5JR9A

Crystal structure of apo-nec3po
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
188
structure length
188
Chain Sequence
RGSMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
molecule keywords NEQ131
total genus 82
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jr9A00
5JR9B 5JREA 5JR9A 3ZC0A 5JRCA 5JRCB 5JR9C 3ZC1A
chains in the Genus database with same CATH superfamily
2X9HA 5HCMA 3TLWA 3RC8A 4U31A 2V1DB 2XAQB 4QH4A 2H3RA 4YSXA 3FXEB 4UVAB 2BG9B 1XMQT 1HX8A 5AQQB 5CA1E 2ZLYA 5L3CB 3P4RA 2H7OA 5LHGB 1N34T 2VB6A 1D1BA 3KVAA 2PFVA 1YXRA 3NRYA 4GIWA 4QWNB 3WAKA 5AQHB 2N9DA 5IUXA 1HNXT 3SS1A 4G63A 1VOMA 1WR6A 2KINB 2CHNA 3AAIA 3AE5A 4PJMA 4U2ZA 4HWFA 3KV9A 4PK4A 5L3DB 1MMDA 2BKOA 2QRXA 4LFCT 5HYAA 4EAHA 2E9XD 2I6HA 5FVKA 1XMOT 3NWIA 1KF6A 4IREA 5EK4A 4CI1B 4JI2T 5AQTB 2P9BA 3AE1A 4GKKT 3B13A 4PJNA 3PTRB 2L3LA 1GQEA 2WAUA 3PDYA 1QSDA 2VKDA 2KNDA 4XAXB 5DJQC 2BG9A 5F3JA 5LG4A 1I94T 4DR7T 1UK5A 2X0YA 3AE6A 3FHNA 3PU8A 4QKNA 2H89A 2X9XA 3MXZA 1G73A 3O1JA 4TV8E 3U78A 4JI0T 3RI5A 1XNRT 5HWYA 2VKHA 3P4SA 4ZEYA 3NKZA 4JI7T 5E0OA 2OA5A 3CIRA 2XQ3A 2WMOA 2IAKA 3ESLA 3H37A 4XZCA 2MBGA 3SFDA 3GN5B 1KEYA 3MJXA 4IDPA 4PK5A 4UV9B 5FXXA 5HAXA 3RIAA 3AXJB 4GYRA 4X20E 1YQ3A 4L0RA 1HS7A 3ETUA 4BJMA 5HEJA 3JADA 2Y6XA 4JI6T 2Z6EA 3O9XA 3KV6A 1D0YA 3LSVA 2XQ9A 4B3RT 4DV0T 2HN2A 2EHOC 4EGWA 3AE8A 4H9OC 4YY3T 1UCUA 3I1AA 2E2AA 2JQQA 4HFEA 4J2CA 4NUUA 4DR4T 3N9OA 3ZT7A 2D9DA 4LMJA 3ZN0B 2D0UA 3BQLA 4TX5A 1KNRA 3L8RA 3UUNA 1CUNA 3PU3A 3CWZB 5LP6E 3AE4A 4JYAT 3AE3A 2CEAA 2Q9QC 2JRKA 3VR8A 3LBXB 3RRCA 2NR4A 1R8IA 4IDZA 2OV9A 4UELA 2D5UA 4QX7B 3T8OA 2YKSA 3GN5A 4YTMA 1N36T 3ZMZB 3VKHA 2R6GF 2BZBA 3RX6A 5JDMA 4QXCB 3ZMVB 1W9RA 3HKBE 4IDOA 4PNIA 5JRCA 1WR0A 4JI8T 2VKOA 2WCAA 3CQXC 2XJ7A 3TLUA 4X1YE 1NEKA 2LSGA 2J47A 3RYHE 4Z8XA 3PUQA 4QHOA 3OJAA 1OXZA 4ZHQE 5L3FB 5JR9A 1E2AA 2B1EA 4CN1A 5JDQA 5LGTB 2ZM6T 1XNQT 2VASA 4WBOA 4AQFC 4UXNB 1Y64B 5KXJA 5LYJE 3P7IA 5J2UE 1N32T 2JQ9A 3OBVE 4H9QC 1IBMT 4COFA 4HFBA 1UX4A 4JEHB 3RRWA 4IHJE 3RIFA 3VRBA 4PW8A 5GONE 5CA0E 2W0GA 1HCIA 5AQMB 5HXRA 4LF8T 2PJQA 5JDNA 4OFZA 4DUYT 4YHHT 1BR2A 2LKHA 3A5XA 3O4XE 4HWCA 4NIQA 4DVDA 4EIWA 4ZI2D 5J0ZA 2LSIA 4PFOA 4ZOLE 5FVLA 2LSKA 2JPFA 3EVYA 1KNPA 3VHLA 2DI4A 3ZT6A 4GK5E 3UUBA 2DLRA 3EI0A 3IA3A 5HXCA 1OEDC 2AXDS 4WBNE 5FY1A 3PJAA 5L3EB 2Q9QB 2A3DA 1MIVA 1YD8G 2XQYA 3E08A 3K3OA 1J1JA 1VCSA 4LF7T 2NW7A 2JQHA 5LJMA 3DJBA 3DTOA 2CXFA 2I59A 2JQKA 1BR4A 1D0ZA 2WB5A 3IF8B 2Q9QA 4HWHA 1ZP0A 4TUYE 1UX5A 4OHFA 5HEGA 4JI5T 3RKOA 4DUZT 4U33A 3P8CD 3P50A 4I55E 5J2TE 4LF5T 4A97A 4DV1T 1E1HB 3CQGB 4UF0B 3P4PA 5AFUL 4UV8B 2WY2A 2FJBA 1MIWA 2YU1A 3EUHA 3KV4A 4C90A 3P4WA 4H63H 5KDMC 1ZHCA 3N5LA 2IW5B 2IHR1 4O8SA 1HF8A 2BS2A 4DV6T 4DBQA 2UU9T 3A7MA 1HR0T 2XAJB 4WNKA 2X68A 2FJAA 2VQFT 3KV5A 3A8YC 3EDUA 5AQGB 2IUBA 5ABFA 3FXDB 4CN4A 1IBLT 4A5XA 2LOSA 5AQJB 1S94A 2CMRA 4KMCA 3I9YA 3V5UA 3ZYMA 4DO0A 4OX9T 2A2FX 4EYUA 3FZFB 1D1AA 5DQVA 4CI3B 3T1HT 2DWKA 4JLEA 2NW8A 3FZLB 2UXNB 2LM9A 3PURA 4V1Av 2NW9A 2XPKA 2EHOD 4KI0F 4DIDB 3AXJA 3DP7A 4ERRA 3VKGA 5ABGA 2WWUA 5HEUA 2J4GA 3BQIA 4HWDA 5LBMA 3RHWA 3O1IA 1J5WA 5BR8T 3AEBA 2YEVC 2KWHA 3RIUA 2CLYC 3CKDA 1HG2A 4HKAA 4X5TA 4AQFA 3RC3A 5HXSA 5L3BB 2E9XA 5DQWA 2WP9A 2WU5A 3MKDA 5LOVE 5C8YE 3UT5E 5CGMA 5LGNB 5FY0A 3GWHA 4HTEA 2V7LA 3QUJA 5LNKA 3AAAB 3JC6D 2W2UA 4IDNA 2V5CA 2V26A 2XM2A 2CBIA 2LOPA 3AEGA 3FZKB 3Q9DA 5TAOA 3C50A 4P1NA 3ZKRA 4YTPA 5ABHA 5JDLA 2XSBA 3BK9A 5AQNB 5KMGP 3N9PA 3UU5A 1MMGA 3AEAA 3FZHB 2XHEB 4ILAA 3I9WA 4IT4A 3U3IA 3GMIA 2Y8DA 4EXTA 2BKNA 4H9NC 4LMKA 1HNZT 3WI3A 2E8IA 3KDSE 4YTNA 4DV4T 3KFWX 4AXPA 3VRAA 2SPCA 4AKGA 2XY8B 4IE6A 5HWXA 4HFVA 4YSYA 5JDFA 2UUBT 3PUSA 4YT0A 1JNZA 2BVMA 3D0TA 4QXBB 1MNDA 2M6IA 5JQGE 1MNEA 3J7Yq 2LEHA 3NVOA 4HFHA 5JRCB 3ANWA 4I4TE 3PE0A 1T72A 1FMWA 2VWAA 4H9SE 4CXWA 3AEDA 5HEOA 1N33T 2CLYB 2LRLA 3AE7A 4FI5A 1YKHB 4UF0A 2WBLA 3JC6C 2K3WA 2WSSV 1Y01A 2CXLA 2LJLA 3UFGA 5BMVE 5F8PA 4P0AA 4JI4T 2W62A 3PUWF 4ILCA 3ZCIA 5FXVA 3PUYF 1SE7A 4TWFA 4X62T 2ODVA 2LSYA 2ZM0A 5C2TA 5LB7B 2CBJA 2QVAA 2XQ5A 4H9PC 1U5PA 2NOXA 3ETVA 2KSRA 4O4LE 3CVRA 3N9MA 4LFBT 3AVRA 4YFSA 3AA1B 3UU6A 1FIOA 1JNRA 4HFDA 4IDQA 4ASKA 4YXDA 5JR9C 2MYSA 3S4UA 2EHOB 