CI1B 3IEEA 4L5GA 3N9MA 3ZCJA 5CB4E 4P09A 3UFEA 5L3CB 4WBNE 1HF8A 4I55E 5JDHA 2X9HA 3SOLA 2V7IA 5LOVE 3ZN1B 3RC8A 2KNDA 2DWKA 3V5SA 4OFZA 4PJLA 3N2GE 1Y64B 2EHOD 3N2OA 3K3OA 4ILUA 3QUJA 4QKNA 5JQGE 1WYCA 3MKDA 2RA1A 2MOZA 2CLYB 3C50A 3HKCE 5FP3A 2ODVA 4HTEA 1MMDA 4C90A 4ANJA 5ADXL 3KINB 1ZEEA 2WBLA 5CA1E 3N9PA 1HX8A 1MNEA 5FXWA 4KP3C 2VK9A 4NUUA 4UVCB 3NZQA 2KT9A 3LFMA 4CQIA 5FY7A 3C4WA 3AB3B 1MNDA 5EK4A 4ZI3D 1BR0A 3OYZA 4DBQA 4I4TE 3IHRA 3ZC1A 3ZJ2A 2CWYA 3F31A 4OHFA 3UULA 4O4IE 2MBGA 2NTXA 3VKHA 5LXTE 2KWHA 2PJQA 3PURA 2H7OA 3C51A 2NW9A 2X67A 3ZMTB 2NWBA 2V7MA 4UV8B 1IJ5A 2HPLA 3UUXB 3T8OA 1WYBA 2K5BB 2EHOB 2CXFA 3L3PA 3Q5WA 4GK5E 2XTLA 3C64A 2CEAA 3LK42 1FMWA 2WWUA 4PFPA 4DMVA 2Q9QC 4N78D 5LHHB 1CUNA 2C5IT 2WSSV 1HTJF 2DI4A 3N9QA 3E08A 4WW0A 1QUUA 2YK0A 4Z8XA 1WLXA 3EVYA 3GMIA 5L3EB 3I0OA 4PK5A 3HI2A 3U3IA 5H6RB 3R84B 4H9SE 5DQVA 3WAJA 5JR9A 4TV8E 3LG7A 3CX6B 3GWHA 2JMHA 4EZ4A 1BR1A 2QGSA 2LSGA 3BK9A 3GA8A 3O1IA 4XAXB 4DBRA 5C8YE 4OYJA 4QX7B 3N9LA 3CKDA 1KNZA 3OJAA 3RC3A 4PNIA 5J1GA 3VHLA 3VKGA 2JQQA 2LJLA 4DNDA 3HR0A 4WBOA 4PJMA 2LHNA 1IAPA 3B57A 3OBVE 4YJ2E 2Z6EA 4PW8A 2W0GA 1HCIA 3CQCB 4O8SA 4B6XA 3NZPA 5JVDE 3ZN0B 3TKLB 1S94A 3E0ZA 3R6NA 4ZI7E 2Q9QD 3I0QA 5LGTB 3LBXA 4ISSA 3ANWB 3WI3A 3C98B 4GK0E 4PK6A 5IHYA 1B7TA 5LA6E 4M1PA 3DTOA 1Z0PA 2DWGA 2WAUA 1YKHB 2KXPB 5FXZA 3F57A 4CZZB 2LEHA 2VKHA 4MFRA 5DJQC 3LK3B 2IW5B 2LM9A 4IHJE 3E22E 2C0SA 2CM0A 3CQGB 3N2KE 3H37A 1WRDA 4EB6E 4KBMB 1EZ3A 3ZPOA 4O2AE 5HWXA 3MZKB 3EUHA 4JUYA 4EYUA 2WM9A 1V9DA 4EAHA 5L3FB 3SRZA 3C4ZA 2HH7A 4AKIA 3PU8A 1FMVA 4UVBB 5JDQA 3RPUA 1U5PA 4UF0B 4IE0A 1G73A 2MTQA 3FHNA 4BJMA 1D1CA 2JMKA 3M65A 2Y48B 2V7JA 4XBFB 3ZMUB 2Q9QB 2IC9A 5FXVA 1ZV4X 2YEVC 3HL6A 4UEMA 4H9RC 1MMNA 3CX8B 2KMFA 3PE0A 1SHZC 5HYAA 3ZC0A 3AA7B 3JC6C 5JDGA 4J2CA 3H3AA 4YFSA 5JREA 2KLQA 3SWHA 2YU1A 2WMOA 2EHOA 2W61A 4UELA 4WNKA 4FJOA 4IE7A 4H9OC 3SS1A 1HFAA 1HG5A 4HGAA 4QXCB 3ZMVB 1D0YA 2VL8A 3F2EA 4AQFC 4G2AA 2RP4A 2V1DB 2E8IA 5LBMA 2L9QA 3V5UA 3UUNA 2XAHB 4ASKA 5E0OA 1D1AA 5LCYA 1VRBA 4U74A 3O1HA 2CA5A 2K24A 4X1YE 5HAXA 4JLEA 1LRZA 4X1IE 5L3GB 1MMAA 5KMGP 1SA0E 4HN9A 2KZ7B 1BR2A 2XASB 3AA6B 4UXNB 4H63V 4CI3B 2D0UA 4ZS3A 1YW0A 4GYSA 5JDFA 1US7B 1HS7A 3CX7B 1MIWA 4A56A 3I1AA 4MALA 5JR9C 3N9OA 3JC6D 2LSIA 5HXSA 2BVMA 3KV6A 3ZCIA 4EZHA 2CXDA 5JH7E 3FXDB 5L2LA 2IC6A 5FXXA 2A2FX 2NOXA 4AI6A 3DP7A 5LJNA 4GOUA 3RYFE 3BQIA 3ZJ1A 1X79A 5EZYE 2ES0A 3CWZB 3KBTA 3LK2B 4V1Av 1YD8G 2A3DA 4QX8B 4XZCA 5J2TE 5HXHA 4C91A 2L3LA 4MLKA 4IE5A 3ANWA 3U78A 3C4XA 2KWIB 5JDLA 4NUVA 2ZM0A 2DHRA 3KVBA 2J1DG 2C5JA 1T98A 3KFWX 1MIVA 3MJXA 3W15B 1VOMA 3ZLIA 3DJBA 4UIGA 4I50E 2E9XC 5F8PA 2BDEA 3RYIE 5LGNB 3ZYKA 2M67A 2N2NA 3MA9A 3CMLA 4IIJE 2H7VC 2X0LB 2LSKA 3FB2A 4X1KE 5LNKA 3Q9DA 4IDZA 1NWMX 4AKRB 5JDMA 4H9QC 4KUMB 2WMNA 4AKHA 2W00A 4YLHA 4G63A 4UF0A 4EIWA 1LVKA 3J7Yq 2CWOA 2X68A 4F6RC 4YHJA 1D0XA 2P9BA 5CA0E 1LKXA 4DO0A 2CMRA 2SPCA 2VWAA 2NTYA 5FMNA 3AVRA 2A72A 4CXXA 2Q9QA 3AAAB 4QWNB 2BZBA 2ZMAA 2LT3A 3QK6A 4BAYB 3Q2MA 3N5LA 5TAOA 3I9YA 3HKDE 3FBZA 2PFVA 3S4UA 3RH3A 5KX5E 4GYRA 3I9WA 1G8XA 2KINB 2V7KA 2XAGB 4QXBB 