5JR9B

Crystal structure of apo-nec3po
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
186
structure length
186
Chain Sequence
GSMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
molecule keywords NEQ131
molecule tags Dna binding protein
source organism Nanoarchaeum equitans (strain kin4-m)
total genus 82
structure length 186
sequence length 186
chains with identical sequence D, E, F, G, H
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jr9B00
5JR9C 5JR9A 5JREA 3ZC1A 3ZC0A 5JRCB 5JRCA 5JR9B
chains in the Genus database with same CATH superfamily
3TKLB 4IE5A 4UV9B 5F5WA 2VK9A 5FY0A 4GKKT 2V5DA 1UCUA 1T72A 3K3QC 3N2GE 4AKHA 1WCRA 3N2KE 2HN1A 1D0XA 1LKXA 3N2OA 4NPPA 2V1DB 4HFDA 5J2TE 3K3NA 2V6YB 2CXLA 1T8BA 5DABA 3UQ4A 2VWAA 1ZKEA 2ACXA 4H9SE 3HR0A 5HYAA 3P4PA 4ZI2C 5F8PA 4ILCA 4L9IA 3SOLA 5BR8T 2E9XD 2VVNA 3H37A 2DL1A 2JMHA 4ILUA 2BS2A 3WI3A 3UUNA 5JREA 2CWOA 5AQQB 2BS3A 4OX9T 2YK0A 5CB4E 5LJMA 5L3EB 4TNVA 3H3MA 2HPLA 5KXJA 2X51A 4DO0A 3ZT6A 1D1CA 4JLEA 2XQ3A 2HPJA 3UULA 1IAPA 3ZPOA 2LKHA 1ZOYA 3O1IA 4MFRA 4CI3B 3RI5A 2FJEA 2WMNA 5AQMB 3N9LA 1Y01A 5HEUA 4I55E 4Z91A 3J7Yq 3FBZA 3ANWA 3UTKA 4O8SA 4JV5T 1OEDC 2JMKA 5CGMA 3AEDA 2NP9A 2ES0A 2Q9QD 4O2BE 2QYWA 2KWHA 4ZXLA 2XY8B 5AQGB 5ADXL 2XASB 1XZYA 1BR4A 4X1IE 3FZFB 4CXYA 4B3ST 2FJDA 4YFSA 3PU8A 4QHOA 3AE8A 4EYUA 2CHNA 4I4TE 3C4ZA 4JI6T 1IZNB 4AQYT 2V7JA 4GOUA 3SWHA 4I43B 4XZCA 2MOZA 1Z8UA 4GIWA 3UFGA 2E9XC 4IIJE 3VHLA 4E7SA 4CXXA 5HXHA 4HGAA 4HN9A 4KMCA 5CJ5A 4AKIA 2ODUA 5AQPB 1SHZC 3E22E 5AQRB 4DMWA 4B3TT 1W09A 3D0TA 1QUUA 4GK0E 3P7IA 2CMRA 4JI3T 1J5WA 5J2UE 5CA0E 5L47A 2I0MA 3K3OA 2L3LA 3RIUC 5JR9B 4HWCA 5HWXA 2WU5A 2XQ6A 1MNEA 4U31A 1HNXT 3GN5A 3OVUA 5JH7E 3WAKA 2Q9QC 2V7LA 3PUQA 2Y48B 4IGUA 2V7IA 1N32T 2X9WA 3CX8B 4PJJA 1HCIA 3ETVA 5FVLA 3RKGA 2XHEB 3NKZA 2W2UA 1X79A 2X9HA 4U7YA 3AXJB 1D1AA 4NUUA 5HEHA 3KV9A 4JEUB 4C90A 3I0QA 2IAKA 3HKDE 5FL0A 2J62A 3LSVA 3EDVA 3C64A 4LF5T 2JQQA 2XUEA 4TN7B 4HWDA 1N36T 2D5UA 3AVSA 5LJNA 2ZM2A 3EVYA 4LFCT 3EDUA 4QX7B 2E8IA 2OV9A 4LMJA 4KX6A 4IDZA 4TWHA 3OYZA 5LYJE 3KBUA 4IDPA 4DNDA 2XJ7A 3K8PC 2UXNB 2BVMA 2H3RA 4PJMA 3U78A 3LJCA 2QGSA 1T7SA 2J4GA 2IIUA 1M62A 4AISA 2W63A 5LP6E 5H6QB 2BZBA 4YLHA 2F4VT 3SFEA 3I9WA 2W66A 3IA3A 2XTLA 2BG9E 4QXBB 3CQGB 4X1KE 3LBXB 4DR1T 3JCFA 2PTFA 3IBPA 5BMVE 2D0TA 3CMLA 3RIAA 4ZI3D 2X67A 3CX6B 4K0UA 3WAJA 1GQEA 2XQAA 3LDQB 2FBWA 3RLFF 3AE6A 3LG7A 3KBTA 1IBMT 3A5XA 5M4YA 3T1HT 2KMFA 4CN4A 1W0BA 2WDVA 4TWDA 1HF8A 1EZ3A 1E7PA 3UT5E 4L5GA 4LF6T 5JDMA 5LBQB 5AQOB 3CVRA 3HKEE 3ZYLA 3BK9A 4IL9A 5LXTE 4IL4A 2X0YA 4EYYR 2PBIA 5ABFA 2HHHT 4HTEA 2NTXA 3ZYKA 2UXXB 2WWVA 3AECA 3DP7A 3CWZB 1KEYA 3QB5A 2K9AA 4DV0T 3EUHA 1HS7A 4YSZA 4YSYA 2RP4A 4DR3T 4G2AA 4LFBT 3K1SA 3O4XE 2JQKA 4ANJA 4FJOA 2A72A 5DQWA 4U2ZA 3N9MA 4QXHB 4HWIB 1FEWA 2A3DA 2YINA 1HNWT 5AQIB 2FJBA 4AQFA 2BG9A 5JVDE 2V7MA 3TLWA 1HG2A 2B76A 2LM2A 2WQYA 4WW0A 2BVLA 4DV2T 4BJMA 4OYKA 4DMVA 1KFYA 2HN2A 4UF0A 2JPFA 4AIUA 2CM0A 3N9OA 2NTYA 4HFBA 4U74A 3NWIA 2EHOC 3AA0B 4DR4T 3E0ZA 2IC6A 2KSRA 2UUAT 3J9X1 4EAHA 1NEKA 2OA5A 1LVKA 5L3CB 3N9NA 4CI2B 1DU2A 3OJAA 1W0AA 3TLVA 2L8KA 2AXDS 3PV0F 4ZZBA 5FXWA 3ABVA 2YU1A 3AE3A 1FIOA 4ZOLE 3P4QA 1WYBA 4HFVA 3VR9A 2J1DG 2VURA 1ZP0A 3RYIE 1HNZT 1Z0PA 5JRCB 3IHRA 4U33A 1YXRA 2H88A 3VKGA 2XM2A 2CRBA 5AQTB 1HX8A 4PW8A 4ASKA 2AE9A 2MYSA 4PK6A 2LE8A 4X20E 3RKOA 3FZMB 3F2EA 2EHOB 2MTQA 1E1HB 2XQYA 2RA1A 3ONJA 2LHNA 3C4WA 4K0KT 1B7TA 2UU9T 4A5XA 2KNDA 4EB6E 4DV7T 5LGUB 2K5BB 2VKJA 3ETUA 3QC9A 3UU6A 2UXBT 2W67A 2XZEA 2VL8A 4ILAA 2VL0A 2YDQA 2LHRA 5HEGA 1D0ZA 3ANWB 4H9PC 2X0HA 2VASA 2FUPA 1SA0E 3L09A 1XNRT 3P8CD 4V1Av 3LK2B 1UK5A 2DWKA 4LMLA 4Z8XA 2E5LT 2XQ5A 4TNWA 4CQIA 3TLUA 4QWNB 4F6RC 2PJQA 3BQIA 1HX1B 4JI2T 3I1AA 2NW9A 3F57A 2BKNA 5J0ZA 3UFEA 3KV5A 3X1DA 4JI5T 5KDMC 4O4HE 3NZPA 5EK4A 3NRYA 2LKGA 4O2AE 2ACZA 2LT3A 3RYFE 3FZKB 4X66T 3L39A 2I59A 1LVFA 4IDNA 1IBLT 2V6YA 3OYXA 5LCYA 2V6XA 4PFOA 2M67A 1VRBA 4IDOA 2SPCA 3MA9A 4AQGA 2W62A 4IHJE 4IE7A 4TX5A 4UXNB 4IREA 5DJQC 3ZSSA 4YXDA 3AE5A 4HWHA 4N78D 2W0GA 2CXDA 2K3WA 2BBJA 2XAJB 4PK4A 2LSIA 1IJ5A 3Q5DA 1N34T 4B3RT 5EZYE 3ZSTA 3FZHB 5LGTB 3GA8A 3AA1B 2I6HA 4B6XA 5ABEA 5GONE 4DIDB 1XDPA 2YOEA 3F31A 3KV6A 2A2FX 3C51A 5FVKA 4HFCA 