5JRCA

Crystal structure of nec3po in complex with ssrna.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
186
structure length
186
Chain Sequence
b'SMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEQ131
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
total genus 84
structure length 186
sequence length 186
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jrcA00
5JR9A 5JRCA 3ZC1A 5JREA 5JR9B 3ZC0A 5JRCB 5JR9C
chains in the Genus database with same CATH superfamily
4HGAA 3NBXX 1I94T 1HTJF 4YT0A 1HX8A 4FI5A 4YJ3E 4YY3T 2WCAA 4XZCA 1IJ6A 5J1GA 4PJJA 1SUMB 5BR8T 5HXHA 1Y64B 1KNZA 4V1Av 4HFBA 3OYZA 5LJNA 3JCFA 3Q5DA 3RX6A 2FJAA 5L3FB 5LA6E 3CQGB 2WU2A 4B3MT 2W62A 2PBIA 4GOUA 1U4QA 2LRLA 1VOMA 2LJLA 5FY7A 4PW8A 2LSIA 3DP7A 5JDNA 4QXBB 3ZT5A 4UIGA 4XBFB 4KI0F 2UUBT 3SFDA 2NW8A 5HXCA 4JI8T 4ANJA 3SRZA 4QX7B 3FZHB 3KINB 3UFGA 4IDZA 2XTLA 1UGOA 2YU2A 3RIUC 4IL4A 4DBQA 3RC8A 2ZM0A 4CXXA 2YN6A 2FJEA 3CWZB 3TLUA 2D0TA 4A5XA 1XNQT 5HEGA 4JI1T 4LFCT 2XHEB 5ETWA 5IWAT 1E7PA 4DV1T 3I9YA 3IA3A 4ILUA 4QWNB 3VRBA 4AKHA 4NXMT 3GWHA 2DCFA 2X9XA 5AQLB 2YU1A 2D0UA 2XZEA 3IHRA 4ISSA 4IREA 4IDNA 4UR9A 3CK6A 3VKGA 3N2GE 2MYSA 2WZIA 4QH4A 3RYIE 3Q5XA 1W0BA 1ZP0A 3Q5EA 4ZEYA 2KWHA 3M3ZB 4YTPA 2J4GA 3T1HT 5LCYA 4DV0T 5L3GB 3MXZA 4QXHB 3L39A 2V7MA 4YSZA 1MIYA 1KEYA 2Y48B 3WAJA 2DWGA 2BG9C 2LSJA 2W2UA 2D5UA 2W67A 3PUGA 2V7JA 3HA4A 3PUZF 4HWFA 2W00A 4AQFA 3RQWA 3OPCA 4ASKA 3QUJA 3KV6A 4LF4T 4JV5T 2XM1A 4NIQA 1WRDA 2XQ5A 4GK5E 2FBWA 2IC9A 1WYCA 5HXRA 1YQ3A 1IJ5A 4DR1T 3AAIA 3K8PC 2PFVA 1UX4A 2DHRA 4JBWF 3VRAA 2UUAT 2BDEA 4UVAB 5ABFB 4A98A 2LOSA 5AFUL 4AI6A 1QLBA 5ABEA 4C91A 2J1DG 4TWDA 3RYHE 3ABVA 4EZ4A 3ZJ2A 2KNDA 4ERRA 3MK7C 1OEDB 3UUXB 1OEDE 4DR3T 1MMGA 3I9WA 2NTYA 3ESLA 2CXDA 4LMLA 3O4XE 4X65T 2WDVA 3FXEB 4IHJE 5A1LA 4YFSA 4CXWA 1ZOYA 4O4HE 3FZKB 3OYXA 5JRCB 2GK9A 4HE8A 4KP3C 1SE7A 2L9QA 4QKNA 3RF1A 2KXPB 4AKRB 5GONE 2LSKA 5FY1A 4UELA 2I0MA 4OYJA 1T7SA 4U3CA 1V9DA 2BVMA 4Z8XA 4KHZF 3UU8A 3PU8A 5JRCA 3ZCIA 2MPKA 3R6NA 2NWBA 2A9UA 2YDRA 3RKOA 1NWMX 3UFEA 2XUEA 4GYSA 3RKGA 3UTKA 5HWXA 4CZZB 3NWIA 5HEUA 2C5JA 4A56A 3ZJ1A 2VKHA 4LF7T 4YLHA 3EABA 5DQVA 3AVRA 2AE9A 2MAWA 4EZHA 4I0UA 1VCTA 3ZC1A 3H3AA 5LHHB 2AXDS 4AISA 2Z6EA 3M65A 4P0BA 4HWCA 1S35A 3ZT6A 3ZN1B 4OK0A 4KBMB 4JI7T 3WAKA 5C2TA 1BR4A 2WMNA 1MMAA 2K48A 3AE2A 5LHIB 4JI5T 3KDSE 5HEHA 5JREA 4CN4A 5LJMA 3ZMZB 4CQIA 4CXYA 1D0YA 1HFAA 3F57A 4CN6A 2XAGB 2HN1A 3P4QA 5H6RB 3RIAA 4UVBB 2YOEA 3ZSTA 1HCIA 4U74A 1IBMT 4E7ZA 1H7CA 2ACXA 5IHYA 3G06A 2QYWA 3HKDE 4DV2T 3HKEE 3VR8A 2BKPA 3L3PA 3EI0A 2VWAA 5AQMB 4MFRA 4YTMA 4BA9A 2CHOA 4WBNE 1O3XA 2B1EA 2VQFT 3N9NA 1JNRA 1T72A 1GQEA 1HR0T 5HXEA 4ISTA 4EGWA 4AKGA 4GK0E 2L8KA 2PG8A 1CUNA 3O1HA 3AE1A 1BR1A 2ZM2A 3RPUA 3P8CD 5LYJE 3MZKB 1E2AA 3H37A 4DVDA 2X68A 1WR0A 1R8IA 4EIWA 3ZC0A 2A2FX 3V5UA 2DLRA 5M4YA 4HWIB 2XQ8A 5ABGA 3VR9A 2YDSA 4HN9A 4O4IE 4O8SA 2H3RA 3O1JA 3MJXA 4P0AA 4JUYA 3Q9DA 3CKDA 3GA8A 5AQSB 3LK2B 2CLYC 2J62A 3N2KE 2XJ7A 5LNKA 1NENA 1G8XA 2X0HA 4AKLA 3QOFA 3SOLA 2K5BB 2V6YB 3PUYF 3VKHA 5AQRB 1MMNA 4WW0A 2VL0A 4TWHA 2VQET 2J47A 3UQ4A 3EDVA 2V8SV 1X79A 1D1BA 1LVKA 5E0OA 5FXZA 3OVUA 3OKQA 2V6YA 3UT5E 4TV9E 4NUVA 2R6GF 3A5XA 2FJDA 4IDQA 2Q9QB 3K1SA 4YXDA 2V6XA 2X66A 4UVCB 3CIRA 3LSVA 3SS1A 2QA7A 1ZV4X 5LBQB 3AAAB 2XAHB 2UU9T 2LRKA 3ANWA 2Q9QA 3BQKA 2V7LA 1J1JA 5HXSA 5L3CB 3ZYKA 3PV0F 1US7B 2A72A 3PUVF 4H63H 2JIWA 4QH1A 3TLSA 2EHOC 1YW0A 4DR7T 4YTNA 2WP9A 4NUUA 1Z8UA 2C0SA 5EK3A 3IBPA 4IL9A 2V5CA 4H9SE 3AEGA 4L9IA 2NR4A 2WDQA 5JDFA 2L3LA 3AE5A 2IW5B 3N5LA 1HF8A 4B3ST 3AE3A 2EHOB 3A8YC 2YDQA 4JI6T 3PJAA 3FBZA 1XDOA 2M6IA 5JDHA 3VHLA 2OA5A 2LLYA 4H9QC 3L8RA 3KV9A 2WAUA 5JDMA 2BS3A 3NKZA 3HL6A 5FNVE 2EHOA 3F2EA 5FMNA 4O4JE 4CI2B 3CX6B 4L0RA 3A7MA 5IUXA 3PJAJ 4X62T 4PJLA 2F4VT 3RRCA 4B6XA 2JQHA 2CE7A 4ZI2D 5EK2A 5LXTE 4UV8B 5HEOA 4PFPA 5JDLA 3D0TA 1HX1B 3TLTA 3LBXB 3P7IA 2V1DB 2KT9A 5F8PA 4EAHA 3LDQB 5EZYE 2YINA 3HKBE 2FUPA 2JPFA 4KUMB 2I59A 5L47A 3O9XA 4AXPA 4X5TA 1VCSA 5CA0E 3KFWX 3LBXA 1BR0A 1L0VA 2SPCA 3RIUA 2VB6A 1I6ZA 4IE7A 3KBTA 2XQ4A 2VURA 2WM9A 5HAXA 2LHRA 3C51A 5AQFB 4J2CA 3LJCA 2WQYA 3PE0A 3I1AA 2X0LB 1MNDA 1XZYA 2UUCT 3ZMTB 1D0XA 1D0ZA 3RQUA 3P50A 3AA1B 4HFEA 3RYFE 1WR6A 5JDGA 