3GN5B 3NRXA 2XUEA 2DNXA 4JEUB 2E9XD 2I59A 3PUAA 4PJNA 2NW7A 3L09A 5A1LA 2B1EA 2XHEB 2ZLYA 4H9NC 2UXNB 5F3JA 5JRCB 3MACA 3KVAA 3RKOA 3ONXA 3UTKA 5AFUL 1NAFA 3RRWA 1BR4A 3AVSA 4AXPA 3A5XA 2D5UA 3CPZA 2D2SA 4ZOLE 2GK9A 4H9PC 5ETWA 5IYZE 4O4LE 1UX5A 3OYXA 1D0ZA 4QHOA 2W63A 4HFVA 3ETVA 3O1JA 3Q5XA 1QSDA 4HE8A 1IZNB 2D0TA 5DABA 4ZHQE 1OWAA 2XAQB 3PUQA 4HKAA 2V26A 5HXRA 1ZHCA 5FYMA 3P8CD 2V7LA 2E9XB 3PDYA 1AJ3A 2LOSA 2UXXB 1MIYA 2NP9A 2ODUA 4P0BA 4I43B 2VKDA 4K0UA 2W62A 4BJNA 5LJMA 2MYSA 3HA4A 2JJ9A 2IAKA 2N1GA 3K3QC 3K3NA 2X9YA 1S35A 4IGUA 1FIOA 1WR6A 4UVAB 1U4QA 2XAJB 5EK2A 1MMGA 1D1BA 4ZI2C 3D0TA 4QXHB 2H3RA 3ZYLA 1E1HB 4O4JE 3QC9A 4EOZB 2L8KA 2G0UA 3PU3A 5L3DB 1O3XA 2LE8A 2YU2A 3J9X1 3KV9A 4P0AA 5LBQB 3KDSE 4E7ZA 4GIWA 4JEHB 4UV9B 2XAFB 4DMWA 2X51A 3O4XE 2X9WA 4H63H 3ZEFB 2YINA 1FEWA 3MXZA 4L9IA 4PK4A 5FNVE 4E7SA 3B13A 5M4YA 4AQGA 3LJCA 4L0RA 2Y6XA 5LGUB 2PG8A 4AKLA 5H6QB 4AQFA 2VKJA 2HPJA 2X9XA 4ERRA 2LHRA 4O4HE 2K48A 1UX4A 4TX5A 4ISTA 2LSYA 5HWYA 3NRYA 5HXEA 5BMVE 2ACXA 3ETUA 3RYHE 4MBQA 4TUYE 4OYKA 3FXEB 2CE7A 4EXTA 1ZKEA 3GN5A 3N9NA 5LG4A 4HEAA 3IBPA 2X66A 2QA7A 3PUSA 5DQWA 4ZI2D 3BQKA 5JRCA 4KMCA 5LHIB 3ZYMA 2DCFA 5FY1A 3WAKA 2CLYC 5GONE 4IE6A 3PTRB 3FBLA 3RX6A 3RRCA 4FI5A 3PUGA 2LSJA 2ZM8A 4DVDA 4PJJA 4MHCA 5FY0A 3ZMSB 2C5KT 3UT5E 2JRKA 2DLRA 3ZMZB 5L3BB 4CXYA 1IJ6A 2JPFA 2VB6A 3UUMA 2LOPA 3K8PC 4EYYR 4U72A 1OXZA 2N9DA 4TZ4C 3HKEE 5LP6E 4PFOA 1YKEB 3HKBE 2VKOA 1KK7A 3ESLA 3P7IA 4ZS2A 2E9XA 5JDNA 3MK7C 2EHOC 3NBXX 4BA9A 3AA1B 5LYJE 5JR9B 2PBIA 2K9AA 1HG2A 2CCQA 3KV4A 4IE4A 3AA0B 3EDUA 2NW8A 3IF8B 4AKGA 4CI2B 3BQLA 1LVFA 2CXLA 5J2UE 2XQYA 3EDVA 3CVRA 3O9XA 3VU7H 3KBUA 4TV9E 2VASA 4PAGA 2BVLA 5LHGB 5HXCA 2OA5A 2Y8DA 3OKQA 2ZM2A 4X20E 3AAEB 3KV5A 3AAIA 4ZI3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 C;  5JR9 B;  3ZC0 A;  5JRC B;  5JR9 A;  3ZC1 A;  5JRE A;  5JRC A; 
#chains in the Genus database with same CATH topology
 4CXW A;  1UCU A;  3RYC E;  2IDO B;  4P09 A;  5ABH A;  3UFE A;  5AQG B;  4WBN E;  1HF8 A;  2QRX A;  2X9H A;  3SOL A;  3RC8 A;  2DWK A;  4OFZ A;  4PJL A;  2WB5 A;  1Y64 B;  2YDR A;  3UQ7 A;  4HFH A;  4QKN A;  3C50 A;  3UU4 A;  3HKC E;  1MMD A;  4C90 A;  4ANJ A;  5ADX L;  3KIN B;  3RGL A;  5CA1 E;  3AEG A;  3N9P A;  3LSV A;  2X0H A;  2XZE A;  2VK9 A;  2NR4 A;  4UVC B;  4I4T E;  2MBG A;  2NTX A;  5AQV B;  3VKH A;  3PUR A;  2H7O A;  2NW9 A;  4CN6 A;  3ZMT B;  2NWB A;  2XQA A;  4UV8 B;  3UUX B;  5ABF A;  3C64 A;  2UU9 T;  4DMV A;  5LHH B;  4KHZ F;  3E08 A;  3CIR A;  1QUU A;  4WW0 A;  4Z90 A;  2YK0 A;  3GMI A;  3U3I A;  4H9S E;  2UXB T;  3CX6 B;  4A98 A;  4U2Z A;  3O1I A;  4XAX B;  4DBR A;  4DR7 T;  1YQ3 A;  4PNI A;  2LJL A;  4WBO A;  4PJM A;  1IAP A;  2Z6E A;  3AEE A;  4O8S A;  3ZN0 B;  4YHH T;  3P4W A;  3E0Z A;  3LBX A;  4GK0 E;  4M1P A;  3DTO A;  2DWG A;  4EED A;  5AQF B;  2LEH A;  4HWF A;  5DJQ C;  3E22 E;  2C0S A;  5AQM B;  3CQG B;  4NIQ A;  3H37 A;  3EAM A;  4Z91 A;  4JUY A;  4EYU A;  5L3F B;  3C4Z A;  3PU8 A;  1U5P A;  4UF0 B;  4BJM A;  3PUV F;  4XBF B;  3ZMU B;  2XQ7 A;  1X9B A;  5FXV A;  2YEV C;  