5JRCB

Crystal structure of nec3po in complex with ssrna.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
185
structure length
185
Chain Sequence
SMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEQ131
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
total genus 84
structure length 185
sequence length 185
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jrcB00
5JRCB 5JR9B 5JRCA 3ZC1A 5JREA 5JR9A 3ZC0A 5JR9C
chains in the Genus database with same CATH superfamily
1MIYA 4ZXLA 3LBXB 2XM1A 4NXMT 5H6RB 2YK0A 1VRBA 2C5JA 3AEBA 1YW0A 4GYSA 3AEFA 4JEHB 3JAEA 5HEHA 3FZHB 3PUXF 3ZMUB 2FBWA 2FJEA 5AQPB 4LFCT 3PUVF 3N9NA 3KVAA 4B6XA 5JR9A 4EIWA 5AQUB 4AISA 1HTJF 5L3FB 3OKQA 4KHPT 3C51A 2ZM6T 2XQYA 5LHIB 1V9DA 2WDRA 2XSBA 5LP6E 4IE7A 1QSDA 1FIOA 1LKXA 3H3AA 2NWBA 3EABA 1YKEB 1W09A 1OEDB 5ADXL 2E9XA 4LFAT 3PUQA 4ISSA 4IHJE 2LKHA 3NWIA 3SWHA 3RC8A 4AKRB 4PK6A 2KT9A 4L0RA 4B3ST 3EHZA 5KXJA 2A9UA 2DHRA 2I59A 3AA6B 3N9QA 4UV9B 2N9DA 3KINB 2CRBA 1KK7A 2PBIA 1T98A 4U2ZA 2PTFA 1IJ5A 2BBJA 4A5XA 3AAEB 2DLRA 2PG8A 5L3DB 5AQFB 4WZXA 2B76A 1W0BA 5LYJE 2WY2A 2X68A 4HFCA 1KEYA 1R8IA 3FB2A 4HEAA 4FI5A 2EHOC 3C4WA 5C2TA 3N2GE 4MLKA 3A7MA 3KVBA 4AI6A 3N9PA 4LF6T 3EUHA 5AFUL 2BKOA 2XQ4A 4BJMA 2CCQA 3BQLA 3AE6A 4DNDA 3AE1A 4U74A 3LK3B 3P4PA 5J0ZA 4NUVA 2KINB 2WSSV 1VOMA 4MALA 2K24A 1B7TA 1QLBA 2CXDA 2NTYA 4CI2B 3V5UA 2EHOD 1MMDA 4UEMA 3AAAB 1CHUA 4PJNA 2XTLA 4E7ZA 2X51A 4AQFC 2QA7A 2D0UA 4WW0A 3RHWA 5JRCA 4MBQA 2W0GA 3E08A 2K9AA 5KMGP 3NZQA 5F3JA 1E1HB 3PU8A 5FNVE 4HFBA 2K5BB 3KFWX 2JPFA 5AQLB 3C4XA 3LDQB 1W0AA 3ZJ2A 1J5WA 3ETVA 2LKGA 5AQGB 4LF8T 4KUMB 3DJBA 2WZHA 1NWMX 2JIWA 2IC9A 2DCFA 3RC3A 4OYKA 1BR1A 1WYCA 3EAMA 5IHYA 3KBUA 4C90A 1UGOA 3SFEA 2YDQA 4H63V 1UUSA 3Q5XA 4HFVA 1JNRA 2YINA 3L09A 4HWDA 2D0TA 2RP4A 3MJXA 2VL8A 5TAOA 2CM0A 2BVLA 2XQ7A 2Q9QA 3AVRA 4LF5T 3VHLA 5J2TE 1SE7A 3BK9A 4KX6A 4HWFA 2XAGB 3ZSTA 3O1HA 5ABFB 2ZM2A 4DV4T 5HXHA 3T8OA 5AQIB 3ONXA 2VKOA 2JQ9A 3MA9A 3RYIE 1XNQT 3AEGA 3RRWA 3C50A 4O8SA 5IWAT 4U31A 3UULA 2LSYA 2IW5B 3NRYA 3MKDA 3KV6A 4PNIA 2MYSA 5CJ5A 4TUYE 1J5ET 4C91A 2WS3A 3AE2A 2L9QA 4EYYR 2WWUA 1ZOYA 