5JR9A

Crystal structure of apo-nec3po
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
188
structure length
188
Chain Sequence
RGSMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
molecule keywords NEQ131
total genus 82
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jr9A00
5JR9C 5JRCA 5JR9A 5JR9B 3ZC0A 5JREA 3ZC1A 5JRCB
chains in the Genus database with same CATH superfamily
2V8SV 2ZMAA 1UX5A 2K48A 2RP4A 2W0GA 3L39A 2E5VA 1X79A 2ZM2A 2ZM0A 3C4ZA 2QA7A 1YKEB 1BR1A 2OLTA 3A8YC 3CIRA 3CX6B 3CVRA 3GWHA 2XQ4A 2H3RA 5FL0A 3ZT5A 4DV2T 1ZV4X 2Y8DA 1ZEEA 2IW5B 4EZ4A 1YXRA 2VKDA 4UV9B 1T8BA 4PW8A 5JDGA 4DR1T 2BZBA 4X1YE 2MOZA 4YHJA 1E1HB 3RRCA 4EXTA 5J2UE 2X9XA 4IDQA 5ADXL 4E7SA 5F3JA 2IIUA 3T1HT 5FXWA 3AB3B 4JI5T 4YJ3E 3P4SA 4B6XA 3ZC0A 2M67A 2VVNA 5TAOA 4A97A 3P8CD 2HPJA 3ZPOA 1QUUA 1B7TA 4UELA 4U3CA 2Q9QB 4ISTA 2MAWA 2WP9A 2UXDT 2BDEA 3LK3B 4U74A 3R84B 4JBWF 4X64T 5LNKA 2MTQA 2WQYA 2UXBT 2CBJA 1BR4A 1HTJF 2JQKA 4HTEA 1IBMT 1FMVA 2LKHA 3AA1B 4ZOLE 4YT0A 5AQFB 5ABEA 5FVKA 1E2AA 2W66A 4IGUA 5LHGB 4AQFA 5IWAT 3KV6A 2PFVA 3G06A 3CQXC 2VQET 3AVRA 2VKOA 4QH4A 5HCJA 2BVMA 3ABVA 2CBIA 4IE4A 5HEJA 3B57A 3PUQA 1MMNA 2CHNA 5ETWA 3RIUC 4QH1A 2LHRA 5LBQB 3PJAJ 4N78D 4TWDA 1LKXA 2P9BA 2X0YA 5FP3A 3ZEFB 1IBKT 4PAGA 1MIYA 2DHRA 2DCFA 4O4JE 3JC6D 5FMNA 1J5ET 1KFYA 4DMWA 2LSJA 3LBXB 3IF8B 1U4QA 1UURA 3E0ZA 2IHR1 1MIWA 1WFDA 3AE8A 4K0UA 4PJMA 4C91A 5HEOA 3PUZF 2KMFA 3PUAA 2LJLA 1HNXT 5HEGA 1XMOT 5JRCA 2V5DA 4H63V 2QGSA 5HAXA 4TNVA 1D0XA 4EAHA 5IUXA 5AQPB 4HFBA 5AQVB 2V6YB 4FI5A 4CZZB 3O1HA 4FJOA 5JDLA 2W63A 1HG2A 5ABFB 2CEAA 2E9XB 2LRKA 2N2NA 4P0BA 4TWFA 3ZYLA 4HFHA 3ZT6A 4HFIA 2V6YA 2B1EA 3CX7B 3PTRB 3L3PA 2LSKA 2LKGA 4BJMA 1N33T 4YSYA 5CJ5A 4LMJA 2PBIA 2YINA 4QX7B 2WS3A 4G63A 2Q9QC 5HWYA 2YDQA 4Z90A 4DV1T 2X68A 4HKAA 3L09A 4AKRB 5AFUL 3BK9A 4A5XA 1G8XA 2Z6EA 3AXJB 2HN1A 3HKBE 2C5KT 4JI6T 4H9PC 4EB6E 3UUXB 1XNQT 2DWGA 3PV0F 1NWMX 3AE1A 4UEMA 5JDFA 2V6XA 3FXDB 4IDPA 5AQMB 5FYMA 3RKGA 2K3WA 4UV8B 3VRBA 1M7KA 3E08A 4YJ2E 3AE5A 4IE7A 1T7SA 3EDVA 1SHZC 4YSXA 3RH3A 5LGNB 1FMWA 4F8HA 4DR7T 2EHOB 3OVUA 4PK4A 3VKGA 5LBMA 2BKPA 2YOEA 2Q9QA 1L0VA 5L3EB 2LSYA 5JDHA 1UUSA 3WAJA 4GKKT 3MJXA 5ABHA 5H6QB 5LYJE 1G73A 2BS3A 2NW7A 4MALA 2CXLA 4EEDA 2WZHA 2JMHA 3RPUA 4UXNB 5BMVE 2E2AA 3KV9A 3QOFA 4I50E 2VWAA 4YY3T 4X65T 4QXBB 1HFAA 5JR9A 3ZLIA 5JTGA 4NUVA 4IL4A 1IJ5A 2NTYA 2CXFA 2D9DA 2LSGA 1W09A 3LJCA 5HXEA 1WCRA 3AEAA 4JLEA 4HWFA 2NW8A 3FXEB 1N34T 3ZN1B 2Y48B 4ZI3D 2XSAA 3N9MA 2H88A 2NTXA 3Q5EA 4U31A 5F8PA 5LXTE 4B3MT 5JRCB 1QLBA 4AQYT 2FJBA 3UFEA 4IDZA 1WR0A 2CPTA 1MMDA 2KWIB 4GK0E 4QX8B 4C90A 4P1NA 5H6RB 4NXNT 3E22E 5HXCA 3OKQA 4ILUA 3ZN0B 4KI0F 2LSIA 2XY8B 4O2AE 2X9WA 4DV7T 1I94T 2BKNA 3C98B 3CPZA 3AEBA 1X9BA 5LB7B 5CB4E 3RIFA 1I6ZA 1HNWT 4WNKA 4PFOA 5EK4A 3UUBA 3EABA 3ZYMA 5JR9C 5HCMA 2LM2A 2QYWA 3V5UA 5JR9B 1Z8UA 3BQKA 4TWHA 3VHLA 3IEEA 5LP6E 4U2YA 5FXVA 3ZYKA 3L8RA 3W15B 2I59A 3H37A 2BBHA 2IUBA 2VKJA 5F5WA 5HEUA 3WI3A 3ZCIA 1J1JA 3VKHA 5ABGA 5FL1A 3ZMVB 4ZZCA 2VASA 2XAQB 3K3QC 4UVBB 4ZS3A 4YHHT 4UF0B 1JNZA 4YTMA 1LVFA 2BBJA 2XAHB 3CKDA 3PUYF 5CA1E 2LLYA 3QK6A 4HFCA 1N36T 2DI4A 4HEAA 1CHUA 2JQ9A 3NZPA 5J0ZA 2LOPA 2VL8A 2MBGA 4BAYB 4NUUA 3AA0B 4XBFB 3K8PC 1H7CA 3NZQA 4WYVA 3ETVA 2ES0A 3RRWA 2GK9A 1R8IA 4OX9T 4CN6A 3ZMUB 3PUWF 2X67A 1AJ3A 2UUBT 3UT5E 3GN5B 3VR8A 5LMNT 2QRXA 3O9XA 1Y64B 2BS2A 2XAJB 3FHNA 3MXZA 3OYZA 2HPLA 1D0ZA 1W0BA 2M6BA 2XQYA 2XUEA 1VCSA 3FZKB 2VVSA 3QC9A 3K1SA 1MNEA 4I43B 3KBUA 4HFDA 2A3DA 2CE7A 4TNWA 2HHHT 1HCIA 3AEEA 3H3AA 3JCFA 4I55E 4KBMB 4O4HE 2CCQA 2V7KA 1D0YA 4UVCB 4KMCA 3N9NA 3RC3A 4L9IA 3LSVA 3NKZA 4GOUA 3N2KE 4HGAA 4M1PA 3AXJA 5HEHA 4ZI2D 5JREA 3ANWA 1OEDA 3U3IA 4ZS2A 1XDPA 5FVLA 3RQUA 3MK7C 4Z91A 1E7PA 1KK7A 3RC8A 1HR0T 2WDQA 5AQOB 5L3DB 1D1AA 3LK42 2AXDS 3KDSE 1KNPA 5AQUB 3J9X1 5C8YE 2CLYC 5LHHB 5LJNA 2EHOA 3SWHA 2CM0A 1HX1B 2E9XC 2XHEB 2J1DG 3CQCB 3I0OA 3LBXA 3GMIA 3O1JA 4DV3T 2WBLA 4V1Av 3DTOA 2UXCT 3ZMZB 3F31A 4ANJA 3NRYA 2WAUA 4HE8A 1HG5A 4O4LE 4PK6A 4TN7B 5AQSB 2XZEA 3UU5A 5LJMA 2A9UA 3KVBA 5HWXA 4DV0T 5HXRA 2K5BB 2WDVA 3P50A 3EHZA 3AE4A 4O8SA 5AQQB 4EEBA 2XQ5A 2ODUA 2W00A 3EUHA 3RLFF 4P0AA 2NP9A 4GIWA 4AXPA 3O4XE 4OK0A 5LOVE 2JMKA 3M3ZB 