1QSDA 1OEDB 2QVAA 3PUZF 4P0AA 1KNPA 1NWMX 3LFMA 1AJ3A 4LF9T 3KVAA 4B3MT 2CHOA 2XQ4A 5KX5E 3GMIA 2JJ9A 3ZC1A 3AAEB 2CWYA 5JDHA 2WDRA 2LSJA 4DV4T 4PFPA 3PUSA 5EK3A 2V8SV 4ZHQE 3QOFA 4UV8B 3O9XA 5LMNT 2BKPA 3JADA 3KDSE 5EK2A 5LHHB 2GK9A 5AQNB 1VCSA 4ZS3A 3FB2A 3CX7B 2N2NA 1CUNA 2E9XB 3ZN0B 4DVDA 5LGNB 5L3FB 1ZV4X 3P4WA 3PURA 2XM1A 2D2SA 3C98B 2CCQA 4HFIA 4J2CA 5JDLA 2YDRA 5J1GA 4LF7T 3ZC0A 3H3AA 2JQ9A 2WS3A 3UU4A 3LK42 4MALA 1M7KA 4UR9A 4ISTA 3PUVF 2VQET 5FNVE 2WZHA 3OTOT 3ZMVB 4NUVA 4TV8E 2K24A 4BAYB 1MMNA 3VRBA 1S94A 2JRKA 4LFAT 4AKLA 2WM9A 5JR9A 2BDEA 2Q9QB 3HKCE 5L4HA 5LG4A 1KK7A 3N9PA 1MIYA 2XPKA 5AQUB 1SE7A 2CBIA 5L4EA 5AQLB 5LA6E 3A8YC 4YSXA 4JBWF 4CN1A 3V5UA 3CQCB 2DNXA 2ZLYA 4Z90A 2ZMAA 3RGLA 3ZYMA 1US7B 3AEFA 3CIRA 4X65T 2M6BA 2BG9C 4AQFC 2A9UA 1XWMA 4QKNA 2LEHA 3AXJA 1NENA 4LF4T 5ABFB 3SFDA 5LHGB 1ZEEA 4UELA 2YDSA 2OLTA 1OXZA 4JEHB 3CQXC 5LG3A 4JI4T 3B5MA 3RIUA 4WBNE 1U4QA 2WU2A 3EAMA 5JDNA 1MIVA 2C5JA 3ZT5A 4ERRA 3B57A 2KZ7B 3KV4A 2ZM6T 5TAOA 1FJGT 5CFBA 3AEEA 1HFAA 4YY3T 3QB5K 3GWHA 4OYJA 2G0UA 1J1JA 1XDOA 1XMQT 1T98A 3ZLIA 2C5KT 4G63A 3CPZA 4I0UA 3LBXA 3ZEFB 2WP9A 4HFEA 4O4JE 4EV6A 1HG5A 5AQKB 5HCMA 3IF8B 2UUCT 3RRCA 2XAQB 3PTRB 2W00A 2IDOB 1UURA 4YT0A 4H63H 5LHIB 2QRXA 1Y64B 3Q9DA 3NVOA 2MAWA 5AQSB 1WFDA 3RX6A 3PDYA 3G06A 3EI0A 5L3BB 3L8RA 3MZKB 4YTPA 4U3CA 2XSBA 5AQHB 3I0OA 5C8YE 4PJLA 2UXCT 4GYRA 3S4UA 4ZI3C 5HWYA 3ZT7A 3HI2A 2YEVC 4ADZA 5AQFB 4NXNT 1D0YA 4XAXB 3C4XA 5HXRA 3OKQA 3NBXX 4X64T 2W4XA 2V26A 1G8XA 1HTJF 2LLYA 1W9RA 1O3XA 1KNZA 2LSYA 2LSKA 4EZ4A 5JDGA 4JI7T 2E5VA 3VKHA 3L3PA 5C3JA 3Q2MA 4DV1T 1U5PA 1WR0A 3W15B 4EEDA 5IWAT 1VOMA 3PUAA 2CBJA 3RC3A 1J5ET 4DBQA 3P4RA 3O1JA 4Q25A 4LF8T 3HL6A 2V5CA 5FKYA 4YTMA 3M3ZB 2H7OA 2VKHA 4HKAA 4EZHA 2X66A 1LRZA 2WSSV 5JDFA 4EXTA 2C5IT 1YQ4A 2XAGB 4P09A 4QH5A 3ZCIA 4JI1T 2DI4A 2MBGA 3CKDA 1MMAA 3QK6A 1I94T 3PJAJ 1XNQT 3LK3B 2J47A 3RQUA 4HWFA 4JUYA 3SRZA 4JYAT 4TV9E 2VKOA 2LRLA 3ZMUB 2CPTA 3AA7B 4A98A 2FJAA 5FYMA 3U3IA 3EABA 2LOPA 1MNDA 4LMKA 2NW8A 5FY7A 5L2LA 3VRAA 4DBRA 2N1GA 5HXCA 1WYCA 2WMOA 3BQLA 1MMDA 5FL1A 4DR2T 3UU8A 5JRCA 3RRWA 4I50E 4DR6T 1KF6A 3ZMTB 4HFHA 3ZN1B 3PUYF 3HKBE 3RC8A 1CHUA 2V7KA 2EHOA 2B1EA 5FXZA 5IUXA 3SS1A 4ZI7E 4WBOA 3AE7A 3FBLA 1N33T 4HE8A 1D1BA 5CA1E 5AFUL 1KNRA 4YTNA 5LBMA 4EGWA 2D0UA 2XSAA 4IE6A 1MIWA 4OK0A 3RF1A 3TLSA 4QX8B 2DHRA 2JIWA 1SUMB 1OEDE 1IBKT 3AB3B 4FI5A 5AQVB 3RQWA 4DV5T 4M1PA 4WNKA 5FXXA 1IJ6A 1YD8G 1HR0T 2X68A 4UEMA 5KMGP 3AAIA 4X5TA 1BR0A 4P1NA 1G73A 3PUGA 5ABHA 2BS4A 4ZEYA 1V9DA 2BBHA 4YHHT 3CK6A 4DR7T 1BR1A 4DV6T 4H9RC 2YN6A 3RPUA 2N9DA 3N5LA 3A7MA 2LOSA 3ONXA 5F3JA 3VR8A 2NOXA 4L0RA 4U2YA 5JR9C 1NAFA 3GN5B 3VU7H 4NXMT 3R6NA 4EOZB 4PK5A 2M6IA 3RIFA 3AAAB 1XMOT 2YKSA 3ZCJA 3FXDB 2WAUA 4U72A 5DQVA 2DWGA 4JI8T 4U7IA 5AQJB 1YKHB 5JDQA 2ZM8A 3V5SA 5IHYA 2HH7A 3PUXF 4TUYE 3PUWF 2X9XA 2XAFB 1UX4A 2KXPB 3KFWX 4PJNA 3T8OA 1UGOA 2VKDA 3UQ7A 1FMWA 5LB7B 2XQ9A 3EHZA 3MK7C 1UX5A 3C50A 4COFA 2L9QA 4A56A 4X62T 4ILBA 3I9YA 4C91A 4AKGA 1OEDA 2VVSA 2Y6XA 5LNKA 2IHR1 3N9QA 3AEAA 2Y8DA 1UUSA 4YJ3E 1YW0A 2CA5A 1S35A 5H6RB 2LRKA 3DTOA 1QLBA 3M65A 2KWIB 2NWBA 4EEBA 5FY1A 3MACA 4CI1B 2UXDT 2XQ7A 4KHPT 3MJXA 1JNZA 4TZ4C 4KUMB 4OHFA 2H89A 5IYZE 3OBVE 3RHWA 2Z6EA 3RYHE 2PFVA 5A1LA 3TLTA 3MKDA 3ZMZB 2LSGA 3UUBA 4ISSA 1YQ3A 4QH4A 4H9NC 4ZS2A 4MBQA 3P4SA 2E9XA 2DLRA 2WY2A 2P9BA 3P50A 2WB5A 3JAFA 2IC9A 3AE1A 3Q5XA 2CE7A 3Q5WA 4GK5E 4AKRB 5L3DB 4PNIA 3AEBA 3FZLB 1WR6A 3HA4A 4H9OC 4CXWA 5HAXA 3NRXA 3NZQA 5ETWA 4H63V 2NW7A 1FMVA 2R6GF 5LOVE 4PAGA 4QXCB 1MMGA 4X1YE 5LMUT 4MHCA 4TWFA 3KINB 5FXVA 4DUYT 4AXPA 5HCJA 2H7VC 4HEAA 2E2AA 1X9BA 1L0VA 3ONLC 4YJ2E 2Q9QA 2D9DA 2LJLA 2XQ8A 2CEAA 4BJNA 5C2TA 1ZHCA 3ZMSB 4KP3C 3JC6D 1BR2A 4IDQA 2EHOD 2RPAA 3UUXB 2CXFA 3MXZA 3RH3A 3QNUA 2JQHA 2VB6A 3BQKA 2BG9B 2LM9A 3R84B 5HXEA 4WZXA 3OPCA 1WLXA 4AI6A 2ODVA 4OFZA 3KVBA 5JTGA 3E08A 5HEJA 2W61A 4IE0A 4UF0B 3PE0A 4YHJA 2C0SA 4O4IE 4UVBB 2CLYC 4O4LE 5HXSA 2QA7A 4QH1A 3RYCE 5L3GB 3Q5EA 4NIQA 4BA9A 4DUZT 2K48A 4CN6A 2KINB 5HEOA 2MPKA 3AE2A 2UUBT 4GYSA 1I6ZA 4UVAB 2DCFA 3PU3A 2VQFT 3ZJ2A 3AEGA 2NR4A 2X0LB 5FMNA 2YU2A 3AE9A 4H9QC 1WRDA 3AE4A 4P0BA 4ZI2D 3QUJA 2WDQA 2KT9A 4CZZB 4IE4A 3PJAA 5E0OA 3UU5A 3O1HA 3JAEA 5JQGE 1OWAA 3AA6B 3FHNA 4UVCB 4F8HA 4XBFB 2CLYB 3JC6C 2WZIA 4IT4A 4KBMB 3B13A 2IW5B 2KLQA 2XAHB 3FXEB 5FP3A 2ZM0A 4GKJT 3UUMA 2BKOA 4UIGA 4JI0T 4E7ZA 2IMLA 1H7CA 3IEEA 3AVRA 4KI0F 2WBLA 4EIWA 1E2AA 4DV3T 4DR5T 4A97A 3ZJ1A 2WCAA 3DJBA 4ZZCA 1YKEB 5ABGA 1JNRA 3T1YT 2WWUA 2IUBA 1VCTA 2PG8A 1R8IA 4WYVA 4KHZF 3ESLA 2X9YA 3UU3A 4MLKA 3ZKRA
