5JR9A

Crystal structure of apo-nec3po
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
188
structure length
188
Chain Sequence
b'RGSMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEQ131
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
total genus 82
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jr9A00
5JR9C 3ZC0A 5JRCB 5JRCA 3ZC1A 5JREA 5JR9B 5JR9A
chains in the Genus database with same CATH superfamily
3PUZF 3T8OA 2YINA 4PJLA 4TV9E 3VRBA 3FZHB 4HFCA 2D0TA 3ZC1A 3N9OA 2B76A 2X0LB 4IDQA 2XPKA 1Z8UA 1KNPA 1X79A 2YN6A 2AXDS 2XAGB 5IYZE 3BQKA 4IDNA 1D0YA 1KEYA 2J1DG 2PJQA 5ABFA 1QUUA 4CN1A 3QC9A 5L3CB 4YLHA 3JAFA 4UVCB 4YJ3E 3AEBA 2WU5A 1KF6A 3RKOA 2BKOA 3VKHA 5AQTB 3H3MA 3TKLB 3RHWA 1HNZT 2VL8A 3Q5WA 4B3RT 3OKQA 4O8SA 4K0UA 4EXTA 4WW0A 4O4LE 5LG3A 3ZCJA 4TNVA 4XAXB 2VK9A 2WY2A 3LSVA 1SA0E 3NWIA 4NXNT 2I59A 3P4SA 2CPTA 2XM1A 5HXCA 4GK0E 3VR8A 4MLKA 5FVLA 2JRKA 1FMWA 3RX6A 2BG9B 2C0SA 4AIUA 3ETUA 4X5TA 5M4YA 3RRWA 4JYAT 4LF7T 4IGUA 2X9XA 4O4JE 1HX1B 4ZZCA 4UV8B 4IE0A 4HWCA 5CB4E 2FUPA 1U5PA 2XQ5A 3AA7B 3ZMUB 4YTPA 1S35A 4EZHA 2VB6A 3UUMA 4DV0T 3HA4A 1MNDA 2H7VC 3N9LA 1IBKT 4CXXA 2CBJA 3V5SA 2WP9A 3NKZA 5JDFA 3K8PC 2VWAA 2UXCT 3UU8A 1IJ5A 2W4XA 4PK6A 2NW9A 5KMGP 4HFVA 4DV3T 4AI6A 3IHRA 5LGTB 4QH1A 3UFEA 2W2UA 1MIWA 3FZLB 4EYYR 3MJXA 4YHHT 4AQYT 2PTFA 5JH7E 5LCYA 3ZN0B 3A7MA 2FJBA 4A97A 1CHUA 2UUCT 4X1YE 4HFEA 4E7ZA 4IL4A 4DR1T 2CA5A 1DU2A 2V5CA 3MA9A 3RC3A 4DV4T 3LK2B 2BVMA 2BS4A 4O4HE 4UV9B 4ZHQE 4DR4T 4PAGA 3D0TA 3W15B 4P1NA 5CGMA 2X67A 4F8HA 1KNZA 3ZSSA 2BBHA 4Z91A 4PK5A 1EZ3A 3SOLA 2XQ6A 3AVSA 3SRZA 1LVFA 2V7KA 4IE6A 5C3JA 3LJCA 3L3PA 2UXDT 3AA6B 2XAJB 5LGUB 4IREA 3AXJB 2BG9E 2CHNA 2V6YB 5JRCA 3OTOT 4LMKA 5FY1A 2VASA 2W66A 3PDYA 4EB6E 3QNUA 5AFUL 3GA8A 2V6XA 3RQWA 3EUHA 5AQSB 5LBQB 2ZM2A 4C91A 1B7TA 2BG9C 2WBLA 2W63A 4K0KT 4AQFC 3ZMSB 1NWMX 4OK0A 1YQ3A 3TLSA 1HTJF 3FXEB 5JQGE 4LF9T 1XMOT 3AEEA 2RP4A 4EZ4A 4L9IA 2W61A 5LOVE 2V8SV 3TLWA 4DBRA 3RRCA 3KINB 4HTEA 3IF8B 4A5XA 1XNQT 4PFPA 2VL0A 2VURA 3FZMB 2ES0A 3AE5A 1US7B 5H6RB 2AE9A 3H37A 1UUSA 3V5UA 1IBLT 4P09A 1Z0PA 4BA9A 3TLUA 1YKEB 3B5MA 4LF4T 2LOSA 3PU3A 1HCIA 2L9QA 5ABEA 4U33A 4DUYT 1FIOA 3ZT6A 4KBMB 3ZMVB 3ZLIA 2ODVA 2WAUA 1XMQT 3OYXA 4JI0T 3CQXC 2IDOB 3ZT5A 2NTYA 2A2FX 2XY8B 1FEWA 4O2BE 2J62A 3IA3A 5EK2A 2BZBA 3RIUC 2IW5B 4ILCA 3H3AA 5LA6E 5FMNA 5L3EB 2LHNA 3ESLA 3T1YT 1QLBA 3I0OA 5AQPB 2NW7A 3RIAA 1I94T 3AE6A 2LHRA 2QGSA 2XJ7A 2E8IA 3VRAA 4NUVA 3UU4A 2L8KA 3KV4A 4JLEA 2D2SA 2YDRA 2V1DB 4GYSA 2KSRA 2P9BA 3Q9DA 1W09A 1WYBA 2KXPB 2LM2A 2XQAA 1OEDB 5EK4A 3RC8A 3J9X1 2M67A 2BG9A 5DJQC 3CX7B 4YFSA 2A72A 3ZYKA 2JIWA 3Q5DA 4AQFA 4PJNA 4LF5T 2G0UA 5JDHA 2F4VT 2ODUA 4UVAB 4TNWA 3ANWB 2UXXB 3LFMA 4LF6T 4P0BA 4EOZB 4JI5T 5AQNB 4IHJE 1BR4A 2BKNA 2LEHA 3GMIA 3IEEA 3MKDA 2W0GA 2CCQA 4WYVA 4HWFA 3C4XA 3ZJ2A 2VVSA 3DJBA 3MACA 3OVUA 3GN5A 1MIYA 2WU2A 2NP9A 3U3IA 1D0XA 3PJAA 2GK9A 4BJNA 2XM2A 3AE2A 1XWMA 2C5JA 3Q5EA 5JDNA 2V7IA 3AE8A 1HG5A 3HR0A 1HX8A 5FVKA 2CEAA 4HFIA 5ADXL 1NENA 4QH4A 3AAAB 4YSXA 2FJEA 5AQIB 5F5WA 2XTLA 4E7SA 4DR3T 3CX8B 3RIUA 4EEDA 3C50A 4IE5A 4TWHA 4DIDB 3JADA 3ONLC 3N2OA 5LNKA 3OBVE 2XASB 4XBFB 4U2ZA 4YXDA 5HEUA 4CN6A 4X62T 4LFCT 3KVBA 2V5DA 4HWHA 3Q2MA 2XQ8A 4ZI3C 2XQ4A 3ZC0A 3BQIA 4P0AA 1D1BA 1OEDE 3AB3B 5HEGA 4YY3T 2C5KT 4F6RC 3AXJA 1IJ6A 2V6YA 5H6QB 1J1JA 2DI4A 5FL0A 2YDQA 1OEDC 4N78D 3DP7A 3M3ZB 4GKKT 5LXTE 3F57A 4DV6T 2ZMAA 4X66T 2HN1A 2KMFA 3ETVA 4LF8T 2ACXA 1UX4A 2JJ9A 4EIWA 5JDMA 4MFRA 4KUMB 2X9HA 3MZKB 1BR1A 4YJ2E 2CHOA 2NOXA 1NEKA 4BAYB 2E5LT 2HPJA 3SWHA 2E2AA 3PV0F 3EVYA 3HKCE 3B57A 3N2GE 2YEVC 3ZYMA 2W67A 4IE4A 5LYJE 2N1GA 1G8XA 2XQ3A 4H63V 2LM9A 2DCFA 2I0MA 3HKBE 3C64A 3CKDA 1W0BA 3FB2A 4H9PC 3LBXB 3UULA 4IE7A 1E7PA 1VRBA 3S4UA 4HWDA 4CI2B 3AA1B 4ZOLE 2KWHA 4CN4A 4BJMA 5JDQA 5KXJA 2LSJA 5AQGB 1HNXT 4H9QC 3GWHA 5ETWA 2Z6EA 4TN7B 3WAJA 1OWAA 5L4EA 5JVDE 3FZFB 4B3TT 4IDOA 3GN5B 5E0OA 2UXNB 5AQMB 4CI3B 2W00A 3RYFE 3RH3A 4J2CA 3CWZB 2XQ7A 3F2EA 1HR0T 4AKRB 2BS3A 4U7YA 1XZYA 4H63H 3L39A 3CX6B 3HL6A 4HFDA 5IWAT 4OHFA 5EK3A 3R84B 2V7JA 3I1AA 3I9YA 3HKDE 4AKIA 3B13A 3LK3B 4U7IA 1UX5A 2X0HA 5FXXA 1OEDA 4IL9A 1UURA 1SHZC 3UQ4A 5LGNB 2KLQA 3RQUA 4H9SE 3A5XA 2K48A 5L3DB 4LFBT 