4QXCB 3ZT7A 1SA0E 1UCUA 3QB5K 2XPKA 4AQFC 2XSBA 1XMQT 4LF7T 2KLQA 4LF6T 4YLHA 1WR6A 2CA5A 4X5TA 3TLVA 3QUJA 5KXJA 5DJQC 4UR9A 2W67A 4BJNA 3PU3A 5LCYA 2XQ3A 1YKHB 3FZLB 4B3ST 4KHPT 4QXHB 2XM1A 1NEKA 4GK5E 5AQTB 4CI3B 3T8OA 5LA6E 4IE5A 2X66A 3UU8A 4EIWA 2I0MA 2PJQA 4DUYT 3ZC1A 1MMAA 1XWMA 2B76A 3T1YT 3P4WA 5L2LA 1CUNA 4OYJA 3RQWA 4DBQA 4DV5T 5J2TE 1OWAA 2V7MA 1MNDA 4A56A 4B3RT 2N1GA 3HA4A 4J2CA 2H89A 3ONLC 4JI0T 3LFMA 4ISSA 2DNXA 3N9PA 5FXXA 4PJNA 2WWVA 5BR8T 2WDRA 4HWIB 4DR3T 2YKSA 5EZYE 4DR5T 3RGLA 3AE3A 2X51A 4QKNA 5JH7E 3AEFA 4CXXA 2L8KA 3ANWB 3P4RA 2PTFA 4DR4T 2D5UA 1S35A 4IHJE 2LEHA 2FJAA 2LRLA 5GONE 3KINB 3AVSA 2CWOA 5L47A 4U7IA 3MACA 4H9NC 5KDMC 2N9DA 4UF0A 2BS4A 3FB2A 3VU7H 4IDOA 2YU1A 2KWHA 3RX6A 2E9XD 2KXPB 5IHYA 4H9SE 2IAKA 4F6RC 3JAFA 2XQ9A 5JQGE 1U5PA 2R6GF 2V5CA 2XJ7A 5AQJB 2YK0A 5FXZA 1IJ6A 1M62A 1D1CA 1OEDB 3N9LA 3ZCJA 1BR0A 4CI1B 2MPKA 4CI2B 3EI0A 4AKHA 2QVAA 4JI3T 5IYZE 3BQIA 2JQHA 2SPCA 3IBPA 2JIWA 3CWZB 2DWKA 2H7OA 3J7Yq 4OHFA 3AEDA 1FJGT 2XAFB 3MZKB 1YQ4A 2X0LB 3KFWX 3QNUA 3K3NA 4ZI3C 2UXXB 4GYSA 2IC6A 3HKCE 3NRXA 4DBRA 1UX4A 1T98A 4X62T 4H9QC 4AISA 2G0UA 3AE2A 3OTOT 4U33A 5AQLB 4WW0A 3TLTA 1XDOA 3ONXA 2W2UA 4B3TT 3TLSA 2RPAA 4HFVA 4LMKA 4U72A 2BG9B 3IA3A 1YQ3A 2UU9T 4JI8T 3A5XA 5CA0E 1KF6A 4XZCA 2KT9A 3ESLA 5AQIB 2E8IA 4TV8E 3RHWA 3KVAA 5FNVE 3FZFB 3V5SA 4O4IE 5JDMA 3NVOA 1US7B 3C64A 3AAIA 3QB5A 4DVDA 3RYHE 4ZI2C 4ZEYA 2JJ9A 3Q2MA 2C5JA 3KV4A 3SS1A 2WZIA 3PU8A 2XQ8A 3GA8A 4U7YA 4DR2T 4AKGA 5AQNB 1N32T 2LHNA 2NR4A 5LG4A 4LF5T 4KX6A 3SFEA 3UUMA 4Q25A 3TLUA 2CRBA 2ZLYA 2VK9A 2V1DB 3FZHB 3LK2B 3N2GE 4CN1A 3OJAA 4ZHQE 3PUXF 4JYAT 1D1BA 5J1GA 3AE9A 4IDNA 3VRAA 2FJDA 1W9RA 3X1DA 3UU6A 4IE6A 4MBQA 2CLYB 3C51A 3RYFE 2J62A 2XASB 3UULA 4AQGA 4ZZBA 1SE7A 4X66T 4K0KT 2YU2A 5L4EA 4COFA 4ADZA 1JNRA 2D2SA 2BG9E 2BG9A 2C5IT 4MLKA 2KNDA 3H3MA 4ILCA 2XQAA 2NWBA 4JEUB 4A98A 2LT3A 3CQGB 2NOXA 2A72A 3FBLA 2EHOD 2UXNB 3N5LA 4I4TE 4ASKA 2X9YA 2HH7A 3RI5A 3ZMTB 3A7MA 5LG3A 2NW9A 1HS7A 5LGUB 3HKEE 2HN2A 3PUGA 1XNRT 3B5MA 4YFSA 2E5LT 4JV5T 1IAPA 3JADA 3ZJ1A 2XAGB 2M6IA 4YSZA 5KMGP 4NXMT 4LFBT 4MHCA 3I9WA 5AQKB 1WYCA 3TKLB 1SUMB 3C4WA 2V7JA 2W61A 1NENA 2CHOA 1UK5A 1WLXA 3ZKRA 2DLRA 3LDQB 5FY1A 3Q9DA 4WZXA 5JVDE 4EYUA 1FIOA 1VCTA 2IMLA 4DNDA 5C2TA 3AAAB 4LFAT 1S94A 3HI2A 3TLWA 3P7IA 4UIGA 3ETUA 1OEDE 2W62A 4U2ZA 4LFCT 4P09A 4JI2T 4X1IE 4LMLA 2X0HA 1V9DA 1UGOA 2WWUA 4ILBA 2FJEA 1QSDA 3WAKA 3ZMSB 4EZHA 2D0UA 2V7IA 4YTPA 2YEVC 2MYSA 5M4YA 2AE9A 4IREA 2I6HA 2BG9C 2CMRA 2KZ7B 5DQVA 3AEGA 5JDNA 2LOSA 5E0OA 3F57A 4ILAA 3RF1A 5LGTB 3NWIA 3B13A 3C4XA 4L0RA 1VRBA 3JC6C 3PE0A 3UU3A 5LMUT 3DJBA 2JRKA 4JI4T 2X9HA 2YDSA 2ACXA 1T72A 2Y6XA 1HF8A 1IZNB 4HWCA 1KEYA 5L3GB 4HWHA 1LVKA 2EHOC 3AE7A 2VQFT 4JEHB 3CK6A 3I1AA 4H63H 4EYYR 5LHIB 1KNRA 5EK3A 2DL1A 3S4UA 1HNZT 3N9QA 4ZXLA 1FEWA 4EGWA 4DO0A 1WRDA 1Z0PA 5KX5E 2YN6A 2UUAT 3EDUA 2FBWA 5AQGB 1OEDC 1VOMA 3LG7A 4TX5A 3UUNA 3UQ7A 2W4XA 5CGMA 1MIVA 2WB5A 1WYBA 3I9YA 1HX8A 1O3XA 4KP3C 2E9XA 2ODVA 3GN5A 3M65A 3AA6B 5AQHB 3RKOA 4ERRA 2F4VT 2ACZA 4O2BE 5HXHA 4PJJA 3EVYA 2K9AA 4KHZF 2FUPA 4PJLA 4YXDA 3JAEA 1ZHCA 2BVLA 2LE8A 5DQWA 4X20E 1J5WA 1ZP0A 2D0TA 2K24A 4H9OC 4NPPA 5L4HA 3U78A 3VR9A 2ZM8A 3ZSSA 2CWYA 2UUCT 3BQLA 4AKIA 3PJAA 3AA7B 4E7ZA 2KSRA 3F2EA 5FY0A 4QH5A 3UTKA 1KNZA 3SOLA 2J47A 3AAEB 2WU2A 3PUSA 3UU4A 4EV6A 5HYAA 3FBZA 2L3LA 3Q5XA 4OYKA 4I0UA 2L9QA 3MKDA 3OBVE 4LF4T 2WSSV 4CXYA 2WCAA 3ZSTA 3UFGA 1OXZA 1YW0A 2VURA 1BR2A 3NBXX 2IC9A 3FZMB 3O1IA 3K3OA 2YDRA 3SFDA 4AKLA 5CFBA 5DABA 2VKHA 5JDQA 1IBLT 3KBTA 4YTNA 2XQ6A 1DU2A 2JQQA 3KV5A 4PFPA 1ZOYA 2V7LA 2XQ7A 4CXWA 4QHOA 3C50A 3OPCA 1LRZA 2LM9A 2RA1A 3D0TA 4HWDA 3EAMA 2PG8A 3PUVF 4QWNB 2XM2A 4JI7T 3MA9A 4UVAB 3HL6A 4CQIA 2CXDA 4OFZA 4TUYE 2VL0A 5C3JA 4G2AA 3RYCE 4JI1T 3N9OA 4DIDB 3P4PA 4PK5A 4X1KE 2ZM6T 3ZJ2A 1NAFA 4ZI7E 5L3CB 5ABFA 3Q5WA 3SRZA 4CN4A 4BA9A 3N2OA 3HKDE 3RYIE 1GQEA 1YD8G 4KUMB 4L5GA 1W0AA 5L3BB 1XZYA 4JUYA 2Q9QD 2V26A 4DMVA 4MFRA 4NIQA 4WBNE 4HFEA 4IT4A 4WBOA 4LF8T 5AQRB 3ONJA 3RIUA 5EK2A 3Q5DA 3IHRA 2OV9A 3HR0A 2WMOA 1EZ3A 1Y01A 2WU5A 4PNIA 4AI6A 2IDOB 2VB6A 4GYRA 5FKYA 2BKOA 3P4QA 4Z8XA 2JPFA 4IE0A 4GKJT 2A2FX 3R6NA 4EOZB 3PDYA 4DR6T 5A1LA 2KINB 4LF9T 2WMNA 2WY2A 2H7VC 3RIAA 2OA5A 4TV9E 3OYXA 2J4GA 3CX8B 5L3FB 4AIUA 2XTLA 5HXSA 4IIJE 3I0QA 5FY7A 4DUZT 4DV4T 2C0SA 1ZKEA 2WM9A 3CMLA 3PURA 4IL9A 1MMGA 3AE6A 4H9RC 4XAXB 4TZ4C 3DP7A 3UQ4A 4DV6T 3AECA 4HN9A