3T8OA 2XAJB 3NZQA 2ES0A 2KMFA 2X9YA 2DI4A 1KF6A 2W0GA 2LEHA 3WI3A 1UUSA 4TNWA 3AAEB 4HFIA 5LG3A 4H63V 1UK5A 3AE8A 5LG4A 1IBKT 4TX5A 4YSYA 2BG9B 2BG9E 2B76A 4ADZA 5L3DB 2LE8A 4AKIA 4U72A 3AEBA 3LK3B 3AVSA 1HNZT 4UV9B 2HN2A 2ZM8A 4ZS2A 3TKLB 2BG9A 1ZHCA 2X67A 2LKHA 2XASB 5CB4E 3JC6D 2ZLYA 3SWHA 4DNDA 2H88A 3ETUA 3KV5A 3CX7B 1MNEA 2ACZA 3B5MA 1N33T 3BQLA 2LOPA 1OWAA 2CRBA 3VU7H 2X0YA 4HTEA 4PK6A 5JVDE 2UXNB 2BBHA 5JDQA 1J5ET 1AJ3A 3N9PA 1BR2A 2XSBA 2HPLA 4U31A 3EVYA 5F3JA 2BS2A 3I0QA 4YHHT 4HWHA 2WSSV 5HWYA 3RHWA 1FJGT 1T98A 3P4WA 3S4UA 3FBLA 2I6HA 4JEHB 2JMHA 3TLVA 1OXZA 5LGTB 4U2YA 4N78D 2XQYA 4PNIA 4HFCA 4ILCA 2BBJA 4ILBA 2E5VA 2XAQB 3H3MA 3UUBA 2VK9A 3EAMA 2RP4A 2DNXA 3N9LA 3UU3A 4DMVA 3IEEA 1KK7A 3B13A 2KZ7B 5FL0A 4LMJA 1YXRA 3RC3A 3E22E 4LF5T 3Q2MA 4DV6T 4ILAA 4HFVA 4JLEA 2XQAA 3SFEA 2UXCT 4BAYB 2MBGA 2BKOA 2WBLA 2ODUA 2VL8A 4IE4A 3C4WA 3OJAA 5LMUT 1LRZA 2JQQA 2C5KT 3PUSA 2MOZA 2DL1A 2G0UA 2E9XC 3C50A 4H9OC 5BMVE 3BK9A 2VKDA 4EV6A 3ONJA 2BVLA 1FEWA 1N32T 4KX6A 5CFBA 1SA0E 3N2OA 3ZPOA 4GIWA 4LF8T 4ZZBA 4P09A 2Q9QD 3P4RA 3P4SA 2MTQA 1Z0PA 3UUMA 2D2SA 3ETVA 3N9OA 2NW7A 5CGMA 4PJMA 3GN5B 3BQIA 1FMWA 2PJQA 4UXNB 3RYCE 3ZCJA 4HWDA 3ZT7A 3RH3A 2IHR1 2XSAA 1WLXA 3K3QC 4OYKA 3GN5A 2CMRA 1N34T 2JRKA 1WFDA 2CPTA 3QB5K 1KNPA 3PUWF 5FY0A 4YJ2E 3EDUA 2ZMAA 4QHOA 3ONXA 5FKYA 4YHJA 2NTXA 3KVBA 5HCMA 2WDRA 2VVNA 5AQGB 5HEJA 1X9BA 4DO0A 4X66T 5DABA 4X20E 5LGUB 2XQ7A 4Q25A 1LVFA 2EHOD 2K9AA 2N1GA 2E2AA 5LB7B 2ZM6T 1CHUA 5JR9C 2M67A 4WYVA 4HKAA 4IE5A 3UUNA 3J9X1 3EUHA 1NAFA 1KFYA 3JAFA 1HNXT 1B7TA 5L4HA 5DQWA 3UU5A 4GKKT 1WCRA 2V5DA 3CMLA 3PU3A 3FHNA 4O2AE 3ZYMA 5J2TE 1EZ3A 3RGLA 2DWKA 2KINB 4H9RC 1U5PA 3AA7B 5JR9B 4MBQA 2CLYB 2C5IT 4I55E 5AQVB 5J0ZA 4TWFA 4PJNA 4XAXB 3Q5WA 4DR5T 2WMOA 3PTRB 5AQTB 3K3OA 1IBLT 3ANWB 2LSYA 5JR9A 3DTOA 5CJ5A 3AEEA 2YEVC 3E0ZA 3AA6B 2QGSA 4IIJE 2BZBA 4CN1A 1QUUA 2XQ9A 4E7SA 5AQQB 2CM0A 4AQGA 4U7IA 2IIUA 3U3IA 4LFAT 1UX5A 2IMLA 2IUBA 2WWUA 4FJOA 3C64A 3AEFA 3AE6A 4IDOA 4WZXA 3MKDA 2XM2A 4JEUB 3CPZA 4U7YA 2XAFB 1MMDA 4HFHA 2H7OA 2W61A 2HHHT 4ZXLA 3QK6A 2W4XA 3IF8B 1M7KA 4ZHQE 4ZOLE 5HYAA 4HEAA 5FXVA 4X1YE 3FXDB 4ZI3C 4AQYT 1LKXA 4U2ZA 5AQUB 3K3NA 3GMIA 1FMVA 2WS3A 4TN7B 3O1IA 4MALA 4X1KE 4U33A 3QB5A 1XNRT 3TLWA 1FIOA 4IDPA 4JI4T 3AE7A 2H7VC 3HKCE 1J5WA 4X64T 4UF0B 2NP9A 4O4LE 1IAPA 3N9MA 4OFZA 5DJQC 3EHZA 4LF9T 2OV9A 4QX8B 1N36T 4TUYE 3NZPA 3HI2A 3CQXC 4B3RT 3CQCB 4OX9T 4UF0A 5C8YE 3FZFB 3V5SA 5EK4A 4B3TT 1HG5A 5J2UE 2CBJA 3PURA 3L09A 3OTOT 1KNRA 1SHZC 3JADA 4BJNA 2Y8DA 4I4TE 4M1PA 2H89A 4EEDA 3DJBA 2ODVA 5LGNB 4TV8E 2E8IA 4OHFA 2D9DA 4ZS3A 4EYUA 1T8BA 5KMGP 1XWMA 3P4PA 3J7Yq 4AQFC 4K0KT 5LBMA 4X1IE 2UXBT 4JYAT 4L5GA 3W15B 2HH7A 4NXNT 2KSRA 3FZMB 5FXWA 1IZNB 1D1CA 2PTFA 2VKJA 3CVRA 3FZLB 1HG2A 5AQNB 1DU2A 3PUAA 2X9HA 3AE4A 2CHNA 2XQ3A 4DIDB 2IAKA 2CA5A 5KXJA 4O2BE 4MHCA 1WYBA 4JI0T 4ZI2C 3HR0A 4C90A 2LHNA 4DR6T 4Z90A 4COFA 2K24A 2LSGA 1YQ4A 1XDPA 2RA1A 2NW9A 3AEDA 4KMCA 4LMKA 2XQ6A 1UCUA 1OEDC 5TAOA 3PDYA 3ZMSB 2CWYA 2K3WA 2A3DA 2CXLA 4BJMA 2JQ9A 2VKOA 2YKSA 5C3JA 2JJ9A 2LKGA 3B57A 5AQJB 3QNUA 4AIUA 4PFOA 2E9XD 5LHGB 3T1YT 1ZKEA 2LT3A 5F5WA 3E08A 4Z91A 2X9WA 5ABHA 5JTGA 2VVSA 2V7IA 2YK0A 5ABFA 2E5LT 5AQOB 3I0OA 2LM2A 3LG7A 4HFDA 3AEAA 4TNVA 3UULA 2M6BA 1MIWA 1W09A 3KV4A 1OEDA 1JNZA 3NVOA 5KDMC 4A97A 4CI1B 5AQIB 3LK42 4TZ4C 3CX8B 1NEKA 4NPPA 3RRWA 5L3EB 3AXJB 1YD8G 3AA0B 2P9BA 2UXXB 4DV5T 4G2AA 4H9PC 4LFBT 5IYZE 4IT4A 3AXJA 4DMWA 1G73A 2QRXA 3FB2A 4IE0A 2KLQA 3ZSSA 3UQ7A 3LFMA 4DV3T 2JMKA 1QSDA 1VRBA 1MIVA 2N9DA 3JC6C 1UURA 4G63A 3C4ZA 4DR4T 3UU6A 2JQKA 5L3BB 4I50E 3JAEA 3NRXA 1W9RA 2UXDT 4YSXA 4QH5A 4I43B 4JI3T 2WWVA 4EOZB 4K0UA 4IGUA 1HNWT 2V26A 3ZEFB 4DV7T 2E9XB 3ONLC 4GYRA 3NRYA 1XMQT 4PK4A 4F6RC 4F8HA 3KVAA 2HPJA 4GKJT 2E9XA 5HCJA 4PAGA 1W0AA 4PK5A 5FL1A 5AQHB 3C4XA 2W66A 1D1AA 3U78A 2WB5A 4ZZCA 4WNKA 1XMOT 4CI3B 2W63A 4JI2T 2IC6A 3ZYLA 5CA1E 1ZEEA 5AQPB 2CEAA 4WBOA 1YKEB 2CCQA 5FVKA 2WU5A 1HS7A 2BS4A 5LMNT 3AB3B 4KHPT 4EYYR 5H6QB 3C98B 5LOVE 3ZMVB 3PUXF 2RPAA 5JH7E 2Y6XA 4DV4T 5KX5E 2CWOA 4P1NA 3KBUA 3AE9A 5JQGE 4DUZT 4EXTA 5L2LA 5LP6E 3N9QA 3ZMUB 2XPKA 2QVAA 1YKHB 2OLTA 1Y01A 5FYMA 3ZKRA 2BKNA 2X51A 2LM9A 1E1HB 3R84B 3ZLIA 3RIFA 4UEMA 4DR2T 2KWIB 3RLFF 2FJBA 5AQKB 4ZI3D 2WY2A 2Q9QC 4DBRA 4LF6T 3UU4A 3OBVE 3RI5A 3MA9A 2V7KA 4EEBA 3F31A 1M62A 4EB6E 3QC9A 3PUQA 2XY8B 3MACA 4ZI7E 2VASA 3X1DA 5FP3A 5FXXA 2CBIA 4IE6A 3ZN0B 4H9NC 4DUYT 5FVLA 2N2NA 5ADXL 2NOXA 2WZHA 4QXCB 3AECA 2IDOB 2CXFA 4MLKA 5L4EA 1S94A