3ZJ1A 1IAPA 3OYZA 4HN9A 4ISTA 1X79A 3CQCB 5FYMA 4EZHA 2XQ6A 4YHJA 3UU4A 3ZYKA 2X0HA 5LHHB 2W63A 4OYJA 5AQKB 3MACA 2CA5A 2C5KT 2LSJA 3F2EA 1WCRA 4FJOA 4MFRA 4ANJA 4ZI7E 3C51A 2E9XB 5HXHA 4X1IE 2HPLA 4JBWF 1I6ZA 4E7SA 1W0BA 1XDPA 1YKEB 2X67A 1NENA 3VR9A 4B6XA 4MHCA 3RYIE 3RGLA 2A72A 3TKLB 3ZCJA 4WZXA 2RA1A 1WYCA 2J1DG 3E0ZA 4NPPA 4O4HE 4CXXA 4NXMT 1FMVA 4OYKA 3ZC0A 5EZYE 2XQAA 4ISSA 2YN6A 4PK6A 4AQYT 1J5ET 1IJ6A 2XAFB 3LK42 4H9RC 3HKEE 4TWDA 4EV6A 4TV9E 3JAEA 5JREA 4PJLA 2HN1A 5JDHA 4IIJE 3LG7A 2AE9A 3TLTA 2XAHB 2FBWA 4JEUB 1VRBA 3RKGA 4CQIA 2ES0A 1D0XA 5L47A 3AE9A 4TNWA 3ANWB 3ONXA 2WWVA 5ABFB 4AKIA 3PJAJ 4AISA 2W67A 3MA9A 3ZT5A 1VCTA 4ZZBA 3L39A 3PUGA 4GOUA 1QUUA 4IL4A 2PTFA 3OKQA 4JV5T 2WZHA 1Z0PA 2BG9E 2WS3A 2KWIB 5L4HA 1X9BA 3PUAA 4ZS3A 3QB5K 5CFBA 4Q25A 4AIUA 2IDOB 3G06A 4X64T 1W0AA 2JJ9A 4U72A 2CWOA 3T1YT 3PUVF 5JTGA 4L5GA 4KHPT 2M6BA 4B3MT 3LJCA 3LDQB 2WU2A 5JDGA 3RF1A 3AA0B 2E5LT 2N2NA 3AA7B 3WAJA 3N9LA 3FZMB 3JAFA 4KUMB 4CZZB 4DR1T 3CX6B 4LFAT 4P0BA 5ETWA 2L8KA 2V5DA 2ZM2A 1MIYA 3HKCE 3UULA 2CE7A 3OTOT 3RYFE 5FNVE 2CHOA 2BS3A 3Q5EA 5L2LA 4BAYB 3LBXA 4OK0A 4GYSA 2XASB 3AEFA 2XQ7A 4U3CA 3KBTA 1WYBA 5IHYA 2JMKA 5AQUB 2I0MA 5M4YA 3NZQA 2HPJA 2DL1A 4O4JE 2Q9QD 2XM1A 2G0UA 2XSAA 3SFEA 3I0QA 4I50E 4MALA 1LRZA 1HFAA 3R6NA 3RQWA 1FEWA 4ADZA 4YSZA 2E9XC 5H6QB 5A1LA 3NZPA 1IZNB 3NRXA 3H3AA 5HXEA 2W66A 3C4XA 3RH3A 3N2GE 3QB5A 1WFDA 2K5BB 5AQVB 5AQIB 2CWYA 1XDOA 4ILBA 1E7PA 4TZ4C 3ZPOA 4KHZF 1FJGT 1KNZA 4IE4A 2CXDA 4IE0A 4HFIA 2VVNA 4ZXLA 1L0VA 1SHZC 2MAWA 3PUXF 5EK2A 2J62A 2NP9A 2XAGB 3N2OA 3OVUA 1O3XA 2N1GA 3L3PA 2V6XA 3ZSTA 4DBRA 3AB3B 4K0UA 2UUCT 4UVCB 3LK3B 3IBPA 2ACXA 3AAEB 4N78D 4HEAA 2WZIA 4HGAA 3C4ZA 2UXBT 2YDQA 5LMNT 3K3QC 5FP3A 2X66A 2IC9A 2ZM8A 3UUXB 3HA4A 3E22E 2YDSA 3ZEFB 3I0OA 4EOZB 2VL0A 4CXYA 3QNUA 1Z8UA 3BQKA 4ILUA 2NTYA 4LF6T 3CX7B 5LCYA 3J9X1 2WQYA 1UURA 2BKPA 2KLQA 3LK2B 5KX5E 4YLHA 3PV0F 4EEDA 2XQ8A 4CN6A 4GK0E 2ODUA 2W4XA 5L4EA 2H7VC 2IIUA 2RPAA 5LHIB 4NXNT 4PJJA 3K8PC 2VKJA 3V5SA 1ZKEA 2BG9C 3IHRA 5CJ5A 1OEDA 3EHZA 2YDRA 1YW0A 2X0LB 3SOLA 4QXHB 2YK0A 1KK7A 1HNWT 4L9IA 5LBQB 4KX6A 5LGUB 2WMNA 3RQUA 4DV3T 4TNVA 2MOZA 3CX8B 1LVKA 4PAGA 2X51A 3ZSSA 2V7KA 3CPZA 2C0SA 4KBMB 3LFMA 2DHRA 3ONJA 5FL1A 3UQ4A 3C98B 1S35A 2ZMAA 4UEMA 3M3ZB 1T98A 3X1DA 3Q5DA 2KMFA 4AKHA 3SWHA 1SUMB 4H63V 2DCFA 4U2YA 3UFEA 3ZC1A 4MLKA 3RPUA 2UXCT 1IBKT 4BA9A 2PG8A 3ZMUB 3C4WA 2LHNA 2L9QA 2LLYA 4UVBB 3NBXX 4EZ4A 4XBFB 2M67A 3TLSA 4ZI2C 4B3ST 5LXTE 4LF4T 5H6RB 1M7KA 5FKYA 1XWMA 4F6RC 4DR5T 2BVLA 2C5IT 1T7SA 4U7YA 1V9DA 3F57A 1ZV4X 3QK6A 4ZI3C 4AKLA 3Q5WA 3QOFA 4EEBA 2VL8A 1H7CA 2NTXA 4WYVA 2KT9A 2WM9A 3RLFF 1M62A 1ZOYA 5HEHA 1AJ3A 3FBLA 4U7IA 1BR0A 1BR1A 2H88A 3ZN1B 4AI6A 4LMLA 1EZ3A 2YOEA 1QLBA 1HX1B 5AQRB 2E5VA 4IE5A 2PBIA 1D1CA 2MTQA 4O2BE 5DABA 4K0KT 4O4IE 2VVSA 1G8XA 1SA0E 4M1PA 4F8HA 2K24A 2LHRA 3EAMA 5AQSB 5LJNA 1DU2A 4HFCA 2D2SA 1HG5A 4HE8A 2LKGA 3HI2A 3OYXA 4DR6T 5AQOB 3N9NA 5FXZA 2DNXA 4PFPA 2KXPB 1B7TA 3EDVA 3N9QA 2BBJA 5F5WA 5FMNA 4X66T 1OWAA 4BJNA 3QC9A 5FXWA 1YQ4A 4EB6E 5C3JA 2LT3A 3RYCE 4A98A 4TWHA 2JMHA 2HHHT 3Q2MA 3UQ7A 4Z91A 2XUEA 4QH5A 2EHOA 2V6YA 3FB2A 2A9UA 4YJ3E 2VK9A 3F31A 5JVDE 2UXXB 3M65A 2F4VT 4X1KE 5CB4E 2BS4A 2DWGA 3Q5XA 4AKRB 3ABVA 2K48A 4AQGA 4DR3T 3TLVA 3AA6B 3MZKB 4I43B 3UTKA 4DR2T 2UUAT 5LG3A 1U4QA 2JIWA 3IEEA 4TN7B 4IE7A 4ZI3D 2HH7A 4DNDA 2QGSA 5AQFB 1ZEEA 3EABA 5ABEA 2QYWA 3CK6A 4IL9A 4G2AA 1OEDE 3ONLC 4DV2T 3UU8A 2V6YB 4QX8B 2LRKA 3H3MA 3W15B 5IWAT 4I0UA 1IJ5A 4ZS2A 4CI2B 5IYZE 2CM0A 3AE2A 4NUVA 5LMUT 4DV5T 3HKDE 3AECA 3OPCA 5AQLB 4C91A 2YINA 2V8SV 1W09A 4KP3C 1CHUA 3CMLA 3O1HA 4MBQA 4EYYR 3ZJ2A 3B5MA 3VU7H 4YJ2E 2V7JA 2VQET 5AQPB 1NWMX 3SRZA 4B3TT 3HR0A 4A56A 4UR9A 2FJEA 2V7IA 3PUZF 5FL0A 1OEDB 2BBHA 2ACZA 3AVSA 3JCFA 3KBUA 3P4QA 3AEEA 2K9AA 3KVBA 3ZMSB 4Z90A 2LM2A 4UIGA 5LA6E 5JH7E 1MMAA 4JI1T 5EK3A 1KFYA 2W00A 3HL6A 5FY7A 2GK9A 3RIUC 5ADXL 4X65T 1UUSA 2OLTA 2WDQA 4JI3T 2KZ7B 2X9YA 1US7B 2WDRA 2YU2A 3K3NA 3UU3A 2FUPA 3N2KE 2C5JA 4ZZCA 2RP4A 2V7MA 2MPKA 4U74A 4O2AE 1UGOA 4P09A 5HCJA 5JR9B 3ZLIA 1HTJF 2QA7A 4DMWA 3ZMTB 4LF9T 4GKJT 2CRBA 2D0TA 3UUMA 1T8BA 1WRDA 3KINB 1XZYA 4QH1A 5J1GA 2B76A 1MMNA 2CPTA 2Y48B 4HWIB 2BDEA 3K1SA 3FBZA 3R84B 2CCQA 4WW0A 1LKXA 2IMLA 4DV7T 2W61A 2XQ4A 2FJDA 1LVFA 3B57A 2X9WA 1NAFA 3MK7C 4IGUA 2VURA 2XZEA 1WLXA 2IC6A 4DMVA 4E7ZA 4JUYA 3GA8A 5L3GB 2UXDT 3ZYLA 2LE8A 3L09A 3C64A 2WDVA 2NWBA 2XTLA