3ONJA 2Q9QC 4HN9A 2H3RA 5JTGA 4TUYE 3VKGA 3I0QA 4G63A 4TV8E 4AQGA 5BR8T 5HAXA 1ZV4X 2KINB 2X9WA 3PUWF 3ANWA 2CWOA 3NZPA 3CQCB 4QXCB 2DLRA 2WMNA 1IBMT 3HI2A 2KNDA 2I6HA 4QX7B 4CZZB 4I4TE 4AISA 5J0ZA 3N9MA 2MPKA 4NUUA 4JI3T 5AQVB 2PFVA 3RYHE 2QVAA 2EHOB 5IUXA 1YKHB 2BS2A 4MALA 1O3XA 2ACZA 2Y8DA 1YW0A 5FYMA 3TLTA 3BK9A 2A9UA 5JDLA 3AAEB 2ZM0A 4Z90A 4DR6T 3KBTA 3F31A 4IDZA 4LMLA 3ZJ1A 2CRBA 2OV9A 4JI1T 1N33T 1D1AA 1QSDA 5IHYA 2K3WA 2WWVA 4V1Av 5AQOB 2FJDA 2D0UA 2LSKA 4TWFA 2OA5A 3AEDA 3JCFA 3RLFF 5LJNA 3UU3A 1WR0A 4DV7T 3PUAA 2H89A 4KHZF 2LRLA 1BR0A 2V7MA 4U72A 4ZI2C 5FY7A 4JEHB 2X9YA 3CVRA 2IC9A 2WDQA 4O2AE 1ZKEA 5LHIB 5JDGA 3CPZA 3E08A 3CK6A 5KX5E 3P4WA 2Q9QD 4JI4T 1HFAA 2Q9QA 5L47A 5BMVE 1MMGA 3E0ZA 2WB5A 5HXHA 4DV5T 4HFBA 4H9OC 5FXVA 1WCRA 4JUYA 1MNEA 2IAKA 3O9XA 2B1EA 3J7Yq 4QH5A 5LMNT 3L8RA 5HEJA 3SFDA 3UUBA 2IMLA 3CQGB 1D1CA 4OFZA 4B6XA 2YU2A 4ISSA 2VQET 5F8PA 2JMKA 1R8IA 3N5LA 3AE9A 1IZNB 3P4QA 2LSIA 4ZS2A 4TX5A 3PUSA 2WDRA 5KDMC 2XAQB 1WRDA 2OLTA 4H9RC 1Y01A 3VU7H 4JEUB 5LG4A 2K9AA 3A8YC 4X1KE 2JPFA 1G73A 1XDPA 1LRZA 2BBJA 2WM9A 2VKOA 5LHGB 5FL1A 2EHOC 4WZXA 3O1JA 4QKNA 1ZOYA 2M6BA 4JI8T 3KV9A 3LBXA 3RPUA 4DBQA 4ZEYA 2KT9A 2NWBA 3AVRA 4GYRA 3X1DA 4DMWA 4KP3C 1U4QA 3EABA 4XZCA 1M62A 3UFGA 2IC6A 4EYUA 3UU6A 3N9QA 4TZ4C 3AEGA 4C90A 4DMVA 3P8CD 3P50A 2HPLA 2BVLA 4ASKA 2WQYA 4JI2T 2XSBA 2BKPA 2JMHA 2K5BB 2FBWA 4U3CA 2VKHA 5F3JA 5HCMA 4YTNA 5AQFB 2CM0A 2LSYA 4B3ST 5EZYE 2DNXA 4EV6A 3K1SA 3PJAJ 3FBZA 2XAHB 2WSSV 2WWUA 3M65A 1D0ZA 3N9NA 4A98A 1LKXA 2DWKA 4NXMT 5FP3A 2WDVA 3E22E 1KFYA 4EGWA 2X0YA 3PTRB 4HGAA 4QXBB 3PUXF 1HS7A 2SPCA 3UT5E 1YD8G 3VR9A 4AXPA 2ZM8A 1JNRA 4QHOA 5HEHA 2Y48B 1XNRT 3PUQA 3N2KE 5L3BB 4JI7T 1E2AA 4AKHA 2LJLA 5TAOA 4YSYA 2K24A 5FXWA 2DHRA 3QB5A 1ZP0A 3BQLA 2NR4A 2E9XC 1BR2A 3KDSE 3AE3A 3P4RA 2E5VA 5DQWA 4I55E 3RF1A 2X51A 3UTKA 4KHPT 3P4PA 5L4HA 3MXZA 1ZEEA 4DR7T 4CQIA 5HWXA 2EHOD 2Q9QB 2J4GA 2EHOA 2LOPA 4PJMA 2YK0A 2XQYA 2BDEA 5AQQB 5J2UE 5JR9B 4I50E 4LFAT 2QRXA 4DO0A 4MHCA 2N2NA 4IT4A 4M1PA 2LT3A 4ILUA 1I6ZA 2J47A 3RYCE 2VQFT 4UF0A 2WCAA 3RKGA 2CLYC 2UUBT 5FKYA 4WNKA 1S94A 1N32T 3UQ7A 4GIWA 3NRXA 4YT0A 2XHEB 4UELA 5CFBA 3OJAA 2C5IT 3ZSTA 1T7SA 2H7OA 4ISTA 3PUGA 4U74A 1J5WA 5FY0A 4YSZA 3UUNA 1WR6A 5CJ5A 3SFEA 2XAFB 2UU9T 1WYCA 1M7KA 3JAEA 3K3QC 2WS3A 3C4ZA 5LHHB 1MMAA 3I9WA 4UVBB 3O1HA 2JQ9A 2FJAA 4GOUA 3AE7A 3DTOA 3VHLA 1KNRA 3L09A 2VKJA 4PK4A 4KMCA 4ILAA 3T1HT 5AQLB 3KFWX 1VOMA 4DVDA 4ZI3D 1UGOA 2E9XD 2E9XA 4I0UA 3AE4A 4HFHA 2YOEA 2WMOA 4X20E 3ZEFB 2CBIA 4ILBA 1HF8A 4GK5E 3ZMZB 5DABA 4O4IE 3NRYA 1N34T 2IUBA 1KK7A 4L0RA 1ZHCA 3WAKA 4ANJA 2M6IA 4CXWA 4HWIB 2CE7A 3U78A 2LRKA 4Z8XA 3C51A 3PUYF 3K3OA 4FI5A 4DV1T 4HE8A 4COFA 4PFOA 5C2TA 4YHJA 5JR9C 2Y6XA 1X9BA 1T98A 2V26A 4ZI7E 4PW8A 4U2YA 1VCSA 5ABHA 2MBGA 4CXYA 4UEMA 4Q25A 1L0VA 3QB5K 5CA1E 4NIQA 5FXZA 3KBUA 3PUVF 1H7CA 4HEAA 1SUMB 3TLVA 2CXFA 4LMJA 5LJMA 1Y64B 3NBXX 3IBPA 3ONXA 5CA0E 3AEAA 1JNZA 2X66A 4EEBA 3RIFA 4ZS3A 3ZYLA 3WI3A 5L3GB 3PE0A 5ABFB 4UR9A 5FNVE 5AQHB 2YU1A 4QXHB 4X64T 2R6GF 2JQKA 2V7LA 3UUXB 5J2TE 5LBMA 3KV6A 4KX6A 2IIUA 1N36T 2MYSA 4NPPA 4YTMA 4UF0B 3EHZA 3UU5A 1E1HB 1UK5A 5AQJB 1FJGT 2MAWA 2ZM6T 1WFDA 3OYZA 3AE1A 3NZQA 4G2AA 4CI1B 3LG7A 2D9DA 4DV2T 3RYIE 2LKHA 2XUEA 5HCJA 2HH7A 3FZKB 3OPCA 2HHHT 2YKSA 2PG8A 5L3FB 5J1GA 2N9DA 3R6NA 4B3MT 3Q5XA 3ZKRA 4ADZA 1XDOA 4KI0F 1T8BA 4ZZBA 2RA1A 3NVOA 3ZCIA 2XZEA 3ZN1B 1MMDA 4X65T 1FMVA 4ZXLA 4EAHA 1LVKA 1VCTA 5JR9A 1HG2A 4FJOA 4WBOA 1GQEA 4GKJT 3P7IA 1AJ3A 2E9XB 3RI5A 1NAFA 4TWDA 3O4XE 5HEOA 4UIGA 3AAIA 2XQ9A 2LE8A 3K3NA 5A1LA 3SS1A 2LKGA 3JC6C 5AQUB 2WZIA 4AKLA 5ABGA 2UXBT 5JREA 3ZMTB 3O1IA 3C4WA 1YXRA 3CMLA 2IHR1 1T72A 2MOZA 4DUZT 3PURA 2NW8A 1UCUA 2QA7A 4JBWF 1J5ET 1WLXA 2CWYA 3N9PA 4HKAA 3FBLA 3HKEE 2W62A 3FXDB 5HXEA 2CLYB 5L2LA 4MBQA 5AQKB 3AA0B 3LDQB 2CMRA 3QK6A 3PU8A 1MIVA 4PNIA 2VVNA 2CXDA 4QX8B 4UXNB 3C98B 4DR5T 2XSAA 4X1IE 2RPAA 2YDSA 4WBNE 1MMNA 2A3DA 2MTQA 2DWGA 4ZI2D 4A56A 1SE7A 1CUNA 4QWNB 3MK7C 1W9RA 2DL1A 2KZ7B 1W0AA 2QYWA 2CXLA 4IDPA 5GONE 4I43B 5LMUT 1IAPA 2JQHA 1OXZA 3CIRA 2ZLYA 4DR2T 4PJJA 5DQVA 4ERRA 1V9DA 2PBIA 2L3LA 2JQQA 2D5UA 5HWYA 3EAMA 3LK42 4OYKA 2KWIB 5JRCB 3KVAA 3FHNA 1HNWT 4OX9T 3G06A 5C8YE 3EDVA 2HN2A 3EI0A 2LLYA 2H88A 4DNDA 4OYJA 3AEFA 3RGLA 3ZT7A 5HYAA 3AECA 3QUJA 4H9NC 5HXRA 4U31A 4AKGA 5LB7B 2X68A 4JV5T 2WZHA 5HXSA 3KV5A 1YQ4A 2VKDA 4L5GA 5AQRB 2NTXA 3EDUA 4JI6T 3JC6D 2UUAT 3ABVA 3QOFA 4IIJE 2LSGA 3ZPOA 5LP6E