chains in the Genus database with same CATH topology
2JMHA 5LYJE 3MZKB 4HGAA 1OXZA 5LGTB 3NBXX 3H37A 4L5GA 3W15B 4DVDA 2X68A 4N78D 2XQYA 4PNIA 2HH7A 4EIWA 3ZC0A 2A2FX 1HTJF 2DLRA 3V5UA 5M4YA 5FXWA 1IZNB 2XAQB 1HX8A 1D1CA 4FI5A 2VK9A 2VKJA 4YJ3E 2RP4A 2DNXA 3N9LA 1IJ6A 4HN9A 3CVRA 4O4IE 4XZCA 5J1GA 4PJJA 4DMVA 1HG2A 4O8SA 3PUAA 2X9HA 2H3RA 3IEEA 1KK7A 5HXHA 1Y64B 3O1JA 3B13A 3MJXA 4P0AA 1KNZA 4V1Av 4JUYA 3OYZA 5LJNA 2KZ7B 3Q9DA 3CKDA 3GA8A 3RX6A 3RC3A 3E22E 2IAKA 3Q2MA 5LA6E 5L3FB 3CQGB 2CA5A 3LK2B 2CLYC 3N2KE 2W62A 5LNKA 4O2BE 1G8XA 2PBIA 4HFVA 4GOUA 4JLEA 4MHCA 1WYBA 1U4QA 4BAYB 2MBGA 4ZI2C 1VOMA 2LJLA 4AKLA 5FY7A 3HR0A 2WBLA 2ODUA 4PW8A 2LSIA 2VL8A 4C90A 3SOLA 4IE4A 2LHNA 3C4WA 2K5BB 3OJAA 3DP7A 5JDNA 4QXBB 1LRZA 2JQQA 4UIGA 2C5KT 3PUSA 4XBFB 3VKHA 2K24A 1MMNA 2MOZA 4WW0A 2G0UA 2LSGA 2NW8A 2RA1A 2E9XC 2NW9A 5HXCA 3C50A 4H9OC 4ANJA 4KMCA 5BMVE 3SRZA 3EDVA 4QX7B 1UCUA 3BK9A 3KINB 5TAOA 1X79A 2VKDA 1D1BA 3PDYA 3ZMSB 4IDZA 2CWYA 1LVKA 2A3DA 5E0OA 2XTLA 2BVLA 5FXZA 1FEWA 2YU2A 3OKQA 2CXLA 3UT5E 1SA0E 4BJMA 2VKOA 3N2OA 4DBQA 3ZPOA 4GIWA 3RC8A 4TV9E 2ZM0A 2JJ9A 4CXXA 4NUVA 3CWZB 3A5XA 3B57A 2D0TA 4PFOA 2E9XD 2Q9QD 4P09A 5LHGB 2Q9QB 1ZKEA 1Z0PA 2MTQA 3UUMA 2LT3A 2D2SA 3E08A 2X66A 4UVCB 2X9WA 3ETVA 3N9OA 2NW7A 2V7IA 2YK0A 4PJMA 3GN5B 3SS1A 2XHEB 5ETWA 3BQIA 1FMWA 2QA7A 2PJQA 1ZV4X 4UXNB 5LBQB 3AAAB 3RYCE 3I0OA 2XAHB 3I9YA 3ZCJA 3LG7A 4ILUA 3UULA 3RH3A 3ANWA 2Q9QA 4QWNB 4AKHA 3BQKA 3GWHA 1WLXA 2V7LA 2DCFA 1MIWA 2X9XA 3KV4A 2YU1A 2D0UA 3K3QC 3IHRA 4ISSA 5HXSA 3VKGA 4OYKA 3N2GE 2MYSA 3GN5A 3RYIE 2CMRA 5KDMC 5L3CB 3ZYKA 3Q5XA 1US7B 4CI1B 2A72A 4H63H 5LBMA 3LK42 4TZ4C 3CX8B 2JRKA 2EHOC 1YW0A 4NUUA 2KWHA 5FY0A 4YJ2E 2C0SA 5EK3A 3EDUA 3IBPA 2ZMAA 4QHOA 5LCYA 3RRWA 5L3EB 3ONXA 5L3GB 3MXZA 4QXHB 4YHJA 2NTXA 1YD8G 3KVBA 2V7MA 4H9SE 1MIYA 4L9IA 2Y48B 5JDFA 3AA0B 3WAJA 2DWGA 2L3LA 2P9BA 2LSJA 4DO0A 2IW5B 5DABA 3N5LA 2D5UA 1HF8A 2UXXB 4X20E 5LGUB 1LVFA 4G2AA 2EHOD 2K9AA 3PUGA 2EHOB 2V7JA 2N1GA 4H9PC 5IYZE 3HA4A 5JR9C 2M67A 2W00A 4DMWA 4HKAA 3FBZA 4IE5A 4AQFA 1G73A 5JDHA 3UUNA 3FB2A 3J9X1 3VHLA 3EUHA 4IE0A 2OA5A 1NAFA 2KLQA 4H9QC 4ASKA 3LFMA 3QUJA 1B7TA 3KV9A 3KV6A 2WAUA 5DQWA 5JDMA 3CMLA 2JMKA 3PU3A 1QSDA 1VRBA 3FHNA 1MIVA 4O2AE 3HL6A 5FNVE 2EHOA 2N9DA 3F2EA 3JC6C 3ZYMA 1WRDA 5FMNA 5J2TE 1EZ3A 4G63A 4O4JE 2DWKA 4GK5E 3C4ZA 2IC9A 1WYCA 2KINB 5HXRA 4CI2B 1IJ5A 3AAIA 3CX6B 3K8PC 4H9RC 4L0RA 1U5PA 4PJLA 3RRCA 2PFVA 3AA7B 5JR9B 4MBQA 2CLYB 5L3BB 1UX4A 2DHRA 4B6XA 4I50E 2C5IT 4I55E 3NRXA 2CE7A 4ZI2D 5EK2A 2BDEA 5LXTE 4UV8B 4PJNA 4UVAB 4I43B 4XAXB 3Q5WA 4EOZB 2LOSA 2WMOA 4K0UA 5AFUL 4AI6A 3PTRB 4IGUA 4PFPA 4C91A 2J1DG 3K3OA 5JDLA 2V26A 3D0TA 3ZEFB 3ANWB 2E9XB 3RYHE 2LSYA 4GYRA 3NRYA 5JR9A 4EZ4A 3DTOA 3ZJ2A 2KNDA 4ERRA 3LBXB 3MK7C 3P7IA 2V1DB 4PK4A 2KT9A 5F8PA 3UUXB 4F6RC 1MMGA 4EAHA 5EZYE 2YINA 3HKBE 3I9WA 2JPFA 4KUMB 2YEVC 2I59A 3KVAA 2NTYA 3E0ZA 3AA6B 2HPJA 2QGSA 3ESLA 4IIJE 2CXDA 3O9XA 2BZBA 3O4XE 1QUUA 2E9XA 4AXPA 3FXEB 4E7SA 4PAGA 4IHJE 5A1LA 4YFSA 5CA0E 3KFWX 3LBXA 4CXWA 2CM0A 1BR0A 4AQGA 4O4HE 3OYXA 4PK5A 5JRCB 3U3IA 2GK9A 1UX5A 3C4XA 4HE8A 4KP3C 2SPCA 2WWUA 1D1AA 4FJOA 3C64A 3U78A 2L9QA 2VB6A 4QKNA 2KXPB 4AKRB 5GONE 2LSKA 3MKDA 4IE7A 5FY1A 3KBTA 4JEUB 4UELA 2WM9A 5HAXA 4OYJA 4WNKA 1V9DA 2BVMA 4CI3B 2LHRA 3CPZA 2W63A 3C51A 4J2CA 2IC6A 3LJCA 4Z8XA 3PU8A 2XAFB 5JRCA 1MMDA 3ZYLA 3ZCIA 2H7OA 5CA1E 1ZEEA 3R6NA 2NWBA 3PE0A 2CEAA 3I1AA 3RKOA 4WBOA 1YKEB 1NWMX 2CCQA 2X0LB 3UFEA 2XUEA 1MNDA 4GYSA 3UTKA 3ZMTB 2W61A 1D0XA 1HS7A 1D0ZA 3AB3B 3AA1B 4EYYR 5HWXA 4CZZB 5H6QB 3RYFE 1WR6A 5JDGA 2C5JA 3T8OA 4A56A 2XAJB 3NZQA 3QK6A 3ZJ1A 2VKHA 3C98B 5LOVE 3ZMVB 2ES0A 2KMFA 3IF8B 4YLHA 2X9YA 2DI4A 5DQVA 5JH7E 2Y6XA 3AVRA 4ZHQE 2W0GA 4ZOLE 5KX5E 2CWOA 3KBUA 2LEHA 4EZHA 3WI3A 5JQGE 3AAEB 4HEAA 5HYAA 3ZC1A 3H3AA 4EXTA 5FXVA 5LHHB 5L2LA 4X1YE 3FXDB 4ZI3C 5LP6E 1LKXA 2Z6EA 4H63V 3M65A 3N9QA 4P0BA 5LG4A 1S35A 4TX5A 3ZMUB 3K3NA 3GMIA 3ZN1B 1FMVA 4ADZA 5L3DB 