2CPT A;  4H9R C;  3CX8 B;  2KMF A;  5HEU A;  4J2C A;  3ZSS A;  4H9O C;  4JBW F;  1HG5 A;  2XSB A;  4HGA A;  4QXC B;  4DR4 T;  5LBM A;  2L9Q A;  4JI6 T;  5F5W A;  2XAH B;  5KXJ A;  1VRB A;  4U74 A;  4X1Y E;  4JLE A;  1LRZ A;  4X1I E;  1SA0 E;  2BKN A;  1BR2 A;  2XAS B;  3AA6 B;  4ZS3 A;  4A56 A;  4MAL A;  4U2Y A;  3KV6 A;  2JIW A;  2IC6 A;  2NOX A;  5LJN A;  2WP9 A;  3RYF E;  1X79 A;  3CWZ B;  3K1S A;  4C91 A;  2L3L A;  3FZM B;  5LG3 A;  4QH5 A;  4X5T A;  1L0V A;  3AE5 A;  1MIV A;  2CHO A;  3MJX A;  3W15 B;  3DJB A;  4QH1 A;  4UIG A;  2M67 A;  3AEC A;  2LSK A;  3FB2 A;  4Q25 A;  2IHR 1;  4AKR B;  2WMN A;  4AKH A;  4TWD A;  1W0A A;  2X68 A;  4YHJ A;  5CA0 E;  2NTY A;  1W0B A;  2Q9Q A;  3AAA B;  2BZB A;  2RPA A;  2XPK A;  4IDO A;  2LKG A;  5KX5 E;  2KIN B;  4QXB B;  1J5W A;  3UQ4 A;  2XUE A;  2DNX A;  3SFE A;  2I59 A;  4PJN A;  2B1E A;  2XHE B;  2XQ5 A;  3KVA A;  2LLY A;  2XY8 B;  5AFU L;  1NAF A;  2XM1 A;  5AQU B;  3RRW A;  1BR4 A;  3AVS A;  3CPZ A;  5FVL A;  3VR8 A;  3OYX A;  4QHO A;  2VVN A;  5FL1 A;  3AEA A;  1N32 T;  3OTO T;  5DAB A;  4HFE A;  2V7L A;  3PDY A;  5L4E A;  2NP9 A;  2WDV A;  2ODU A;  4COF A;  4K0U A;  2W62 A;  3HA4 A;  3UFG A;  3K3N A;  1WR6 A;  4UVA B;  5EK2 A;  1MMG A;  1D1B A;  2G0U A;  1O3X A;  2YU2 A;  4JI2 T;  4LFA T;  3T1H T;  4JI5 T;  2DL1 A;  4H63 H;  1GQE A;  4HFD A;  3B13 A;  4AQG A;  5LGU B;  2PG8 A;  4X65 T;  4TX5 A;  4IST A;  5HWY A;  3NRY A;  1E7P A;  3RYH E;  3PUW F;  4MBQ A;  4TUY E;  3GN5 A;  3N9N A;  5LG4 A;  4HEA A;  3IBP A;  4KMC A;  5LHI B;  3ZYM A;  4IE6 A;  3PTR B;  3FBL A;  3RX6 A;  2LSJ A;  5FY0 A;  3ZMS B;  4DV2 T;  3UT5 E;  4U72 A;  2WS3 A;  2N9D A;  4AQY T;  2B76 A;  5ABE A;  3A8Y C;  1KK7 A;  4ZS2 A;  2E9X A;  3MK7 C;  3NBX X;  4DUZ T;  3AA1 B;  1OED B;  3AA0 B;  2ACZ A;  3EDU A;  3BQL A;  4ILA A;  4I0U A;  4TV9 E;  2VAS A;  1JNR A;  2QVA A;  2XJ7 A;  4ZI3 C;  1H7C A;  1KNP A;  4A5X A;  4YJ3 E;  4CI1 B;  3IEE A;  4L5G A;  3N9M A;  4JI8 T;  5L3C B;  4JYA T;  5JDH A;  2E5V A;  2BG9 B;  3V5S A;  1SUM B;  3N2G E;  3N2O A;  3K3O A;  2W2U A;  3QUJ A;  1WYC A;  3MKD A;  2CLY B;  4KX6 A;  5FP3 A;  2YDS A;  3NKZ A;  1ZEE A;  2V6Y A;  4LML A;  4WZX A;  1T72 A;  3NZQ A;  3OYZ A;  2FJE A;  4DBQ A;  3ZC1 A;  3ZJ2 A;  4YY3 T;  2CBI A;  2FJD A;  4O4I E;  2KWH A;  2PJQ A;  3B5M A;  1WYB A;  1T7S A;  4GK5 E;  3LK4 2;  3AE2 A;  2WWU A;  2Q9Q C;  3P4S A;  1CUN A;  2WSS V;  1HTJ F;  2XM2 A;  5AQI B;  1WLX A;  3ZT5 A;  2VUR A;  3HI2 A;  2KSR A;  5H6R B;  3R84 B;  2XQ8 A;  1XDO A;  2LKH A;  2LSG A;  3GA8 A;  5C8Y E;  4OYJ A;  1M7K A;  1KNZ A;  3OJA A;  2JQQ A;  4DND A;  2LHN A;  3B57 A;  4YJ2 E;  3AE8 A;  4A97 A;  2W0G A;  1HCI A;  3CQC B;  5JVD E;  3EHZ A;  4B3S T;  2XQ3 A;  3AE1 A;  3R6N A;  3ANW B;  3C98 B;  4PK6 A;  2VQF T;  1Z0P A;  1YKH B;  2KXP B;  3AE7 A;  2MPK A;  3G06 A;  3OPC A;  4DV7 T;  5LMN T;  5HWX A;  2WM9 A;  2WQY A;  1V9D A;  3SRZ A;  2HH7 A;  3EAB A;  1G73 A;  3FHN A;  3ONL C;  1CHU A;  3AE6 A;  4UEM A;  1SHZ C;  3ZC0 A;  3AA7 B;  3JC6 C;  3H3A A;  2KLQ A;  3TLV A;  2UUA T;  2WMO A;  2EHO