chains in the Genus database with same CATH topology
2X9HA 3RC8A 2V1DB 2XAQB 2H3RA 3FXEB 4UVAB 1HX8A 5CA1E 2ZLYA 5L3CB 2H7OA 5LHGB 2VB6A 1D1BA 3KVAA 2PFVA 3NRYA 4GIWA 3WAKA 4QWNB 2N9DA 3SS1A 4G63A 1VOMA 1WR6A 2KINB 3AAIA 4PJMA 3KV9A 4PK4A 1MMDA 5HYAA 4EAHA 2E9XD 4CI1B 5EK4A 2P9BA 3B13A 4PJNA 3PTRB 2L3LA 2WAUA 3PDYA 5F3JA 1QSDA 2VKDA 2KNDA 4XAXB 5DJQC 5LG4A 3FHNA 3PU8A 4QKNA 3MXZA 2X9XA 1G73A 3O1JA 4TV8E 3U78A 5HWYA 2VKHA 5E0OA 2OA5A 2WMOA 2IAKA 3ESLA 3H37A 4XZCA 2MBGA 3GN5B 3MJXA 4PK5A 4UV9B 5FXXA 5HAXA 4GYRA 4X20E 4L0RA 1HS7A 3ETUA 4BJMA 2Y6XA 2Z6EA 3O9XA 3KV6A 1D0YA 2EHOC 4H9OC 1UCUA 3I1AA 2JQQA 4J2CA 4NUUA 3N9OA 3ZN0B 2D0UA 3BQLA 4TX5A 3UUNA 1CUNA 3PU3A 3CWZB 5LP6E 2CEAA 2Q9QC 2JRKA 3LBXB 3RRCA 4IDZA 4UELA 2D5UA 4QX7B 3T8OA 3GN5A 3ZMZB 3VKHA 2BZBA 3RX6A 5JDMA 4QXCB 3ZMVB 4PNIA 3HKBE 5JRCA 2VKOA 3CQXC 4X1YE 2LSGA 3RYHE 4Z8XA 3PUQA 4QHOA 3OJAA 1OXZA 4ZHQE 5L3FB 5JR9A 2B1EA 5JDQA 5LGTB 2VASA 4WBOA 4AQFC 4UXNB 1Y64B 5LYJE 3P7IA 5J2UE 3OBVE 4H9QC 1UX4A 4JEHB 3RRWA 4IHJE 4PW8A 5GONE 5CA0E 2W0GA 1HCIA 5HXRA 2PJQA 5JDNA 4OFZA 1BR2A 3O4XE 3A5XA 4DVDA 4EIWA 4ZI2D 2LSIA 4PFOA 4ZOLE 2LSKA 2JPFA 3EVYA 3VHLA 2DI4A 4GK5E 2DLRA 5HXCA 4WBNE 5FY1A 2Q9QB 2A3DA 1MIVA 1YD8G 2XQYA 3E08A 3K3OA 2NW7A 5LJMA 3DJBA 3DTOA 2CXFA 2I59A 3IF8B 1BR4A 1D0ZA 5L3DB 2Q9QA 4TUYE 3RKOA 1UX5A 4OHFA 3P8CD 4I55E 5J2TE 1E1HB 3CQGB 4UF0B 5AFUL 4UV8B 2YU1A 3EUHA 1MIWA 3KV4A 4C90A 4H63H 5KDMC 1ZHCA 3N5LA 2IW5B 4O8SA 1HF8A 4DBQA 2XAJB 4WNKA 2X68A 3KV5A 3EDUA 3FXDB 2LOSA 1S94A 2CMRA 4KMCA 3I9YA 3V5UA 3ZYMA 4DO0A 2A2FX 4EYUA 1D1AA 5DQVA 4CI3B 2DWKA 4JLEA 2NW8A 2UXNB 2LM9A 3PURA 4V1Av 2NW9A 2EHOD 4ERRA 3DP7A 3VKGA 2WWUA 3BQIA 5LBMA 3O1IA 2YEVC 2KWHA 2CLYC 3CKDA 1HG2A 4HKAA 5HXSA 4AQFA 3RC3A 5L3BB 2E9XA 5DQWA 5LOVE 3MKDA 5C8YE 3UT5E 5LGNB 5FY0A 3GWHA 4HTEA 2V7LA 3QUJA 5LNKA 3AAAB 3JC6D 2V26A 5TAOA 2LOPA 3Q9DA 3C50A 5JDLA 3BK9A 5KMGP 3N9PA 1MMGA 2XHEB 3I9WA 3U3IA 3GMIA 2Y8DA 4EXTA 4H9NC 3WI3A 2E8IA 3KDSE 3KFWX 4AXPA 2SPCA 4AKGA 4IE6A 5HWXA 4HFVA 5JDFA 3PUSA 2BVMA 3D0TA 4QXBB 1MNDA 5JQGE 1MNEA 3J7Yq 2LEHA 3ANWA 4I4TE 3PE0A 4CXWA 1FMWA 2VWAA 4H9SE 2CLYB 4FI5A 1YKHB 4UF0A 2WBLA 3JC6C 2WSSV 2CXLA 2LJLA 5BMVE 4P0AA 5F8PA 2W62A 3ZCIA 5FXVA 2ODVA 2LSYA 2ZM0A 4H9PC 4O4LE 1U5PA 2NOXA 3ETVA 3N9MA 3AVRA 4YFSA 3AA1B 1FIOA 4ASKA 5JR9C 2MYSA 3S4UA 2EHOB 3ZJ1A 1IAPA 3OYZA 4HN9A 4ISTA 1X79A 3CQCB 5FYMA 4EZHA 4YHJA 3ZYKA 5LHHB 2W63A 4OYJA 3MACA 2CA5A 2C5KT 2LSJA 3F2EA 4FJOA 4MFRA 4ANJA 4ZI7E 3C51A 2E9XB 5HXHA 4X1IE 2HPLA 4E7SA 1YKEB 4B6XA 2X67A 4MHCA 3RYIE 3ZCJA 2A72A 3TKLB 2RA1A 1WYCA 2J1DG 3E0ZA 4O4HE 4CXXA 1FMVA 4OYKA 3ZC0A 5EZYE 4ISSA 4PK6A 1IJ6A 2XAFB 3LK42 4H9RC 3HKEE 4TV9E 5JREA 4PJLA 5JDHA 4IIJE 3LG7A 2XAHB 4CQIA 4JEUB 1VRBA 2ES0A 1D0XA 3ANWB 3ONXA 4AKIA 3MA9A 3PUGA 4GOUA 1QUUA 3OKQA 1Z0PA 2KWIB 3PUAA 4ZS3A 2JJ9A 4U72A 2CWOA 4L5GA 3LJCA 5JDGA 3AA0B 2N2NA 3AA7B 3WAJA 3N9LA 4CZZB 4KUMB 3CX6B 4P0BA 5ETWA 2L8KA 2ZM2A 1MIYA 3HKCE 3UULA 2CE7A 3RYFE 5FNVE 5L2LA 4BAYB 3LBXA 4OK0A 4GYSA 2XASB 3KBTA 1WYBA 5IHYA 2JMKA 5M4YA 3NZQA 2HPJA 4O4JE 2Q9QD 2G0UA 3I0QA 4I50E 4MALA 1LRZA 1HFAA 3R6NA 4ADZA 1FEWA 2E9XC 5H6QB 5A1LA 3NZPA 1IZNB 3NRXA 3H3AA 5HXEA 3C4XA 3RH3A 3N2GE 2K5BB 2CWYA 3ZPOA 4TZ4C 1KNZA 4IE4A 2CXDA 4IE0A 1SHZC 5EK2A 2XAGB 2NP9A 3N2OA 5L3EB 1O3XA 2N1GA 3L3PA 4DBRA 3AB3B 4K0UA 4UVCB 3LK3B 3IBPA 2ACXA 3AAEB 4N78D 4HEAA 4HGAA 3C4ZA 3K3QC 5FP3A 2X66A 2IC9A 2ZM8A 3UUXB 3HA4A 3E22E 3I0OA 4EOZB 4CXYA 3BQKA 4ILUA 2NTYA 3CX7B 5LCYA 3J9X1 2KLQA 3LK2B 5KX5E 4YLHA 4GK0E 2ODUA 2H7VC 5LHIB 4PJJA 3K8PC 2VKJA 3V5SA 1ZKEA 3IHRA 3SOLA 1YW0A 2X0LB 4QXHB 2YK0A 1KK7A 4L9IA 5LBQB 5LGUB 2WMNA 2MOZA 3CX8B 1LVKA 4PAGA 2X51A 2V7KA 3CPZA 2C0SA 4KBMB 3LFMA 2DHRA 3C98B 1S35A 2ZMAA 4UEMA 1T98A 2KMFA 4AKHA 3SWHA 4H63V 3UFEA 2DCFA 3ZC1A 4MLKA 3RPUA 4BA9A 2PG8A 3ZMUB 3C4WA 2LHNA 2L9QA 4UVBB 3NBXX 4EZ4A 4XBFB 2M67A 4ZI2C 5LXTE 5H6RB 4F6RC 2BVLA 2C5IT 1V9DA 3F57A 1ZV4X 3QK6A 4ZI3C 4AKLA 3Q5WA 2VL8A 1H7CA 2NTXA 2KT9A 2WM9A 1AJ3A 3FBLA 1BR0A 1BR1A 3ZN1B 4AI6A 1EZ3A 