chains in the Genus database with same CATH topology
3CWZB 3TKLB 4IE5A 3LK42 4UV9B 4MALA 1V9DA 2K9AA 2VK9A 3EUHA 1HS7A 4ISTA 5FY0A 5FNVE 3ZMVB 4NUVA 1BR1A 1UCUA 4H9RC 4TV8E 3RPUA 2K24A 3K3QC 2RP4A 2N9DA 4BAYB 1MMNA 3N5LA 4G2AA 1S94A 3N2GE 4AKHA 2JRKA 2LOSA 3ONXA 4AKLA 5F3JA 3O4XE 2WM9A 5JR9A 2BDEA 4ANJA 2NOXA 3N2KE 4FJOA 2Q9QB 2A72A 1D0XA 4L0RA 5DQWA 3HKCE 1NAFA 1LKXA 5JR9C 3GN5B 3VU7H 5LG4A 1KK7A 3N9MA 3N2OA 3R6NA 4EOZB 2V1DB 5J2TE 4PK5A 3N9PA 1MIYA 3K3NA 4QXHB 3AAAB 1FEWA 2A3DA 3ZCJA 2CXLA 3FXDB 2WAUA 5DABA 4U72A 5DQVA 2DWGA 5LA6E 2VWAA 2YINA 1ZKEA 2ACXA 4H9SE 3HR0A 5HYAA 1YKHB 3V5UA 3CQCB 5JDQA 4ZI2C 2ZM8A 2DNXA 5F8PA 4L9IA 2ZLYA 3V5SA 5IHYA 4AQFA 3SOLA 2ZMAA 5JVDE 3ZYMA 2V7MA 1US7B 1HG2A 2E9XD 2HH7A 4WW0A 4AQFC 2BVLA 3H37A 2JMHA 4ILUA 4QKNA 3WI3A 3UUNA 5JREA 2LEHA 4BJMA 4OYKA 4DMVA 2CWOA 2YK0A 4TUYE 5LHGB 1ZEEA 5CB4E 5LJMA 4UELA 2X9XA 2XAFB 1UX4A 5L3EB 4UF0A 2JPFA 1OXZA 2KXPB 3KFWX 2CM0A 4JEHB 3N9OA 4PJNA 2HPLA 3T8OA 2NTYA 2VKDA 2X51A 3CQXC 4U74A 4DO0A 2EHOC 1D1CA 4JLEA 2HPJA 1FMWA 3AA0B 3UULA 4WBNE 1IAPA 3ZPOA 1U4QA 3MK7C 3E0ZA 2IC6A 1UX5A 3C50A 2L9QA 5JDNA 1MIVA 3J9X1 2C5JA 3O1IA 4EAHA 2OA5A 4A56A 1LVKA 5L3CB 4ERRA 3N9NA 4MFRA 4CI3B 3B57A 2KZ7B 2WMNA 3KV4A 4CI2B 3I9YA 3OJAA 3N9LA 5TAOA 4C91A 4AKGA 4I55E 2L8KA 3J7Yq 3FBZA 2Y6XA 3ANWA 1HFAA 3UTKA 5FXWA 4O8SA 2YU1A 1FIOA 2JMKA 5LNKA 3GWHA 3N9QA 4ZOLE 2NP9A 4OYJA 1WYBA 2ES0A 2G0UA 2Q9QD 4O2BE 2KWHA 2Y8DA 4HFVA 2J1DG 4YJ3E 1T98A 1YW0A 3RYIE 3ZLIA 5ADXL 1Z0PA 2C5KT 5JRCB 2XASB 3IHRA 4G63A 2CA5A 3CPZA 1S35A 5H6RB 1BR4A 4X1IE 3DTOA 3LBXA 3ZEFB 4CXYA 3M65A 3VKGA 2KWIB 2NWBA 4O4JE 4YFSA 3PU8A 3MACA 5FY1A 4CI1B 1HG5A 4QHOA 1HX8A 4PW8A 4ASKA 3MJXA 4EYUA 2MYSA 4PK6A 2LE8A 4TZ4C 4X20E 3IF8B 3RRCA 2XAQB 4KUMB 3PTRB 4I4TE 4OHFA 2W00A 3C4ZA 5IYZE 3RKOA 3OBVE 2Z6EA 3F2EA 2EHOB 3RYHE 2MTQA 4H63H 1E1HB 2PFVA 2XQYA 1IZNB 5A1LA 2RA1A 1Y64B 5LHIB 3MKDA 3ZMZB 2LHNA 2V7JA 3C4WA 4GOUA 2LSGA 1B7TA 3SWHA 3Q9DA 4I43B 4XZCA 4ISSA 2MOZA 2KNDA 4EB6E 3RX6A 4H9NC 3PDYA 4ZS2A 4MBQA 5LGUB 4GIWA 5L3BB 3MZKB 2K5BB 2E9XA 2VKJA 3ETUA 2DLRA 3QC9A 2P9BA 2E9XC 2VL8A 3I0OA 2IC9A 4IIJE 3Q5XA 3VHLA 4E7SA 2LHRA 5C8YE 4PJLA 2CE7A 3Q5WA 4GK5E 1D0ZA 4CXXA 5HXHA 4GYRA 3S4UA 3ANWB 4HGAA 4ZI3C 4H9PC 4AKRB 5HWYA 5L3DB 2VASA 4PNIA 1SA0E 3HI2A 3L09A 4HN9A 3P8CD 2YEVC 1WR6A 4KMCA 4V1Av 3LK2B 4AKIA 3HA4A 2ODUA 2DWKA 1SHZC 4ADZA 4H9OC 4CXWA 4Z8XA 1D0YA 4XAXB 3E22E 3C4XA 5HAXA 4CQIA 3NRXA 3NZQA 4QWNB 4DMWA 4F6RC 5ETWA 5HXRA 3OKQA 3NBXX 4H63V 2PJQA 3BQIA 2NW7A 1FMVA 5LOVE 3D0TA 4PAGA 2V26A 1QUUA 1G8XA 1HTJF 4GK0E 4QXCB 1MMGA 3I1AA 4X1YE 2NW9A 3P7IA 3F57A 1O3XA 1KNZA 3UFEA 3KV5A 2CMRA 2LSYA 3KINB 4MHCA 2LSKA 4EZ4A 5JDGA 5FXVA 5J2UE 5CA0E 5KDMC 4AXPA 4O4HE 3VKHA 3L3PA 3NZPA 5EK4A 3K3OA 3NRYA 2L3LA 3Q2MA 2H7VC 4HEAA 5JR9B 1U5PA 5HWXA 3W15B 1MNEA 1VOMA 4O2AE 3PUAA 2LT3A 4YJ2E 2Q9QA 3RYFE 3RC3A 3GN5A 4DBQA 2LJLA 5JH7E 3WAKA 3O1JA 2I59A 2Q9QC 3HL6A 2V7LA 1LVFA 2CEAA 3PUQA 4BJNA 3OYXA 5LCYA 1ZHCA 3ZMSB 4KP3C 3JC6D 1BR2A 2Y48B 2EHOD 4IGUA 4PFOA 2M67A 3UUXB 1VRBA 2V7IA 2CXFA 2X9WA 3MXZA 2SPCA 3CX8B 3RH3A 3MA9A 4PJJA 1HCIA 2H7OA 2VB6A 3BQKA 3ETVA 4AQGA 2W62A 2XHEB 4IHJE 2LM9A 2VKHA 4HKAA 3R84B 1X79A 5HXEA 4IE7A 2X9HA 4EZHA 2X66A 4TX5A 4UXNB 1WLXA 5DJQC 1D1AA 4NUUA 4AI6A 2ODVA 1LRZA 4N78D 2W0GA 4OFZA 2WSSV 3KVBA 3KV9A 3E08A 2W61A 4JEUB 3I0QA 5JDFA 4C90A 4IE0A 4EXTA 2CXDA 2C5IT 2IAKA 4UF0B 2XAGB 3HKDE 4P09A 3ZCIA 2DI4A 3PE0A 2XAJB 4PK4A 2MBGA 2LSIA 1IJ5A 3CKDA 4YHJA 5EZYE 3EDVA 1MMAA 3C64A 3QK6A 2JQQA 2XUEA 5LGTB 3GA8A 2C0SA 4O4IE 3AA1B 4UVBB 4TN7B 2D5UA 3AVSA 3LK3B 5LJNA 2ZM2A 2CLYC 3EVYA 4O4LE 5HXSA 4B6XA 3EDUA 4QX7B 2QA7A 2E8IA 3RYCE 4IDZA 4JUYA 3OYZA 5GONE 3SRZA 5L3GB 4TV9E 5LYJE 2VKOA 3ZMUB 3KBUA 4BA9A 3F31A 2K48A 4DNDA 3KV6A 3AA7B 2A2FX 3K8PC 3C51A 2UXNB 2BVMA 2H3RA 5FYMA 4PJMA 3U78A 2KINB 3U3IA 3LJCA 1QSDA 2QGSA 2LOPA 1MNDA 4P0AA 2W63A 4GYSA 1NWMX 2NW8A 5FY7A 5LP6E 