A;  2W61 A;  3FZK B;  4B3T T;  4JV5 T;  1KNR A;  3JAD A;  3ZMV B;  1D0Y A;  3F2E A;  4G2A A;  2V1D B;  2E8I A;  5E0O A;  3NWI A;  5LCY A;  3AE4 A;  2CA5 A;  2K24 A;  1MMA A;  4HN9 A;  2KZ7 B;  2J47 A;  4ILB A;  3VRB A;  4UXN B;  4LFC T;  4GYS A;  1US7 B;  2CBJ A;  5JR9 C;  2LSI A;  4GKJ T;  2BVM A;  4LF6 T;  4EZH A;  4LMJ A;  2A2F X;  3BQI A;  3T1Y T;  3ZJ1 A;  3KBT A;  1YD8 G;  4XZC A;  5J2T E;  5HXH A;  3X1D A;  4LF5 T;  3AE3 A;  2J1D G;  2C5J A;  1XWM A;  2MAW A;  4I50 E;  2E9X C;  1YQ4 A;  3ZYK A;  3RLF F;  3CML A;  3RIU A;  2X0L B;  2YDQ A;  1NWM X;  4KUM B;  2W00 A;  4G63 A;  2CWO A;  1W9R A;  1D0X A;  2P9B A;  2SPC A;  2VWA A;  5LB7 B;  2A72 A;  2LT3 A;  3RHW A;  1UGO A;  5TAO A;  3HKD E;  3FBZ A;  3S4U A;  2XAG B;  2V7K A;  1XMQ T;  4JEU B;  2JQK A;  5A1L A;  4H9N C;  5F3J A;  5JRC B;  3MAC A;  2I0M A;  3RF1 A;  2ZM6 T;  4AXP A;  4KI0 F;  5IYZ E;  3AXJ A;  2GK9 A;  4H9P C;  2QYW A;  4HFV A;  3O1J A;  3Q5X A;  3JCF A;  4HE8 A;  2D0T A;  4LF8 T;  2FUP A;  4ZXL A;  3L8R A;  5FL0 A;  1NEN A;  2H89 A;  2V26 A;  1ZHC A;  1M62 A;  5FYM A;  2D9D A;  5AQK B;  1AJ3 A;  1MIY A;  3CK6 A;  5HCM A;  4DID B;  4HFB A;  4BJN A;  2JJ9 A;  1UK5 A;  2X9Y A;  1FIO A;  4EV6 A;  2XAJ B;  4ZI2 C;  4QXH B;  3ZYL A;  4O4J E;  3QC9 A;  4EOZ B;  5LMU T;  2LE8 A;  5LBQ B;  4GIW A;  2X9W A;  2YIN A;  4L9I A;  2BKP A;  4ZZB A;  5FNV E;  1KFY A;  5HEH A;  3ZST A;  2VKJ A;  2XQ4 A;  2LHR A;  1UX4 A;  2LSY A;  3ZKR A;  5BMV E;  1IBM T;  2ACX A;  4OYK A;  3UU3 A;  2QA7 A;  5DQW A;  3BQK A;  4X64 T;  2DCF A;  5FY1 A;  2UUC T;  3RQU A;  2R6G F;  2JRK A;  2DLR A;  5ABF B;  3H3M A;  3ZMZ B;  2W4X A;  4U7Y A;  2LOP A;  3K8P C;  2AE9 A;  3TLW A;  3HKE E;  4PFO A;  3ESL A;  2EHO C;  2PBI A;  5AQP B;  2K9A A;  4IE4 A;  4WYV A;  4YTP A;  5FKY A;  3PJA A;  1IBK T;  1LVF A;  2XQ9 A;  3IA3 A;  2CXL A;  5J2U E;  3EDV A;  3AED A;  2BS3 A;  3KBU A;  4PAG A;  5HXC A;  1XDP A;  4DR6 T;  4TN7 B;  4OK0 A;  2CRB A;  5EK3 A;  2E5L T;  3LBX B;  3CQX C;  3ZCJ A;  5CB4 E;  3FZF B;  4I55 E;  4HWI B;  2V7I A;  5LOV E;  3ZN1 B;  2KND A;  3P4P A;  5JQG E;  2RA1 A;  5IWA T;  5C2T A;  4ILC A;  4NPP A;  2KT9 A;  3LFM A;  5FY7 A;  3AB3 B;  4ZI3 D;  1ZP0 A;  4OHF A;  2WZI A;  3RIU C;  5LXT E;  3C51 A;  2V7M A;  3PUY F;  2HPL A;  3T8O A;  2K5B B;  2CXF A;  3Q5W A;  2XTL A;  1FMW A;  4PFP A;  2C5I T;  3N9Q A;  2J62 A;  4TWH A;  5J0Z A;  4HFC A;  3FZH B;  4Z8X A;  3PJA J;  3EVY A;  3I0O A;  4DV4 T;  2WDR A;  3Q5D A;  5JR9 A;  4TV8 E;  3GWH A;  2JMH A;  4EZ4 A;  3BK9 A;  3N9L A;  3CKD A;  3RC3 A;  3VHL A;  3NZP A;  1S94 A;  3JAE A;  3ZT6 A;  2Q9Q D;  2LM2 A;  5LGT B;  4ISS A;  1B7T A;  5LA6 E;  5FXZ A;  2FJA A;  4CZZ B;  2M6B A;  4MFR A;  3LK3 B;  2IW5 B;  2LM9 A;  2HN1 A;  3FZL B;  3LDQ B;  1EZ3 A;  4UR9 A;  4CN4 A;  3EUH A;  2BKO A;  2LRK A;  1FMV A;  4UVB B;  3RPU A;  2MTQ A;  2CHN A;  1D1C A;  2JMK A;  2Y48 B;  2V7J A;  2Q9Q B;  3AEF A;  1ZV4 X;  1MMN A;  5JDG A;  4YFS A;  5JRE A;  3SWH A;  1NEK A;  4FJO A;  4IE7 A;  3SS1 A;  1HFA A;  2LRL A;  1YXR A;  2RP4 A;  2E2A A;  4ASK A;  3VRA