4IE5A 2PBIA 1D1CA 2MTQA 4O2BE 5DABA 4O4IE 1G8XA 1SA0E 4M1PA 5LJNA 2K24A 2LHRA 2D2SA 1HG5A 4HE8A 3HI2A 3OYXA 3N9NA 5FXZA 2DNXA 4PFPA 2KXPB 1B7TA 3EDVA 3N9QA 5FMNA 1OWAA 4BJNA 3QC9A 5FXWA 4EB6E 2LT3A 3RYCE 2JMHA 3Q2MA 2XUEA 2EHOA 3FB2A 4YJ3E 2VK9A 3F31A 5JVDE 2UXXB 3M65A 4X1KE 5CB4E 2DWGA 3Q5XA 4AKRB 4AQGA 2K48A 3AA6B 3MZKB 3UTKA 1U4QA 3IEEA 4TN7B 4IE7A 4ZI3D 2HH7A 4DNDA 2QGSA 1ZEEA 4G2AA 4QX8B 3W15B 1IJ5A 3C64A 4ZS2A 4CI2B 5IYZE 2CM0A 4NUVA 5JRCB 3HKDE 4C91A 2YINA 4EYYR 4KP3C 3CMLA 3O1HA 4MBQA 3ZJ2A 3VU7H 4YJ2E 2V7JA 1NWMX 3SRZA 3HR0A 4A56A 2V7IA 4I43B 3AVSA 3ZMSB 3KBUA 2K9AA 3KVBA 5LA6E 4UIGA 5JH7E 1MMAA 5EK3A 5FY7A 2W00A 3HL6A 5ADXL 2GK9A 2KZ7B 2X9YA 1US7B 2YU2A 3K3NA 3N2KE 2C5JA 2RP4A 2V7MA 4U74A 4O2AE 4P09A 5JR9B 3ZLIA 1HTJF 2QA7A 4DMWA 3ZMTB 2D0TA 3UUMA 1WRDA 3KINB 5J1GA 1MMNA 2Y48B 2BDEA 3R84B 3FBZA 2CCQA 4WW0A 1LKXA 2W61A 1LVFA 3B57A 2X9WA 1NAFA 3MK7C 4IGUA 1WLXA 2IC6A 4DMVA 4E7ZA 4JUYA 3GA8A 5L3GB 3ZYLA 2LE8A 3L09A 3CVRA 3ZEFB 2NWBA 2XTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 B;  5JRE A;  5JR9 A;  3ZC0 A;  5JRC A;  5JRC B;  5JR9 C;  3ZC1 A; 
#chains in the Genus database with same CATH topology
 2X9H A;  5HCM A;  3TLW A;  3RC8 A;  4U31 A;  2V1D B;  2XAQ B;  4QH4 A;  2H3R A;  4YSX A;  3FXE B;  4UVA B;  2BG9 B;  1XMQ T;  1HX8 A;  5AQQ B;  5CA1 E;  2ZLY A;  5L3C B;  3P4R A;  2H7O A;  5LHG B;  1N34 T;  2VB6 A;  1D1B A;  3KVA A;  2PFV A;  1YXR A;  3NRY A;  4GIW A;  4QWN B;  3WAK A;  5AQH B;  2N9D A;  5IUX A;  1HNX T;  3SS1 A;  4G63 A;  1VOM A;  1WR6 A;  2KIN B;  2CHN A;  3AAI A;  3AE5 A;  4PJM A;  4U2Z A;  4HWF A;  3KV9 A;  4PK4 A;  5L3D B;  1MMD A;  2BKO A;  2QRX A;  4LFC T;  5HYA A;  4EAH A;  2E9X D;  2I6H A;  5FVK A;  1XMO T;  3NWI A;  1KF6 A;  4IRE A;  5EK4 A;  4CI1 B;  4JI2 T;  5AQT B;  2P9B A;  3AE1 A;  4GKK T;  3B13 A;  4PJN A;  3PTR B;  2L3L A;  1GQE A;  2WAU A;  3PDY A;  1QSD A;  2VKD A;  2KND A;  4XAX B;  5DJQ C;  2BG9 A;  5F3J A;  5LG4 A;  1I94 T;  4DR7 T;  1UK5 A;  2X0Y A;  3AE6 A;  3FHN A;  3PU8 A;  4QKN A;  2H89 A;  2X9X A;  3MXZ A;  1G73 A;  3O1J A;  4TV8 E;  3U78 A;  4JI0 T;  3RI5 A;  1XNR T;  5HWY A;  2VKH A;  3P4S A;  4ZEY A;  3NKZ A;  4JI7 T;  5E0O A;  2OA5 A;  3CIR A;  2XQ3 A;  2WMO A;  2IAK A;  3ESL A;  3H37 A;  4XZC A;  2MBG A;  3SFD A;  3GN5 B;  1KEY A;  3MJX A;  4IDP A;  4PK5 A;  4UV9 B;  5FXX A;  5HAX A;  3RIA A;  3AXJ B;  4GYR A;  4X20 E;  1YQ3 A;  4L0R A;  1HS7 A;  3ETU A;  4BJM A;  5HEJ A;  3JAD A;  2Y6X A;  4JI6 T;  2Z6E A;  3O9X A;  3KV6 A;  1D0Y A;  3LSV A;  2XQ9 A;  4B3R T;  4DV0 T;  2HN2 A;  2EHO C;  4EGW A;  3AE8 A;  4H9O C;  4YY3 T;  1UCU A;  3I1A A;  2E2A A;  2JQQ A;  4HFE A;  4J2C A;  4NUU A;  4DR4 T;  3N9O A;  3ZT7 A;  2D9D A;  4LMJ A;  3ZN0 B;  2D0U A;  3BQL A;  4TX5 A;  1KNR A;  3L8R A;  3UUN A;  1CUN A;  3PU3 A;  3CWZ B;  5LP6 E;  3AE4 A;  4JYA T;  3AE3 A;  2CEA A;  2Q9Q C;  2JRK A;  3VR8 A;  3LBX B;  3RRC A;  2NR4 A;  1R8I A;  4IDZ A;  2OV9 A;  4UEL A;  2D5U A;  4QX7 B;  3T8O A;  2YKS A;  3GN5 A;  4YTM A;  1N36 T;  3ZMZ B;  3VKH A;  2R6G F;  2BZB A;  3RX6 A;  5JDM A;  4QXC B;  3ZMV B;  1W9R A;  3HKB E;  4IDO A;  4PNI A;  5JRC A;  1WR0 A;  4JI8 T;  2VKO A;  2WCA A;  3CQX C;  2XJ7 A;  3TLU A;  4X1Y E;  1NEK A;  2LSG A;  2J47 A;  3RYH E;  4Z8X A;  3PUQ A;  4QHO A;  3OJA A;  1OXZ A;  4ZHQ E;  5L3F B;  5JR9 A;  1E2A A;  2B1E A;  4CN1 A;  5JDQ A;  5LGT B;  2ZM6 T;  1XNQ T;  2VAS A;  4WBO A;  4AQF C;  4UXN B;  1Y64 B;  5KXJ A;  5LYJ E;  3P7I A;  5J2U E;  1N32 T;  2JQ9 A;  3OBV E;  4H9Q C;  1IBM T;  4COF A;  4HFB A;  1UX4 A;  4JEH B;  3RRW A;  4IHJ E;  3RIF A;  3VRB A;  4PW8 A;  5GON E;  5CA0 E;  2W0G A;  1HCI A;  5AQM B;  5HXR A;  4LF8 T;  2PJQ A;  5JDN A;  4OFZ A;  4DUY T;  4YHH T;  1BR2 A;  2LKH A;  3A5X A;  3O4X E;  4HWC A;  4NIQ A;  4DVD A;  4EIW A;  4ZI2 D;  5J0Z A;  2LSI A;  4PFO A;  4ZOL E;  5FVL A;  2LSK A;  2JPF A;  3EVY A;  1KNP A;  3VHL A;  2DI4 A;  3ZT6 A;  4GK5 E;  3UUB A;  2DLR A;  3EI0 A;  3IA3 A;  5HXC A;  1OED C;  2AXD S;  4WBN E;  5FY1 A;  3PJA A;  5L3E B;  2Q9Q B;  2A3D A;  1MIV A;  1YD8 G;  2XQY A;  3E08 A;  3K3O A;  1J1J A;  1VCS A;  4LF7 T;  2NW7 A;  2JQH A;  5LJM A;  3DJB A;  