4UVAB 2BZBA 4YLHA 3LFMA 5H6QB 2DCFA 5L2LA 3PU3A 1AJ3A 4DBRA 2N1GA 3ZJ2A 3I9WA 5HXCA 1WYCA 2WMOA 3KVAA 3BQLA 5KX5E 3GMIA 2JJ9A 2XTLA 1MMDA 2X0LB 3ZC1A 5FMNA 3AAEB 2YU2A 2CWYA 4H9QC 5JRCA 4QXBB 3RRWA 3CQGB 4X1KE 4I50E 1WRDA 3LBXB 5JDHA 4P0BA 2LSJA 3IBPA 4ZI2D 5BMVE 4PFPA 3ZMTB 3PUSA 2D0TA 3ZN1B 3CMLA 3QUJA 2KT9A 5EK3A 4CZZB 4ZHQE 4UV8B 3O9XA 4ZI3D 2X67A 3CX6B 4K0UA 4IE4A 5E0OA 3WAJA 3HKBE 3O1HA 3RC8A 5JQGE 1OWAA 2V7KA 2EHOA 2B1EA 3KDSE 5FXZA 5EK2A 3SS1A 3AA6B 3FHNA 4UVCB 5LHHB 4XBFB 2CLYB 2GK9A 4ZI7E 3LG7A 3JC6C 4WBOA 3KBTA 4ZS3A 4KBMB 3B13A 3FB2A 3FBLA 2IW5B 2KLQA 4HE8A 1D1BA 5CA1E 2XAHB 3CX7B 3FXEB 3A5XA 5FP3A 2N2NA 2ZM0A 1CUNA 5AFUL 3UUMA 5M4YA 2KMFA 2E9XB 4UIGA 5LBMA 4E7ZA 2D0UA 3ZN0B 4DVDA 4IE6A 1HF8A 1MIWA 4OK0A 5LGNB 1EZ3A 4QX8B 1H7CA 3IEEA 2DHRA 3UT5E 3AVRA 5L3FB 4L5GA 2WBLA 5JDMA 5LBQB 1ZV4X 4EIWA 3PURA 3CVRA 3HKEE 3ZYLA 3BK9A 5LXTE 3AB3B 4FI5A 2D2SA 3C98B 3ZJ1A 2CCQA 3DJBA 1YKEB 4EYYR 4M1PA 4WNKA 2PBIA 1IJ6A 2WWUA 5FXXA 1YD8G 4J2CA 5JDLA 2X68A 4UEMA 2PG8A 4HTEA 2NTXA 2X9YA 3ESLA 5J1GA 3ZYKA 3ZC0A 5KMGP 3AAIA 4MLKA 1BR0A 3H3AA 1G73A 2UXXB 3PUGA 3DP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 C;  5JR9 A;  5JRE A;  3ZC1 A;  3ZC0 A;  5JRC B;  5JRC A;  5JR9 B; 
#chains in the Genus database with same CATH topology
 3TKL B;  4IE5 A;  4UV9 B;  5F5W A;  2VK9 A;  5FY0 A;  4GKK T;  2V5D A;  1UCU A;  1T72 A;  3K3Q C;  3N2G E;  4AKH A;  1WCR A;  3N2K E;  2HN1 A;  1D0X A;  1LKX A;  3N2O A;  4NPP A;  2V1D B;  4HFD A;  5J2T E;  3K3N A;  2V6Y B;  2CXL A;  1T8B A;  5DAB A;  3UQ4 A;  2VWA A;  1ZKE A;  2ACX A;  4H9S E;  3HR0 A;  5HYA A;  3P4P A;  4ZI2 C;  5F8P A;  4ILC A;  4L9I A;  3SOL A;  5BR8 T;  2E9X D;  2VVN A;  3H37 A;  2DL1 A;  2JMH A;  4ILU A;  2BS2 A;  3WI3 A;  3UUN A;  5JRE A;  2CWO A;  5AQQ B;  2BS3 A;  4OX9 T;  2YK0 A;  5CB4 E;  5LJM A;  5L3E B;  4TNV A;  3H3M A;  2HPL A;  5KXJ A;  2X51 A;  4DO0 A;  3ZT6 A;  1D1C A;  4JLE A;  2XQ3 A;  2HPJ A;  3UUL A;  1IAP A;  3ZPO A;  2LKH A;  1ZOY A;  3O1I A;  4MFR A;  4CI3 B;  3RI5 A;  2FJE A;  2WMN A;  5AQM B;  3N9L A;  1Y01 A;  5HEU A;  4I55 E;  4Z91 A;  3J7Y q;  3FBZ A;  3ANW A;  3UTK A;  4O8S A;  4JV5 T;  1OED C;  2JMK A;  5CGM A;  3AED A;  2NP9 A;  2ES0 A;  2Q9Q D;  4O2B E;  2QYW A;  2KWH A;  4ZXL A;  2XY8 B;  5AQG B;  5ADX L;  2XAS B;  1XZY A;  1BR4 A;  4X1I E;  3FZF B;  4CXY A;  4B3S T;  2FJD A;  4YFS A;  3PU8 A;  4QHO A;  3AE8 A;  4EYU A;  2CHN A;  4I4T E;  3C4Z A;  4JI6 T;  1IZN B;  4AQY T;  2V7J A;  4GOU A;  3SWH A;  4I43 B;  4XZC A;  2MOZ A;  1Z8U A;  4GIW A;  3UFG A;  2E9X C;  4IIJ E;  3VHL A;  4E7S A;  4CXX A;  5HXH A;  4HGA A;  4HN9 A;  4KMC A;  5CJ5 A;  4AKI A;  2ODU A;  5AQP B;  1SHZ C;  3E22 E;  5AQR B;  4DMW A;  4B3T T;  1W09 A;  3D0T A;  1QUU A;  4GK0 E;  3P7I A;  2CMR A;  4JI3 T;  1J5W A;  5J2U E;  5CA0 E;  5L47 A;  2I0M A;  3K3O A;  2L3L A;  3RIU C;  5JR9 B;  4HWC A;  5HWX A;  2WU5 A;  2XQ6 A;  1MNE A;  4U31 A;  1HNX T;  3GN5 A;  3OVU A;  5JH7 E;  3WAK A;  2Q9Q C;  2V7L A;  3PUQ A;  2Y48 B;  4IGU A;  2V7I A;  1N32 T;  2X9W A;  3CX8 B;  4PJJ A;  1HCI A;  3ETV A;  5FVL A;  3RKG A;  2XHE B;  3NKZ A;  2W2U A;  1X79 A;  2X9H A;  4U7Y A;  3AXJ B;  1D1A A;  4NUU A;  5HEH A;  3KV9 A;  4JEU B;  4C90 A;  3I0Q A;  2IAK A;  3HKD E;  5FL0 A;  2J62 A;  3LSV A;  3EDV A;  3C64 A;  4LF5 T;  2JQQ A;  2XUE A;  4TN7 B;  4HWD A;  1N36 T;  2D5U A;  3AVS A;  5LJN A;  2ZM2 A;  3EVY A;  4LFC T;  3EDU A;  4QX7 B;  2E8I A;  2OV9 A;  4LMJ A;  4KX6 A;  4IDZ A;  4TWH A;  3OYZ A;  5LYJ E;  3KBU A;  4IDP A;  4DND A;  2XJ7 A;  3K8P C;  2UXN B;  2BVM A;  2H3R A;  4PJM A;  3U78 A;  3LJC A;  2QGS A;  1T7S A;  2J4G A;  2IIU A;  1M62 A;  4AIS A;  2W63 A;  5LP6 E;  5H6Q B;  2BZB A;  4YLH A;  2F4V T;  3SFE A;  3I9W A;  2W66 A;  3IA3 A;  2XTL A;  2BG9 E;  4QXB B;  3CQG B;  4X1K E;  3LBX B;  4DR1 T;  3JCF A;  2PTF A;  3IBP A;  5BMV E;  2D0T A;  3CML A;  3RIA A;  4ZI3 D;  2X67 A;  3CX6 B;  4K0U A;  3WAJ A;  1GQE A;  2XQA A;  3LDQ B;  2FBW A;  3RLF F;  3AE6 A;  3LG7 A;  3KBT A;  1IBM T;  3A5X A;  5M4Y A;  3T1H T;  2KMF A;  4CN4 A;  1W0B A;  2WDV A;  4TWD A;  1HF8 A;  1EZ3 A;  1E7P A;  3UT5 E;  4L5G A;  4LF6 T;  5JDM A;  5LBQ B;  5AQO B;  3CVR A;  3HKE