chains in the Genus database with same CATH topology
2ZMAA 1UX5A 2K48A 2RP4A 2W0GA 4I4TE 2ZM0A 1X79A 2ZM2A 3C4ZA 4YJ3E 2QA7A 1YKEB 1BR1A 4EYYR 5JDHA 3CX6B 3GWHA 3CVRA 2H3RA 1ZV4X 2Y8DA 1ZEEA 2IW5B 4EZ4A 2VKDA 4UV9B 4PW8A 5JDGA 2BZBA 3RRCA 2MOZA 4YHJA 1E1HB 4EXTA 5J2UE 2X9XA 5ADXL 4E7SA 5F3JA 5FXWA 3AB3B 4B6XA 3ZC0A 2M67A 5TAOA 3P8CD 2HPJA 3ZPOA 1QUUA 1B7TA 4UELA 2Q9QB 4ISTA 2BDEA 3LK3B 4U74A 3R84B 5LNKA 2MTQA 1BR4A 1HTJF 4HTEA 1FMVA 3AA1B 4ZOLE 4IGUA 5LHGB 4AQFA 3KV6A 2PFVA 3CQXC 3AVRA 2VKOA 2BVMA 4IE4A 3B57A 3PUQA 1MMNA 5ETWA 2LHRA 5LBQB 4N78D 1LKXA 2P9BA 5FP3A 3ZEFB 4PAGA 1MIYA 2DHRA 2DCFA 4O4JE 3JC6D 5FMNA 4DMWA 2LSJA 3LBXB 3IF8B 1U4QA 3E0ZA 1MIWA 4K0UA 4PJMA 4C91A 2KMFA 3PUAA 2LJLA 5JRCA 4H63V 2QGSA 5HAXA 4EAHA 1D0XA 4CZZB 4FI5A 3O1HA 4FJOA 5JDLA 2W63A 1HG2A 2CEAA 2E9XB 4P0BA 2N2NA 3ZYLA 2B1EA 3CX7B 3PTRB 3L3PA 2LSKA 4BJMA 5HWYA 2PBIA 2YINA 4QX7B 4G63A 2Q9QC 2X68A 4HKAA 3L09A 4AKRB 5AFUL 3BK9A 1G8XA 2Z6EA 3HKBE 2C5KT 4H9PC 4EB6E 3UUXB 2DWGA 4UEMA 1NWMX 5JDFA 3FXDB 5FYMA 4UV8B 4YJ2E 3E08A 4IE7A 3EDVA 1SHZC 3RH3A 5LGNB 1FMWA 2EHOB 4PK4A 3VKGA 5LBMA 5L3EB 2Q9QA 2LSYA 3WAJA 3MJXA 5H6QB 5LYJE 1G73A 2NW7A 4MALA 2CXLA 2JMHA 3RPUA 4UXNB 5BMVE 3KV9A 4I50E 2VWAA 4QXBB 1HFAA 5JR9A 3ZLIA 4NUVA 1IJ5A 2NTYA 2CXFA 2LSGA 3LJCA 5HXEA 4JLEA 2NW8A 3FXEB 3ZN1B 2Y48B 4ZI3D 3N9MA 2NTXA 5F8PA 5LXTE 5JRCB 3UFEA 4IDZA 4QX8B 1MMDA 2KWIB 4GK0E 4C90A 5H6RB 3E22E 5HXCA 3OKQA 4ILUA 3ZN0B 4O2AE 2LSIA 2X9WA 3C98B 3CPZA 5CB4E 4WNKA 4PFOA 5EK4A 3ZYMA 5JR9C 5JR9B 3V5UA 3BQKA 5LP6E 3VHLA 3IEEA 5FXVA 3ZYKA 3W15B 2I59A 3H37A 2VKJA 3WI3A 3ZCIA 3ZMVB 2VASA 2XAQB 3K3QC 4UVBB 4ZS3A 4UF0B 1LVFA 2XAHB 3CKDA 5CA1E 3QK6A 2DI4A 4HEAA 3NZPA 4XBFB 2LOPA 2VL8A 2MBGA 4BAYB 4NUUA 3AA0B 3K8PC 1H7CA 3NZQA 3RRWA 3ETVA 2ES0A 2GK9A 3ZMUB 2X67A 1AJ3A 3UT5E 3GN5B 1Y64B 3FHNA 2XAJB 3MXZA 3OYZA 2HPLA 1D0ZA 2XQYA 2XUEA 3QC9A 4I43B 1MNEA 3KBUA 2A3DA 2CE7A 1HCIA 3H3AA 4I55E 4KBMB 4O4HE 2CCQA 2V7KA 1D0YA 4UVCB 4KMCA 3N9NA 3RC3A 4L9IA 4GOUA 4HGAA 4M1PA 3N2KE 4ZI2D 5JREA 3VKHA 3ANWA 3U3IA 4ZS2A 3MK7C 1KK7A 3RC8A 5L3DB 1D1AA 3LK42 5LJNA 3KDSE 3J9X1 5C8YE 5LHHB 2CLYC 2EHOA 3SWHA 2CM0A 2E9XC 3I0OA 2XHEB 2J1DG 3CQCB 3LBXA 3O1JA 3GMIA 4X1YE 2WBLA 4V1Av 3DTOA 3ZMZB 3F31A 4ANJA 3NRYA 2WAUA 4HE8A 1HG5A 4O4LE 4PK6A 4TN7B 5LJMA 3KVBA 5HWXA 5HXRA 2K5BB 4O8SA 2ODUA 2W00A 3EUHA 4P0AA 2NP9A 4GIWA 4AXPA 3O4XE 4OK0A 5LOVE 2JMKA 4QXCB 1SA0E 1UCUA 4AQFC 2KLQA 4YLHA 1WR6A 2CA5A 3QUJA 5DJQC 4BJNA 3PU3A 5LCYA 1YKHB 4QXHB 4GK5E 4CI3B 3T8OA 5LA6E 4IE5A 2X66A 4EIWA 2PJQA 3ZC1A 1MMAA 5L2LA 1CUNA 4OYJA 4DBQA 5J2TE 1OWAA 2V7MA 1MNDA 4A56A 2N1GA 3HA4A 4J2CA 3LFMA 4ISSA 2DNXA 3N9PA 5FXXA 4PJNA 5EZYE 2X51A 4QKNA 5JH7E 4CXXA 2L8KA 3ANWB 2D5UA 1S35A 4IHJE 2LEHA 5GONE 3KINB 3AVSA 2CWOA 3MACA 4H9NC 5KDMC 2N9DA 4UF0A 3FB2A 3VU7H 2YU1A 2KWHA 3RX6A 2E9XD 2KXPB 5IHYA 4H9SE 2IAKA 4F6RC 5JQGE 1U5PA 3UTKA 5FXZA 3ZCJA 2YK0A 1IJ6A 3N9LA 1D1CA 1BR0A 4AKHA 4CI1B 4CI2B 5IYZE 3BQIA 2SPCA 3IBPA 3CWZB 2DWKA 2H7OA 3J7Yq 4OHFA 2XAFB 3MZKB 2X0LB 3KFWX 3K3NA 4ZI3C 2UXXB 4GYSA 2IC6A 3HKCE 3NRXA 4DBRA 1UX4A 1T98A 4H9QC 2G0UA 4WW0A 3ONXA 4U72A 4HFVA 3A5XA 5CA0E 4XZCA 2KT9A 3ESLA 2E8IA 4TV8E 3KVAA 5FNVE 5JDMA 3V5SA 4O4IE 1US7B 3C64A 3AAIA 4DVDA 3RYHE 4ZI2C 2JJ9A 3Q2MA 2C5JA 3KV4A 3SS1A 3PU8A 3GA8A 4AKGA 2LHNA 5LG4A 3UUMA 2ZLYA 2VK9A 2V1DB 3LK2B 3N2GE 3OJAA 4ZHQE 1D1BA 5J1GA 4IE6A 4MBQA 2CLYB 3C51A 3RYFE 4AQGA 2XASB 3UULA 2YU2A 4ADZA 2D2SA 2C5IT 4MLKA 2KNDA 4JEUB 2NWBA 2LT3A 3CQGB 2NOXA 2A72A 3FBLA 2EHOD 2UXNB 3N5LA 4ASKA 2X9YA 2HH7A 3ZMTB 1HS7A 2NW9A 5LGUB 3HKEE 3PUGA 4YFSA 1IAPA 3ZJ1A 2XAGB 5KMGP 4MHCA 3I9WA 1WYCA 3TKLB 3C4WA 2V7JA 2W61A 1WLXA 2DLRA 5FY1A 3Q9DA 5JVDE 4EYUA 1FIOA 4DNDA 3AAAB 1S94A 3HI2A 3P7IA 4UIGA 3ETUA 2W62A 4P09A 4X1IE 1V9DA 2WWUA 3WAKA 1QSDA 4EZHA 3ZMSB 5M4YA 2D0UA 2V7IA 2YEVC 2MYSA 2CMRA 2KZ7B 5DQVA 5JDNA 2LOSA 5E0OA 3F57A 5LGTB 3B13A 3C4XA 4L0RA 1VRBA 3JC6C 3PE0A 3DJBA 2JRKA 2X9HA 2ACXA 2Y6XA 1HF8A 1IZNB 5L3GB 1LVKA 2EHOC 4JEHB 3I1AA 4H63H 5LHIB 5EK3A 3S4UA 3N9QA 