chains in the Genus database with same CATH topology
3VHLA 3L09A 2QGSA 1O3XA 3T8OA 2YINA 2E8IA 4PJLA 4TV9E 4NUVA 2L8KA 2Y8DA 3KV4A 1YW0A 2VKJA 4JLEA 4PK4A 4KMCA 5FYMA 2D0TA 3ZC1A 3N9OA 2D2SA 2V1DB 3BK9A 2X0LB 4GYSA 5JDLA 3KFWX 1VOMA 2P9BA 3Q9DA 1X79A 1WYBA 2KXPB 4DVDA 4ZI3D 2E9XD 5EK4A 3RC8A 3AAEB 2ZM0A 3J9X1 2E9XA 3KBTA 2M67A 3F31A 4IDZA 3ZJ1A 2WMOA 4X20E 2XAGB 1D1AA 3ZEFB 1QSDA 5IYZE 3BQKA 5DJQC 3CX7B 1D0YA 4YFSA 2A72A 3ZYKA 5IHYA 4V1Av 1HF8A 2D0UA 4GK5E 2J1DG 2LSKA 4PJNA 3ZMZB 2PJQA 4AQFA 2G0UA 5DABA 1QUUA 5JDHA 2OA5A 4O4IE 2ODUA 3NRYA 3QC9A 4UVAB 5L3CB 4YLHA 3ANWB 2UXXB 4UVCB 5LP6E 1KK7A 4YJ3E 3LFMA 4L0RA 1ZHCA 5LJNA 4P0BA 3WAKA 4EOZB 3PUAA 3RKOA 4IHJE 1BR0A 2V7MA 4U72A 4ZI2C 1BR4A 4ANJA 3VKHA 5FY7A 3TKLB 2LEHA 4JEHB 3GMIA 4CXWA 3IEEA 3MKDA 2W0GA 2CE7A 3U78A 2X9YA 2CCQA 4Z8XA 2VL8A 3Q5WA 3C51A 3CVRA 2IC9A 4O2AE 1ZKEA 5LHIB 5JDGA 3K3OA 4FI5A 3OKQA 3C4XA 4HE8A 4O8SA 3ZJ2A 3DJBA 4K0UA 4EXTA 4WW0A 4PFOA 4O4LE 3MACA 3CPZA 3E08A 3GN5A 5KX5E 2Q9QD 4YHJA 5JR9C 3ZCJA 1HFAA 1MIYA 2NP9A 2Y6XA 4XAXB 2VK9A 3U3IA 1T98A 1D0XA 2Q9QA 2V26A 2GK9A 4ZI7E 4PW8A 4BJNA 5BMVE 1MMGA 2MBGA 3E0ZA 4CXYA 1SA0E 4UEMA 5HXHA 2C5JA 4H9OC 5FXVA 4JUYA 1MNEA 2I59A 2IAKA 5CA1E 5JDNA 3O9XA 2V7IA 2B1EA 3J7Yq 5FXZA 3KBUA 1H7CA 4HEAA 5HXCA 1HG5A 3HR0A 1HX8A 2CXFA 4GK0E 2CEAA 5LJMA 1Y64B 3NBXX 3IBPA 3CQGB 5ADXL 1D1CA 4MLKA 3ONXA 2JRKA 4OFZA 3AAAB 1FMWA 5CA0E 4B6XA 2X66A 2YU2A 2XTLA 4ISSA 3RX6A 4E7SA 2C0SA 4ZS3A 5F8PA 2JMKA 3ZYLA 3CX8B 3ETUA 3WI3A 3N5LA 5L3GB 3PE0A 1IZNB 3C50A 3RRWA 4IE5A 5FNVE 5M4YA 4IGUA 2LSIA 2YU1A 4ZS2A 4QXHB 3N2OA 5LNKA 4TX5A 3PUSA 2X9XA 2V7LA 2XASB 3OBVE 4O4JE 3UUXB 4XBFB 4UV8B 4IE0A 5J2TE 5LBMA 2XAQB 5KDMC 3KV6A 1WRDA 5CB4E 4H9RC 3VU7H 4JEUB 1U5PA 3AA7B 3ZMUB 2MYSA 5LG4A 2K9AA 3KVBA 4UF0B 4X1KE 2JPFA 1S35A 4EZHA 2VB6A 3UUMA 3Q2MA 1E1HB 1G73A 4ZI3C 3HA4A 1LRZA 2WM9A 1MNDA 3ZC0A 2H7VC 3N9LA 2VKOA 5LHGB 3BQIA 4CXXA 4P0AA 2EHOC 1D1BA 3O1JA 4QKNA 3KV9A 3V5SA 3LBXA 3RPUA 3OYZA 5JDFA 3K8PC 4DBQA 3AB3B 2VWAA 2KT9A 2NWBA 3AVRA 3NZQA 4G2AA 4GYRA 3LG7A 4CI1B 4DMWA 3RYIE 2C5KT 4F6RC 2XUEA 1IJ5A 1IJ6A 2HH7A 1U4QA 4KP3C 4XZCA 4PK6A 2IC6A 5H6QB 4EYUA 3N9QA 4TZ4C 2NW9A 5KMGP 2DI4A 2PG8A 4HFVA 4C90A 5L3FB 4AI6A 3IHRA 5J1GA 2N9DA 3R6NA 4DMVA 3P8CD 5LGTB 2HPLA 3Q5XA 4N78D 3DP7A 3UFEA 2BVLA 3F57A 5LXTE 4ASKA 1MIWA 4EYYR 3MJXA 2ZMAA 4ADZA 5JH7E 2JMHA 2K5BB 5LCYA 3ZN0B 2KMFA 3ETVA 2VKHA 5F3JA 2RA1A 2ACXA 4X1YE 1UX4A 2JJ9A 2CM0A 2LSYA 3ZCIA 4EIWA 5EZYE 5JDMA 4MFRA 4KUMB 3ZN1B 4E7ZA 2X9HA 2DNXA 3MZKB 1MMDA 1BR1A 2CA5A 1FMVA 4YJ2E 4EAHA 2NOXA 4BAYB 3FBZA 1LVKA 2XAHB 3MA9A 3RC3A 2HPJA 5JR9A 1HG2A 3LK2B 4FJOA 2WSSV 3SWHA 2WWUA 3M65A 3EVYA 4WBOA 2BVMA 3HKCE 3B57A 1D0ZA 3N9NA 3N2GE 4O4HE 1LKXA 2DWKA 4UV9B 4ZHQE 2YEVC 3ZYMA 5FP3A 4PAGA 4IE4A 5LYJE 2N1GA 1G8XA 3D0TA 3P7IA 1AJ3A 3E22E 2E9XB 3W15B 2X67A 3PTRB 4HGAA 1NAFA 4H63V 2LM9A 1KNZA 2DCFA 3HKBE 4PK5A 3C64A 3CKDA 1EZ3A 3SOLA 3AVSA 4QXBB 3O4XE 3SRZA 1LVFA 1HS7A 2V7KA 4UIGA 3AAIA 4IE6A 2SPCA 3FB2A 4H9PC 3UT5E 2LE8A 3K3NA 5A1LA 3LBXB 3UULA 4IE7A 1YD8G 3SS1A 3LJCA 4AXPA 3JC6C 3L3PA 2ZM8A 3AA6B 1VRBA 4QHOA 4AKLA 3S4UA 2Y48B 4CI2B 2XAJB 5LGUB 3AA1B 5JREA 3ZMTB 3O1IA 3PUQA 3N2KE 4ZOLE 5L3BB 2KWHA 3C4WA 3CMLA 5JRCA 2MOZA 4BJMA 4AKHA 2LJLA 5TAOA 5JDQA 5FY1A 2LSJA 3PURA 2VASA 3PDYA 4EB6E 4H9QC 2K24A 5FXWA 2DHRA 3GWHA 5ETWA 5AFUL 2NW8A 2Z6EA 3GA8A 1UCUA 2QA7A 3BQLA 4TN7B 3WAJA 2E9XC 3EUHA 1OWAA 1WLXA 5JVDE 1BR2A 3KDSE 2CWYA 5LBQB 2ZM2A 3N9PA 4C91A 1B7TA 5DQWA 4I55E 2WBLA 4HKAA 2X51A 2W63A 3UTKA 3FBLA 3GN5B 3HKEE 2W62A 4AQFC 3MXZA 5E0OA 1ZEEA 3ZMSB 2UXNB 3FXDB 5HXEA 4CI3B 2CLYB 4CQIA 2W00A 5HWXA 2EHOD 1NWMX 2Q9QB 3RYFE 4OK0A 5L2LA 3RH3A 1HTJF 3FXEB 4J2CA 4MBQA 3AA0B 5JQGE 2CMRA 2EHOA 3CWZB 3F2EA 2LOPA 3QK6A 3PU8A 4PJMA 4AKRB 1MIVA 4PNIA 4H63H 2CXDA 4QX8B 2YK0A 4UXNB 2XQYA 3C98B 3CX6B 2BDEA 5J2UE 5JR9B 3HL6A 2RP4A 4X1IE 4EZ4A 4I50E 4L9IA 4OHFA 4WBNE 2W61A 1MMNA 5LOVE 5EK3A 4DBRA 3R84B 2V7JA 3I1AA 3KINB 3RRCA 4HTEA 3IF8B 4DO0A 2A3DA 2MTQA 2DWGA 2N2NA 