E;  3ZYL A;  3BK9 A;  4IL9 A;  5LXT E;  4IL4 A;  2X0Y A;  4EYY R;  2PBI A;  5ABF A;  2HHH T;  4HTE A;  2NTX A;  3ZYK A;  2UXX B;  2WWV A;  3AEC A;  3DP7 A;  3CWZ B;  1KEY A;  3QB5 A;  2K9A A;  4DV0 T;  3EUH A;  1HS7 A;  4YSZ A;  4YSY A;  2RP4 A;  4DR3 T;  4G2A A;  4LFB T;  3K1S A;  3O4X E;  2JQK A;  4ANJ A;  4FJO A;  2A72 A;  5DQW A;  4U2Z A;  3N9M A;  4QXH B;  4HWI B;  1FEW A;  2A3D A;  2YIN A;  1HNW T;  5AQI B;  2FJB A;  4AQF A;  2BG9 A;  5JVD E;  2V7M A;  3TLW A;  1HG2 A;  2B76 A;  2LM2 A;  2WQY A;  4WW0 A;  2BVL A;  4DV2 T;  4BJM A;  4OYK A;  4DMV A;  1KFY A;  2HN2 A;  4UF0 A;  2JPF A;  4AIU A;  2CM0 A;  3N9O A;  2NTY A;  4HFB A;  4U74 A;  3NWI A;  2EHO C;  3AA0 B;  4DR4 T;  3E0Z A;  2IC6 A;  2KSR A;  2UUA T;  3J9X 1;  4EAH A;  1NEK A;  2OA5 A;  1LVK A;  5L3C B;  3N9N A;  4CI2 B;  1DU2 A;  3OJA A;  1W0A A;  3TLV A;  2L8K A;  2AXD S;  3PV0 F;  4ZZB A;  5FXW A;  3ABV A;  2YU1 A;  3AE3 A;  1FIO A;  4ZOL E;  3P4Q A;  1WYB A;  4HFV A;  3VR9 A;  2J1D G;  2VUR A;  1ZP0 A;  3RYI E;  1HNZ T;  1Z0P A;  5JRC B;  3IHR A;  4U33 A;  1YXR A;  2H88 A;  3VKG A;  2XM2 A;  2CRB A;  5AQT B;  1HX8 A;  4PW8 A;  4ASK A;  2AE9 A;  2MYS A;  4PK6 A;  2LE8 A;  4X20 E;  3RKO A;  3FZM B;  3F2E A;  2EHO B;  2MTQ A;  1E1H B;  2XQY A;  2RA1 A;  3ONJ A;  2LHN A;  3C4W A;  4K0K T;  1B7T A;  2UU9 T;  4A5X A;  2KND A;  4EB6 E;  4DV7 T;  5LGU B;  2K5B B;  2VKJ A;  3ETU A;  3QC9 A;  3UU6 A;  2UXB T;  2W67 A;  2XZE A;  2VL8 A;  4ILA A;  2VL0 A;  2YDQ A;  2LHR A;  5HEG A;  1D0Z A;  3ANW B;  4H9P C;  2X0H A;  2VAS A;  2FUP A;  1SA0 E;  3L09 A;  1XNR T;  3P8C D;  4V1A v;  3LK2 B;  1UK5 A;  2DWK A;  4LML A;  4Z8X A;  2E5L T;  2XQ5 A;  4TNW A;  4CQI A;  3TLU A;  4QWN B;  4F6R C;  2PJQ A;  3BQI A;  1HX1 B;  4JI2 T;  3I1A A;  2NW9 A;  3F57 A;  2BKN A;  5J0Z A;  3UFE A;  3KV5 A;  3X1D A;  4JI5 T;  5KDM C;  4O4H E;  3NZP A;  5EK4 A;  3NRY A;  2LKG A;  4O2A E;  2ACZ A;  2LT3 A;  3RYF E;  3FZK B;  4X66 T;  3L39 A;  2I59 A;  1LVF A;  4IDN A;  1IBL T;  2V6Y A;  3OYX A;  5LCY A;  2V6X A;  4PFO A;  2M67 A;  1VRB A;  4IDO A;  2SPC A;  3MA9 A;  4AQG A;  2W62 A;  4IHJ E;  4IE7 A;  4TX5 A;  4UXN B;  4IRE A;  5DJQ C;  3ZSS A;  4YXD A;  3AE5 A;  4HWH A;  4N78 D;  2W0G A;  2CXD A;  2K3W A;  2BBJ A;  2XAJ B;  4PK4 A;  2LSI A;  1IJ5 A;  3Q5D A;  1N34 T;  4B3R T;  5EZY E;  3ZST A;  3FZH B;  5LGT B;  3GA8 A;  3AA1 B;  2I6H A;  4B6X A;  5ABE A;  5GON E;  4DID B;  1XDP A;  2YOE A;  3F31 A;  3KV6 A;  2A2F X;  3C51 A;  5FVK A;  4HFC A;  1QSD A;  1OED B;  2QVA A;  3PUZ F;  4P0A A;  1KNP A;  1NWM X;  3LFM A;  1AJ3 A;  4LF9 T;  3KVA A;  4B3M T;  2CHO A;  2XQ4 A;  5KX5 E;  3GMI A;  2JJ9 A;  3ZC1 A;  3AAE B;  2CWY A;  5JDH A;  2WDR A;  2LSJ A;  4DV4 T;  4PFP A;  3PUS A;  5EK3 A;  2V8S V;  4ZHQ E;  3QOF A;  4UV8 B;  3O9X A;  5LMN T;  2BKP A;  3JAD A;  3KDS E;  5EK2 A;  5LHH B;  2GK9 A;  5AQN B;  1VCS A;  4ZS3 A;  3FB2 A;  3CX7 B;  2N2N A;  1CUN A;  2E9X B;  3ZN0 B;  4DVD A;  5LGN B;  5L3F B;  1ZV4 X;  3P4W A;  3PUR A;  2XM1 A;  2D2S A;  3C98 B;  2CCQ A;  4HFI A;  4J2C A;  5JDL A;  2YDR A;  5J1G A;  4LF7 T;  3ZC0 A;  3H3A A;  2JQ9 A;  2WS3 A;  3UU4 A;  3LK4 2;  4MAL A;  1M7K A;  4UR9 A;  4IST A;  3PUV F;  2VQE T;  5FNV E;  2WZH A;  3OTO T;  3ZMV B;  4NUV A;  4TV8 E;  2K24 A;  4BAY B;  1MMN A;  3VRB A;  1S94 A;  2JRK A;  4LFA T;  4AKL A;  2WM9 A;  5JR9 A;  2BDE A;  2Q9Q B;  3HKC E;  5L4H A;  5LG4 A;  1KK7 A;  3N9P A;  1MIY A;  2XPK A;  5AQU B;  1SE7 A;  2CBI A;  5L4E A;  5AQL B;  5LA6 E;  3A8Y C;  4YSX A;  4JBW F;  4CN1 A;  3V5U A;  3CQC B;  2DNX A;  2ZLY A;  4Z90 A;  2ZMA A;  3RGL A;  3ZYM A;  1US7 B;  3AEF A;  3CIR A;  4X65 T;  2M6B A;  2BG9 C;  4AQF C;  2A9U A;  1XWM A;  4QKN A;  2LEH A;  3AXJ A;  1NEN A;  4LF4 T;  5ABF B;  3SFD A;  5LHG B;  1ZEE A;  4UEL A;  2YDS A;  2OLT A;  1OXZ A;  4JEH B;  3CQX C;  5LG3 A;  4JI4 T;  3B5M A;  3RIU A;  4WBN E;  1U4Q A;  2WU2 A;  3EAM A;  5JDN A;  1MIV A;  2C5J A;  3ZT5 A;  4ERR A;  3B57 A;  2KZ7 B;  3KV4 A;  2ZM6 T;  5TAO A;  1FJG T;  5CFB A;  3AEE A;  1HFA A;  4YY3 T;  3QB5 K;  3GWH A;  4OYJ A;  2G0U A;  1J1J A;  1XDO A;  1XMQ T;  1T98 A;  3ZLI A;  2C5K T;  4G63 A;  3CPZ A;  4I0U A;  3LBX A;  3ZEF B;  2WP9 