A;  5HAX A;  4DV5 T;  4QH4 A;  5KMG P;  4JI7 T;  4H63 V;  4CI3 B;  4GKK T;  5JDF A;  2WDQ A;  1MIW A;  3N9O A;  1OED C;  3JC6 D;  5HXS A;  2CXD A;  2VVS A;  3FXD B;  5FXX A;  3DP7 A;  4GOU A;  1HNW T;  5EZY E;  2ES0 A;  3LK2 B;  4V1A v;  2A3D A;  5JDL A;  4U3C A;  4NUV A;  2ZM0 A;  2JQH A;  2IML A;  2IIU A;  2X0Y A;  3ZLI A;  1VOM A;  4HWC A;  4IDN A;  1KEY A;  2BDE A;  3VR9 A;  4LFB T;  2N2N A;  4B3R T;  3MA9 A;  1R8I A;  2H7V C;  5LNK A;  5JDM A;  4H9Q C;  4U31 A;  4UF0 A;  1LVK A;  3J7Y q;  4F6R C;  4DO0 A;  5AQN B;  1WR0 A;  5FMN A;  2AXD S;  3QK6 A;  1DU2 A;  3M3Z B;  5AQH B;  3N5L A;  3I9Y A;  2PFV A;  3A7M A;  1G8X A;  3GN5 B;  4DR2 T;  2E9X D;  3L09 A;  2UXN B;  3RKO A;  3UTK A;  2IUB A;  4F8H A;  2V5C A;  3A5X A;  2D2S A;  3JAF A;  4ZOL E;  2UXC T;  4O4L E;  2FBW A;  1D0Z A;  1IZN B;  1VCT A;  1OWA A;  3PUQ A;  4HKA A;  5HXR A;  1OED E;  5AQR B;  4EEB A;  2E9X B;  4P1N A;  4HFI A;  2LOS A;  2W67 A;  4LMK A;  2VKD A;  5LJM A;  2XQ6 A;  1VCS A;  2N1G A;  3K3Q C;  2F4V T;  1S35 A;  1U4Q A;  2UXD T;  2H3R A;  4ZZC A;  2L8K A;  3PU3 A;  2WU2 A;  5L3D B;  2BG9 E;  3J9X 1;  4YT0 A;  3KDS E;  4JEH B;  4UV9 B;  4X66 T;  2I6H A;  3ZEF B;  1UUS A;  1FEW A;  5AQQ B;  2V8S V;  5M4Y A;  3LJC A;  4L0R A;  5L47 A;  4DV6 T;  4AQF A;  1JNZ A;  4O4H E;  2K48 A;  2V6Y B;  1KF6 A;  5HXE A;  2J4G A;  4YSX A;  1T8B A;  4EXT A;  3RIF A;  1ZKE A;  4CN1 A;  2X66 A;  3PUS A;  4ZI2 D;  2A9U A;  3AEB A;  3WAK A;  4IDP A;  4LF9 T;  5GON E;  3PUG A;  2ZM8 A;  1I6Z A;  4PJJ A;  4TNV A;  4U33 A;  5AQO B;  5L3B B;  4CXY A;  1IJ6 A;  2JPF A;  3RI5 A;  2VB6 A;  3UUM A;  4EYY R;  1QLB A;  4TZ4 C;  5LP6 E;  3SFD A;  3RIA A;  3UU8 A;  3P7I A;  4IDQ A;  4TNW A;  4HWD A;  1HG2 A;  2CCQ A;  3KV4 A;  2BS4 A;  2XSA A;  3IF8 B;  2NW8 A;  4AKG A;  4CI2 B;  2XQY A;  3CVR A;  3O9X A;  5AQS B;  5AQL B;  3OKQ A;  3PV0 F;  2OA5 A;  2Y8D A;  2H88 A;  3AAE B;  4O2B E;  4ADZ A;  5KDM C;  3EI0 A;  3RKG A;  2EHO D;  1N33 T;  4ILU A;  4NXM T;  2MOZ A;  2ODV A;  4HTE A;  1Y01 A;  4DR5 T;  2WBL A;  2UUB T;  1HX8 A;  1MNE A;  5FXW A;  4KP3 C;  1SE7 A;  4NUU A;  4CQI A;  3C4W A;  1MND A;  5EK4 A;  1BR0 A;  3IHR A;  2CWY A;  3F31 A;  4DV0 T;  1HR0 T;  3UUL A;  3P4R A;  3OVU A;  2X67 A;  3PUX F;  1IJ5 A;  2EHO B;  5C3J A;  3L3P A;  2CEA A;  1XNR T;  4LF7 T;  5CJ5 A;  4N78 D;  2DI4 A;  4TWF A;  3P50 A;  1I94 T;  5L3E B;  1IBL T;  4PK5 A;  3TLT A;  5DQV A;  2VQE T;  3WAJ A;  1OED A;  3LG7 A;  1BR1 A;  2QGS A;  4DR3 T;  4JI1 T;  4QX7 B;  2YOE A;  5J1G A;  3VKG A;  3HR0 A;  3AE9 A;  3OBV E;  4PW8 A;  4B6X A;  3TKL B;  4ZI7 E;  3I0Q A;  3WI3 A;  5IHY A;  2WAU A;  2V6X A;  4YSZ A;  3F57 A;  2VKH A;  2BG9 A;  5HEO A;  4IHJ E;  4HWH A;  2CM0 A;  3N2K E;  1WRD A;  4EB6 E;  4KBM B;  3UUB A;  4O2A E;  3ZPO A;  3MZK B;  2FJB A;  4EAH A;  3Q5E A;  4AKI A;  4X62 T;  5JDQ A;  2K3W A;  4IE0 A;  3M65 A;  4DUY T;  3ONJ A;  2IC9 A;  3HL6 A;  5HEJ A;  3PE0 A;  5CGM A;  5HYA A;  2WY2 A;  5AQJ B;  4AIU A;  2YU1 A;  5IUX A;  1UUR A;  4UEL A;  4WNK A;  2VL0 A;  1J5E T;  2VL8 A;  4AQF C;  3V5U A;  3UUN