1FEWA 4DO0A 1WRDA 1Z0PA 5KX5E 3EDUA 1VOMA 3LG7A 4TX5A 3UUNA 1MIVA 1WYBA 3I9YA 1HX8A 1O3XA 4KP3C 2E9XA 3GN5A 2ODVA 3M65A 3AA6B 3RKOA 4ERRA 4O2BE 5HXHA 4PJJA 3EVYA 2K9AA 4PJLA 1ZHCA 2BVLA 2LE8A 5DQWA 4X20E 2D0TA 2K24A 4H9OC 3U78A 2ZM8A 2CWYA 3BQLA 4AKIA 3AA7B 4E7ZA 3F2EA 5FY0A 1KNZA 3SOLA 3AAEB 5HYAA 3PUSA 3FBZA 2L3LA 3Q5XA 4OYKA 2L9QA 3MKDA 3OBVE 2WSSV 4CXYA 1OXZA 1YW0A 3NBXX 1BR2A 3O1IA 2IC9A 4AKLA 3K3OA 5JDQA 5DABA 2VKHA 3KBTA 2JQQA 3KV5A 4PFPA 2V7LA 4CXWA 4QHOA 3C50A 1LRZA 2LM9A 2RA1A 3D0TA 2PG8A 4QWNB 3MA9A 4UVAB 3HL6A 4CQIA 2CXDA 4OFZA 4TUYE 4G2AA 3RYCE 3N9OA 4PK5A 4X1KE 3ZJ2A 1NAFA 4ZI7E 5L3CB 3Q5WA 3SRZA 4BA9A 3N2OA 3HKDE 3RYIE 4KUMB 1YD8G 4L5GA 5L3BB 4JUYA 2Q9QD 2V26A 4DMVA 4MFRA 4WBNE 4WBOA 5EK2A 3IHRA 3HR0A 2WMOA 1EZ3A 4PNIA 4AI6A 2VB6A 4GYRA 4Z8XA 2JPFA 4IE0A 2A2FX 3R6NA 4EOZB 3PDYA 5A1LA 2KINB 2WMNA 2H7VC 2OA5A 4TV9E 3OYXA 3CX8B 5L3FB 2XTLA 5HXSA 4IIJE 3I0QA 5FY7A 3CMLA 2C0SA 1ZKEA 2WM9A 3PURA 4XAXB 1MMGA 4H9RC 4TZ4C 3DP7A 3O9XA 4HN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 C;  5JRC A;  5JR9 A;  5JR9 B;  3ZC0 A;  5JRE A;  3ZC1 A;  5JRC B; 
#chains in the Genus database with same CATH topology
 2V8S V;  2ZMA A;  1UX5 A;  2K48 A;  2RP4 A;  2W0G A;  3L39 A;  2E5V A;  1X79 A;  2ZM2 A;  2ZM0 A;  3C4Z A;  2QA7 A;  1YKE B;  1BR1 A;  2OLT A;  3A8Y C;  3CIR A;  3CX6 B;  3CVR A;  3GWH A;  2XQ4 A;  2H3R A;  5FL0 A;  3ZT5 A;  4DV2 T;  1ZV4 X;  2Y8D A;  1ZEE A;  2IW5 B;  4EZ4 A;  1YXR A;  2VKD A;  4UV9 B;  1T8B A;  4PW8 A;  5JDG A;  4DR1 T;  2BZB A;  4X1Y E;  2MOZ A;  4YHJ A;  1E1H B;  3RRC A;  4EXT A;  5J2U E;  2X9X A;  4IDQ A;  5ADX L;  4E7S A;  5F3J A;  2IIU A;  3T1H T;  5FXW A;  3AB3 B;  4JI5 T;  4YJ3 E;  3P4S A;  4B6X A;  3ZC0 A;  2M67 A;  2VVN A;  5TAO A;  4A97 A;  3P8C D;  2HPJ A;  3ZPO A;  1QUU A;  1B7T A;  4UEL A;  4U3C A;  2Q9Q B;  4IST A;  2MAW A;  2WP9 A;  2UXD T;  2BDE A;  3LK3 B;  4U74 A;  3R84 B;  4JBW F;  4X64 T;  5LNK A;  2MTQ A;  2WQY A;  2UXB T;  2CBJ A;  1BR4 A;  1HTJ F;  2JQK A;  4HTE A;  1IBM T;  1FMV A;  2LKH A;  3AA1 B;  4ZOL E;  4YT0 A;  5AQF B;  5ABE A;  5FVK A;  1E2A A;  2W66 A;  4IGU A;  5LHG B;  4AQF A;  5IWA T;  3KV6 A;  2PFV A;  3G06 A;  3CQX C;  2VQE T;  3AVR A;  2VKO A;  4QH4 A;  5HCJ A;  2BVM A;  3ABV A;  2CBI A;  4IE4 A;  5HEJ A;  3B57 A;  3PUQ A;  1MMN A;  2CHN A;  5ETW A;  3RIU C;  4QH1 A;  2LHR A;  5LBQ B;  3PJA J;  4N78 D;  4TWD A;  1LKX A;  2P9B A;  2X0Y A;  5FP3 A;  3ZEF B;  1IBK T;  4PAG A;  1MIY A;  2DHR A;  2DCF A;  4O4J E;  3JC6 D;  5FMN A;  1J5E T;  1KFY A;  4DMW A;  2LSJ A;  3LBX B;  3IF8 B;  1U4Q A;  1UUR A;  3E0Z A;  2IHR 1;  1MIW A;  1WFD A;  3AE8 A;  4K0U A;  4PJM A;  4C91 A;  5HEO A;  3PUZ F;  2KMF A;  3PUA A;  2LJL A;  1HNX T;  5HEG A;  1XMO T;  5JRC A;  2V5D A;  4H63 V;  2QGS A;  5HAX A;  4TNV A;  1D0X A;  4EAH A;  5IUX A;  5AQP B;  4HFB A;  5AQV B;  2V6Y B;  4FI5 A;  4CZZ B;  3O1H A;  4FJO A;  5JDL A;  2W63 A;  1HG2 A;  5ABF B;  2CEA A;  2E9X B;  2LRK A;  2N2N A;  4P0B A;  4TWF A;  3ZYL A;  4HFH A;  3ZT6 A;  4HFI A;  2V6Y A;  2B1E A;  3CX7 B;  3PTR B;  3L3P A;  2LSK A;  2LKG A;  4BJM A;  1N33 T;  4YSY A;  5CJ5 A;  4LMJ A;  2PBI A;  2YIN A;  4QX7 B;  2WS3 A;  4G63 A;  2Q9Q C;  5HWY A;  2YDQ A;  4Z90 A;  4DV1 T;  2X68 A;  4HKA A;  3L09 A;  4AKR B;  5AFU L;  3BK9 A;  4A5X A;  1G8X A;  2Z6E A;  3AXJ B;  2HN1 A;  3HKB E;  2C5K T;  4JI6 T;  4H9P C;  4EB6 E;  3UUX B;  1XNQ T;  2DWG A;  3PV0 F;  1NWM X;  3AE1 A;  4UEM A;  5JDF A;  2V6X A;  3FXD B;  4IDP A;  5AQM B;  5FYM A;  3RKG A;  2K3W A;  4UV8 B;  3VRB A;  1M7K A;  3E08 A;  4YJ2 E;  3AE5 A;  4IE7 A;  1T7S A;  3EDV A;  1SHZ C;  4YSX A;  3RH3 A;  5LGN B;  1FMW A;  4F8H A;  4DR7 T;  2EHO B;  3OVU A;  4PK4 A;  3VKG A;  5LBM A;  2BKP A;  2YOE A;  2Q9Q A;  1L0V A;  5L3E B;  2LSY A;  5JDH A;  1UUS A;  3WAJ A;  4GKK T;  3MJX A;  5ABH A;  5H6Q B;  5LYJ E;  1G73 A;  2BS3 A;  2NW7 A;  4MAL A;  2CXL A;  4EED A;  2WZH A;  2JMH A;  3RPU A;  4UXN B;  5BMV E;  2E2A A;  3KV9 A;  3QOF A;  4I50 E;  2VWA A;  4YY3 T;  4X65 T;  4QXB B;  1HFA A;  5JR9 A;  3ZLI A;  5JTG A;  4NUV A;  4IL4 A;  1IJ5 A;  2NTY A;  2CXF A;  2D9D A;  2LSG A;  1W09 A;  3LJC A;  5HXE A;  