A;  4HFE A;  4O4J E;  4EV6 A;  1HG5 A;  5AQK B;  5HCM A;  3IF8 B;  2UUC T;  3RRC A;  2XAQ B;  3PTR B;  2W00 A;  2IDO B;  1UUR A;  4YT0 A;  4H63 H;  5LHI B;  2QRX A;  1Y64 B;  3Q9D A;  3NVO A;  2MAW A;  5AQS B;  1WFD A;  3RX6 A;  3PDY A;  3G06 A;  3EI0 A;  5L3B B;  3L8R A;  3MZK B;  4YTP A;  4U3C A;  2XSB A;  5AQH B;  3I0O A;  5C8Y E;  4PJL A;  2UXC T;  4GYR A;  3S4U A;  4ZI3 C;  5HWY A;  3ZT7 A;  3HI2 A;  2YEV C;  4ADZ A;  5AQF B;  4NXN T;  1D0Y A;  4XAX B;  3C4X A;  5HXR A;  3OKQ A;  3NBX X;  4X64 T;  2W4X A;  2V26 A;  1G8X A;  1HTJ F;  2LLY A;  1W9R A;  1O3X A;  1KNZ A;  2LSY A;  2LSK A;  4EZ4 A;  5JDG A;  4JI7 T;  2E5V A;  3VKH A;  3L3P A;  5C3J A;  3Q2M A;  4DV1 T;  1U5P A;  1WR0 A;  3W15 B;  4EED A;  5IWA T;  1VOM A;  3PUA A;  2CBJ A;  3RC3 A;  1J5E T;  4DBQ A;  3P4R A;  3O1J A;  4Q25 A;  4LF8 T;  3HL6 A;  2V5C A;  5FKY A;  4YTM A;  3M3Z B;  2H7O A;  2VKH A;  4HKA A;  4EZH A;  2X66 A;  1LRZ A;  2WSS V;  5JDF A;  4EXT A;  2C5I T;  1YQ4 A;  2XAG B;  4P09 A;  4QH5 A;  3ZCI A;  4JI1 T;  2DI4 A;  2MBG A;  3CKD A;  1MMA A;  3QK6 A;  1I94 T;  3PJA J;  1XNQ T;  3LK3 B;  2J47 A;  3RQU A;  4HWF A;  4JUY A;  3SRZ A;  4JYA T;  4TV9 E;  2VKO A;  2LRL A;  3ZMU B;  2CPT A;  3AA7 B;  4A98 A;  2FJA A;  5FYM A;  3U3I A;  3EAB A;  2LOP A;  1MND A;  4LMK A;  2NW8 A;  5FY7 A;  5L2L A;  3VRA A;  4DBR A;  2N1G A;  5HXC A;  1WYC A;  2WMO A;  3BQL A;  1MMD A;  5FL1 A;  4DR2 T;  3UU8 A;  5JRC A;  3RRW A;  4I50 E;  4DR6 T;  1KF6 A;  3ZMT B;  4HFH A;  3ZN1 B;  3PUY F;  3HKB E;  3RC8 A;  1CHU A;  2V7K A;  2EHO A;  2B1E A;  5FXZ A;  5IUX A;  3SS1 A;  4ZI7 E;  4WBO A;  3AE7 A;  3FBL A;  1N33 T;  4HE8 A;  1D1B A;  5CA1 E;  5AFU L;  1KNR A;  4YTN A;  5LBM A;  4EGW A;  2D0U A;  2XSA A;  4IE6 A;  1MIW A;  4OK0 A;  3RF1 A;  3TLS A;  4QX8 B;  2DHR A;  2JIW A;  1SUM B;  1OED E;  1IBK T;  3AB3 B;  4FI5 A;  5AQV B;  3RQW A;  4DV5 T;  4M1P A;  4WNK A;  5FXX A;  1IJ6 A;  1YD8 G;  1HR0 T;  2X68 A;  4UEM A;  5KMG P;  3AAI A;  4X5T A;  1BR0 A;  4P1N A;  1G73 A;  3PUG A;  5ABH A;  2BS4 A;  4ZEY A;  1V9D A;  2BBH A;  4YHH T;  3CK6 A;  4DR7 T;  1BR1 A;  4DV6 T;  4H9R C;  2YN6 A;  3RPU A;  2N9D A;  3N5L A;  3A7M A;  2LOS A;  3ONX A;  5F3J A;  3VR8 A;  2NOX A;  4L0R A;  4U2Y A;  5JR9 C;  1NAF A;  3GN5 B;  3VU7 H;  4NXM T;  3R6N A;  4EOZ B;  4PK5 A;  2M6I A;  3RIF A;  3AAA B;  1XMO T;  2YKS A;  3ZCJ A;  3FXD B;  2WAU A;  4U72 A;  5DQV A;  2DWG A;  4JI8 T;  4U7I A;  5AQJ B;  1YKH B;  5JDQ A;  2ZM8 A;  3V5S A;  5IHY A;  2HH7 A;  3PUX F;  4TUY E;  3PUW F;  2X9X A;  2XAF B;  1UX4 A;  2KXP B;  3KFW X;  4PJN A;  3T8O A;  1UGO A;  2VKD A;  3UQ7 A;  1FMW A;  5LB7 B;  2XQ9 A;  3EHZ A;  3MK7 C;  1UX5 A;  3C50 A;  4COF A;  2L9Q A;  4A56 A;  4X62 T;  4ILB A;  3I9Y A;  4C91 A;  4AKG A;  1OED A;  2VVS A;  2Y6X A;  5LNK A;  2IHR 1;  3N9Q A;  3AEA A;  2Y8D A;  1UUS A;  4YJ3 E;  1YW0 A;  2CA5 A;  1S35 A;  5H6R B;  2LRK A;  3DTO A;  1QLB A;  3M65 A;  2KWI B;  2NWB A;  4EEB A;  5FY1 A;  3MAC A;  4CI1 B;  2UXD T;  2XQ7 A;  4KHP T;  3MJX A;  1JNZ A;  4TZ4 C;  4KUM B;  4OHF A;  2H89 A;  5IYZ E;  3OBV E;  3RHW A;  2Z6E A;  3RYH E;  2PFV A;  5A1L A;  3TLT A;  3MKD A;  3ZMZ B;  2LSG A;  3UUB A;  4ISS A;  1YQ3 A;  4QH4 A;  4H9N C;  4ZS2 A;  4MBQ A;  3P4S A;  2E9X A;  2DLR A;  2WY2 A;  2P9B A;  3P50 A;  2WB5 A;  3JAF A;  2IC9 A;  3AE1 A;  3Q5X A;  2CE7 A;  3Q5W A;  4GK5 E;  4AKR B;  5L3D B;  4PNI A;  3AEB A;  3FZL B;  1WR6 A;  3HA4 A;  4H9O C;  4CXW A;  5HAX A;  3NRX A;  3NZQ A;  5ETW A;  4H63 V;  2NW7 A;  1FMV A;  2R6G F;  5LOV E;  4PAG A;  4QXC B;  1MMG A;  4X1Y E;  5LMU T;  4MHC A;  4TWF A;  3KIN B;  5FXV A;  4DUY T;  4AXP A;  5HCJ A;  2H7V C;  4HEA A;  2E2A A;  1X9B A;  1L0V A;  3ONL C;  4YJ2 E;  2Q9Q A;  2D9D A;  2LJL A;  2XQ8 A;  2CEA A;  4BJN A;  5C2T A;  1ZHC A;  3ZMS B;  4KP3 C;  3JC6 D;  1BR2 A;  4IDQ A;  2EHO D;  2RPA A;  3UUX B;  2CXF A;  3MXZ A;  3RH3 A;  3QNU A;  2JQH A;  2VB6 A;  3BQK A;  2BG9 B;  2LM9 A;  3R84 B;  5HXE A;  4WZX A;  3OPC A;  1WLX A;  4AI6 A;  2ODV A;  4OFZ A;  3KVB A;  5JTG A;  3E08 A;  5HEJ A;  2W61 A;  4IE0 A;  4UF0 B;  3PE0 A;  4YHJ A;  2C0S A;  4O4I E;  4UVB B;  2CLY C;  4O4L E;  5HXS A;  2QA7 A;  4QH1 A;  