A;  4YXD A;  1D1A A;  3AXJ B;  1XNQ T;  3O1H A;  5L3G B;  3TLS A;  5JTG A;  4YTM A;  2D0U A;  1YW0 A;  2M6I A;  1HS7 A;  3CX7 B;  3I1A A;  3ZCI A;  5JH7 E;  5L2L A;  4AI6 A;  1HX1 B;  4QX8 B;  4MLK A;  4IE5 A;  3ANW A;  3U78 A;  2KWI B;  3C4X A;  4JI4 T;  2HN2 A;  2W66 A;  3UU5 A;  3KVB A;  2DHR A;  1T98 A;  3KFW X;  1E2A A;  5F8P A;  3RYI E;  5LGN B;  5HEG A;  3P4Q A;  4IIJ E;  4DR1 T;  4X1K E;  2WWV A;  3Q9D A;  4IDZ A;  5CFB A;  4YLH A;  1HNZ T;  2WU5 A;  4EIW A;  4JI0 T;  4NXN T;  4DV3 T;  1LKX A;  2CMR A;  3AVR A;  4CXX A;  4QWN B;  2ZMA A;  4BAY B;  2OLT A;  3Q2M A;  3ZT7 A;  3RH3 A;  4GYR A;  3I9W A;  2V5D A;  3NRX A;  1XMO T;  3PUA A;  2NW7 A;  2ZLY A;  3ONX A;  5L4H A;  2YN6 A;  2D5U A;  4KHP T;  5ETW A;  1UX5 A;  1FJG T;  2W63 A;  3ETV A;  2WCA A;  1QSD A;  4YSY A;  3TLU A;  4ZHQ E;  2XAQ B;  4U7I A;  3P8C D;  2PTF A;  5BR8 T;  5FVK A;  2UXX B;  3UU6 A;  2BBJ A;  4P0B A;  1J1J A;  4I43 B;  3QB5 K;  1HNX T;  3QNU A;  2MYS A;  2IAK A;  5AQT B;  4IGU A;  1WCR A;  4B3M T;  2WZH A;  4OX9 T;  4EGW A;  3D0T A;  1E1H B;  4IT4 A;  4P0A A;  3KV9 A;  4E7Z A;  2XAF B;  4DMW A;  2X51 A;  3O4X E;  1XZY A;  5HCJ A;  3MXZ A;  4PK4 A;  1WFD A;  4E7S A;  4IRE A;  2HHH T;  2Y6X A;  4AKL A;  5H6Q B;  2HPJ A;  2X9X A;  4ERR A;  2YKS A;  3ETU A;  1Z8U A;  1ZOY A;  3FXE B;  2CE7 A;  2BBH A;  2BG9 C;  3ABV A;  1W09 A;  5JRC A;  2CLY C;  4AIS A;  3RRC A;  4FI5 A;  1N34 T;  3NVO A;  4JI3 T;  4K0K T;  4DVD A;  4MHC A;  2C5K T;  3L39 A;  5ABG A;  3QB5 A;  4IL9 A;  1OXZ A;  4YTN A;  1YKE B;  3HKB E;  4LF4 T;  2VKO A;  5JDN A;  5LYJ E;  4BA9 A;  5JR9 B;  3QOF A;  2JQ9 A;  2BS2 A;  4IL4 A;  4ZEY A;  3PUZ F;  3RQW A;  3VU7 H;  4DV1 T;  2BVL A;  1N36 T;  5LHG B;  2OV9 A;  2ZM2 A;  4X20 E;  3KV5 A;  3AAI A; 
#chains in the Genus database with same CATH homology
 1H7C A;  4CXW A;  4TN7 B;  4YJ3 E;  4OK0 A;  1UCU A;  4O2B E;  4ADZ A;  5KDM C;  5EK3 A;  3RYC E;  3LBX B;  3CQX C;  4CI1 B;  3IEE A;  4L5G A;  3N9M A;  3ZCJ A;  5CB4 E;  4P09 A;  3UFE A;  5L3C B;  4WBN E;  1HF8 A;  4I55 E;  5JDH A;  2X9H A;  3SOL A;  2V7I A;  5LOV E;  3ZN1 B;  3RC8 A;  2KND A;  2DWK A;  3V5S A;  4OFZ A;  4PJL A;  3N2G E;  1Y64 B;  2EHO D;  3N2O A;  3K3O A;  4ILU A;  3QUJ A;  4QKN A;  5JQG E;  1WYC A;  3MKD A;  2RA1 A;  2MOZ A;  2CLY B;  3C50 A;  3HKC E;  5FP3 A;  2ODV A;  4HTE A;  1MMD A;  4C90 A;  4ANJ A;  5ADX L;  3KIN B;  1ZEE A;  2WBL A;  5CA1 E;  3N9P A;  1HX8 A;  1MNE A;  5FXW A;  4KP3 C;  2VK9 A;  4NUU A;  4UVC B;  3NZQ A;  2KT9 A;  3LFM A;  4CQI A;  5FY7 A;  3C4W A;  3AB3 B;  1MND A;  5EK4 A;  4ZI3 D;  1BR0 A;  3OYZ A;  4DBQ A;  4I4T E;  3IHR A;  3ZC1 A;  3ZJ2 A;  2CWY A;  3F31 A;  4OHF A;  3UUL A;  4O4I E;  2MBG A;  2NTX A;  3VKH A;  5LXT E;  2KWH A;  2PJQ A;  3PUR A;  2H7O A;  3C51 A;  2NW9 A;  2X67 A;  3ZMT B;  2NWB A;  2V7M A;  4UV8 B;  1IJ5 A;  2HPL A;  3UUX B;  3T8O A;  1WYB A;  2K5B B;  2EHO B;  2CXF A;  3L3P A;  3Q5W A;  4GK5 E;  2XTL A;  3C64 A;  2CEA A;  3LK4 2;  1FMW A;  2WWU A;  4PFP A;  4DMV A;  2Q9Q C;  4N78 D;  5LHH B;  1CUN A;  2C5I T;  2WSS V;  1HTJ F;  2DI4 A;  3N9Q A;  3E08 A;  4WW0 A;  1QUU A;  2YK0 A;  4Z8X A;  1WLX A;  3EVY A;  3GMI A;  5L3E B;  3I0O A;  4PK5 A;  3HI2 A;  3U3I A;  5H6R B;  3R84 B;  4H9S E;  5DQV A;  3WAJ A;  5JR9 A;  4TV8 E;  3LG7 A;  3CX6 B;  3GWH A;  2JMH A;  4EZ4 A;  1BR1 A;  2QGS A;  2LSG A;  3BK9 A;  3GA8 A;  3O1I A;  4XAX B;  4DBR A;  5C8Y E;  4OYJ A;  4QX7 B;  3N9L A;  3CKD A;  1KNZ A;  3OJA A;  3RC3 A;  4PNI A;  5J1G A;  3VHL A;  3VKG A;  2JQQ A;  2LJL A;  4DND A;  3HR0 A;  4WBO A;  4PJM A;  2LHN A;  1IAP A;  3B57 A;  3OBV E;  4YJ2 E;  2Z6E A;  4PW8 A;  2W0G A;  1HCI A;  3CQC B;  4O8S A;  4B6X A;  3NZP A;  5JVD E;  3ZN0 B;  3TKL B;  1S94 A;  3E0Z A;  3R6N A;  4ZI7 E;  2Q9Q D;  3I0Q A;  5LGT B;  3LBX A;  4ISS A;  3ANW B;  3WI3 A;  3C98 B;  4GK0 E;  4PK6 A;  5IHY A;  1B7T A;  5LA6 E;  4M1P A;  3DTO A;  1Z0P A;  2DWG A;  2WAU A;  1YKH B;  2KXP B;  5FXZ A;  3F57 A;  4CZZ B;  2LEH A;  2VKH A;  4MFR A;  5DJQ C;  3LK3 B;  2IW5 B;  2LM9 A;  4IHJ E;  3E22 E;  2C0S A;  2CM0 A;  3CQG B;  3N2K E;  3H37 A;  1WRD A;  4EB6 E;  4KBM B;  1EZ3 A;  3ZPO A;  4O2A E;  5HWX A;  3MZK B;  3EUH A;  4JUY A;  4EYU A;  2WM9 A;  1V9D A;  4EAH A;  5L3F B;  3SRZ A;  3C4Z A;  2HH7 A;  4AKI A;  3PU8 A;  1FMV A;  4UVB B;  5JDQ A;  3RPU A;  1U5P A;  4UF0 B;  4IE0 A;  1G73 A;  2MTQ A;  3FHN A;  4BJM A;  1D1C A;  2JMK A;  3M65 A;  2Y48 B;  2V7J A;  4XBF B;  3ZMU B;  2Q9Q B;  2IC9 A;  5FXV A;  1ZV4 X;  2YEV C;  3HL6 A;  4UEM A;  4H9R C;  1MMN A;  3CX8 B;  2KMF A;  3PE0 A;  1SHZ C;  5HYA A;  3ZC0 A;  3AA7 B;  3JC6 C;  5JDG A;  4J2C A;  3H3A A;  4YFS A;  5JRE A;  2KLQ A;  3SWH A;  2YU1 A;  2WMO A;  2EHO A;  2W61 A;  4UEL A;  4WNK A;  4FJO A;  4IE7 A;  4H9O C;  3SS1 A;  1HFA A;  1HG5 A;  4HGA A;  4QXC B;  3ZMV B;  1D0Y A;  2VL8 A;  3F2E A;  4AQF C;  4G2A A;  2RP4 A;  2V1D B;  2E8I A;  5LBM A;  2L9Q A;  3V5U A;  3UUN A;  2XAH B;  4ASK A;  5E0O A;  1D1A A;  5LCY A;  1VRB A;  4U74 A;  3O1H A;  2CA5 A;  2K24 A;  4X1Y E;  5HAX A;  4JLE A;  1LRZ A;  4X1I E;  5L3G B;  1MMA A;  5KMG P;  1SA0 E;  4HN9 A;  2KZ7 B;  1BR2 A;  2XAS B;  3AA6 B;  4UXN B;  4H63 V;  4CI3 B;  2D0U A;  4ZS3 A;  1YW0 A;  4GYS A;  5JDF A;  1US7 B;  1HS7 A;  3CX7 B;  1MIW A;  4A56 A;  3I1A A;  4MAL A;  5JR9 C;  3N9O A;  3JC6 D;  2LSI A;  5HXS A;  2BVM A;  3KV6 A;  3ZCI A;  4EZH A;  2CXD A;  5JH7 E;  3FXD B;  5L2L A;  2IC6 A;  5FXX A;  2A2F X;  2NOX A;  4AI6 A;  3DP7 A;  5LJN A;  4GOU A;  3RYF E;  3BQI A;  3ZJ1 A;  1X79 A;  5EZY E;  2ES0 A;  3CWZ B;  3KBT A;  3LK2 B;  4V1A v;  1YD8 G;  2A3D A;  4QX8 B;  4XZC A;  5J2T E;  5HXH A;  4C91 A;  2L3L A;  4MLK A;  4IE5 A;  3ANW A;  3U78 A;  3C4X A;  2KWI B;  5JDL A;  4NUV A;  2ZM0 A;  2DHR A;  3KVB A;  2J1D G;  2C5J A;  1T98 A;  3KFW X;  1MIV A;  3MJX A;  3W15 B;  1VOM A;  3ZLI A;  3DJB A;  4UIG A;  4I50 E;  2E9X C;  5F8P A;  2BDE A;  3RYI E;  5LGN B;  3ZYK A;  2M67 A;  2N2N A;  3MA9 A;  3CML A;  4IIJ E;  2H7V C;  2X0L B;  2LSK A;  3FB2 A;  4X1K E;  5LNK A;  3Q9D A;  4IDZ A;  1NWM X;  4AKR B;  5JDM A;  4H9Q C;  4KUM B;  2WMN A;  4AKH A;  2W00 A;  4YLH A;  4G63 A;  4UF0 A;  4EIW