1YKHB 4OK0A 3O1IA 4TN7B 4KBMB 2LE8A 4MALA 4AKIA 4U72A 4X1KE 5FYMA 1FIOA 2X51A 2LM9A 1E1HB 3R84B 3ZLIA 2H7VC 3HKCE 3LK3B 3AVSA 3WAKA 4UEMA 1BR4A 2WMNA 1MMAA 2K48A 2KWIB 4UV9B 4UF0B 2NP9A 5LHIB 2ZM8A 4ZS2A 3KDSE 3TKLB 4ZI3D 5JREA 1ZHCA 2Q9QC 2X67A 4O4LE 5LJMA 1IAPA 3ZMZB 4DBRA 3N9MA 4CQIA 4OFZA 4CXYA 1D0YA 5DJQC 1HFAA 2XASB 3F57A 5CB4E 3JC6D 2ZLYA 3SWHA 4QX8B 4DNDA 2XAGB 4TUYE 3ETUA 3NZPA 3OBVE 3HI2A 3CQXC 3CQCB 3KV5A 5H6RB 3CX7B 3MA9A 4UF0A 5C8YE 3V5SA 1MNEA 2V7KA 3F31A 5EK4A 1HG5A 5J2UE 3PURA 4UVBB 3L09A 1HCIA 4U74A 3BQLA 1H7CA 4E7ZA 2LOPA 2ACXA 1OWAA 4EB6E 1SHZC 4BJNA 3QC9A 2Y8DA 3PUQA 4I4TE 5IHYA 4M1PA 3VU7H 3HKDE 3MACA 4ZI7E 3HKEE 2VASA 3DJBA 4HTEA 2ODVA 4PK6A 5JVDE 2UXNB 5JDQA 1AJ3A 3N9PA 3L3PA 2VWAA 5FP3A 1BR2A 5LGNB 5FXXA 4MFRA 2HPLA 4TV8E 4IE6A 2E8IA 3ZN0B 4OHFA 4H9NC 4BA9A 4WBNE 1O3XA 2B1EA 4ZS3A 3EVYA 4EYUA 5F3JA 5KMGP 3I0QA 2N2NA 3N9NA 5ADXL 2WSSV 2NOXA 5HXEA 4ISTA 5HWYA 4AKGA 4GK0E 3J7Yq 2L8KA 2PG8A 1T98A 4QXCB 1CUNA 4AQFC 3O1HA 3S4UA 1BR1A 2CXFA 2ZM2A 3FBLA 3RPUA 4MLKA 3P8CD 4JEHB 1S94A 4X1IE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 A;  5JRC A;  3ZC1 A;  5JRE A;  5JR9 B;  3ZC0 A;  5JRC B;  5JR9 C; 
#chains in the Genus database with same CATH topology
 4HGA A;  3NBX X;  1I94 T;  1HTJ F;  4YT0 A;  1HX8 A;  4FI5 A;  4YJ3 E;  4YY3 T;  2WCA A;  4XZC A;  1IJ6 A;  5J1G A;  4PJJ A;  1SUM B;  5BR8 T;  5HXH A;  1Y64 B;  1KNZ A;  4V1A v;  4HFB A;  3OYZ A;  5LJN A;  3JCF A;  3Q5D A;  3RX6 A;  2FJA A;  5L3F B;  5LA6 E;  3CQG B;  2WU2 A;  4B3M T;  2W62 A;  2PBI A;  4GOU A;  1U4Q A;  2LRL A;  1VOM A;  2LJL A;  5FY7 A;  4PW8 A;  2LSI A;  3DP7 A;  5JDN A;  4QXB B;  3ZT5 A;  4UIG A;  4XBF B;  4KI0 F;  2UUB T;  3SFD A;  2NW8 A;  5HXC A;  4JI8 T;  4ANJ A;  3SRZ A;  4QX7 B;  3FZH B;  3KIN B;  3UFG A;  4IDZ A;  2XTL A;  1UGO A;  2YU2 A;  3RIU C;  4IL4 A;  4DBQ A;  3RC8 A;  2ZM0 A;  4CXX A;  2YN6 A;  2FJE A;  3CWZ B;  3TLU A;  2D0T A;  4A5X A;  1XNQ T;  5HEG A;  4JI1 T;  4LFC T;  2XHE B;  5ETW A;  5IWA T;  1E7P A;  4DV1 T;  3I9Y A;  3IA3 A;  4ILU A;  4QWN B;  3VRB A;  4AKH A;  4NXM T;  3GWH A;  2DCF A;  2X9X A;  5AQL B;  2YU1 A;  2D0U A;  2XZE A;  3IHR A;  4ISS A;  4IRE A;  4IDN A;  4UR9 A;  3CK6 A;  3VKG A;  3N2G E;  2MYS A;  2WZI A;  4QH4 A;  3RYI E;  3Q5X A;  1W0B A;  1ZP0 A;  3Q5E A;  4ZEY A;  2KWH A;  3M3Z B;  4YTP A;  2J4G A;  3T1H T;  5LCY A;  4DV0 T;  5L3G B;  3MXZ A;  4QXH B;  3L39 A;  2V7M A;  4YSZ A;  1MIY A;  1KEY A;  2Y48 B;  3WAJ A;  2DWG A;  2BG9 C;  2LSJ A;  2W2U A;  2D5U A;  2W67 A;  3PUG A;  2V7J A;  3HA4 A;  3PUZ F;  4HWF A;  2W00 A;  4AQF A;  3RQW A;  3OPC A;  4ASK A;  3QUJ A;  3KV6 A;  4LF4 T;  4JV5 T;  2XM1 A;  4NIQ A;  1WRD A;  2XQ5 A;  4GK5 E;  2FBW A;  2IC9 A;  1WYC A;  5HXR A;  1YQ3 A;  1IJ5 A;  4DR1 T;  3AAI A;  3K8P C;  2PFV A;  1UX4 A;  2DHR A;  4JBW F;  3VRA A;  2UUA T;  2BDE A;  4UVA B;  5ABF B;  4A98 A;  2LOS A;  5AFU L;  4AI6 A;  1QLB A;  5ABE A;  4C91 A;  2J1D G;  4TWD A;  3RYH E;  3ABV A;  4EZ4 A;  3ZJ2 A;  2KND A;  4ERR A;  3MK7 C;  1OED B;  3UUX B;  1OED E;  4DR3 T;  1MMG A;  3I9W A;  2NTY A;  3ESL A;  2CXD A;  4LML A;  3O4X E;  4X65 T;  2WDV A;  3FXE B;  4IHJ E;  5A1L A;  4YFS A;  4CXW A;  1ZOY A;  4O4H E;  3FZK B;  3OYX A;  5JRC B;  2GK9 A;  4HE8 A;  4KP3 C;  1SE7 A;  2L9Q A;  4QKN A;  3RF1 A;  2KXP B;  4AKR B;  5GON E;  2LSK A;  5FY1 A;  4UEL A;  2I0M A;  4OYJ A;  1T7S A;  4U3C A;  1V9D A;  2BVM A;  4Z8X A;  4KHZ F;  3UU8 A;  3PU8 A;  5JRC A;  3ZCI A;  2MPK A;  3R6N A;  2NWB A;  2A9U A;  2YDR A;  3RKO A;  1NWM X;  3UFE A;  2XUE A;  4GYS A;  3RKG A;  3UTK A;  5HWX A;  4CZZ B;  3NWI A;  5HEU A;  2C5J A;  4A56 A;  3ZJ1 A;  2VKH A;  4LF7 T;  4YLH A;  3EAB A;  5DQV A;  3AVR A;  2AE9 A;  2MAW A;  4EZH A;  4I0U A;  1VCT A;  3ZC1 A;  3H3A A;  5LHH B;  2AXD S;  4AIS A;  2Z6E A;  3M65 A;  4P0B A;  4HWC A;  1S35 A;  3ZT6 A;  3ZN1 B;  4OK0 A;  4KBM B;  4JI7 T;  3WAK A;  5C2T A;  1BR4 A;  2WMN A;  1MMA A;  2K48 A;  3AE2 A;  5LHI B;  4JI5 T;  3KDS E;  5HEH A;  5JRE A;  4CN4 A;  5LJM A;  3ZMZ B;  4CQI A;  4CXY A;  1D0Y A;  1HFA A;  3F57 A;  4CN6 A;  2XAG B;  2HN1 A;  3P4Q A;  5H6R B;  3RIA A;  4UVB B;  2YOE A;  3ZST A;  1HCI A;  4U74 A;  