1WCR A;  3AEA A;  4JLE A;  4HWF A;  2NW8 A;  3FXE B;  1N34 T;  3ZN1 B;  2Y48 B;  4ZI3 D;  2XSA A;  3N9M A;  2H88 A;  2NTX A;  3Q5E A;  4U31 A;  5F8P A;  5LXT E;  4B3M T;  5JRC B;  1QLB A;  4AQY T;  2FJB A;  3UFE A;  4IDZ A;  1WR0 A;  2CPT A;  1MMD A;  2KWI B;  4GK0 E;  4QX8 B;  4C90 A;  4P1N A;  5H6R B;  4NXN T;  3E22 E;  5HXC A;  3OKQ A;  4ILU A;  3ZN0 B;  4KI0 F;  2LSI A;  2XY8 B;  4O2A E;  2X9W A;  4DV7 T;  1I94 T;  2BKN A;  3C98 B;  3CPZ A;  3AEB A;  1X9B A;  5LB7 B;  5CB4 E;  3RIF A;  1I6Z A;  1HNW T;  4WNK A;  4PFO A;  5EK4 A;  3UUB A;  3EAB A;  3ZYM A;  5JR9 C;  5HCM A;  2LM2 A;  2QYW A;  3V5U A;  5JR9 B;  1Z8U A;  3BQK A;  4TWH A;  3VHL A;  3IEE A;  5LP6 E;  4U2Y A;  5FXV A;  3ZYK A;  3L8R A;  3W15 B;  2I59 A;  3H37 A;  2BBH A;  2IUB A;  2VKJ A;  5F5W A;  5HEU A;  3WI3 A;  3ZCI A;  1J1J A;  3VKH A;  5ABG A;  5FL1 A;  3ZMV B;  4ZZC A;  2VAS A;  2XAQ B;  3K3Q C;  4UVB B;  4ZS3 A;  4YHH T;  4UF0 B;  1JNZ A;  4YTM A;  1LVF A;  2BBJ A;  2XAH B;  3CKD A;  3PUY F;  5CA1 E;  2LLY A;  3QK6 A;  4HFC A;  1N36 T;  2DI4 A;  4HEA A;  1CHU A;  2JQ9 A;  3NZP A;  5J0Z A;  2LOP A;  2VL8 A;  2MBG A;  4BAY B;  4NUU A;  3AA0 B;  4XBF B;  3K8P C;  1H7C A;  3NZQ A;  4WYV A;  3ETV A;  2ES0 A;  3RRW A;  2GK9 A;  1R8I A;  4OX9 T;  4CN6 A;  3ZMU B;  3PUW F;  2X67 A;  1AJ3 A;  2UUB T;  3UT5 E;  3GN5 B;  3VR8 A;  5LMN T;  2QRX A;  3O9X A;  1Y64 B;  2BS2 A;  2XAJ B;  3FHN A;  3MXZ A;  3OYZ A;  2HPL A;  1D0Z A;  1W0B A;  2M6B A;  2XQY A;  2XUE A;  1VCS A;  3FZK B;  2VVS A;  3QC9 A;  3K1S A;  1MNE A;  4I43 B;  3KBU A;  4HFD A;  2A3D A;  2CE7 A;  4TNW A;  2HHH T;  1HCI A;  3AEE A;  3H3A A;  3JCF A;  4I55 E;  4KBM B;  4O4H E;  2CCQ A;  2V7K A;  1D0Y A;  4UVC B;  4KMC A;  3N9N A;  3RC3 A;  4L9I A;  3LSV A;  3NKZ A;  4GOU A;  3N2K E;  4HGA A;  4M1P A;  3AXJ A;  5HEH A;  4ZI2 D;  5JRE A;  3ANW A;  1OED A;  3U3I A;  4ZS2 A;  1XDP A;  5FVL A;  3RQU A;  3MK7 C;  4Z91 A;  1E7P A;  1KK7 A;  3RC8 A;  1HR0 T;  2WDQ A;  5AQO B;  5L3D B;  1D1A A;  3LK4 2;  2AXD S;  3KDS E;  1KNP A;  5AQU B;  3J9X 1;  5C8Y E;  2CLY C;  5LHH B;  5LJN A;  2EHO A;  3SWH A;  2CM0 A;  1HX1 B;  2E9X C;  2XHE B;  2J1D G;  3CQC B;  3I0O A;  3LBX A;  3GMI A;  3O1J A;  4DV3 T;  2WBL A;  4V1A v;  3DTO A;  2UXC T;  3ZMZ B;  3F31 A;  4ANJ A;  3NRY A;  2WAU A;  4HE8 A;  1HG5 A;  4O4L E;  4PK6 A;  4TN7 B;  5AQS B;  2XZE A;  3UU5 A;  5LJM A;  2A9U A;  3KVB A;  5HWX A;  4DV0 T;  5HXR A;  2K5B B;  2WDV A;  3P50 A;  3EHZ A;  3AE4 A;  4O8S A;  5AQQ B;  4EEB A;  2XQ5 A;  2ODU A;  2W00 A;  3EUH A;  3RLF F;  4P0A A;  2NP9 A;  4GIW A;  4AXP A;  3O4X E;  4OK0 A;  5LOV E;  2JMK A;  3M3Z B;  4QXC B;  3ZT7 A;  1SA0 E;  1UCU A;  3QB5 K;  2XPK A;  4AQF C;  2XSB A;  1XMQ T;  4LF7 T;  2KLQ A;  4LF6 T;  4YLH A;  1WR6 A;  2CA5 A;  4X5T A;  3TLV A;  3QUJ A;  5KXJ A;  5DJQ C;  4UR9 A;  2W67 A;  4BJN A;  3PU3 A;  5LCY A;  2XQ3 A;  1YKH B;  3FZL B;  4B3S T;  4KHP T;  4QXH B;  2XM1 A;  1NEK A;  4GK5 E;  5AQT B;  4CI3 B;  3T8O A;  5LA6 E;  4IE5 A;  2X66 A;  3UU8 A;  4EIW A;  2I0M A;  2PJQ A;  4DUY T;  3ZC1 A;  1MMA A;  1XWM A;  2B76 A;  3T1Y T;  3P4W A;  5L2L A;  1CUN A;  4OYJ A;  3RQW A;  4DBQ A;  4DV5 T;  5J2T E;  1OWA A;  2V7M A;  1MND A;  4A56 A;  4B3R T;  2N1G A;  3HA4 A;  4J2C A;  2H89 A;  3ONL C;  4JI0 T;  3LFM A;  4ISS A;  2DNX A;  3N9P A;  5FXX A;  4PJN A;  2WWV A;  5BR8 T;  2WDR A;  4HWI B;  4DR3 T;  2YKS A;  5EZY E;  4DR5 T;  3RGL A;  3AE3 A;  2X51 A;  4QKN A;  5JH7 E;  3AEF A;  4CXX A;  2L8K A;  3ANW B;  3P4R A;  2PTF A;  4DR4 T;  2D5U A;  1S35 A;  4IHJ E;  2LEH A;  2FJA A;  2LRL A;  5GON E;  3KIN B;  3AVS A;  2CWO A;  5L47 A;  4U7I A;  3MAC A;  4H9N C;  5KDM C;  2N9D A;  4UF0 A;  2BS4 A;  3FB2 A;  3VU7 H;  4IDO A;  2YU1 A;  2KWH A;  3RX6 A;  2E9X D;  2KXP B;  5IHY A;  4H9S E;  2IAK A;  4F6R C;  3JAF A;  2XQ9 A;  5JQG E;  1U5P A;  2R6G F;  2V5C A;  2XJ7 A;  5AQJ B;  2YK0 A;  5FXZ A;  1IJ6 A;  1M62 A;  1D1C A;  1OED B;  3N9L A;  3ZCJ A;  1BR0 A;  4CI1 B;  2MPK A;  4CI2 B;  3EI0 A;  4AKH A;  2QVA A;  4JI3 T;  5IYZ E;  3BQI A;  2JQH A;  2SPC A;  3IBP A;  2JIW A;  3CWZ B;  2DWK A;  2H7O A;  3J7Y q;  4OHF A;  3AED A;  1FJG T;  2XAF B;  3MZK