3RYC E;  5L3G B;  3Q5E A;  4NIQ A;  4BA9 A;  4DUZ T;  2K48 A;  4CN6 A;  2KIN B;  5HEO A;  2MPK A;  3AE2 A;  2UUB T;  4GYS A;  1I6Z A;  4UVA B;  2DCF A;  3PU3 A;  2VQF T;  3ZJ2 A;  3AEG A;  2NR4 A;  2X0L B;  5FMN A;  2YU2 A;  3AE9 A;  4H9Q C;  1WRD A;  3AE4 A;  4P0B A;  4ZI2 D;  3QUJ A;  2WDQ A;  2KT9 A;  4CZZ B;  4IE4 A;  3PJA A;  5E0O A;  3UU5 A;  3O1H A;  3JAE A;  5JQG E;  1OWA A;  3AA6 B;  3FHN A;  4UVC B;  4F8H A;  4XBF B;  2CLY B;  3JC6 C;  2WZI A;  4IT4 A;  4KBM B;  3B13 A;  2IW5 B;  2KLQ A;  2XAH B;  3FXE B;  5FP3 A;  2ZM0 A;  4GKJ T;  3UUM A;  2BKO A;  4UIG A;  4JI0 T;  4E7Z A;  2IML A;  1H7C A;  3IEE A;  3AVR A;  4KI0 F;  2WBL A;  4EIW A;  1E2A A;  4DV3 T;  4DR5 T;  4A97 A;  3ZJ1 A;  2WCA A;  3DJB A;  4ZZC A;  1YKE B;  5ABG A;  1JNR A;  3T1Y T;  2WWU A;  2IUB A;  1VCT A;  2PG8 A;  1R8I A;  4WYV A;  4KHZ F;  3ESL A;  2X9Y A;  3UU3 A;  4MLK A;  3ZKR A; 
#chains in the Genus database with same CATH homology
 3CWZ B;  3TKL B;  4IE5 A;  3LK4 2;  4UV9 B;  4MAL A;  1V9D A;  2K9A A;  2VK9 A;  3EUH A;  1HS7 A;  4IST A;  5FY0 A;  5FNV E;  3ZMV B;  4NUV A;  1BR1 A;  1UCU A;  4H9R C;  4TV8 E;  3RPU A;  2K24 A;  3K3Q C;  2RP4 A;  2N9D A;  4BAY B;  1MMN A;  3N5L A;  4G2A A;  1S94 A;  3N2G E;  4AKH A;  2JRK A;  2LOS A;  3ONX A;  4AKL A;  5F3J A;  3O4X E;  2WM9 A;  5JR9 A;  2BDE A;  4ANJ A;  2NOX A;  3N2K E;  4FJO A;  2Q9Q B;  2A72 A;  1D0X A;  4L0R A;  5DQW A;  3HKC E;  1NAF A;  1LKX A;  5JR9 C;  3GN5 B;  3VU7 H;  5LG4 A;  1KK7 A;  3N9M A;  3N2O A;  3R6N A;  4EOZ B;  2V1D B;  5J2T E;  4PK5 A;  3N9P A;  1MIY A;  3K3N A;  4QXH B;  3AAA B;  1FEW A;  2A3D A;  3ZCJ A;  2CXL A;  3FXD B;  2WAU A;  5DAB A;  4U72 A;  5DQV A;  2DWG A;  5LA6 E;  2VWA A;  2YIN A;  1ZKE A;  2ACX A;  4H9S E;  3HR0 A;  5HYA A;  1YKH B;  3V5U A;  3CQC B;  5JDQ A;  4ZI2 C;  2ZM8 A;  2DNX A;  5F8P A;  4L9I A;  2ZLY A;  3V5S A;  5IHY A;  4AQF A;  3SOL A;  2ZMA A;  5JVD E;  3ZYM A;  2V7M A;  1US7 B;  1HG2 A;  2E9X D;  2HH7 A;  4WW0 A;  4AQF C;  2BVL A;  3H37 A;  2JMH A;  4ILU A;  4QKN A;  3WI3 A;  3UUN A;  5JRE A;  2LEH A;  4BJM A;  4OYK A;  4DMV A;  2CWO A;  2YK0 A;  4TUY E;  5LHG B;  1ZEE A;  5CB4 E;  5LJM A;  4UEL A;  2X9X A;  2XAF B;  1UX4 A;  5L3E B;  4UF0 A;  2JPF A;  1OXZ A;  2KXP B;  3KFW X;  2CM0 A;  4JEH B;  3N9O A;  4PJN A;  2HPL A;  3T8O A;  2NTY A;  2VKD A;  2X51 A;  3CQX C;  4U74 A;  4DO0 A;  2EHO C;  1D1C A;  4JLE A;  2HPJ A;  1FMW A;  3AA0 B;  3UUL A;  4WBN E;  1IAP A;  3ZPO A;  1U4Q A;  3MK7 C;  3E0Z A;  2IC6 A;  1UX5 A;  3C50 A;  2L9Q A;  5JDN A;  1MIV A;  3J9X 1;  2C5J A;  3O1I A;  4EAH A;  2OA5 A;  4A56 A;  1LVK A;  5L3C B;  4ERR A;  3N9N A;  4MFR A;  4CI3 B;  3B57 A;  2KZ7 B;  2WMN A;  3KV4 A;  4CI2 B;  3I9Y A;  3OJA A;  3N9L A;  5TAO A;  4C91 A;  4AKG A;  4I55 E;  2L8K A;  3J7Y q;  3FBZ A;  2Y6X A;  3ANW A;  1HFA A;  3UTK A;  5FXW A;  4O8S A;  2YU1 A;  1FIO A;  2JMK A;  5LNK A;  3GWH A;  3N9Q A;  4ZOL E;  2NP9 A;  4OYJ A;  1WYB A;  2ES0 A;  2G0U A;  2Q9Q D;  4O2B E;  2KWH A;  2Y8D A;  4HFV A;  2J1D G;  4YJ3 E;  1T98 A;  1YW0 A;  3RYI E;  3ZLI A;  5ADX L;  1Z0P A;  2C5K T;  5JRC B;  2XAS B;  3IHR A;  4G63 A;  2CA5 A;  3CPZ A;  1S35 A;  5H6R B;  1BR4 A;  4X1I E;  3DTO A;  3LBX A;  3ZEF B;  4CXY A;  3M65 A;  3VKG A;  2KWI B;  2NWB A;  4O4J E;  4YFS A;  3PU8 A;  3MAC A;  5FY1 A;  4CI1 B;  1HG5 A;  4QHO A;  1HX8 A;  4PW8 A;  4ASK A;  3MJX A;  4EYU A;  2MYS A;  4PK6 A;  2LE8 A;  4TZ4 C;  4X20 E;  3IF8 B;  3RRC A;  2XAQ B;  4KUM B;  3PTR B;  4I4T E;  4OHF A;  2W00 A;  3C4Z A;  5IYZ E;  3RKO A;  3OBV E;  2Z6E A;  3F2E A;  2EHO B;  3RYH E;  2MTQ A;  4H63 H;  1E1H B;  2PFV A;  2XQY A;  1IZN B;  5A1L A;  2RA1 A;  1Y64 B;  5LHI B;  3MKD A;  3ZMZ B;  2LHN A;  2V7J A;  3C4W A;  4GOU A;  2LSG A;  1B7T A;  3SWH A;  3Q9D A;  4I43 B;  4XZC A;  4ISS A;  2MOZ A;  2KND A;  4EB6 E;  3RX6 A;  4H9N C;  3PDY A;  4ZS2 A;  4MBQ A;  5LGU B;  4GIW A;  5L3B B;  3MZK B;  2K5B B;  2E9X A;  2VKJ A;  3ETU A;  2DLR A;  3QC9 A;  2P9B A;  2E9X C;  2VL8 A;  3I0O A;  2IC9 A;  4IIJ E;  3Q5X A;  3VHL A;  4E7S A;  2LHR A;  5C8Y E;  4PJL A;  2CE7 A;  3Q5W A;  4GK5 E;  1D0Z A;  4CXX A;  5HXH A;  4GYR A;  3S4U A;  3ANW B;  4HGA A;  4ZI3 