1IBM T;  4E7Z A;  1H7C A;  2ACX A;  5IHY A;  3G06 A;  2QYW A;  3HKD E;  4DV2 T;  3HKE E;  3VR8 A;  2BKP A;  3L3P A;  3EI0 A;  2VWA A;  5AQM B;  4MFR A;  4YTM A;  4BA9 A;  2CHO A;  4WBN E;  1O3X A;  2B1E A;  2VQF T;  3N9N A;  1JNR A;  1T72 A;  1GQE A;  1HR0 T;  5HXE A;  4IST A;  4EGW A;  4AKG A;  4GK0 E;  2L8K A;  2PG8 A;  1CUN A;  3O1H A;  3AE1 A;  1BR1 A;  2ZM2 A;  3RPU A;  3P8C D;  5LYJ E;  3MZK B;  1E2A A;  3H37 A;  4DVD A;  2X68 A;  1WR0 A;  1R8I A;  4EIW A;  3ZC0 A;  2A2F X;  3V5U A;  2DLR A;  5M4Y A;  4HWI B;  2XQ8 A;  5ABG A;  3VR9 A;  2YDS A;  4HN9 A;  4O4I E;  4O8S A;  2H3R A;  3O1J A;  3MJX A;  4P0A A;  4JUY A;  3Q9D A;  3CKD A;  3GA8 A;  5AQS B;  3LK2 B;  2CLY C;  2J62 A;  3N2K E;  2XJ7 A;  5LNK A;  1NEN A;  1G8X A;  2X0H A;  4AKL A;  3QOF A;  3SOL A;  2K5B B;  2V6Y B;  3PUY F;  3VKH A;  5AQR B;  1MMN A;  4WW0 A;  2VL0 A;  4TWH A;  2VQE T;  2J47 A;  3UQ4 A;  3EDV A;  2V8S V;  1X79 A;  1D1B A;  1LVK A;  5E0O A;  5FXZ A;  3OVU A;  3OKQ A;  2V6Y A;  3UT5 E;  4TV9 E;  4NUV A;  2R6G F;  3A5X A;  2FJD A;  4IDQ A;  2Q9Q B;  3K1S A;  4YXD A;  2V6X A;  2X66 A;  4UVC B;  3CIR A;  3LSV A;  3SS1 A;  2QA7 A;  1ZV4 X;  5LBQ B;  3AAA B;  2XAH B;  2UU9 T;  2LRK A;  3ANW A;  2Q9Q A;  3BQK A;  2V7L A;  1J1J A;  5HXS A;  5L3C B;  3ZYK A;  3PV0 F;  1US7 B;  2A72 A;  3PUV F;  4H63 H;  2JIW A;  4QH1 A;  3TLS A;  2EHO C;  1YW0 A;  4DR7 T;  4YTN A;  2WP9 A;  4NUU A;  1Z8U A;  2C0S A;  5EK3 A;  3IBP A;  4IL9 A;  2V5C A;  4H9S E;  3AEG A;  4L9I A;  2NR4 A;  2WDQ A;  5JDF A;  2L3L A;  3AE5 A;  2IW5 B;  3N5L A;  1HF8 A;  4B3S T;  3AE3 A;  2EHO B;  3A8Y C;  2YDQ A;  4JI6 T;  3PJA A;  3FBZ A;  1XDO A;  2M6I A;  5JDH A;  3VHL A;  2OA5 A;  2LLY A;  4H9Q C;  3L8R A;  3KV9 A;  2WAU A;  5JDM A;  2BS3 A;  3NKZ A;  3HL6 A;  5FNV E;  2EHO A;  3F2E A;  5FMN A;  4O4J E;  4CI2 B;  3CX6 B;  4L0R A;  3A7M A;  5IUX A;  3PJA J;  4X62 T;  4PJL A;  2F4V T;  3RRC A;  4B6X A;  2JQH A;  2CE7 A;  4ZI2 D;  5EK2 A;  5LXT E;  4UV8 B;  5HEO A;  4PFP A;  5JDL A;  3D0T A;  1HX1 B;  3TLT A;  3LBX B;  3P7I A;  2V1D B;  2KT9 A;  5F8P A;  4EAH A;  3LDQ B;  5EZY E;  2YIN A;  3HKB E;  2FUP A;  2JPF A;  4KUM B;  2I59 A;  5L47 A;  3O9X A;  4AXP A;  4X5T A;  1VCS A;  5CA0 E;  3KFW X;  3LBX A;  1BR0 A;  1L0V A;  2SPC A;  3RIU A;  2VB6 A;  1I6Z A;  4IE7 A;  3KBT A;  2XQ4 A;  2VUR A;  2WM9 A;  5HAX A;  2LHR A;  3C51 A;  5AQF B;  4J2C A;  3LJC A;  2WQY A;  3PE0 A;  3I1A A;  2X0L B;  1MND A;  1XZY A;  2UUC T;  3ZMT B;  1D0X A;  1D0Z A;  3RQU A;  3P50 A;  3AA1 B;  4HFE A;  3RYF E;  1WR6 A;  5JDG A;  3T8O A;  2XAJ B;  3NZQ A;  2ES0 A;  2KMF A;  2X9Y A;  2DI4 A;  1KF6 A;  2W0G A;  2LEH A;  3WI3 A;  1UUS A;  4TNW A;  3AAE B;  4HFI A;  5LG3 A;  4H63 V;  1UK5 A;  3AE8 A;  5LG4 A;  1IBK T;  4TX5 A;  4YSY A;  2BG9 B;  2BG9 E;  2B76 A;  4ADZ A;  5L3D B;  2LE8 A;  4AKI A;  4U72 A;  3AEB A;  3LK3 B;  3AVS A;  1HNZ T;  4UV9 B;  2HN2 A;  2ZM8 A;  4ZS2 A;  3TKL B;  2BG9 A;  1ZHC A;  2X67 A;  2LKH A;  2XAS B;  5CB4 E;  3JC6 D;  2ZLY A;  3SWH A;  4DND A;  2H88 A;  3ETU A;  3KV5 A;  3CX7 B;  1MNE A;  2ACZ A;  3B5M A;  1N33 T;  3BQL A;  2LOP A;  1OWA A;  2CRB A;  3VU7 H;  2X0Y A;  4HTE A;  4PK6 A;  5JVD E;  2UXN B;  2BBH A;  5JDQ A;  1J5E T;  1AJ3 A;  3N9P A;  1BR2 A;  2XSB A;  2HPL A;  4U31 A;  3EVY A;  5F3J A;  2BS2 A;  3I0Q A;  4YHH T;  4HWH A;  2WSS V;  5HWY A;  3RHW A;  1FJG T;  1T98 A;  3P4W A;  3S4U A;  3FBL A;  2I6H A;  4JEH B;  2JMH A;  3TLV A;  1OXZ A;  5LGT B;  4U2Y A;  4N78 D;  2XQY A;  4PNI A;  4HFC A;  4ILC A;  2BBJ A;  4ILB A;  2E5V A;  2XAQ B;  3H3M A;  3UUB A;  2VK9 A;  3EAM A;  2RP4 A;  2DNX A;  3N9L A;  3UU3 A;  4DMV A;  3IEE A;  1KK7 A;  3B13 A;  2KZ7 B;  5FL0 A;  4LMJ A;  1YXR A;  3RC3 A;  3E22 E;  4LF5 T;  3Q2M A;  4DV6 T;  4ILA A;  4HFV A;  4JLE A;  2XQA A;  3SFE A;  2UXC T;  4BAY B;  2MBG A;  2BKO A;  2WBL A;  2ODU A;  2VL8 A;  4IE4 A;  3C4W A;  3OJA A;  5LMU T;  1LRZ A;  2JQQ A;  2C5K T;  3PUS A;  2MOZ A;  2DL1 A;  2G0U A;  2E9X C;  3C50 A;  4H9O C;  5BMV E;  3BK9 A;  2VKD A;  4EV6 A;  3ONJ A;  2BVL A;  1FEW A;  1N32 T;  4KX6 A;  5CFB A;  1SA0 E;  3N2O A;  3ZPO A;  4GIW A;  4LF8 T;  4ZZB A;  4P09 A;  2Q9Q D;  3P4R A;  