4MHCA 4ZI2D 3I9YA 3HKDE 4AKIA 4A56A 4PFPA 3B13A 1CUNA 3LK3B 4QWNB 4M1PA 2LT3A 2ES0A 3MK7C 4ILUA 2KZ7B 1UX5A 1US7B 5FXXA 2CXLA 5GONE 5H6RB 1SHZC 4I43B 3RYCE 4UF0A 1IAPA 3H37A 5LGNB 1OXZA 2KLQA 2ZLYA 4H9SE 4PJJA 5DQVA 4ERRA 3A5XA 1V9DA 3V5UA 2K48A 2PBIA 2CLYC 5L3DB 4P09A 2Q9QC 1Z0PA 2L3LA 4HN9A 4BA9A 4WNKA 2JQQA 1S94A 1YKEB 2H3RA 4TUYE 3VKGA 3I0QA 2D5UA 5HWYA 4G63A 4TV8E 3LK42 4GIWA 4OYKA 4AQGA 2LOSA 3PU3A 2KWIB 3NRXA 1HCIA 2L9QA 3KVAA 5JRCB 3FHNA 2XHEB 4UELA 5HAXA 1ZV4X 3OJAA 2KINB 2X9WA 2C5IT 5C8YE 3ANWA 2H7OA 4ISTA 2CWOA 3NZPA 3CQCB 3EDVA 1FIOA 4QXCB 4KBMB 3ZMVB 3PUGA 4U74A 3ZLIA 2ODVA 2WAUA 2DLRA 2WMNA 3HI2A 2KNDA 3OYXA 4DNDA 4OYJA 3CQXC 5FY0A 2NTYA 5HYAA 4QX7B 3QUJA 4H9NC 3UUNA 4CZZB 2A2FX 4I4TE 1WR6A 1FEWA 5HXRA 4O2BE 2XAFB 3N9MA 1WYCA 4AKGA 5EK2A 2BZBA 3K3QC 2X68A 2IW5B 4NUUA 3C4ZA 5HXSA 3H3AA 5LHHB 1MMAA 3I9WA 4UVBB 5LA6E 3O1HA 3KV5A 5FMNA 2PFVA 3RYHE 2EHOB 2VKDA 4L5GA 5L3EB 2LHNA 3ESLA 4GOUA 1YKHB 2NTXA 3EDUA 3I0OA 3JC6D 3DTOA 2NW7A 4IIJE 2LSGA 4MALA 3ZPOA 2LHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 C;  3ZC0 A;  5JRC B;  5JRC A;  3ZC1 A;  5JRE A;  5JR9 B;  5JR9 A; 
#chains in the Genus database with same CATH topology
 3PUZ F;  3T8O A;  2YIN A;  4PJL A;  4TV9 E;  3VRB A;  3FZH B;  4HFC A;  2D0T A;  3ZC1 A;  3N9O A;  2B76 A;  2X0L B;  4IDQ A;  2XPK A;  1Z8U A;  1KNP A;  1X79 A;  2YN6 A;  2AXD S;  2XAG B;  5IYZ E;  3BQK A;  4IDN A;  1D0Y A;  1KEY A;  2J1D G;  2PJQ A;  5ABF A;  1QUU A;  4CN1 A;  3QC9 A;  5L3C B;  4YLH A;  3JAF A;  4UVC B;  4YJ3 E;  3AEB A;  2WU5 A;  1KF6 A;  3RKO A;  2BKO A;  3VKH A;  5AQT B;  3H3M A;  3TKL B;  3RHW A;  1HNZ T;  2VL8 A;  3Q5W A;  4B3R T;  3OKQ A;  4O8S A;  4K0U A;  4EXT A;  4WW0 A;  4O4L E;  5LG3 A;  3ZCJ A;  4TNV A;  4XAX B;  2VK9 A;  2WY2 A;  3LSV A;  1SA0 E;  3NWI A;  4NXN T;  2I59 A;  3P4S A;  2CPT A;  2XM1 A;  5HXC A;  4GK0 E;  3VR8 A;  4MLK A;  5FVL A;  2JRK A;  1FMW A;  3RX6 A;  2BG9 B;  2C0S A;  4AIU A;  3ETU A;  4X5T A;  5M4Y A;  3RRW A;  4JYA T;  4LF7 T;  4IGU A;  2X9X A;  4O4J E;  1HX1 B;  4ZZC A;  4UV8 B;  4IE0 A;  4HWC A;  5CB4 E;  2FUP A;  1U5P A;  2XQ5 A;  3AA7 B;  3ZMU B;  4YTP A;  1S35 A;  4EZH A;  2VB6 A;  3UUM A;  4DV0 T;  3HA4 A;  1MND A;  2H7V C;  3N9L A;  1IBK T;  4CXX A;  2CBJ A;  3V5S A;  2WP9 A;  3NKZ A;  5JDF A;  3K8P C;  2VWA A;  2UXC T;  3UU8 A;  1IJ5 A;  2W4X A;  4PK6 A;  2NW9 A;  5KMG P;  4HFV A;  4DV3 T;  4AI6 A;  3IHR A;  5LGT B;  4QH1 A;  3UFE A;  2W2U A;  1MIW A;  3FZL B;  4EYY R;  3MJX A;  4YHH T;  4AQY T;  2PTF A;  5JH7 E;  5LCY A;  3ZN0 B;  3A7M A;  2FJB A;  4A97 A;  1CHU A;  2UUC T;  4X1Y E;  4HFE A;  4E7Z A;  4IL4 A;  4DR1 T;  2CA5 A;  1DU2 A;  2V5C A;  3MA9 A;  3RC3 A;  4DV4 T;  3LK2 B;  2BVM A;  2BS4 A;  4O4H E;  4UV9 B;  4ZHQ E;  4DR4 T;  4PAG A;  3D0T A;  3W15 B;  4P1N A;  5CGM A;  2X67 A;  4F8H A;  1KNZ A;  3ZSS A;  2BBH A;  4Z91 A;  4PK5 A;  1EZ3 A;  3SOL A;  2XQ6 A;  3AVS A;  3SRZ A;  1LVF A;  2V7K A;  4IE6 A;  5C3J A;  3LJC A;  3L3P A;  2UXD T;  3AA6 B;  2XAJ B;  5LGU B;  4IRE A;  3AXJ B;  2BG9 E;  2CHN A;  2V6Y B;  5JRC A;  3OTO T;  4LMK A;  5FY1 A;  2VAS A;  2W66 A;  3PDY A;  4EB6 E;  3QNU A;  5AFU L;  3GA8 A;  2V6X A;  3RQW A;  3EUH A;  5AQS B;  5LBQ B;  2ZM2 A;  4C91 A;  1B7T A;  2BG9 C;  2WBL A;  2W63 A;  4K0K T;  4AQF C;  3ZMS B;  1NWM X;  4OK0 A;  1YQ3 A;  3TLS A;  1HTJ F;  3FXE B;  5JQG E;  4LF9 T;  1XMO T;  3AEE A;  2RP4 A;  4EZ4 A;  4L9I A;  2W61 A;  5LOV E;  2V8S V;  3TLW A;  4DBR A;  3RRC A;  3KIN B;  4HTE A;  3IF8 B;  4A5X A;  1XNQ T;  4PFP A;  2VL0 A;  2VUR A;  3FZM B;  2ES0 A;  3AE5 A;  1US7 B;  5H6R B;  2AE9 A;  3H37 A;  1UUS A;  3V5U A;  1IBL T;  4P09 A;  1Z0P A;  4BA9 A;  3TLU A;  1YKE B;  3B5M A;  4LF4 T;  2LOS A;  3PU3 A;  1HCI A;  2L9Q A;  5ABE A;  4U33 A;  4DUY T;  1FIO A;  3ZT6 A;  4KBM B;  3ZMV B;  3ZLI A;  2ODV A;  2WAU A;  1XMQ T;  3OYX A;  4JI0 T;  3CQX C;  2IDO B;  3ZT5 A;  2NTY A;  2A2F X;  2XY8 B;  1FEW A;  4O2B E;  2J62 A;  3IA3 A;  5EK2 A;  2BZB A;  3RIU C;  2IW5 B;  4ILC A;  3H3A A;  5LA6 E;  5FMN A;  5L3E B;  2LHN A;  3ESL A;  3T1Y T;  1QLB A;  3I0O A;  5AQP B;  2NW7 A;  3RIA A;  1I94 T;  3AE6 A;  2LHR A;  2QGS A;  2XJ7 A;  