B;  1YQ4 A;  2X0L B;  3KFW X;  3QNU A;  3K3N A;  4ZI3 C;  2UXX B;  4GYS A;  2IC6 A;  3HKC E;  3NRX A;  4DBR A;  1UX4 A;  1T98 A;  4X62 T;  4H9Q C;  4AIS A;  2G0U A;  3AE2 A;  3OTO T;  4U33 A;  5AQL B;  4WW0 A;  3TLT A;  1XDO A;  3ONX A;  2W2U A;  4B3T T;  3TLS A;  2RPA A;  4HFV A;  4LMK A;  4U72 A;  2BG9 B;  3IA3 A;  1YQ3 A;  2UU9 T;  4JI8 T;  3A5X A;  5CA0 E;  1KF6 A;  4XZC A;  2KT9 A;  3ESL A;  5AQI B;  2E8I A;  4TV8 E;  3RHW A;  3KVA A;  5FNV E;  3FZF B;  3V5S A;  4O4I E;  5JDM A;  3NVO A;  1US7 B;  3C64 A;  3AAI A;  3QB5 A;  4DVD A;  3RYH E;  4ZI2 C;  4ZEY A;  2JJ9 A;  3Q2M A;  2C5J A;  3KV4 A;  3SS1 A;  2WZI A;  3PU8 A;  2XQ8 A;  3GA8 A;  4U7Y A;  4DR2 T;  4AKG A;  5AQN B;  1N32 T;  2LHN A;  2NR4 A;  5LG4 A;  4LF5 T;  4KX6 A;  3SFE A;  3UUM A;  4Q25 A;  3TLU A;  2CRB A;  2ZLY A;  2VK9 A;  2V1D B;  3FZH B;  3LK2 B;  3N2G E;  4CN1 A;  3OJA A;  4ZHQ E;  3PUX F;  4JYA T;  1D1B A;  5J1G A;  3AE9 A;  4IDN A;  3VRA A;  2FJD A;  1W9R A;  3X1D A;  3UU6 A;  4IE6 A;  4MBQ A;  2CLY B;  3C51 A;  3RYF E;  2J62 A;  2XAS B;  3UUL A;  4AQG A;  4ZZB A;  1SE7 A;  4X66 T;  4K0K T;  2YU2 A;  5L4E A;  4COF A;  4ADZ A;  1JNR A;  2D2S A;  2BG9 E;  2BG9 A;  2C5I T;  4MLK A;  2KND A;  3H3M A;  4ILC A;  2XQA A;  2NWB A;  4JEU B;  4A98 A;  2LT3 A;  3CQG B;  2NOX A;  2A72 A;  3FBL A;  2EHO D;  2UXN B;  3N5L A;  4I4T E;  4ASK A;  2X9Y A;  2HH7 A;  3RI5 A;  3ZMT B;  3A7M A;  5LG3 A;  2NW9 A;  1HS7 A;  5LGU B;  3HKE E;  2HN2 A;  3PUG A;  1XNR T;  3B5M A;  4YFS A;  2E5L T;  4JV5 T;  1IAP A;  3JAD A;  3ZJ1 A;  2XAG B;  2M6I A;  4YSZ A;  5KMG P;  4NXM T;  4LFB T;  4MHC A;  3I9W A;  5AQK B;  1WYC A;  3TKL B;  1SUM B;  3C4W A;  2V7J A;  2W61 A;  1NEN A;  2CHO A;  1UK5 A;  1WLX A;  3ZKR A;  2DLR A;  3LDQ B;  5FY1 A;  3Q9D A;  4WZX A;  5JVD E;  4EYU A;  1FIO A;  1VCT A;  2IML A;  4DND A;  5C2T A;  3AAA B;  4LFA T;  1S94 A;  3HI2 A;  3TLW A;  3P7I A;  4UIG A;  3ETU A;  1OED E;  2W62 A;  4U2Z A;  4LFC T;  4P09 A;  4JI2 T;  4X1I E;  4LML A;  2X0H A;  1V9D A;  1UGO A;  2WWU A;  4ILB A;  2FJE A;  1QSD A;  3WAK A;  3ZMS B;  4EZH A;  2D0U A;  2V7I A;  4YTP A;  2YEV C;  2MYS A;  5M4Y A;  2AE9 A;  4IRE A;  2I6H A;  2BG9 C;  2CMR A;  2KZ7 B;  5DQV A;  3AEG A;  5JDN A;  2LOS A;  5E0O A;  3F57 A;  4ILA A;  3RF1 A;  5LGT B;  3NWI A;  3B13 A;  3C4X A;  4L0R A;  1VRB A;  3JC6 C;  3PE0 A;  3UU3 A;  5LMU T;  3DJB A;  2JRK A;  4JI4 T;  2X9H A;  2YDS A;  2ACX A;  1T72 A;  2Y6X A;  1HF8 A;  1IZN B;  4HWC A;  1KEY A;  5L3G B;  4HWH A;  1LVK A;  2EHO C;  3AE7 A;  2VQF T;  4JEH B;  3CK6 A;  3I1A A;  4H63 H;  4EYY R;  5LHI B;  1KNR A;  5EK3 A;  2DL1 A;  3S4U A;  1HNZ T;  3N9Q A;  4ZXL A;  1FEW A;  4EGW A;  4DO0 A;  1WRD A;  1Z0P A;  5KX5 E;  2YN6 A;  2UUA T;  3EDU A;  2FBW A;  5AQG B;  1OED C;  1VOM A;  3LG7 A;  4TX5 A;  3UUN A;  3UQ7 A;  2W4X A;  5CGM A;  1MIV A;  2WB5 A;  1WYB A;  3I9Y A;  1HX8 A;  1O3X A;  4KP3 C;  2E9X A;  2ODV A;  3GN5 A;  3M65 A;  3AA6 B;  5AQH B;  3RKO A;  4ERR A;  2F4V T;  2ACZ A;  4O2B E;  5HXH A;  4PJJ A;  3EVY A;  2K9A A;  4KHZ F;  2FUP A;  4PJL A;  4YXD A;  3JAE A;  1ZHC A;  2BVL A;  2LE8 A;  5DQW A;  4X20 E;  1J5W A;  1ZP0 A;  2D0T A;  2K24 A;  4H9O C;  4NPP A;  5L4H A;  3U78 A;  3VR9 A;  2ZM8 A;  3ZSS A;  2CWY A;  2UUC T;  3BQL A;  4AKI A;  3PJA A;  3AA7 B;  4E7Z A;  2KSR A;  3F2E A;  5FY0 A;  4QH5 A;  3UTK A;  1KNZ A;  3SOL A;  2J47 A;  3AAE B;  2WU2 A;  3PUS A;  3UU4 A;  4EV6 A;  5HYA A;  3FBZ A;  2L3L A;  3Q5X A;  4OYK A;  4I0U A;  2L9Q A;  3MKD A;  3OBV E;  4LF4 T;  2WSS V;  4CXY A;  2WCA A;  3ZST A;  3UFG A;  1OXZ A;  1YW0 A;  2VUR A;  1BR2 A;  3NBX X;  2IC9 A;  3FZM B;  3O1I A;  3K3O A;  2YDR A;  3SFD A;  4AKL A;  5CFB A;  5DAB A;  2VKH A;  5JDQ A;  1IBL T;  3KBT A;  4YTN A;  2XQ6 A;  1DU2 A;  2JQQ A;  3KV5 A;  4PFP A;  1ZOY A;  2V7L A;  2XQ7 A;  4CXW A;  4QHO A;  3C50 A;  3OPC A;  1LRZ A;  2LM9 A;  2RA1 A;  3D0T A;  4HWD A;  3EAM A;  2PG8 A;  3PUV F;  4QWN B;  2XM2 A;  4JI7 T;  3MA9 A;  4UVA B;  3HL6 A;  4CQI A;  2CXD A;  4OFZ A;  4TUY E;  2VL0 A;  5C3J A;  4G2A A;  3RYC E;  4JI1 T;  3N9O A;  4DID B;  3P4P A;  4PK5 A;  4X1K E;  2ZM6 T;  3ZJ2 A;  1NAF A;  4ZI7 E;  5L3C B;  