3P4S A;  2MTQ A;  1Z0P A;  3UUM A;  2D2S A;  3ETV A;  3N9O A;  2NW7 A;  5CGM A;  4PJM A;  3GN5 B;  3BQI A;  1FMW A;  2PJQ A;  4UXN B;  3RYC E;  3ZCJ A;  4HWD A;  3ZT7 A;  3RH3 A;  2IHR 1;  2XSA A;  1WLX A;  3K3Q C;  4OYK A;  3GN5 A;  2CMR A;  1N34 T;  2JRK A;  1WFD A;  2CPT A;  3QB5 K;  1KNP A;  3PUW F;  5FY0 A;  4YJ2 E;  3EDU A;  2ZMA A;  4QHO A;  3ONX A;  5FKY A;  4YHJ A;  2NTX A;  3KVB A;  5HCM A;  2WDR A;  2VVN A;  5AQG B;  5HEJ A;  1X9B A;  4DO0 A;  4X66 T;  5DAB A;  4X20 E;  5LGU B;  2XQ7 A;  4Q25 A;  1LVF A;  2EHO D;  2K9A A;  2N1G A;  2E2A A;  5LB7 B;  2ZM6 T;  1CHU A;  5JR9 C;  2M67 A;  4WYV A;  4HKA A;  4IE5 A;  3UUN A;  3J9X 1;  3EUH A;  1NAF A;  1KFY A;  3JAF A;  1HNX T;  1B7T A;  5L4H A;  5DQW A;  3UU5 A;  4GKK T;  1WCR A;  2V5D A;  3CML A;  3PU3 A;  3FHN A;  4O2A E;  3ZYM A;  5J2T E;  1EZ3 A;  3RGL A;  2DWK A;  2KIN B;  4H9R C;  1U5P A;  3AA7 B;  5JR9 B;  4MBQ A;  2CLY B;  2C5I T;  4I55 E;  5AQV B;  5J0Z A;  4TWF A;  4PJN A;  4XAX B;  3Q5W A;  4DR5 T;  2WMO A;  3PTR B;  5AQT B;  3K3O A;  1IBL T;  3ANW B;  2LSY A;  5JR9 A;  3DTO A;  5CJ5 A;  3AEE A;  2YEV C;  3E0Z A;  3AA6 B;  2QGS A;  4IIJ E;  2BZB A;  4CN1 A;  1QUU A;  2XQ9 A;  4E7S A;  5AQQ B;  2CM0 A;  4AQG A;  4U7I A;  2IIU A;  3U3I A;  4LFA T;  1UX5 A;  2IML A;  2IUB A;  2WWU A;  4FJO A;  3C64 A;  3AEF A;  3AE6 A;  4IDO A;  4WZX A;  3MKD A;  2XM2 A;  4JEU B;  3CPZ A;  4U7Y A;  2XAF B;  1MMD A;  4HFH A;  2H7O A;  2W61 A;  2HHH T;  4ZXL A;  3QK6 A;  2W4X A;  3IF8 B;  1M7K A;  4ZHQ E;  4ZOL E;  5HYA A;  4HEA A;  5FXV A;  4X1Y E;  3FXD B;  4ZI3 C;  4AQY T;  1LKX A;  4U2Z A;  5AQU B;  3K3N A;  3GMI A;  1FMV A;  2WS3 A;  4TN7 B;  3O1I A;  4MAL A;  4X1K E;  4U33 A;  3QB5 A;  1XNR T;  3TLW A;  1FIO A;  4IDP A;  4JI4 T;  3AE7 A;  2H7V C;  3HKC E;  1J5W A;  4X64 T;  4UF0 B;  2NP9 A;  4O4L E;  1IAP A;  3N9M A;  4OFZ A;  5DJQ C;  3EHZ A;  4LF9 T;  2OV9 A;  4QX8 B;  1N36 T;  4TUY E;  3NZP A;  3HI2 A;  3CQX C;  4B3R T;  3CQC B;  4OX9 T;  4UF0 A;  5C8Y E;  3FZF B;  3V5S A;  5EK4 A;  4B3T T;  1HG5 A;  5J2U E;  2CBJ A;  3PUR A;  3L09 A;  3OTO T;  1KNR A;  1SHZ C;  3JAD A;  4BJN A;  2Y8D A;  4I4T E;  4M1P A;  2H89 A;  4EED A;  3DJB A;  2ODV A;  5LGN B;  4TV8 E;  2E8I A;  4OHF A;  2D9D A;  4ZS3 A;  4EYU A;  1T8B A;  5KMG P;  1XWM A;  3P4P A;  3J7Y q;  4AQF C;  4K0K T;  5LBM A;  4X1I E;  2UXB T;  4JYA T;  4L5G A;  3W15 B;  2HH7 A;  4NXN T;  2KSR A;  3FZM B;  5FXW A;  1IZN B;  1D1C A;  2PTF A;  2VKJ A;  3CVR A;  3FZL B;  1HG2 A;  5AQN B;  1DU2 A;  3PUA A;  2X9H A;  3AE4 A;  2CHN A;  2XQ3 A;  4DID B;  2IAK A;  2CA5 A;  5KXJ A;  4O2B E;  4MHC A;  1WYB A;  4JI0 T;  4ZI2 C;  3HR0 A;  4C90 A;  2LHN A;  4DR6 T;  4Z90 A;  4COF A;  2K24 A;  2LSG A;  1YQ4 A;  1XDP A;  2RA1 A;  2NW9 A;  3AED A;  4KMC A;  4LMK A;  2XQ6 A;  1UCU A;  1OED C;  5TAO A;  3PDY A;  3ZMS B;  2CWY A;  2K3W A;  2A3D A;  2CXL A;  4BJM A;  2JQ9 A;  2VKO A;  2YKS A;  5C3J A;  2JJ9 A;  2LKG A;  3B57 A;  5AQJ B;  3QNU A;  4AIU A;  4PFO A;  2E9X D;  5LHG B;  3T1Y T;  1ZKE A;  2LT3 A;  5F5W A;  3E08 A;  4Z91 A;  2X9W A;  5ABH A;  5JTG A;  2VVS A;  2V7I A;  2YK0 A;  5ABF A;  2E5L T;  5AQO B;  3I0O A;  2LM2 A;  3LG7 A;  4HFD A;  3AEA A;  4TNV A;  3UUL A;  2M6B A;  1MIW A;  1W09 A;  3KV4 A;  1OED A;  1JNZ A;  3NVO A;  5KDM C;  4A97 A;  4CI1 B;  5AQI B;  3LK4 2;  4TZ4 C;  3CX8 B;  1NEK A;  4NPP A;  3RRW A;  5L3E B;  3AXJ B;  1YD8 G;  3AA0 B;  2P9B A;  2UXX B;  4DV5 T;  4G2A A;  4H9P C;  4LFB T;  5IYZ E;  4IT4 A;  3AXJ A;  4DMW A;  1G73 A;  2QRX A;  3FB2 A;  4IE0 A;  2KLQ A;  3ZSS A;  3UQ7 A;  3LFM A;  4DV3 T;  2JMK A;  1QSD A;  1VRB A;  1MIV A;  2N9D A;  3JC6 C;  1UUR A;  4G63 A;  3C4Z A;  4DR4 T;  3UU6 A;  2JQK A;  5L3B B;  4I50 E;  3JAE A;  3NRX A;  1W9R A;  2UXD T;  4YSX A;  4QH5 A;  4I43 B;  4JI3 T;  2WWV A;  4EOZ B;  4K0U A;  4IGU A;  1HNW T;  2V26 A;  3ZEF B;  4DV7 T;  2E9X B;  3ONL C;  4GYR A;  3NRY A;  1XMQ T;  4PK4 A;  4F6R C;  4F8H A;  3KVA A;  2HPJ A;  4GKJ T;  2E9X A;  5HCJ A;  4PAG A;  1W0A A;  4PK5 A;  5FL1 A;  5AQH B;  3C4X A;  2W66 A;  1D1A A;  3U78 A;  2WB5 A;  4ZZC A;  4WNK A;  1XMO T;  4CI3 B;  2W63 A;  4JI2 T;  2IC6 A;  3ZYL A;  5CA1 E;  1ZEE