2E8I A;  3VRA A;  4NUV A;  3UU4 A;  2L8K A;  3KV4 A;  4JLE A;  2D2S A;  2YDR A;  2V1D B;  4GYS A;  2KSR A;  2P9B A;  3Q9D A;  1W09 A;  1WYB A;  2KXP B;  2LM2 A;  2XQA A;  1OED B;  5EK4 A;  3RC8 A;  3J9X 1;  2M67 A;  2BG9 A;  5DJQ C;  3CX7 B;  4YFS A;  2A72 A;  3ZYK A;  2JIW A;  3Q5D A;  4AQF A;  4PJN A;  4LF5 T;  2G0U A;  5JDH A;  2F4V T;  2ODU A;  4UVA B;  4TNW A;  3ANW B;  2UXX B;  3LFM A;  4LF6 T;  4P0B A;  4EOZ B;  4JI5 T;  5AQN B;  4IHJ E;  1BR4 A;  2BKN A;  2LEH A;  3GMI A;  3IEE A;  3MKD A;  2W0G A;  2CCQ A;  4WYV A;  4HWF A;  3C4X A;  3ZJ2 A;  2VVS A;  3DJB A;  3MAC A;  3OVU A;  3GN5 A;  1MIY A;  2WU2 A;  2NP9 A;  3U3I A;  1D0X A;  3PJA A;  2GK9 A;  4BJN A;  2XM2 A;  3AE2 A;  1XWM A;  2C5J A;  3Q5E A;  5JDN A;  2V7I A;  3AE8 A;  1HG5 A;  3HR0 A;  1HX8 A;  5FVK A;  2CEA A;  4HFI A;  5ADX L;  1NEN A;  4QH4 A;  3AAA B;  4YSX A;  2FJE A;  5AQI B;  5F5W A;  2XTL A;  4E7S A;  4DR3 T;  3CX8 B;  3RIU A;  4EED A;  3C50 A;  4IE5 A;  4TWH A;  4DID B;  3JAD A;  3ONL C;  3N2O A;  5LNK A;  3OBV E;  2XAS B;  4XBF B;  4U2Z A;  4YXD A;  5HEU A;  4CN6 A;  4X62 T;  4LFC T;  3KVB A;  2V5D A;  4HWH A;  3Q2M A;  2XQ8 A;  4ZI3 C;  2XQ4 A;  3ZC0 A;  3BQI A;  4P0A A;  1D1B A;  1OED E;  3AB3 B;  5HEG A;  4YY3 T;  2C5K T;  4F6R C;  3AXJ A;  1IJ6 A;  2V6Y A;  5H6Q B;  1J1J A;  2DI4 A;  5FL0 A;  2YDQ A;  1OED C;  4N78 D;  3DP7 A;  3M3Z B;  4GKK T;  5LXT E;  3F57 A;  4DV6 T;  2ZMA A;  4X66 T;  2HN1 A;  2KMF A;  3ETV A;  4LF8 T;  2ACX A;  1UX4 A;  2JJ9 A;  4EIW A;  5JDM A;  4MFR A;  4KUM B;  2X9H A;  3MZK B;  1BR1 A;  4YJ2 E;  2CHO A;  2NOX A;  1NEK A;  4BAY B;  2E5L T;  2HPJ A;  3SWH A;  2E2A A;  3PV0 F;  3EVY A;  3HKC E;  3B57 A;  3N2G E;  2YEV C;  3ZYM A;  2W67 A;  4IE4 A;  5LYJ E;  2N1G A;  1G8X A;  2XQ3 A;  4H63 V;  2LM9 A;  2DCF A;  2I0M A;  3HKB E;  3C64 A;  3CKD A;  1W0B A;  3FB2 A;  4H9P C;  3LBX B;  3UUL A;  4IE7 A;  1E7P A;  1VRB A;  3S4U A;  4HWD A;  4CI2 B;  3AA1 B;  4ZOL E;  2KWH A;  4CN4 A;  4BJM A;  5JDQ A;  5KXJ A;  2LSJ A;  5AQG B;  1HNX T;  4H9Q C;  3GWH A;  5ETW A;  2Z6E A;  4TN7 B;  3WAJ A;  1OWA A;  5L4E A;  5JVD E;  3FZF B;  4B3T T;  4IDO A;  3GN5 B;  5E0O A;  2UXN B;  5AQM B;  4CI3 B;  2W00 A;  3RYF E;  3RH3 A;  4J2C A;  3CWZ B;  2XQ7 A;  3F2E A;  1HR0 T;  4AKR B;  2BS3 A;  4U7Y A;  1XZY A;  4H63 H;  3L39 A;  3CX6 B;  3HL6 A;  4HFD A;  5IWA T;  4OHF A;  5EK3 A;  3R84 B;  2V7J A;  3I1A A;  3I9Y A;  3HKD E;  4AKI A;  3B13 A;  3LK3 B;  4U7I A;  1UX5 A;  2X0H A;  5FXX A;  1OED A;  4IL9 A;  1UUR A;  1SHZ C;  3UQ4 A;  5LGN B;  2KLQ A;  3RQU A;  4H9S E;  3A5X A;  2K48 A;  5L3D B;  4LFB T;  3ONJ A;  2Q9Q C;  4HN9 A;  2H3R A;  5JTG A;  4TUY E;  3VKG A;  3I0Q A;  4G63 A;  4TV8 E;  4AQG A;  5BR8 T;  5HAX A;  1ZV4 X;  2KIN B;  2X9W A;  3PUW F;  3ANW A;  2CWO A;  3NZP A;  3CQC B;  4QXC B;  2DLR A;  2WMN A;  1IBM T;  3HI2 A;  2KND A;  2I6H A;  4QX7 B;  4CZZ B;  4I4T E;  4AIS A;  5J0Z A;  3N9M A;  2MPK A;  4NUU A;  4JI3 T;  5AQV B;  2PFV A;  3RYH E;  2QVA A;  2EHO B;  5IUX A;  1YKH B;  2BS2 A;  4MAL A;  1O3X A;  2ACZ A;  2Y8D A;  1YW0 A;  5FYM A;  3TLT A;  3BK9 A;  2A9U A;  5JDL A;  3AAE B;  2ZM0 A;  4Z90 A;  4DR6 T;  3KBT A;  3F31 A;  4IDZ A;  4LML A;  3ZJ1 A;  2CRB A;  2OV9 A;  4JI1 T;  1N33 T;  1D1A A;  1QSD A;  5IHY A;  2K3W A;  2WWV A;  4V1A v;  5AQO B;  2FJD A;  2D0U A;  2LSK A;  4TWF A;  2OA5 A;  3AED A;  3JCF A;  3RLF F;  5LJN A;  3UU3 A;  1WR0 A;  4DV7 T;  3PUA A;  2H89 A;  4KHZ F;  2LRL A;  1BR0 A;  2V7M A;  4U72 A;  4ZI2 C;  5FY7 A;  4JEH B;  2X9Y A;  3CVR A;  2IC9 A;  2WDQ A;  4O2A E;  1ZKE A;  5LHI B;  5JDG A;  3CPZ A;  3E08 A;  3CK6 A;  5KX5 E;  3P4W A;  2Q9Q D;  4JI4 T;  1HFA A;  2Q9Q A;  5L47 A;  5BMV E;  1MMG A;  3E0Z A;  2WB5 A;  5HXH A;  4DV5 T;  4HFB A;  4H9O C;  5FXV A;  1WCR A;  4JUY A;  1MNE A;  2IAK A;  3O9X A;  2B1E A;  3J7Y q;  4QH5 A;  5LMN T;  3L8R A;  5HEJ A;  3SFD A;  3UUB A;  2IML A;  3CQG B;  1D1C A;  4OFZ A;  4B6X A;  2YU2 A;  4ISS A;  2VQE T;  5F8P A;  2JMK A;  1R8I A;  3N5L A;  3AE9 A;  1IZN B;  3P4Q A;  2LSI A;  4ZS2 A;  4TX5 A;  3PUS A;  2WDR A;  5KDM C;  2XAQ B;  1WRD A;  2OLT A;  4H9R C;  1Y01 A;  3VU7 H;  4JEU B;  5LG4 A;  2K9A A;  