5ABF A;  3Q5W A;  3SRZ A;  4CN4 A;  4BA9 A;  3N2O A;  3HKD E;  3RYI E;  1GQE A;  1YD8 G;  4KUM B;  4L5G A;  1W0A A;  5L3B B;  1XZY A;  4JUY A;  2Q9Q D;  2V26 A;  4DMV A;  4MFR A;  4NIQ A;  4WBN E;  4HFE A;  4IT4 A;  4WBO A;  4LF8 T;  5AQR B;  3ONJ A;  3RIU A;  5EK2 A;  3Q5D A;  3IHR A;  2OV9 A;  3HR0 A;  2WMO A;  1EZ3 A;  1Y01 A;  2WU5 A;  4PNI A;  4AI6 A;  2IDO B;  2VB6 A;  4GYR A;  5FKY A;  2BKO A;  3P4Q A;  4Z8X A;  2JPF A;  4IE0 A;  4GKJ T;  2A2F X;  3R6N A;  4EOZ B;  3PDY A;  4DR6 T;  5A1L A;  2KIN B;  4LF9 T;  2WMN A;  2WY2 A;  2H7V C;  3RIA A;  2OA5 A;  4TV9 E;  3OYX A;  2J4G A;  3CX8 B;  5L3F B;  4AIU A;  2XTL A;  5HXS A;  4IIJ E;  3I0Q A;  5FY7 A;  4DUZ T;  4DV4 T;  2C0S A;  1ZKE A;  2WM9 A;  3CML A;  3PUR A;  4IL9 A;  1MMG A;  3AE6 A;  4H9R C;  4XAX B;  4TZ4 C;  3DP7 A;  3UQ4 A;  4DV6 T;  3AEC A;  4HN9 A; 
#chains in the Genus database with same CATH homology
 2ZMA A;  1UX5 A;  2K48 A;  2RP4 A;  2W0G A;  4I4T E;  2ZM0 A;  1X79 A;  2ZM2 A;  3C4Z A;  4YJ3 E;  2QA7 A;  1YKE B;  1BR1 A;  4EYY R;  5JDH A;  3CX6 B;  3GWH A;  3CVR A;  2H3R A;  1ZV4 X;  2Y8D A;  1ZEE A;  2IW5 B;  4EZ4 A;  2VKD A;  4UV9 B;  4PW8 A;  5JDG A;  2BZB A;  3RRC A;  2MOZ A;  4YHJ A;  1E1H B;  4EXT A;  5J2U E;  2X9X A;  5ADX L;  4E7S A;  5F3J A;  5FXW A;  3AB3 B;  4B6X A;  3ZC0 A;  2M67 A;  5TAO A;  3P8C D;  2HPJ A;  3ZPO A;  1QUU A;  1B7T A;  4UEL A;  2Q9Q B;  4IST A;  2BDE A;  3LK3 B;  4U74 A;  3R84 B;  5LNK A;  2MTQ A;  1BR4 A;  1HTJ F;  4HTE A;  1FMV A;  3AA1 B;  4ZOL E;  4IGU A;  5LHG B;  4AQF A;  3KV6 A;  2PFV A;  3CQX C;  3AVR A;  2VKO A;  2BVM A;  4IE4 A;  3B57 A;  3PUQ A;  1MMN A;  5ETW A;  2LHR A;  5LBQ B;  4N78 D;  1LKX A;  2P9B A;  5FP3 A;  3ZEF B;  4PAG A;  1MIY A;  2DHR A;  2DCF A;  4O4J E;  3JC6 D;  5FMN A;  4DMW A;  2LSJ A;  3LBX B;  3IF8 B;  1U4Q A;  3E0Z A;  1MIW A;  4K0U A;  4PJM A;  4C91 A;  2KMF A;  3PUA A;  2LJL A;  5JRC A;  4H63 V;  2QGS A;  5HAX A;  4EAH A;  1D0X A;  4CZZ B;  4FI5 A;  3O1H A;  4FJO A;  5JDL A;  2W63 A;  1HG2 A;  2CEA A;  2E9X B;  4P0B A;  2N2N A;  3ZYL A;  2B1E A;  3CX7 B;  3PTR B;  3L3P A;  2LSK A;  4BJM A;  5HWY A;  2PBI A;  2YIN A;  4QX7 B;  4G63 A;  2Q9Q C;  2X68 A;  4HKA A;  3L09 A;  4AKR B;  5AFU L;  3BK9 A;  1G8X A;  2Z6E A;  3HKB E;  2C5K T;  4H9P C;  4EB6 E;  3UUX B;  2DWG A;  4UEM A;  1NWM X;  5JDF A;  3FXD B;  5FYM A;  4UV8 B;  4YJ2 E;  3E08 A;  4IE7 A;  3EDV A;  1SHZ C;  3RH3 A;  5LGN B;  1FMW A;  2EHO B;  4PK4 A;  3VKG A;  5LBM A;  5L3E B;  2Q9Q A;  2LSY A;  3WAJ A;  3MJX A;  5H6Q B;  5LYJ E;  1G73 A;  2NW7 A;  4MAL A;  2CXL A;  2JMH A;  3RPU A;  4UXN B;  5BMV E;  3KV9 A;  4I50 E;  2VWA A;  4QXB B;  1HFA A;  5JR9 A;  3ZLI A;  4NUV A;  1IJ5 A;  2NTY A;  2CXF A;  2LSG A;  3LJC A;  5HXE A;  4JLE A;  2NW8 A;  3FXE B;  3ZN1 B;  2Y48 B;  4ZI3 D;  3N9M A;  2NTX A;  5F8P A;  5LXT E;  5JRC B;  3UFE A;  4IDZ A;  4QX8 B;  1MMD A;  2KWI B;  4GK0 E;  4C90 A;  5H6R B;  3E22 E;  5HXC A;  3OKQ A;  4ILU A;  3ZN0 B;  4O2A E;  2LSI A;  2X9W A;  3C98 B;  3CPZ A;  5CB4 E;  4WNK A;  4PFO A;  5EK4 A;  3ZYM A;  5JR9 C;  5JR9 B;  3V5U A;  3BQK A;  5LP6 E;  3VHL A;  3IEE A;  5FXV A;  3ZYK A;  3W15 B;  2I59 A;  3H37 A;  2VKJ A;  3WI3 A;  3ZCI A;  3ZMV B;  2VAS A;  2XAQ B;  3K3Q C;  4UVB B;  4ZS3 A;  4UF0 B;  1LVF A;  2XAH B;  3CKD A;  5CA1 E;  3QK6 A;  2DI4 A;  4HEA A;  3NZP A;  4XBF B;  2LOP A;  2VL8 A;  2MBG A;  4BAY B;  4NUU A;  3AA0 B;  3K8P C;  1H7C A;  3NZQ A;  3RRW A;  3ETV A;  2ES0 A;  2GK9 A;  3ZMU B;  2X67 A;  1AJ3 A;  3UT5 E;  3GN5 B;  1Y64 B;  3FHN A;  2XAJ B;  3MXZ A;  3OYZ A;  2HPL A;  1D0Z A;  2XQY A;  2XUE A;  3QC9 A;  4I43 B;  1MNE A;  3KBU A;  2A3D A;  2CE7 A;  1HCI A;  3H3A A;  4I55 E;  4KBM B;  4O4H E;  2CCQ A;  2V7K A;  1D0Y A;  4UVC B;  4KMC A;  3N9N A;  3RC3 A;  4L9I A;  4GOU A;  4HGA A;  4M1P A;  3N2K E;  4ZI2 D;  5JRE A;  3VKH A;  3ANW A;  3U3I A;  4ZS2 A;  3MK7 C;  1KK7 A;  3RC8 A;  5L3D B;  1D1A A;  3LK4 2;  5LJN A;  3KDS E;  3J9X 1;  5C8Y E;  5LHH B;  2CLY C;  2EHO A;  3SWH A;  2CM0 A;  2E9X C;  3I0O A;  2XHE B;  2J1D G;  3CQC B;  3LBX A;  3O1J A;  3GMI A;  4X1Y E;  2WBL A;  4V1A v;  3DTO A;  3ZMZ B;  3F31 A;  4ANJ A;  