A;  5AQP B;  2CEA A;  4WBO A;  1YKE B;  2CCQ A;  5FVK A;  2WU5 A;  1HS7 A;  2BS4 A;  5LMN T;  3AB3 B;  4KHP T;  4EYY R;  5H6Q B;  3C98 B;  5LOV E;  3ZMV B;  3PUX F;  2RPA A;  5JH7 E;  2Y6X A;  4DV4 T;  5KX5 E;  2CWO A;  4P1N A;  3KBU A;  3AE9 A;  5JQG E;  4DUZ T;  4EXT A;  5L2L A;  5LP6 E;  3N9Q A;  3ZMU B;  2XPK A;  2QVA A;  1YKH B;  2OLT A;  1Y01 A;  5FYM A;  3ZKR A;  2BKN A;  2X51 A;  2LM9 A;  1E1H B;  3R84 B;  3ZLI A;  3RIF A;  4UEM A;  4DR2 T;  2KWI B;  3RLF F;  2FJB A;  5AQK B;  4ZI3 D;  2WY2 A;  2Q9Q C;  4DBR A;  4LF6 T;  3UU4 A;  3OBV E;  3RI5 A;  3MA9 A;  2V7K A;  4EEB A;  3F31 A;  1M62 A;  4EB6 E;  3QC9 A;  3PUQ A;  2XY8 B;  3MAC A;  4ZI7 E;  2VAS A;  3X1D A;  5FP3 A;  5FXX A;  2CBI A;  4IE6 A;  3ZN0 B;  4H9N C;  4DUY T;  5FVL A;  2N2N A;  5ADX L;  2NOX A;  2WZH A;  4QXC B;  3AEC A;  2IDO B;  2CXF A;  4MLK A;  5L4E A;  1S94 A; 
#chains in the Genus database with same CATH homology
 2JMH A;  5LYJ E;  3MZK B;  4HGA A;  1OXZ A;  5LGT B;  3NBX X;  3H37 A;  4L5G A;  3W15 B;  4DVD A;  2X68 A;  4N78 D;  2XQY A;  4PNI A;  2HH7 A;  4EIW A;  3ZC0 A;  2A2F X;  1HTJ F;  2DLR A;  3V5U A;  5M4Y A;  5FXW A;  1IZN B;  2XAQ B;  1HX8 A;  1D1C A;  4FI5 A;  2VK9 A;  2VKJ A;  4YJ3 E;  2RP4 A;  2DNX A;  3N9L A;  1IJ6 A;  4HN9 A;  3CVR A;  4O4I E;  4XZC A;  5J1G A;  4PJJ A;  4DMV A;  1HG2 A;  4O8S A;  3PUA A;  2X9H A;  2H3R A;  3IEE A;  1KK7 A;  5HXH A;  1Y64 B;  3O1J A;  3B13 A;  3MJX A;  4P0A A;  1KNZ A;  4V1A v;  4JUY A;  3OYZ A;  5LJN A;  2KZ7 B;  3Q9D A;  3CKD A;  3GA8 A;  3RX6 A;  3RC3 A;  3E22 E;  2IAK A;  3Q2M A;  5LA6 E;  5L3F B;  3CQG B;  2CA5 A;  3LK2 B;  2CLY C;  3N2K E;  2W62 A;  5LNK A;  4O2B E;  1G8X A;  2PBI A;  4HFV A;  4GOU A;  4JLE A;  4MHC A;  1WYB A;  1U4Q A;  4BAY B;  2MBG A;  4ZI2 C;  1VOM A;  2LJL A;  4AKL A;  5FY7 A;  3HR0 A;  2WBL A;  2ODU A;  4PW8 A;  2LSI A;  2VL8 A;  4C90 A;  3SOL A;  4IE4 A;  2LHN A;  3C4W A;  2K5B B;  3OJA A;  3DP7 A;  5JDN A;  4QXB B;  1LRZ A;  2JQQ A;  4UIG A;  2C5K T;  3PUS A;  4XBF B;  3VKH A;  2K24 A;  1MMN A;  2MOZ A;  4WW0 A;  2G0U A;  2LSG A;  2NW8 A;  2RA1 A;  2E9X C;  2NW9 A;  5HXC A;  3C50 A;  4H9O C;  4ANJ A;  4KMC A;  5BMV E;  3SRZ A;  3EDV A;  4QX7 B;  1UCU A;  3BK9 A;  3KIN B;  5TAO A;  1X79 A;  2VKD A;  1D1B A;  3PDY A;  3ZMS B;  4IDZ A;  2CWY A;  1LVK A;  2A3D A;  5E0O A;  2XTL A;  2BVL A;  5FXZ A;  1FEW A;  2YU2 A;  3OKQ A;  2CXL A;  3UT5 E;  1SA0 E;  4BJM A;  2VKO A;  3N2O A;  4DBQ A;  3ZPO A;  4GIW A;  3RC8 A;  4TV9 E;  2ZM0 A;  2JJ9 A;  4CXX A;  4NUV A;  3CWZ B;  3A5X A;  3B57 A;  2D0T A;  4PFO A;  2E9X D;  2Q9Q D;  4P09 A;  5LHG B;  2Q9Q B;  1ZKE A;  1Z0P A;  2MTQ A;  3UUM A;  2LT3 A;  2D2S A;  3E08 A;  2X66 A;  4UVC B;  2X9W A;  3ETV A;  3N9O A;  2NW7 A;  2V7I A;  2YK0 A;  4PJM A;  3GN5 B;  3SS1 A;  2XHE B;  5ETW A;  3BQI A;  1FMW A;  2QA7 A;  2PJQ A;  1ZV4 X;  4UXN B;  5LBQ B;  3AAA B;  3RYC E;  3I0O A;  2XAH B;  3I9Y A;  3ZCJ A;  3LG7 A;  4ILU A;  3UUL A;  3RH3 A;  3ANW A;  2Q9Q A;  4QWN B;  4AKH A;  3BQK A;  3GWH A;  1WLX A;  2V7L A;  2DCF A;  1MIW A;  2X9X A;  3KV4 A;  2YU1 A;  2D0U A;  3K3Q C;  3IHR A;  4ISS A;  5HXS A;  3VKG A;  4OYK A;  3N2G E;  2MYS A;  3GN5 A;  3RYI E;  2CMR A;  5KDM C;  5L3C B;  3ZYK A;  3Q5X A;  1US7 B;  4CI1 B;  2A72 A;  4H63 H;  5LBM A;  3LK4 2;  4TZ4 C;  3CX8 B;  2JRK A;  2EHO C;  1YW0 A;  4NUU A;  2KWH A;  5FY0 A;  4YJ2 E;  2C0S A;  5EK3 A;  3EDU A;  3IBP A;  2ZMA A;  4QHO A;  5LCY A;  3RRW A;  5L3E B;  3ONX A;  5L3G B;  3MXZ A;  4QXH B;  4YHJ A;  2NTX A;  1YD8 G;  3KVB A;  2V7M A;  4H9S E;  1MIY A;  4L9I A;  2Y48 B;  5JDF A;  3AA0 B;  3WAJ A;  2DWG A;  2L3L A;  2P9B A;  2LSJ A;  4DO0 A;  2IW5 B;  5DAB A;  3N5L A;  2D5U A;  1HF8 A;  2UXX B;  4X20 E;  5LGU B;  1LVF A;  4G2A A;  2EHO D;  2K9A A;  3PUG A;  2EHO B;  2V7J A;  2N1G A;  4H9P C;  5IYZ E;  3HA4 A;  5JR9 C;  2M67 A;  2W00 A;  4DMW A;  4HKA A;  3FBZ A;  4IE5 A;  4AQF A;  1G73 A;  5JDH A;  3UUN A;  3FB2 A;  3J9X 1;  3VHL A;  3EUH A;  4IE0 A;  2OA5 A;  1NAF A;  2KLQ A;  4H9Q C;  4ASK A;  3LFM A;  3QUJ A;  1B7T A;  3KV9 A;  3KV6 A;  2WAU A;  5DQW A;  5JDM A;  3CML A;  2JMK A;  3PU3 A;  1QSD A;  1VRB A;  3FHN A;  1MIV A;  