3A8Y C;  4X1K E;  2JPF A;  1G73 A;  1XDP A;  1LRZ A;  2BBJ A;  2WM9 A;  2VKO A;  5LHG B;  5FL1 A;  2EHO C;  4WZX A;  3O1J A;  4QKN A;  1ZOY A;  2M6B A;  4JI8 T;  3KV9 A;  3LBX A;  3RPU A;  4DBQ A;  4ZEY A;  2KT9 A;  2NWB A;  3AVR A;  4GYR A;  3X1D A;  4DMW A;  4KP3 C;  1U4Q A;  3EAB A;  4XZC A;  1M62 A;  3UFG A;  2IC6 A;  4EYU A;  3UU6 A;  3N9Q A;  4TZ4 C;  3AEG A;  4C90 A;  4DMV A;  3P8C D;  3P50 A;  2HPL A;  2BVL A;  4ASK A;  2WQY A;  4JI2 T;  2XSB A;  2BKP A;  2JMH A;  2K5B B;  2FBW A;  4U3C A;  2VKH A;  5F3J A;  5HCM A;  4YTN A;  5AQF B;  2CM0 A;  2LSY A;  4B3S T;  5EZY E;  2DNX A;  4EV6 A;  3K1S A;  3PJA J;  3FBZ A;  2XAH B;  2WSS V;  2WWU A;  3M65 A;  1D0Z A;  3N9N A;  4A98 A;  1LKX A;  2DWK A;  4NXM T;  5FP3 A;  2WDV A;  3E22 E;  1KFY A;  4EGW A;  2X0Y A;  3PTR B;  4HGA A;  4QXB B;  3PUX F;  1HS7 A;  2SPC A;  3UT5 E;  1YD8 G;  3VR9 A;  4AXP A;  2ZM8 A;  1JNR A;  4QHO A;  5HEH A;  2Y48 B;  1XNR T;  3PUQ A;  3N2K E;  5L3B B;  4JI7 T;  1E2A A;  4AKH A;  2LJL A;  5TAO A;  4YSY A;  2K24 A;  5FXW A;  2DHR A;  3QB5 A;  1ZP0 A;  3BQL A;  2NR4 A;  2E9X C;  1BR2 A;  3KDS E;  3AE3 A;  3P4R A;  2E5V A;  5DQW A;  4I55 E;  3RF1 A;  2X51 A;  3UTK A;  4KHP T;  3P4P A;  5L4H A;  3MXZ A;  1ZEE A;  4DR7 T;  4CQI A;  5HWX A;  2EHO D;  2Q9Q B;  2J4G A;  2EHO A;  2LOP A;  4PJM A;  2YK0 A;  2XQY A;  2BDE A;  5AQQ B;  5J2U E;  5JR9 B;  4I50 E;  4LFA T;  2QRX A;  4DO0 A;  4MHC A;  2N2N A;  4IT4 A;  4M1P A;  2LT3 A;  4ILU A;  1I6Z A;  2J47 A;  3RYC E;  2VQF T;  4UF0 A;  2WCA A;  3RKG A;  2CLY C;  2UUB T;  5FKY A;  4WNK A;  1S94 A;  1N32 T;  3UQ7 A;  4GIW A;  3NRX A;  4YT0 A;  2XHE B;  4UEL A;  5CFB A;  3OJA A;  2C5I T;  3ZST A;  1T7S A;  2H7O A;  4IST A;  3PUG A;  4U74 A;  1J5W A;  5FY0 A;  4YSZ A;  3UUN A;  1WR6 A;  5CJ5 A;  3SFE A;  2XAF B;  2UU9 T;  1WYC A;  1M7K A;  3JAE A;  3K3Q C;  2WS3 A;  3C4Z A;  5LHH B;  1MMA A;  3I9W A;  4UVB B;  3O1H A;  2JQ9 A;  2FJA A;  4GOU A;  3AE7 A;  3DTO A;  3VHL A;  1KNR A;  3L09 A;  2VKJ A;  4PK4 A;  4KMC A;  4ILA A;  3T1H T;  5AQL B;  3KFW X;  1VOM A;  4DVD A;  4ZI3 D;  1UGO A;  2E9X D;  2E9X A;  4I0U A;  3AE4 A;  4HFH A;  2YOE A;  2WMO A;  4X20 E;  3ZEF B;  2CBI A;  4ILB A;  1HF8 A;  4GK5 E;  3ZMZ B;  5DAB A;  4O4I E;  3NRY A;  1N34 T;  2IUB A;  1KK7 A;  4L0R A;  1ZHC A;  3WAK A;  4ANJ A;  2M6I A;  4CXW A;  4HWI B;  2CE7 A;  3U78 A;  2LRK A;  4Z8X A;  3C51 A;  3PUY F;  3K3O A;  4FI5 A;  4DV1 T;  4HE8 A;  4COF A;  4PFO A;  5C2T A;  4YHJ A;  5JR9 C;  2Y6X A;  1X9B A;  1T98 A;  2V26 A;  4ZI7 E;  4PW8 A;  4U2Y A;  1VCS A;  5ABH A;  2MBG A;  4CXY A;  4UEM A;  4Q25 A;  1L0V A;  3QB5 K;  5CA1 E;  4NIQ A;  5FXZ A;  3KBU A;  3PUV F;  1H7C A;  4HEA A;  1SUM B;  3TLV A;  2CXF A;  4LMJ A;  5LJM A;  1Y64 B;  3NBX X;  3IBP A;  3ONX A;  5CA0 E;  3AEA A;  1JNZ A;  2X66 A;  4EEB A;  3RIF A;  4ZS3 A;  3ZYL A;  3WI3 A;  5L3G B;  3PE0 A;  5ABF B;  4UR9 A;  5FNV E;  5AQH B;  2YU1 A;  4QXH B;  4X64 T;  2R6G F;  2JQK A;  2V7L A;  3UUX B;  5J2T E;  5LBM A;  3KV6 A;  4KX6 A;  2IIU A;  1N36 T;  2MYS A;  4NPP A;  4YTM A;  4UF0 B;  3EHZ A;  3UU5 A;  1E1H B;  1UK5 A;  5AQJ B;  1FJG T;  2MAW A;  2ZM6 T;  1WFD A;  3OYZ A;  3AE1 A;  3NZQ A;  4G2A A;  4CI1 B;  3LG7 A;  2D9D A;  4DV2 T;  3RYI E;  2LKH A;  2XUE A;  5HCJ A;  2HH7 A;  3FZK B;  3OPC A;  2HHH T;  2YKS A;  2PG8 A;  5L3F B;  5J1G A;  2N9D A;  3R6N A;  4B3M T;  3Q5X A;  3ZKR A;  4ADZ A;  1XDO A;  4KI0 F;  1T8B A;  4ZZB A;  2RA1 A;  3NVO A;  3ZCI A;  2XZE A;  3ZN1 B;  1MMD A;  4X65 T;  1FMV A;  4ZXL A;  4EAH A;  1LVK A;  1VCT A;  5JR9 A;  1HG2 A;  4FJO A;  4WBO A;  1GQE A;  4GKJ T;  3P7I A;  1AJ3 A;  2E9X B;  3RI5 A;  1NAF A;  4TWD A;  3O4X E;  5HEO A;  4UIG A;  3AAI A;  2XQ9 A;  2LE8 A;  3K3N A;  5A1L A;  3SS1 A;  2LKG A;  3JC6 C;  5AQU B;  2WZI A;  4AKL A;  5ABG A;  2UXB T;  5JRE A;  3ZMT B;  3O1I A;  3C4W A;  1YXR A;  3CML A;  2IHR 1;  1T72 A;  2MOZ A;  4DUZ T;  3PUR A;  2NW8 A;  1UCU A;  2QA7 A;  4JBW F;  1J5E T;  1WLX A;  2CWY A;  3N9P A;  4HKA A;  3FBL A;  3HKE E;  2W62 A;  3FXD B;  5HXE A;  2CLY B;  5L2L A;  4MBQ A;  5AQK B;  3AA0 B;  3LDQ B;  2CMR A;  3QK6 A;  3PU8 A;  1MIV A;  4PNI A;  2VVN A;  2CXD A;  