3DTO A;  2CXF A;  2I59 A;  2JQK A;  1BR4 A;  1D0Z A;  2WB5 A;  3IF8 B;  2Q9Q A;  4HWH A;  1ZP0 A;  4TUY E;  1UX5 A;  4OHF A;  5HEG A;  4JI5 T;  3RKO A;  4DUZ T;  4U33 A;  3P8C D;  3P50 A;  4I55 E;  5J2T E;  4LF5 T;  4A97 A;  4DV1 T;  1E1H B;  3CQG B;  4UF0 B;  3P4P A;  5AFU L;  4UV8 B;  2WY2 A;  2FJB A;  1MIW A;  2YU1 A;  3EUH A;  3KV4 A;  4C90 A;  3P4W A;  4H63 H;  5KDM C;  1ZHC A;  3N5L A;  2IW5 B;  2IHR 1;  4O8S A;  1HF8 A;  2BS2 A;  4DV6 T;  4DBQ A;  2UU9 T;  3A7M A;  1HR0 T;  2XAJ B;  4WNK A;  2X68 A;  2FJA A;  2VQF T;  3KV5 A;  3A8Y C;  3EDU A;  5AQG B;  2IUB A;  5ABF A;  3FXD B;  4CN4 A;  1IBL T;  4A5X A;  2LOS A;  5AQJ B;  1S94 A;  2CMR A;  4KMC A;  3I9Y A;  3V5U A;  3ZYM A;  4DO0 A;  4OX9 T;  2A2F X;  4EYU A;  3FZF B;  1D1A A;  5DQV A;  4CI3 B;  3T1H T;  2DWK A;  4JLE A;  2NW8 A;  3FZL B;  2UXN B;  2LM9 A;  3PUR A;  4V1A v;  2NW9 A;  2XPK A;  2EHO D;  4KI0 F;  4DID B;  3AXJ A;  3DP7 A;  4ERR A;  3VKG A;  5ABG A;  2WWU A;  5HEU A;  2J4G A;  3BQI A;  4HWD A;  5LBM A;  3RHW A;  3O1I A;  1J5W A;  5BR8 T;  3AEB A;  2YEV C;  2KWH A;  3RIU A;  2CLY C;  3CKD A;  1HG2 A;  4HKA A;  4X5T A;  4AQF A;  3RC3 A;  5HXS A;  5L3B B;  2E9X A;  5DQW A;  2WP9 A;  2WU5 A;  3MKD A;  5LOV E;  5C8Y E;  3UT5 E;  5CGM A;  5LGN B;  5FY0 A;  3GWH A;  4HTE A;  2V7L A;  3QUJ A;  5LNK A;  3AAA B;  3JC6 D;  2W2U A;  4IDN A;  2V5C A;  2V26 A;  2XM2 A;  2CBI A;  2LOP A;  3AEG A;  3FZK B;  3Q9D A;  5TAO A;  3C50 A;  4P1N A;  3ZKR A;  4YTP A;  5ABH A;  5JDL A;  2XSB A;  3BK9 A;  5AQN B;  5KMG P;  3N9P A;  3UU5 A;  1MMG A;  3AEA A;  3FZH B;  2XHE B;  4ILA A;  3I9W A;  4IT4 A;  3U3I A;  3GMI A;  2Y8D A;  4EXT A;  2BKN A;  4H9N C;  4LMK A;  1HNZ T;  3WI3 A;  2E8I A;  3KDS E;  4YTN A;  4DV4 T;  3KFW X;  4AXP A;  3VRA A;  2SPC A;  4AKG A;  2XY8 B;  4IE6 A;  5HWX A;  4HFV A;  4YSY A;  5JDF A;  2UUB T;  3PUS A;  4YT0 A;  1JNZ A;  2BVM A;  3D0T A;  4QXB B;  1MND A;  2M6I A;  5JQG E;  1MNE A;  3J7Y q;  2LEH A;  3NVO A;  4HFH A;  5JRC B;  3ANW A;  4I4T E;  3PE0 A;  1T72 A;  1FMW A;  2VWA A;  4H9S E;  4CXW A;  3AED A;  5HEO A;  1N33 T;  2CLY B;  2LRL A;  3AE7 A;  4FI5 A;  1YKH B;  4UF0 A;  2WBL A;  3JC6 C;  2K3W A;  2WSS V;  1Y01 A;  2CXL A;  2LJL A;  3UFG A;  5BMV E;  5F8P A;  4P0A A;  4JI4 T;  2W62 A;  3PUW F;  4ILC A;  3ZCI A;  5FXV A;  3PUY F;  1SE7 A;  4TWF A;  4X62 T;  2ODV A;  2LSY A;  2ZM0 A;  5C2T A;  5LB7 B;  2CBJ A;  2QVA A;  2XQ5 A;  4H9P C;  1U5P A;  2NOX A;  3ETV A;  2KSR A;  4O4L E;  3CVR A;  3N9M A;  4LFB T;  3AVR A;  4YFS A;  3AA1 B;  3UU6 A;  1FIO A;  1JNR A;  4HFD A;  4IDQ A;  4ASK A;  4YXD A;  5JR9 C;  2MYS A;  3S4U A;  2EHO B;  3ZJ1 A;  1IAP A;  3OYZ A;  4HN9 A;  4IST A;  1X79 A;  3CQC B;  5FYM A;  4EZH A;  2XQ6 A;  4YHJ A;  3UU4 A;  3ZYK A;  2X0H A;  5LHH B;  2W63 A;  4OYJ A;  5AQK B;  3MAC A;  2CA5 A;  2C5K T;  2LSJ A;  3F2E A;  1WCR A;  4FJO A;  4MFR A;  4ANJ A;  4ZI7 E;  3C51 A;  2E9X B;  5HXH A;  4X1I E;  2HPL A;  4JBW F;  1I6Z A;  4E7S A;  1W0B A;  1XDP A;  1YKE B;  2X67 A;  1NEN A;  3VR9 A;  4B6X A;  4MHC A;  3RYI E;  3RGL A;  2A72 A;  3TKL B;  3ZCJ A;  4WZX A;  2RA1 A;  1WYC A;  2J1D G;  3E0Z A;  4NPP A;  4O4H E;  4CXX A;  4NXM T;  1FMV A;  4OYK A;  3ZC0 A;  5EZY E;  2XQA A;  4ISS A;  2YN6 A;  4PK6 A;  4AQY T;  1J5E T;  1IJ6 A;  2XAF B;  3LK4 2;  4H9R C;  3HKE E;  4TWD A;  4EV6 A;  4TV9 E;  3JAE A;  5JRE A;  4PJL A;  2HN1 A;  5JDH A;  4IIJ E;  3LG7 A;  2AE9 A;  3TLT A;  2XAH B;  2FBW A;  4JEU B;  1VRB A;  3RKG A;  4CQI A;  2ES0 A;  1D0X A;  5L47 A;  3AE9 A;  4TNW A;  3ANW B;  3ONX A;  2WWV A;  5ABF B;  4AKI A;  3PJA J;  4AIS A;  2W67 A;  3MA9 A;  3ZT5 A;  1VCT A;  4ZZB A;  3L39 A;  3PUG A;  4GOU A;  1QUU A;  4IL4 A;  2PTF A;  3OKQ A;  4JV5 T;  2WZH A;  1Z0P A;  2BG9 E;  2WS3 A;  2KWI B;  5L4H A;  1X9B A;  3PUA A;  4ZS3 A;  3QB5 K;  5CFB A;  4Q25 A;  4AIU A;  2IDO B;  3G06 A;  4X64 T;  1W0A A;  2JJ9 A;  4U72 A;  2CWO A;  3T1Y T;  3PUV F;  5JTG A;  4L5G A;  4KHP T;  2M6B A;  4B3M T;  3LJC A;  3LDQ B;  2WU2 A;  5JDG A;  3RF1 A;  3AA0 B;  2E5L T;  2N2N A;  3AA7 B;  3WAJ A;  3N9L A;  3FZM B;  3JAF A;  4KUM B;  4CZZ B;  4DR1 T;  3CX6 B;  4LFA T;  4P0B A;  5ETW A;  2L8K A;  2V5D A;  2ZM2 A;  1MIY A;  3HKC E;  3UUL A;  2CE7 A;  3OTO T;  3RYF E;  5FNV E;  2CHO A;  2BS3 A;  3Q5E A;  5L2L A;  4BAY B;  3LBX A;  4OK0 A;  4GYS A;  2XAS B;  3AEF A;  2XQ7 A;  4U3C A;  3KBT A;  1WYB A;  5IHY A;  2JMK A;  5AQU B;  2I0M A;  5M4Y A;  3NZQ A;  2HPJ A;  2DL1 A;  4O4J E;  2Q9Q D;  2XM1 A;  2G0U A;  2XSA A;  3SFE A;  3I0Q A;  4I50 E;  4MAL A;  1LRZ A;  1HFA A;  3R6N A;  3RQW A;  1FEW A;  4ADZ A;  4YSZ A;  2E9X C;  5H6Q B;  5A1L A;  3NZP A;  1IZN B;  3NRX A;  3H3A A;  5HXE A;  2W66 A;  3C4X A;  3RH3 A;  3N2G E;  3QB5 A;  1WFD A;  2K5B B;  5AQV B;  5AQI B;  2CWY A;  1XDO A;  4ILB A;  1E7P A;  4TZ4 C;  3ZPO A;  4KHZ F;  1FJG T;  1KNZ A;  4IE4 A;  2CXD A;  4IE0 A;  4HFI A;  2VVN A;  4ZXL A;  1L0V A;  1SHZ C;  2MAW A;  3PUX F;  5EK2 A;  2J62 A;  2NP9 A;  2XAG B;  3N2O A;  3OVU A;  1O3X A;  2N1G A;  3L3P A;  2V6X A;  3ZST A;  4DBR A;  3AB3 B;  4K0U A;  2UUC T;  4UVC B;  3LK3 B;  3IBP A;  2ACX A;  3AAE B;  4N78 D;  4HEA A;  2WZI A;  4HGA A;  3C4Z A;  2UXB T;  2YDQ A;  5LMN T;  3K3Q C;  5FP3 A;  2X66 A;  2IC9 A;  2ZM8 A;  3UUX B;  3HA4 A;  3E22 E;  2YDS A;  3ZEF B;  3I0O A;  4EOZ B;  2VL0 A;  4CXY A;  3QNU A;  1Z8U A;  3BQK A;  4ILU A;  2NTY A;  4LF6 T;  3CX7 B;  5LCY A;  3J9X 1;  2WQY A;  1UUR A;  2BKP A;  2KLQ A;  3LK2 B;  5KX5 E;  4YLH A;  3PV0 F;  4EED A;  2XQ8 A;  4CN6 A;  4GK0 E;  2ODU A;  2W4X A;  5L4E A;  2H7V C;  2IIU A;  2RPA A;  5LHI B;  4NXN T;  4PJJ A;  3K8P C;  2VKJ A;  3V5S A;  1ZKE A;  2BG9 C;  3IHR A;  5CJ5 A;  1OED A;  3EHZ A;  2YDR A;  1YW0 A;  2X0L B;  3SOL A;  4QXH B;  2YK0 A;  1KK7 A;  1HNW T;  4L9I A;  5LBQ B;  4KX6 A;  5LGU B;  2WMN A;  3RQU A;  4DV3 T;  4TNV A;  2MOZ A;  3CX8 B;  1LVK A;  4PAG A;  2X51 A;  3ZSS A;  2V7K A;  3CPZ A;  2C0S A;  4KBM B;  3LFM A;  2DHR A;  3ONJ A;  5FL1 A;  3UQ4 A;  3C98 B;  1S35 A;  2ZMA A;  4UEM A;  3M3Z B;  1T98 A;  3X1D A;  3Q5D A;  2KMF A;  4AKH A;  3SWH A;  1SUM B;  4H63 V;  2DCF A;  4U2Y A;  3UFE A;  3ZC1 A;  4MLK A;  3RPU A;  2UXC T;  1IBK T;  4BA9 A;  2PG8 A;  3ZMU B;  3C4W A;  2LHN A;  2L9Q A;  2LLY A;  4UVB B;  3NBX X;  4EZ4 A;  4XBF B;  2M67 A;  3TLS A;  4ZI2 C;  4B3S T;  5LXT E;  4LF4 T;  5H6R B;  1M7K A;  5FKY A;  1XWM A;  4F6R C;  4DR5 T;  2BVL A;  2C5I T;  1T7S A;  4U7Y A;  1V9D A;  3F57 A;  1ZV4 X;  3QK6 A;  4ZI3 C;  4AKL A;  3Q5W A;  3QOF A;  4EEB A;  2VL8 A;  1H7C A;  2NTX A;  4WYV A;  2KT9 A;  2WM9 A;  3RLF F;  1M62 A;  1ZOY A;  5HEH A;  1AJ3 A;  3FBL A;  4U7I A;  1BR0 A;  1BR1 A;  2H88 A;  3ZN1 B;  4AI6 A;  4LML A;  1EZ3 A;  2YOE A;  1QLB A;  1HX1 B;  5AQR B;  2E5V A;  4IE5 A;  2PBI A;  1D1C A;  2MTQ A;  4O2B E;  5DAB A;  4K0K T;  4O4I E;  2VVS A;  1G8X A;  1SA0 E;  4M1P A;  4F8H A;  2K24 A;  2LHR A;  3EAM A;  5AQS B;  5LJN A;  1DU2 A;  4HFC A;  2D2S A;  1HG5 A;  4HE8 A;  2LKG A;  3HI2 A;  3OYX A;  4DR6 T;  5AQO B;  3N9N A;  5FXZ A;  2DNX A;  4PFP A;  2KXP B;  1B7T A;  3EDV A;  3N9Q A;  2BBJ A;  5F5W A;  5FMN A;  4X66 T;  1OWA A;  4BJN A;  3QC9 A;  5FXW A;  1YQ4 A;  4EB6 E;  5C3J A;  2LT3 A;  3RYC E;  4A98 A;  4TWH A;  2JMH A;  2HHH T;  3Q2M A;  3UQ7 A;  4Z91 A;  2XUE A;  4QH5 A;  2EHO A;  2V6Y A;  3FB2 A;  2A9U A;  4YJ3 E;  2VK9 A;  3F31 A;  5JVD E;  2UXX B;  3M65 A;  2F4V T;  4X1K E;  5CB4 E;  2BS4 A;  2DWG A;  3Q5X A;  4AKR B;  3ABV A;  2K48 A;  4AQG A;  4DR3 T;  3TLV A;  3AA6 B;  3MZK B;  4I43 B;  3UTK A;  4DR2 T;  2UUA T;  5LG3 A;  1U4Q A;  2JIW A;  3IEE A;  4TN7 B;  4IE7 A;  4ZI3 D;  2HH7 A;  4DND A;  2QGS A;  5AQF B;  1ZEE A;  3EAB A;  5ABE A;  2QYW A;  3CK6 A;  4IL9 A;  4G2A A;  1OED E;  3ONL C;  4DV2 T;  3UU8 A;  2V6Y B;  4QX8 B;  2LRK A;  3H3M A;  3W15 B;  5IWA T;  4I0U A;  1IJ5 A;  4ZS2 A;  4CI2 B;  5IYZ E;  2CM0 A;  3AE2 A;  4NUV A;  5LMU T;  4DV5 T;  3HKD E;  3AEC A;  3OPC A;  5AQL B;  4C91 A;  2YIN A;  2V8S V;  1W09 A;  4KP3 C;  1CHU A;  3CML A;  3O1H A;  4MBQ A;  4EYY R;  3ZJ2 A;  3B5M A;  3VU7 H;  4YJ2 E;  2V7J A;  2VQE T;  5AQP B;  1NWM X;  3SRZ A;  4B3T T;  3HR0 A;  4A56 A;  4UR9 A;  2FJE A;  2V7I A;  3PUZ F;  5FL0 A;  1OED B;  2BBH A;  2ACZ A;  3AVS A;  3JCF A;  3KBU A;  3P4Q A;  3AEE A;  2K9A A;  3KVB A;  3ZMS B;  4Z90 A;  2LM2 A;  4UIG A;  5LA6 E;  