3NRY A;  2WAU A;  4HE8 A;  1HG5 A;  4O4L E;  4PK6 A;  4TN7 B;  5LJM A;  3KVB A;  5HWX A;  5HXR A;  2K5B B;  4O8S A;  2ODU A;  2W00 A;  3EUH A;  4P0A A;  2NP9 A;  4GIW A;  4AXP A;  3O4X E;  4OK0 A;  5LOV E;  2JMK A;  4QXC B;  1SA0 E;  1UCU A;  4AQF C;  2KLQ A;  4YLH A;  1WR6 A;  2CA5 A;  3QUJ A;  5DJQ C;  4BJN A;  3PU3 A;  5LCY A;  1YKH B;  4QXH B;  4GK5 E;  4CI3 B;  3T8O A;  5LA6 E;  4IE5 A;  2X66 A;  4EIW A;  2PJQ A;  3ZC1 A;  1MMA A;  5L2L A;  1CUN A;  4OYJ A;  4DBQ A;  5J2T E;  1OWA A;  2V7M A;  1MND A;  4A56 A;  2N1G A;  3HA4 A;  4J2C A;  3LFM A;  4ISS A;  2DNX A;  3N9P A;  5FXX A;  4PJN A;  5EZY E;  2X51 A;  4QKN A;  5JH7 E;  4CXX A;  2L8K A;  3ANW B;  2D5U A;  1S35 A;  4IHJ E;  2LEH A;  5GON E;  3KIN B;  3AVS A;  2CWO A;  3MAC A;  4H9N C;  5KDM C;  2N9D A;  4UF0 A;  3FB2 A;  3VU7 H;  2YU1 A;  2KWH A;  3RX6 A;  2E9X D;  2KXP B;  5IHY A;  4H9S E;  2IAK A;  4F6R C;  5JQG E;  1U5P A;  3UTK A;  5FXZ A;  3ZCJ A;  2YK0 A;  1IJ6 A;  3N9L A;  1D1C A;  1BR0 A;  4AKH A;  4CI1 B;  4CI2 B;  5IYZ E;  3BQI A;  2SPC A;  3IBP A;  3CWZ B;  2DWK A;  2H7O A;  3J7Y q;  4OHF A;  2XAF B;  3MZK B;  2X0L B;  3KFW X;  3K3N A;  4ZI3 C;  2UXX B;  4GYS A;  2IC6 A;  3HKC E;  3NRX A;  4DBR A;  1UX4 A;  1T98 A;  4H9Q C;  2G0U A;  4WW0 A;  3ONX A;  4U72 A;  4HFV A;  3A5X A;  5CA0 E;  4XZC A;  2KT9 A;  3ESL A;  2E8I A;  4TV8 E;  3KVA A;  5FNV E;  5JDM A;  3V5S A;  4O4I E;  1US7 B;  3C64 A;  3AAI A;  4DVD A;  3RYH E;  4ZI2 C;  2JJ9 A;  3Q2M A;  2C5J A;  3KV4 A;  3SS1 A;  3PU8 A;  3GA8 A;  4AKG A;  2LHN A;  5LG4 A;  3UUM A;  2ZLY A;  2VK9 A;  2V1D B;  3LK2 B;  3N2G E;  3OJA A;  4ZHQ E;  1D1B A;  5J1G A;  4IE6 A;  4MBQ A;  2CLY B;  3C51 A;  3RYF E;  4AQG A;  2XAS B;  3UUL A;  2YU2 A;  4ADZ A;  2D2S A;  2C5I T;  4MLK A;  2KND A;  4JEU B;  2NWB A;  2LT3 A;  3CQG B;  2NOX A;  2A72 A;  3FBL A;  2EHO D;  2UXN B;  3N5L A;  4ASK A;  2X9Y A;  2HH7 A;  3ZMT B;  1HS7 A;  2NW9 A;  5LGU B;  3HKE E;  3PUG A;  4YFS A;  1IAP A;  3ZJ1 A;  2XAG B;  5KMG P;  4MHC A;  3I9W A;  1WYC A;  3TKL B;  3C4W A;  2V7J A;  2W61 A;  1WLX A;  2DLR A;  5FY1 A;  3Q9D A;  5JVD E;  4EYU A;  1FIO A;  4DND A;  3AAA B;  1S94 A;  3HI2 A;  3P7I A;  4UIG A;  3ETU A;  2W62 A;  4P09 A;  4X1I E;  1V9D A;  2WWU A;  3WAK A;  1QSD A;  4EZH A;  3ZMS B;  5M4Y A;  2D0U A;  2V7I A;  2YEV C;  2MYS A;  2CMR A;  2KZ7 B;  5DQV A;  5JDN A;  2LOS A;  5E0O A;  3F57 A;  5LGT B;  3B13 A;  3C4X A;  4L0R A;  1VRB A;  3JC6 C;  3PE0 A;  3DJB A;  2JRK A;  2X9H A;  2ACX A;  2Y6X A;  1HF8 A;  1IZN B;  5L3G B;  1LVK A;  2EHO C;  4JEH B;  3I1A A;  4H63 H;  5LHI B;  5EK3 A;  3S4U A;  3N9Q A;  1FEW A;  4DO0 A;  1WRD A;  1Z0P A;  5KX5 E;  3EDU A;  1VOM A;  3LG7 A;  4TX5 A;  3UUN A;  1MIV A;  1WYB A;  3I9Y A;  1HX8 A;  1O3X A;  4KP3 C;  2E9X A;  3GN5 A;  2ODV A;  3M65 A;  3AA6 B;  3RKO A;  4ERR A;  4O2B E;  5HXH A;  4PJJ A;  3EVY A;  2K9A A;  4PJL A;  1ZHC A;  2BVL A;  2LE8 A;  5DQW A;  4X20 E;  2D0T A;  2K24 A;  4H9O C;  3U78 A;  2ZM8 A;  2CWY A;  3BQL A;  4AKI A;  3AA7 B;  4E7Z A;  3F2E A;  5FY0 A;  1KNZ A;  3SOL A;  3AAE B;  5HYA A;  3PUS A;  3FBZ A;  2L3L A;  3Q5X A;  4OYK A;  2L9Q A;  3MKD A;  3OBV E;  2WSS V;  4CXY A;  1OXZ A;  1YW0 A;  3NBX X;  1BR2 A;  3O1I A;  2IC9 A;  4AKL A;  3K3O A;  5JDQ A;  5DAB A;  2VKH A;  3KBT A;  2JQQ A;  3KV5 A;  4PFP A;  2V7L A;  4CXW A;  4QHO A;  3C50 A;  1LRZ A;  2LM9 A;  2RA1 A;  3D0T A;  2PG8 A;  4QWN B;  3MA9 A;  4UVA B;  3HL6 A;  4CQI A;  2CXD A;  4OFZ A;  4TUY E;  4G2A A;  3RYC E;  3N9O A;  4PK5 A;  4X1K E;  3ZJ2 A;  1NAF A;  4ZI7 E;  5L3C B;  3Q5W A;  3SRZ A;  4BA9 A;  3N2O A;  3HKD E;  3RYI E;  4KUM B;  1YD8 G;  4L5G A;  5L3B B;  4JUY A;  2Q9Q D;  2V26 A;  4DMV A;  4MFR A;  4WBN E;  4WBO A;  5EK2 A;  3IHR A;  3HR0 A;  2WMO A;  1EZ3 A;  4PNI A;  4AI6 A;  2VB6 A;  4GYR A;  4Z8X A;  2JPF A;  4IE0 A;  2A2F X;  3R6N A;  4EOZ B;  3PDY A;  5A1L A;  2KIN B;  2WMN A;  2H7V C;  2OA5 A;  4TV9 E;  3OYX A;  3CX8 B;  5L3F B;  2XTL A;  5HXS A;  4IIJ E;  3I0Q A;  5FY7 A;  3CML A;  2C0S A;  1ZKE A;  2WM9 A;  3PUR A;  4XAX B;  1MMG A;  4H9R C;  4TZ4 C;  3DP7 A;  3O9X A;  4HN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...