4QX8 B;  4UXN B;  3C98 B;  4DR5 T;  2XSA A;  4X1I E;  2RPA A;  2YDS A;  4WBN E;  1MMN A;  2A3D A;  2MTQ A;  2DWG A;  4ZI2 D;  4A56 A;  1SE7 A;  1CUN A;  4QWN B;  3MK7 C;  1W9R A;  2DL1 A;  2KZ7 B;  1W0A A;  2QYW A;  2CXL A;  4IDP A;  5GON E;  4I43 B;  5LMU T;  1IAP A;  2JQH A;  1OXZ A;  3CIR A;  2ZLY A;  4DR2 T;  4PJJ A;  5DQV A;  4ERR A;  1V9D A;  2PBI A;  2L3L A;  2JQQ A;  2D5U A;  5HWY A;  3EAM A;  3LK4 2;  4OYK A;  2KWI B;  5JRC B;  3KVA A;  3FHN A;  1HNW T;  4OX9 T;  3G06 A;  5C8Y E;  3EDV A;  2HN2 A;  3EI0 A;  2LLY A;  2H88 A;  4DND A;  4OYJ A;  3AEF A;  3RGL A;  3ZT7 A;  5HYA A;  3AEC A;  3QUJ A;  4H9N C;  5HXR A;  4U31 A;  4AKG A;  5LB7 B;  2X68 A;  4JV5 T;  2WZH A;  5HXS A;  3KV5 A;  1YQ4 A;  2VKD A;  4L5G A;  5AQR B;  2NTX A;  3EDU A;  4JI6 T;  3JC6 D;  2UUA T;  3ABV A;  3QOF A;  4IIJ E;  2LSG A;  3ZPO A;  5LP6 E; 
#chains in the Genus database with same CATH homology
 3VHL A;  3L09 A;  2QGS A;  1O3X A;  3T8O A;  2YIN A;  2E8I A;  4PJL A;  4TV9 E;  4NUV A;  2L8K A;  2Y8D A;  3KV4 A;  1YW0 A;  2VKJ A;  4JLE A;  4PK4 A;  4KMC A;  5FYM A;  2D0T A;  3ZC1 A;  3N9O A;  2D2S A;  2V1D B;  3BK9 A;  2X0L B;  4GYS A;  5JDL A;  3KFW X;  1VOM A;  2P9B A;  3Q9D A;  1X79 A;  1WYB A;  2KXP B;  4DVD A;  4ZI3 D;  2E9X D;  5EK4 A;  3RC8 A;  3AAE B;  2ZM0 A;  3J9X 1;  2E9X A;  3KBT A;  2M67 A;  3F31 A;  4IDZ A;  3ZJ1 A;  2WMO A;  4X20 E;  2XAG B;  1D1A A;  3ZEF B;  1QSD A;  5IYZ E;  3BQK A;  5DJQ C;  3CX7 B;  1D0Y A;  4YFS A;  2A72 A;  3ZYK A;  5IHY A;  4V1A v;  1HF8 A;  2D0U A;  4GK5 E;  2J1D G;  2LSK A;  4PJN A;  3ZMZ B;  2PJQ A;  4AQF A;  2G0U A;  5DAB A;  1QUU A;  5JDH A;  2OA5 A;  4O4I E;  2ODU A;  3NRY A;  3QC9 A;  4UVA B;  5L3C B;  4YLH A;  3ANW B;  2UXX B;  4UVC B;  5LP6 E;  1KK7 A;  4YJ3 E;  3LFM A;  4L0R A;  1ZHC A;  5LJN A;  4P0B A;  3WAK A;  4EOZ B;  3PUA A;  3RKO A;  4IHJ E;  1BR0 A;  2V7M A;  4U72 A;  4ZI2 C;  1BR4 A;  4ANJ A;  3VKH A;  5FY7 A;  3TKL B;  2LEH A;  4JEH B;  3GMI A;  4CXW A;  3IEE A;  3MKD A;  2W0G A;  2CE7 A;  3U78 A;  2X9Y A;  2CCQ A;  4Z8X A;  2VL8 A;  3Q5W A;  3C51 A;  3CVR A;  2IC9 A;  4O2A E;  1ZKE A;  5LHI B;  5JDG A;  3K3O A;  4FI5 A;  3OKQ A;  3C4X A;  4HE8 A;  4O8S A;  3ZJ2 A;  3DJB A;  4K0U A;  4EXT A;  4WW0 A;  4PFO A;  4O4L E;  3MAC A;  3CPZ A;  3E08 A;  3GN5 A;  5KX5 E;  2Q9Q D;  4YHJ A;  5JR9 C;  3ZCJ A;  1HFA A;  1MIY A;  2NP9 A;  2Y6X A;  4XAX B;  2VK9 A;  3U3I A;  1T98 A;  1D0X A;  2Q9Q A;  2V26 A;  2GK9 A;  4ZI7 E;  4PW8 A;  4BJN A;  5BMV E;  1MMG A;  2MBG A;  3E0Z A;  4CXY A;  1SA0 E;  4UEM A;  5HXH A;  2C5J A;  4H9O C;  5FXV A;  4JUY A;  1MNE A;  2I59 A;  2IAK A;  5CA1 E;  5JDN A;  3O9X A;  2V7I A;  2B1E A;  3J7Y q;  5FXZ A;  3KBU A;  1H7C A;  4HEA A;  5HXC A;  1HG5 A;  3HR0 A;  1HX8 A;  2CXF A;  4GK0 E;  2CEA A;  5LJM A;  1Y64 B;  3NBX X;  3IBP A;  3CQG B;  5ADX L;  1D1C A;  4MLK A;  3ONX A;  2JRK A;  4OFZ A;  3AAA B;  1FMW A;  5CA0 E;  4B6X A;  2X66 A;  2YU2 A;  2XTL A;  4ISS A;  3RX6 A;  4E7S A;  2C0S A;  4ZS3 A;  5F8P A;  2JMK A;  3ZYL A;  3CX8 B;  3ETU A;  3WI3 A;  3N5L A;  5L3G B;  3PE0 A;  1IZN B;  3C50 A;  3RRW A;  4IE5 A;  5FNV E;  5M4Y A;  4IGU A;  2LSI A;  2YU1 A;  4ZS2 A;  4QXH B;  3N2O A;  5LNK A;  4TX5 A;  3PUS A;  2X9X A;  2V7L A;  2XAS B;  3OBV E;  4O4J E;  3UUX B;  4XBF B;  4UV8 B;  4IE0 A;  5J2T E;  5LBM A;  2XAQ B;  5KDM C;  3KV6 A;  1WRD A;  5CB4 E;  4H9R C;  3VU7 H;  4JEU B;  1U5P A;  3AA7 B;  3ZMU B;  2MYS A;  5LG4 A;  2K9A A;  3KVB A;  4UF0 B;  4X1K E;  2JPF A;  1S35 A;  4EZH A;  2VB6 A;  3UUM A;  3Q2M A;  1E1H B;  1G73 A;  4ZI3 C;  3HA4 A;  1LRZ A;  2WM9 A;  1MND A;  3ZC0 A;  2H7V C;  3N9L A;  2VKO A;  5LHG B;  3BQI A;  4CXX A;  4P0A A;  2EHO C;  1D1B A;  3O1J A;  4QKN A;  3KV9 A;  3V5S A;  3LBX A;  3RPU A;  3OYZ A;  5JDF A;  3K8P C;  4DBQ A;  3AB3 B;  2VWA A;  2KT9 A;  2NWB A;  3AVR A;  3NZQ A;  4G2A A;  4GYR A;  3LG7 A;  4CI1 B;  4DMW A;  3RYI E;  2C5K T;  4F6R C;  2XUE A;  1IJ5 A;  1IJ6 A;  2HH7 A;  1U4Q A;  4KP3 C;  4XZC A;  4PK6 A;  2IC6 A;  5H6Q B;  4EYU A;  3N9Q A;  4TZ4 C;  2NW9 A;  5KMG P;  2DI4 A;  2PG8 A;  4HFV A;  4C90 A;  5L3F B;  4AI6 A;  3IHR A;  5J1G A;  2N9D A;  3R6N A;  4DMV