5JH7 E;  1MMA A;  4JI1 T;  5EK3 A;  1KFY A;  2W00 A;  3HL6 A;  5FY7 A;  2GK9 A;  3RIU C;  5ADX L;  4X65 T;  1UUS A;  2OLT A;  2WDQ A;  4JI3 T;  2KZ7 B;  2X9Y A;  1US7 B;  2WDR A;  2YU2 A;  3K3N A;  3UU3 A;  2FUP A;  3N2K E;  2C5J A;  4ZZC A;  2RP4 A;  2V7M A;  2MPK A;  4U74 A;  4O2A E;  1UGO A;  4P09 A;  5HCJ A;  5JR9 B;  3ZLI A;  1HTJ F;  2QA7 A;  4DMW A;  3ZMT B;  4LF9 T;  4GKJ T;  2CRB A;  2D0T A;  3UUM A;  1T8B A;  1WRD A;  3KIN B;  1XZY A;  4QH1 A;  5J1G A;  2B76 A;  1MMN A;  2CPT A;  2Y48 B;  4HWI B;  2BDE A;  3K1S A;  3FBZ A;  3R84 B;  2CCQ A;  4WW0 A;  1LKX A;  2IML A;  4DV7 T;  2W61 A;  2XQ4 A;  2FJD A;  1LVF A;  3B57 A;  2X9W A;  1NAF A;  3MK7 C;  4IGU A;  2VUR A;  2XZE A;  1WLX A;  2IC6 A;  4DMV A;  4E7Z A;  4JUY A;  3GA8 A;  5L3G B;  2UXD T;  3ZYL A;  2LE8 A;  3L09 A;  3C64 A;  2WDV A;  2NWB A;  2XTL A; 
#chains in the Genus database with same CATH homology
 2X9H A;  3RC8 A;  2V1D B;  2XAQ B;  2H3R A;  3FXE B;  4UVA B;  1HX8 A;  5CA1 E;  2ZLY A;  5L3C B;  2H7O A;  5LHG B;  2VB6 A;  1D1B A;  3KVA A;  2PFV A;  3NRY A;  4GIW A;  3WAK A;  4QWN B;  2N9D A;  3SS1 A;  4G63 A;  1VOM A;  1WR6 A;  2KIN B;  3AAI A;  4PJM A;  3KV9 A;  4PK4 A;  1MMD A;  5HYA A;  4EAH A;  2E9X D;  4CI1 B;  5EK4 A;  2P9B A;  3B13 A;  4PJN A;  3PTR B;  2L3L A;  2WAU A;  3PDY A;  5F3J A;  1QSD A;  2VKD A;  2KND A;  4XAX B;  5DJQ C;  5LG4 A;  3FHN A;  3PU8 A;  4QKN A;  3MXZ A;  2X9X A;  1G73 A;  3O1J A;  4TV8 E;  3U78 A;  5HWY A;  2VKH A;  5E0O A;  2OA5 A;  2WMO A;  2IAK A;  3ESL A;  3H37 A;  4XZC A;  2MBG A;  3GN5 B;  3MJX A;  4PK5 A;  4UV9 B;  5FXX A;  5HAX A;  4GYR A;  4X20 E;  4L0R A;  1HS7 A;  3ETU A;  4BJM A;  2Y6X A;  2Z6E A;  3O9X A;  3KV6 A;  1D0Y A;  2EHO C;  4H9O C;  1UCU A;  3I1A A;  2JQQ A;  4J2C A;  4NUU A;  3N9O A;  3ZN0 B;  2D0U A;  3BQL A;  4TX5 A;  3UUN A;  1CUN A;  3PU3 A;  3CWZ B;  5LP6 E;  2CEA A;  2Q9Q C;  2JRK A;  3LBX B;  3RRC A;  4IDZ A;  4UEL A;  2D5U A;  4QX7 B;  3T8O A;  3GN5 A;  3ZMZ B;  3VKH A;  2BZB A;  3RX6 A;  5JDM A;  4QXC B;  3ZMV B;  4PNI A;  3HKB E;  5JRC A;  2VKO A;  3CQX C;  4X1Y E;  2LSG A;  3RYH E;  4Z8X A;  3PUQ A;  4QHO A;  3OJA A;  1OXZ A;  4ZHQ E;  5L3F B;  5JR9 A;  2B1E A;  5JDQ A;  5LGT B;  2VAS A;  4WBO A;  4AQF C;  4UXN B;  1Y64 B;  5LYJ E;  3P7I A;  5J2U E;  3OBV E;  4H9Q C;  1UX4 A;  4JEH B;  3RRW A;  4IHJ E;  4PW8 A;  5GON E;  5CA0 E;  2W0G A;  1HCI A;  5HXR A;  2PJQ A;  5JDN A;  4OFZ A;  1BR2 A;  3O4X E;  3A5X A;  4DVD A;  4EIW A;  4ZI2 D;  2LSI A;  4PFO A;  4ZOL E;  2LSK A;  2JPF A;  3EVY A;  3VHL A;  2DI4 A;  4GK5 E;  2DLR A;  5HXC A;  4WBN E;  5FY1 A;  2Q9Q B;  2A3D A;  1MIV A;  1YD8 G;  2XQY A;  3E08 A;  3K3O A;  2NW7 A;  5LJM A;  3DJB A;  3DTO A;  2CXF A;  2I59 A;  3IF8 B;  1BR4 A;  1D0Z A;  5L3D B;  2Q9Q A;  4TUY E;  3RKO A;  1UX5 A;  4OHF A;  3P8C D;  4I55 E;  5J2T E;  1E1H B;  3CQG B;  4UF0 B;  5AFU L;  4UV8 B;  2YU1 A;  3EUH A;  1MIW A;  3KV4 A;  4C90 A;  4H63 H;  5KDM C;  1ZHC A;  3N5L A;  2IW5 B;  4O8S A;  1HF8 A;  4DBQ A;  2XAJ B;  4WNK A;  2X68 A;  3KV5 A;  3EDU A;  3FXD B;  2LOS A;  1S94 A;  2CMR A;  4KMC A;  3I9Y A;  3V5U A;  3ZYM A;  4DO0 A;  2A2F X;  4EYU A;  1D1A A;  5DQV A;  4CI3 B;  2DWK A;  4JLE A;  2NW8 A;  2UXN B;  2LM9 A;  3PUR A;  4V1A v;  2NW9 A;  2EHO D;  4ERR A;  3DP7 A;  3VKG A;  2WWU A;  3BQI A;  5LBM A;  3O1I A;  2YEV C;  2KWH A;  2CLY C;  3CKD A;  1HG2 A;  4HKA A;  5HXS A;  4AQF A;  3RC3 A;  5L3B B;  2E9X A;  5DQW A;  5LOV E;  3MKD A;  5C8Y E;  3UT5 E;  5LGN B;  5FY0 A;  3GWH A;  4HTE A;  2V7L A;  3QUJ A;  5LNK A;  3AAA B;  3JC6 D;  2V26 A;  5TAO A;  2LOP A;  3Q9D A;  3C50 A;  5JDL A;  3BK9 A;  5KMG P;  3N9P A;  1MMG A;  2XHE B;  3I9W A;  3U3I A;  3GMI A;  2Y8D A;  4EXT A;  4H9N C;  3WI3 A;  2E8I A;  3KDS E;  3KFW X;  4AXP A;  2SPC A;  4AKG A;  4IE6 A;  5HWX A;  4HFV A;  5JDF A;  3PUS A;  2BVM A;  3D0T A;  4QXB B;  1MND A;  5JQG E;  1MNE A;  3J7Y q;  2LEH A;  3ANW A;  4I4T E;  3PE0 A;  4CXW A;  1FMW A;  2VWA A;  4H9S E;  2CLY B;  4FI5 A;  1YKH B;  4UF0 A;  2WBL A;  3JC6 C;  2WSS V;  2CXL A;  2LJL A;  5BMV E;  4P0A A;  5F8P A;  2W62 A;  3ZCI A;  5FXV A;  2ODV A;  2LSY A;  2ZM0 A;  4H9P C;  