4O2A E;  3HL6 A;  5FNV E;  2EHO A;  2N9D A;  3F2E A;  3JC6 C;  3ZYM A;  1WRD A;  5FMN A;  5J2T E;  1EZ3 A;  4G63 A;  4O4J E;  2DWK A;  4GK5 E;  3C4Z A;  2IC9 A;  1WYC A;  2KIN B;  5HXR A;  4CI2 B;  1IJ5 A;  3AAI A;  3CX6 B;  3K8P C;  4H9R C;  4L0R A;  1U5P A;  4PJL A;  3RRC A;  2PFV A;  3AA7 B;  5JR9 B;  4MBQ A;  2CLY B;  5L3B B;  1UX4 A;  2DHR A;  4B6X A;  4I50 E;  2C5I T;  4I55 E;  3NRX A;  2CE7 A;  4ZI2 D;  5EK2 A;  2BDE A;  5LXT E;  4UV8 B;  4PJN A;  4UVA B;  4I43 B;  4XAX B;  3Q5W A;  4EOZ B;  2LOS A;  2WMO A;  4K0U A;  5AFU L;  4AI6 A;  3PTR B;  4IGU A;  4PFP A;  4C91 A;  2J1D G;  3K3O A;  5JDL A;  2V26 A;  3D0T A;  3ZEF B;  3ANW B;  2E9X B;  3RYH E;  2LSY A;  4GYR A;  3NRY A;  5JR9 A;  4EZ4 A;  3DTO A;  3ZJ2 A;  2KND A;  4ERR A;  3LBX B;  3MK7 C;  3P7I A;  2V1D B;  4PK4 A;  2KT9 A;  5F8P A;  3UUX B;  4F6R C;  1MMG A;  4EAH A;  5EZY E;  2YIN A;  3HKB E;  3I9W A;  2JPF A;  4KUM B;  2YEV C;  2I59 A;  3KVA A;  2NTY A;  3E0Z A;  3AA6 B;  2HPJ A;  2QGS A;  3ESL A;  4IIJ E;  2CXD A;  3O9X A;  2BZB A;  3O4X E;  1QUU A;  2E9X A;  4AXP A;  3FXE B;  4E7S A;  4PAG A;  4IHJ E;  5A1L A;  4YFS A;  5CA0 E;  3KFW X;  3LBX A;  4CXW A;  2CM0 A;  1BR0 A;  4AQG A;  4O4H E;  3OYX A;  4PK5 A;  5JRC B;  3U3I A;  2GK9 A;  1UX5 A;  3C4X A;  4HE8 A;  4KP3 C;  2SPC A;  2WWU A;  1D1A A;  4FJO A;  3C64 A;  3U78 A;  2L9Q A;  2VB6 A;  4QKN A;  2KXP B;  4AKR B;  5GON E;  2LSK A;  3MKD A;  4IE7 A;  5FY1 A;  3KBT A;  4JEU B;  4UEL A;  2WM9 A;  5HAX A;  4OYJ A;  4WNK A;  1V9D A;  2BVM A;  4CI3 B;  2LHR A;  3CPZ A;  2W63 A;  3C51 A;  4J2C A;  2IC6 A;  3LJC A;  4Z8X A;  3PU8 A;  2XAF B;  5JRC A;  1MMD A;  3ZYL A;  3ZCI A;  2H7O A;  5CA1 E;  1ZEE A;  3R6N A;  2NWB A;  3PE0 A;  2CEA A;  3I1A A;  3RKO A;  4WBO A;  1YKE B;  1NWM X;  2CCQ A;  2X0L B;  3UFE A;  2XUE A;  1MND A;  4GYS A;  3UTK A;  3ZMT B;  2W61 A;  1D0X A;  1HS7 A;  1D0Z A;  3AB3 B;  3AA1 B;  4EYY R;  5HWX A;  4CZZ B;  5H6Q B;  3RYF E;  1WR6 A;  5JDG A;  2C5J A;  3T8O A;  4A56 A;  2XAJ B;  3NZQ A;  3QK6 A;  3ZJ1 A;  2VKH A;  3C98 B;  5LOV E;  3ZMV B;  2ES0 A;  2KMF A;  3IF8 B;  4YLH A;  2X9Y A;  2DI4 A;  5DQV A;  5JH7 E;  2Y6X A;  3AVR A;  4ZHQ E;  2W0G A;  4ZOL E;  5KX5 E;  2CWO A;  3KBU A;  2LEH A;  4EZH A;  3WI3 A;  5JQG E;  3AAE B;  4HEA A;  5HYA A;  3ZC1 A;  3H3A A;  4EXT A;  5FXV A;  5LHH B;  5L2L A;  4X1Y E;  3FXD B;  4ZI3 C;  5LP6 E;  1LKX A;  2Z6E A;  4H63 V;  3M65 A;  3N9Q A;  4P0B A;  5LG4 A;  1S35 A;  4TX5 A;  3ZMU B;  3K3N A;  3GMI A;  3ZN1 B;  1FMV A;  4ADZ A;  5L3D B;  1YKH B;  4OK0 A;  3O1I A;  4TN7 B;  4KBM B;  2LE8 A;  4MAL A;  4AKI A;  4U72 A;  4X1K E;  5FYM A;  1FIO A;  2X51 A;  2LM9 A;  1E1H B;  3R84 B;  3ZLI A;  2H7V C;  3HKC E;  3LK3 B;  3AVS A;  3WAK A;  4UEM A;  1BR4 A;  2WMN A;  1MMA A;  2K48 A;  2KWI B;  4UV9 B;  4UF0 B;  2NP9 A;  5LHI B;  2ZM8 A;  4ZS2 A;  3KDS E;  3TKL B;  4ZI3 D;  5JRE A;  1ZHC A;  2Q9Q C;  2X67 A;  4O4L E;  5LJM A;  1IAP A;  3ZMZ B;  4DBR A;  3N9M A;  4CQI A;  4OFZ A;  4CXY A;  1D0Y A;  5DJQ C;  1HFA A;  2XAS B;  3F57 A;  5CB4 E;  3JC6 D;  2ZLY A;  3SWH A;  4QX8 B;  4DND A;  2XAG B;  4TUY E;  3ETU A;  3NZP A;  3OBV E;  3HI2 A;  3CQX C;  3CQC B;  3KV5 A;  5H6R B;  3CX7 B;  3MA9 A;  4UF0 A;  5C8Y E;  3V5S A;  1MNE A;  2V7K A;  3F31 A;  5EK4 A;  1HG5 A;  5J2U E;  3PUR A;  4UVB B;  3L09 A;  1HCI A;  4U74 A;  3BQL A;  1H7C A;  4E7Z A;  2LOP A;  2ACX A;  1OWA A;  4EB6 E;  1SHZ C;  4BJN A;  3QC9 A;  2Y8D A;  3PUQ A;  4I4T E;  5IHY A;  4M1P A;  3VU7 H;  3HKD E;  3MAC A;  4ZI7 E;  3HKE E;  2VAS A;  3DJB A;  4HTE A;  2ODV A;  4PK6 A;  5JVD E;  2UXN B;  5JDQ A;  1AJ3 A;  3N9P A;  3L3P A;  2VWA A;  5FP3 A;  1BR2 A;  5LGN B;  5FXX A;  4MFR A;  2HPL A;  4TV8 E;  4IE6 A;  2E8I A;  3ZN0 B;  4OHF A;  4H9N C;  4BA9 A;  4WBN E;  1O3X A;  2B1E A;  4ZS3 A;  3EVY A;  4EYU A;  5F3J A;  5KMG P;  3I0Q A;  2N2N A;  3N9N A;  5ADX L;  2WSS V;  2NOX A;  5HXE A;  4IST A;  5HWY A;  4AKG A;  4GK0 E;  3J7Y q;  2L8K A;  2PG8 A;  1T98 A;  4QXC B;  1CUN A;  4AQF C;  3O1H A;  3S4U A;  1BR1 A;  2CXF A;  2ZM2 A;  3FBL A;  3RPU A;  4MLK A;  3P8C D;  4JEH B;  1S94 A;  4X1I E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...