A;  3P8C D;  5LGT B;  2HPL A;  3Q5X A;  4N78 D;  3DP7 A;  3UFE A;  2BVL A;  3F57 A;  5LXT E;  4ASK A;  1MIW A;  4EYY R;  3MJX A;  2ZMA A;  4ADZ A;  5JH7 E;  2JMH A;  2K5B B;  5LCY A;  3ZN0 B;  2KMF A;  3ETV A;  2VKH A;  5F3J A;  2RA1 A;  2ACX A;  4X1Y E;  1UX4 A;  2JJ9 A;  2CM0 A;  2LSY A;  3ZCI A;  4EIW A;  5EZY E;  5JDM A;  4MFR A;  4KUM B;  3ZN1 B;  4E7Z A;  2X9H A;  2DNX A;  3MZK B;  1MMD A;  1BR1 A;  2CA5 A;  1FMV A;  4YJ2 E;  4EAH A;  2NOX A;  4BAY B;  3FBZ A;  1LVK A;  2XAH B;  3MA9 A;  3RC3 A;  2HPJ A;  5JR9 A;  1HG2 A;  3LK2 B;  4FJO A;  2WSS V;  3SWH A;  2WWU A;  3M65 A;  3EVY A;  4WBO A;  2BVM A;  3HKC E;  3B57 A;  1D0Z A;  3N9N A;  3N2G E;  4O4H E;  1LKX A;  2DWK A;  4UV9 B;  4ZHQ E;  2YEV C;  3ZYM A;  5FP3 A;  4PAG A;  4IE4 A;  5LYJ E;  2N1G A;  1G8X A;  3D0T A;  3P7I A;  1AJ3 A;  3E22 E;  2E9X B;  3W15 B;  2X67 A;  3PTR B;  4HGA A;  1NAF A;  4H63 V;  2LM9 A;  1KNZ A;  2DCF A;  3HKB E;  4PK5 A;  3C64 A;  3CKD A;  1EZ3 A;  3SOL A;  3AVS A;  4QXB B;  3O4X E;  3SRZ A;  1LVF A;  1HS7 A;  2V7K A;  4UIG A;  3AAI A;  4IE6 A;  2SPC A;  3FB2 A;  4H9P C;  3UT5 E;  2LE8 A;  3K3N A;  5A1L A;  3LBX B;  3UUL A;  4IE7 A;  1YD8 G;  3SS1 A;  3LJC A;  4AXP A;  3JC6 C;  3L3P A;  2ZM8 A;  3AA6 B;  1VRB A;  4QHO A;  4AKL A;  3S4U A;  2Y48 B;  4CI2 B;  2XAJ B;  5LGU B;  3AA1 B;  5JRE A;  3ZMT B;  3O1I A;  3PUQ A;  3N2K E;  4ZOL E;  5L3B B;  2KWH A;  3C4W A;  3CML A;  5JRC A;  2MOZ A;  4BJM A;  4AKH A;  2LJL A;  5TAO A;  5JDQ A;  5FY1 A;  2LSJ A;  3PUR A;  2VAS A;  3PDY A;  4EB6 E;  4H9Q C;  2K24 A;  5FXW A;  2DHR A;  3GWH A;  5ETW A;  5AFU L;  2NW8 A;  2Z6E A;  3GA8 A;  1UCU A;  2QA7 A;  3BQL A;  4TN7 B;  3WAJ A;  2E9X C;  3EUH A;  1OWA A;  1WLX A;  5JVD E;  1BR2 A;  3KDS E;  2CWY A;  5LBQ B;  2ZM2 A;  3N9P A;  4C91 A;  1B7T A;  5DQW A;  4I55 E;  2WBL A;  4HKA A;  2X51 A;  2W63 A;  3UTK A;  3FBL A;  3GN5 B;  3HKE E;  2W62 A;  4AQF C;  3MXZ A;  5E0O A;  1ZEE A;  3ZMS B;  2UXN B;  3FXD B;  5HXE A;  4CI3 B;  2CLY B;  4CQI A;  2W00 A;  5HWX A;  2EHO D;  1NWM X;  2Q9Q B;  3RYF E;  4OK0 A;  5L2L A;  3RH3 A;  1HTJ F;  3FXE B;  4J2C A;  4MBQ A;  3AA0 B;  5JQG E;  2CMR A;  2EHO A;  3CWZ B;  3F2E A;  2LOP A;  3QK6 A;  3PU8 A;  4PJM A;  4AKR B;  1MIV A;  4PNI A;  4H63 H;  2CXD A;  4QX8 B;  2YK0 A;  4UXN B;  2XQY A;  3C98 B;  3CX6 B;  2BDE A;  5J2U E;  5JR9 B;  3HL6 A;  2RP4 A;  4X1I E;  4EZ4 A;  4I50 E;  4L9I A;  4OHF A;  4WBN E;  2W61 A;  1MMN A;  5LOV E;  5EK3 A;  4DBR A;  3R84 B;  2V7J A;  3I1A A;  3KIN B;  3RRC A;  4HTE A;  3IF8 B;  4DO0 A;  2A3D A;  2MTQ A;  2DWG A;  2N2N A;  4MHC A;  4ZI2 D;  3I9Y A;  3HKD E;  4AKI A;  4A56 A;  4PFP A;  3B13 A;  1CUN A;  3LK3 B;  4QWN B;  4M1P A;  2LT3 A;  2ES0 A;  3MK7 C;  4ILU A;  2KZ7 B;  1UX5 A;  1US7 B;  5FXX A;  2CXL A;  5GON E;  5H6R B;  1SHZ C;  4I43 B;  3RYC E;  4UF0 A;  1IAP A;  3H37 A;  5LGN B;  1OXZ A;  2KLQ A;  2ZLY A;  4H9S E;  4PJJ A;  5DQV A;  4ERR A;  3A5X A;  1V9D A;  3V5U A;  2K48 A;  2PBI A;  2CLY C;  5L3D B;  4P09 A;  2Q9Q C;  1Z0P A;  2L3L A;  4HN9 A;  4BA9 A;  4WNK A;  2JQQ A;  1S94 A;  1YKE B;  2H3R A;  4TUY E;  3VKG A;  3I0Q A;  2D5U A;  5HWY A;  4G63 A;  4TV8 E;  3LK4 2;  4GIW A;  4OYK A;  4AQG A;  2LOS A;  3PU3 A;  2KWI B;  3NRX A;  1HCI A;  2L9Q A;  3KVA A;  5JRC B;  3FHN A;  2XHE B;  4UEL A;  5HAX A;  1ZV4 X;  3OJA A;  2KIN B;  2X9W A;  2C5I T;  5C8Y E;  3ANW A;  2H7O A;  4IST A;  2CWO A;  3NZP A;  3CQC B;  3EDV A;  1FIO A;  4QXC B;  4KBM B;  3ZMV B;  3PUG A;  4U74 A;  3ZLI A;  2ODV A;  2WAU A;  2DLR A;  2WMN A;  3HI2 A;  2KND A;  3OYX A;  4DND A;  4OYJ A;  3CQX C;  5FY0 A;  2NTY A;  5HYA A;  4QX7 B;  3QUJ A;  4H9N C;  3UUN A;  4CZZ B;  2A2F X;  4I4T E;  1WR6 A;  1FEW A;  5HXR A;  4O2B E;  2XAF B;  3N9M A;  1WYC A;  4AKG A;  5EK2 A;  2BZB A;  3K3Q C;  2X68 A;  2IW5 B;  4NUU A;  3C4Z A;  5HXS A;  3H3A A;  5LHH B;  1MMA A;  3I9W A;  4UVB B;  5LA6 E;  3O1H A;  3KV5 A;  5FMN A;  2PFV A;  3RYH E;  2EHO B;  2VKD A;  4L5G A;  5L3E B;  2LHN A;  3ESL A;  4GOU A;  1YKH B;  2NTX A;  3EDU A;  3I0O A;  3JC6 D;  3DTO A;  2NW7 A;  4IIJ E;  2LSG A;  4MAL A;  3ZPO A;  2LHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...