4O4L E;  1U5P A;  2NOX A;  3ETV A;  3N9M A;  3AVR A;  4YFS A;  3AA1 B;  1FIO A;  4ASK A;  5JR9 C;  2MYS A;  3S4U A;  2EHO B;  3ZJ1 A;  1IAP A;  3OYZ A;  4HN9 A;  4IST A;  1X79 A;  3CQC B;  5FYM A;  4EZH A;  4YHJ A;  3ZYK A;  5LHH B;  2W63 A;  4OYJ A;  3MAC A;  2CA5 A;  2C5K T;  2LSJ A;  3F2E A;  4FJO A;  4MFR A;  4ANJ A;  4ZI7 E;  3C51 A;  2E9X B;  5HXH A;  4X1I E;  2HPL A;  4E7S A;  1YKE B;  4B6X A;  2X67 A;  4MHC A;  3RYI E;  3ZCJ A;  2A72 A;  3TKL B;  2RA1 A;  1WYC A;  2J1D G;  3E0Z A;  4O4H E;  4CXX A;  1FMV A;  4OYK A;  3ZC0 A;  5EZY E;  4ISS A;  4PK6 A;  1IJ6 A;  2XAF B;  3LK4 2;  4H9R C;  3HKE E;  4TV9 E;  5JRE A;  4PJL A;  5JDH A;  4IIJ E;  3LG7 A;  2XAH B;  4CQI A;  4JEU B;  1VRB A;  2ES0 A;  1D0X A;  3ANW B;  3ONX A;  4AKI A;  3MA9 A;  3PUG A;  4GOU A;  1QUU A;  3OKQ A;  1Z0P A;  2KWI B;  3PUA A;  4ZS3 A;  2JJ9 A;  4U72 A;  2CWO A;  4L5G A;  3LJC A;  5JDG A;  3AA0 B;  2N2N A;  3AA7 B;  3WAJ A;  3N9L A;  4CZZ B;  4KUM B;  3CX6 B;  4P0B A;  5ETW A;  2L8K A;  2ZM2 A;  1MIY A;  3HKC E;  3UUL A;  2CE7 A;  3RYF E;  5FNV E;  5L2L A;  4BAY B;  3LBX A;  4OK0 A;  4GYS A;  2XAS B;  3KBT A;  1WYB A;  5IHY A;  2JMK A;  5M4Y A;  3NZQ A;  2HPJ A;  4O4J E;  2Q9Q D;  2G0U A;  3I0Q A;  4I50 E;  4MAL A;  1LRZ A;  1HFA A;  3R6N A;  4ADZ A;  1FEW A;  2E9X C;  5H6Q B;  5A1L A;  3NZP A;  1IZN B;  3NRX A;  3H3A A;  5HXE A;  3C4X A;  3RH3 A;  3N2G E;  2K5B B;  2CWY A;  3ZPO A;  4TZ4 C;  1KNZ A;  4IE4 A;  2CXD A;  4IE0 A;  1SHZ C;  5EK2 A;  2XAG B;  2NP9 A;  3N2O A;  5L3E B;  1O3X A;  2N1G A;  3L3P A;  4DBR A;  3AB3 B;  4K0U A;  4UVC B;  3LK3 B;  3IBP A;  2ACX A;  3AAE B;  4N78 D;  4HEA A;  4HGA A;  3C4Z A;  3K3Q C;  5FP3 A;  2X66 A;  2IC9 A;  2ZM8 A;  3UUX B;  3HA4 A;  3E22 E;  3I0O A;  4EOZ B;  4CXY A;  3BQK A;  4ILU A;  2NTY A;  3CX7 B;  5LCY A;  3J9X 1;  2KLQ A;  3LK2 B;  5KX5 E;  4YLH A;  4GK0 E;  2ODU A;  2H7V C;  5LHI B;  4PJJ A;  3K8P C;  2VKJ A;  3V5S A;  1ZKE A;  3IHR A;  3SOL A;  1YW0 A;  2X0L B;  4QXH B;  2YK0 A;  1KK7 A;  4L9I A;  5LBQ B;  5LGU B;  2WMN A;  2MOZ A;  3CX8 B;  1LVK A;  4PAG A;  2X51 A;  2V7K A;  3CPZ A;  2C0S A;  4KBM B;  3LFM A;  2DHR A;  3C98 B;  1S35 A;  2ZMA A;  4UEM A;  1T98 A;  2KMF A;  4AKH A;  3SWH A;  4H63 V;  3UFE A;  2DCF A;  3ZC1 A;  4MLK A;  3RPU A;  4BA9 A;  2PG8 A;  3ZMU B;  3C4W A;  2LHN A;  2L9Q A;  4UVB B;  3NBX X;  4EZ4 A;  4XBF B;  2M67 A;  4ZI2 C;  5LXT E;  5H6R B;  4F6R C;  2BVL A;  2C5I T;  1V9D A;  3F57 A;  1ZV4 X;  3QK6 A;  4ZI3 C;  4AKL A;  3Q5W A;  2VL8 A;  1H7C A;  2NTX A;  2KT9 A;  2WM9 A;  1AJ3 A;  3FBL A;  1BR0 A;  1BR1 A;  3ZN1 B;  4AI6 A;  1EZ3 A;  4IE5 A;  2PBI A;  1D1C A;  2MTQ A;  4O2B E;  5DAB A;  4O4I E;  1G8X A;  1SA0 E;  4M1P A;  5LJN A;  2K24 A;  2LHR A;  2D2S A;  1HG5 A;  4HE8 A;  3HI2 A;  3OYX A;  3N9N A;  5FXZ A;  2DNX A;  4PFP A;  2KXP B;  1B7T A;  3EDV A;  3N9Q A;  5FMN A;  1OWA A;  4BJN A;  3QC9 A;  5FXW A;  4EB6 E;  2LT3 A;  3RYC E;  2JMH A;  3Q2M A;  2XUE A;  2EHO A;  3FB2 A;  4YJ3 E;  2VK9 A;  3F31 A;  5JVD E;  2UXX B;  3M65 A;  4X1K E;  5CB4 E;  2DWG A;  3Q5X A;  4AKR B;  4AQG A;  2K48 A;  3AA6 B;  3MZK B;  3UTK A;  1U4Q A;  3IEE A;  4TN7 B;  4IE7 A;  4ZI3 D;  2HH7 A;  4DND A;  2QGS A;  1ZEE A;  4G2A A;  4QX8 B;  3W15 B;  1IJ5 A;  3C64 A;  4ZS2 A;  4CI2 B;  5IYZ E;  2CM0 A;  4NUV A;  5JRC B;  3HKD E;  4C91 A;  2YIN A;  4EYY R;  4KP3 C;  3CML A;  3O1H A;  4MBQ A;  3ZJ2 A;  3VU7 H;  4YJ2 E;  2V7J A;  1NWM X;  3SRZ A;  3HR0 A;  4A56 A;  2V7I A;  4I43 B;  3AVS A;  3ZMS B;  3KBU A;  2K9A A;  3KVB A;  5LA6 E;  4UIG A;  5JH7 E;  1MMA A;  5EK3 A;  5FY7 A;  2W00 A;  3HL6 A;  5ADX L;  2GK9 A;  2KZ7 B;  2X9Y A;  1US7 B;  2YU2 A;  3K3N A;  3N2K E;  2C5J A;  2RP4 A;  2V7M A;  4U74 A;  4O2A E;  4P09 A;  5JR9 B;  3ZLI A;  1HTJ F;  2QA7 A;  4DMW A;  3ZMT B;  2D0T A;  3UUM A;  1WRD A;  3KIN B;  5J1G A;  1MMN A;  2Y48 B;  2BDE A;  3R84 B;  3FBZ A;  2CCQ A;  4WW0 A;  1LKX A;  2W61 A;  1LVF A;  3B57 A;  2X9W A;  1NAF A;  3MK7 C;  4IGU A;  1WLX A;  2IC6 A;  4DMV A;  4E7Z A;  4JUY A;  3GA8 A;  5L3G B;  3ZYL A;  2LE8 A;  3L09 A;  3CVR A;  3ZEF B;  2NWB A;  2XTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...