A;  1LVK A;  3J7Y q;  2CWO A;  2X68 A;  4F6R C;  4YHJ A;  1D0X A;  2P9B A;  5CA0 E;  1LKX A;  4DO0 A;  2CMR A;  2SPC A;  2VWA A;  2NTY A;  5FMN A;  3AVR A;  2A72 A;  4CXX A;  2Q9Q A;  3AAA B;  4QWN B;  2BZB A;  2ZMA A;  2LT3 A;  3QK6 A;  4BAY B;  3Q2M A;  3N5L A;  5TAO A;  3I9Y A;  3HKD E;  3FBZ A;  2PFV A;  3S4U A;  3RH3 A;  5KX5 E;  4GYR A;  3I9W A;  1G8X A;  2KIN B;  2V7K A;  2XAG B;  4QXB B;  3GN5 B;  3NRX A;  2XUE A;  2DNX A;  4JEU B;  2E9X D;  2I59 A;  3PUA A;  4PJN A;  2NW7 A;  3L09 A;  5A1L A;  2B1E A;  2XHE B;  2ZLY A;  4H9N C;  2UXN B;  5F3J A;  5JRC B;  3MAC A;  3KVA A;  3RKO A;  3ONX A;  3UTK A;  5AFU L;  1NAF A;  3RRW A;  1BR4 A;  3AVS A;  4AXP A;  3A5X A;  2D5U A;  3CPZ A;  2D2S A;  4ZOL E;  2GK9 A;  4H9P C;  5ETW A;  5IYZ E;  4O4L E;  1UX5 A;  3OYX A;  1D0Z A;  4QHO A;  2W63 A;  4HFV A;  3ETV A;  3O1J A;  3Q5X A;  1QSD A;  4HE8 A;  1IZN B;  2D0T A;  5DAB A;  4ZHQ E;  1OWA A;  2XAQ B;  3PUQ A;  4HKA A;  2V26 A;  5HXR A;  1ZHC A;  5FYM A;  3P8C D;  2V7L A;  2E9X B;  3PDY A;  1AJ3 A;  2LOS A;  2UXX B;  1MIY A;  2NP9 A;  2ODU A;  4P0B A;  4I43 B;  2VKD A;  4K0U A;  2W62 A;  4BJN A;  5LJM A;  2MYS A;  3HA4 A;  2JJ9 A;  2IAK A;  2N1G A;  3K3Q C;  3K3N A;  2X9Y A;  1S35 A;  4IGU A;  1FIO A;  1WR6 A;  4UVA B;  1U4Q A;  2XAJ B;  5EK2 A;  1MMG A;  1D1B A;  4ZI2 C;  3D0T A;  4QXH B;  2H3R A;  3ZYL A;  1E1H B;  4O4J E;  3QC9 A;  4EOZ B;  2L8K A;  2G0U A;  3PU3 A;  5L3D B;  1O3X A;  2LE8 A;  2YU2 A;  3J9X 1;  3KV9 A;  4P0A A;  5LBQ B;  3KDS E;  4E7Z A;  4GIW A;  4JEH B;  4UV9 B;  2XAF B;  4DMW A;  2X51 A;  3O4X E;  2X9W A;  4H63 H;  3ZEF B;  2YIN A;  1FEW A;  3MXZ A;  4L9I A;  4PK4 A;  5FNV E;  4E7S A;  3B13 A;  5M4Y A;  4AQG A;  3LJC A;  4L0R A;  2Y6X A;  5LGU B;  2PG8 A;  4AKL A;  5H6Q B;  4AQF A;  2VKJ A;  2HPJ A;  2X9X A;  4ERR A;  2LHR A;  4O4H E;  2K48 A;  1UX4 A;  4TX5 A;  4IST A;  2LSY A;  5HWY A;  3NRY A;  5HXE A;  5BMV E;  2ACX A;  3ETU A;  3RYH E;  4MBQ A;  4TUY E;  4OYK A;  3FXE B;  2CE7 A;  4EXT A;  1ZKE A;  3GN5 A;  3N9N A;  5LG4 A;  4HEA A;  3IBP A;  2X66 A;  2QA7 A;  3PUS A;  5DQW A;  4ZI2 D;  3BQK A;  5JRC A;  4KMC A;  5LHI B;  3ZYM A;  2DCF A;  5FY1 A;  3WAK A;  2CLY C;  5GON E;  4IE6 A;  3PTR B;  3FBL A;  3RX6 A;  3RRC A;  4FI5 A;  3PUG A;  2LSJ A;  2ZM8 A;  4DVD A;  4PJJ A;  4MHC A;  5FY0 A;  3ZMS B;  2C5K T;  3UT5 E;  2JRK A;  2DLR A;  3ZMZ B;  5L3B B;  4CXY A;  1IJ6 A;  2JPF A;  2VB6 A;  3UUM A;  2LOP A;  3K8P C;  4EYY R;  4U72 A;  1OXZ A;  2N9D A;  4TZ4 C;  3HKE E;  5LP6 E;  4PFO A;  1YKE B;  3HKB E;  2VKO A;  1KK7 A;  3ESL A;  3P7I A;  4ZS2 A;  2E9X A;  5JDN A;  3MK7 C;  2EHO C;  3NBX X;  4BA9 A;  3AA1 B;  5LYJ E;  5JR9 B;  2PBI A;  2K9A A;  1HG2 A;  2CCQ A;  3KV4 A;  4IE4 A;  3AA0 B;  3EDU A;  2NW8 A;  3IF8 B;  4AKG A;  4CI2 B;  3BQL A;  1LVF A;  2CXL A;  5J2U E;  2XQY A;  3EDV A;  3CVR A;  3O9X A;  3VU7 H;  3KBU A;  4TV9 E;  2VAS A;  4PAG A;  2BVL A;  5LHG B;  5HXC A;  2OA5 A;  2Y8D A;  3OKQ A;  2ZM2 A;  4X20 E;  3AAE B;  3KV5 A;  3AAI A;  4ZI3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...