C;  4H9P C;  4AKR B;  5HWY A;  5L3D B;  2VAS A;  4PNI A;  1SA0 E;  3HI2 A;  3L09 A;  4HN9 A;  3P8C D;  2YEV C;  1WR6 A;  4KMC A;  4V1A v;  3LK2 B;  4AKI A;  3HA4 A;  2ODU A;  2DWK A;  1SHZ C;  4ADZ A;  4H9O C;  4CXW A;  4Z8X A;  1D0Y A;  4XAX B;  3E22 E;  3C4X A;  5HAX A;  4CQI A;  3NRX A;  3NZQ A;  4QWN B;  4DMW A;  4F6R C;  5ETW A;  5HXR A;  3OKQ A;  3NBX X;  4H63 V;  2PJQ A;  3BQI A;  2NW7 A;  1FMV A;  5LOV E;  3D0T A;  4PAG A;  2V26 A;  1QUU A;  1G8X A;  1HTJ F;  4GK0 E;  4QXC B;  1MMG A;  3I1A A;  4X1Y E;  2NW9 A;  3P7I A;  3F57 A;  1O3X A;  1KNZ A;  3UFE A;  3KV5 A;  2CMR A;  2LSY A;  3KIN B;  4MHC A;  2LSK A;  4EZ4 A;  5JDG A;  5FXV A;  5J2U E;  5CA0 E;  5KDM C;  4AXP A;  4O4H E;  3VKH A;  3L3P A;  3NZP A;  5EK4 A;  3K3O A;  3NRY A;  2L3L A;  3Q2M A;  2H7V C;  4HEA A;  5JR9 B;  1U5P A;  5HWX A;  3W15 B;  1MNE A;  1VOM A;  4O2A E;  3PUA A;  2LT3 A;  4YJ2 E;  2Q9Q A;  3RYF E;  3RC3 A;  3GN5 A;  4DBQ A;  2LJL A;  5JH7 E;  3WAK A;  3O1J A;  2I59 A;  2Q9Q C;  3HL6 A;  2V7L A;  1LVF A;  2CEA A;  3PUQ A;  4BJN A;  3OYX A;  5LCY A;  1ZHC A;  3ZMS B;  4KP3 C;  3JC6 D;  1BR2 A;  2Y48 B;  2EHO D;  4IGU A;  4PFO A;  2M67 A;  3UUX B;  1VRB A;  2V7I A;  2CXF A;  2X9W A;  3MXZ A;  2SPC A;  3CX8 B;  3RH3 A;  3MA9 A;  4PJJ A;  1HCI A;  2H7O A;  2VB6 A;  3BQK A;  3ETV A;  4AQG A;  2W62 A;  2XHE B;  4IHJ E;  2LM9 A;  2VKH A;  4HKA A;  3R84 B;  1X79 A;  5HXE A;  4IE7 A;  2X9H A;  4EZH A;  2X66 A;  4TX5 A;  4UXN B;  1WLX A;  5DJQ C;  1D1A A;  4NUU A;  4AI6 A;  2ODV A;  1LRZ A;  4N78 D;  2W0G A;  4OFZ A;  2WSS V;  3KVB A;  3KV9 A;  3E08 A;  2W61 A;  4JEU B;  3I0Q A;  5JDF A;  4C90 A;  4IE0 A;  4EXT A;  2CXD A;  2C5I T;  2IAK A;  4UF0 B;  2XAG B;  3HKD E;  4P09 A;  3ZCI A;  2DI4 A;  3PE0 A;  2XAJ B;  4PK4 A;  2MBG A;  2LSI A;  1IJ5 A;  3CKD A;  4YHJ A;  5EZY E;  3EDV A;  1MMA A;  3C64 A;  3QK6 A;  2JQQ A;  2XUE A;  5LGT B;  3GA8 A;  2C0S A;  4O4I E;  3AA1 B;  4UVB B;  4TN7 B;  2D5U A;  3AVS A;  3LK3 B;  5LJN A;  2ZM2 A;  2CLY C;  3EVY A;  4O4L E;  5HXS A;  4B6X A;  3EDU A;  4QX7 B;  2QA7 A;  2E8I A;  3RYC E;  4IDZ A;  4JUY A;  3OYZ A;  5GON E;  3SRZ A;  5L3G B;  4TV9 E;  5LYJ E;  2VKO A;  3ZMU B;  3KBU A;  4BA9 A;  3F31 A;  2K48 A;  4DND A;  3KV6 A;  3AA7 B;  2A2F X;  3K8P C;  3C51 A;  2UXN B;  2BVM A;  2H3R A;  5FYM A;  4PJM A;  3U78 A;  2KIN B;  3U3I A;  3LJC A;  1QSD A;  2QGS A;  2LOP A;  1MND A;  4P0A A;  2W63 A;  4GYS A;  1NWM X;  2NW8 A;  5FY7 A;  5LP6 E;  4UVA B;  2BZB A;  4YLH A;  3LFM A;  5H6Q B;  2DCF A;  5L2L A;  3PU3 A;  1AJ3 A;  4DBR A;  2N1G A;  3ZJ2 A;  3I9W A;  5HXC A;  1WYC A;  2WMO A;  3KVA A;  3BQL A;  5KX5 E;  3GMI A;  2JJ9 A;  2XTL A;  1MMD A;  2X0L B;  3ZC1 A;  5FMN A;  3AAE B;  2YU2 A;  2CWY A;  4H9Q C;  5JRC A;  4QXB B;  3RRW A;  3CQG B;  4X1K E;  4I50 E;  1WRD A;  3LBX B;  5JDH A;  4P0B A;  2LSJ A;  3IBP A;  4ZI2 D;  5BMV E;  4PFP A;  3ZMT B;  3PUS A;  2D0T A;  3ZN1 B;  3CML A;  3QUJ A;  2KT9 A;  5EK3 A;  4CZZ B;  4ZHQ E;  4UV8 B;  3O9X A;  4ZI3 D;  2X67 A;  3CX6 B;  4K0U A;  4IE4 A;  5E0O A;  3WAJ A;  3HKB E;  3O1H A;  3RC8 A;  5JQG E;  1OWA A;  2V7K A;  2EHO A;  2B1E A;  3KDS E;  5FXZ A;  5EK2 A;  3SS1 A;  3AA6 B;  3FHN A;  4UVC B;  5LHH B;  4XBF B;  2CLY B;  2GK9 A;  4ZI7 E;  3LG7 A;  3JC6 C;  4WBO A;  3KBT A;  4ZS3 A;  4KBM B;  3B13 A;  3FB2 A;  3FBL A;  2IW5 B;  2KLQ A;  4HE8 A;  1D1B A;  5CA1 E;  2XAH B;  3CX7 B;  3FXE B;  3A5X A;  5FP3 A;  2N2N A;  2ZM0 A;  1CUN A;  5AFU L;  3UUM A;  5M4Y A;  2KMF A;  2E9X B;  4UIG A;  5LBM A;  4E7Z A;  2D0U A;  3ZN0 B;  4DVD A;  4IE6 A;  1HF8 A;  1MIW A;  4OK0 A;  5LGN B;  1EZ3 A;  4QX8 B;  1H7C A;  3IEE A;  2DHR A;  3UT5 E;  3AVR A;  5L3F B;  4L5G A;  2WBL A;  5JDM A;  5LBQ B;  1ZV4 X;  4EIW A;  3PUR A;  3CVR A;  3HKE E;  3ZYL A;  3BK9 A;  5LXT E;  3AB3 B;  4FI5 A;  2D2S A;  3C98 B;  3ZJ1 A;  2CCQ A;  3DJB A;  1YKE B;  4EYY R;  4M1P A;  4WNK A;  2PBI A;  1IJ6 A;  2WWU A;  5FXX A;  1YD8 G;  4J2C A;  5JDL A;  2X68 A;  4UEM A;  2PG8 A;  4HTE A;  2NTX A;  2X9Y A;  3ESL A;  5J1G A;  3ZYK A;  3ZC0 A;  5KMG P;  3AAI A;  4MLK A;  1BR0 A;  3H3A A;  1G73 A;  2UXX B;  3PUG A;  3DP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...