5AQHB 5AQMB 4K0UA 3ZKRA 3ZN0B 4A56A 1SA0E 3N5LA 2FJDA 1OEDC 2CHNA 4DBRA 5HXSA 2UUAT 2XQ9A 3X1DA 4ZI7E 2LM9A 1KF6A 2UXBT 4AKLA 3PUZF 4NUUA 4DR3T 3HI2A 2VK9A 2R6GF 5C3JA 3ONJA 4LF9T 1KNZA 2X0YA 3TLWA 5JH7E 4JI1T 1XDPA 3CIRA 4XAXB 2VQET 2QVAA 3PTRB 1XMOT 1HG2A 5DQVA 2W62A 2E5VA 4O4HE 3U3IA 3QUJA 4QXHB 2JJ9A 2KWHA 3PJAA 1YQ3A 1MMGA 4L5GA 2IMLA 2CWOA 3IBPA 1LVKA 5HWYA 4AIUA 3ZYMA 3TKLB 4TWHA 3AECA 4N78D 5EZYE 2J1DG 2NR4A 2UXCT 2CBIA 4HFEA 3FZKB 2LSJA 3IEEA 1WFDA 3FHNA 3EI0A 4UVBB 4EZHA 2X67A 3KBTA 4AKGA 2MTQA 3B57A 3FXEB 2AXDS 3O1JA 4QH5A 3EDUA 4KP3C 2WAUA 4PW8A 4KI0F 2BKNA 2C5IT 4QKNA 5LB7B 2J62A 3P4SA 1NEKA 2IAKA 3R84B 1Z0PA 3F31A 2HPJA 3CQCB 5LOVE 4ZS2A 1T7SA 3UU4A 3PJAJ 5J1GA 5KDMC 3M65A 2J47A 2A3DA 4NPPA 3A8YC 2PFVA 5L3CB 1NAFA 3LK42 4EOZB 2BS4A 1E2AA 2XY8B 2GK9A 4YSZA 2BDEA 3RRCA 1VCTA 2YDRA 2WMOA 3HR0A 2ACZA 4UVCB 1AJ3A 3NVOA 4U7IA 2YU2A 3UTKA 5JR9B 2LSKA 2Y8DA 2V6XA 2A72A 3PE0A 3J7Yq 5L3BB 2V5CA 5F5WA 3AVSA 4I43B 4AQYT 3FZLB 3NBXX 2D2SA 3ZT6A 2V6YA 4HE8A 2UXDT 3WAJA 4LMKA 3RI5A 3K3NA 2XQ3A 4ISTA 4G2AA 2BBHA 1HNWT 4EZ4A 1N33T 2XSAA 1O3XA 2A2FX 4CXXA 4YY3T 5JREA 5AQRB 4EXTA 3CVRA 1T8BA 2WQYA 3SOLA 1D1BA 5HEGA 3VU7H 1GQEA 1Z8UA 3AA7B 4JI4T 5CA0E 5L3GB 5DABA 4O4JE 5JDHA 1XMQT 2ZLYA 1WRDA 1XWMA 4Z8XA 3ZMSB 2DWGA 2XZEA 2FJAA 4GOUA 4LFBT 1HF8A 4TV9E 4X64T 2IC6A 3ONLC 1S35A 4Z91A 4YFSA 3UU8A 4YHJA 5L4EA 4DV7T 3ZMZB 3PURA 3I0OA 3PUGA 4HTEA 3OBVE 4MFRA 2FUPA 4P0AA 4H9QC 2LRKA 4IDNA 3LBXA 5FMNA 2MAWA 3N2KE 2VKDA 3K3OA 4UR9A 2VKHA 4AKIA 3C64A 3ZT7A 2E8IA 3PUSA 4J2CA 1MIWA 5JDGA 4U72A 2W2UA 3VR8A 4UVAB 2BS2A 2LOSA 4ILCA 4WNKA 4JV5T 1IZNB 2CA5A 2PJQA 2XQ8A 4X5TA 5LG3A 5JDLA 1IBLT 3ESLA 3ANWA 3L39A 5LCYA 2LHRA 2ES0A 2XQ6A 3HA4A 1DU2A 1OEDE 1WYBA 5HEJA 4CZZB 2AE9A 4IDZA 4QX7B 3VR9A 3KV9A 3H3MA 3AE7A 4BAYB 3IHRA 3N9LA 3LFMA 1ZKEA 1HFAA 2H88A 4QH4A 1G73A 4UF0B 3C98B 1LVFA 2Z6EA 3AE9A 2V7IA 4CN1A 5JRCB 3CPZA 3VRBA 4PJJA 4HKAA 2WP9A 1ZHCA 2WZIA 3FBZA 1ZV4X 3ZN1B 3WI3A 5IYZE 3PV0F 3ZT5A 5HCMA 3AEAA 4JEUB 4ZZCA 4PK5A 2LLYA 2V8SV 2I0MA 2YEVC 1FEWA 4X66T 2VL0A 2WBLA 2LEHA 1FMWA 4EEBA 1UX5A 2BG9C 4UELA 4DV0T 1MNDA 4QH1A 4QXBB 1I94T 3O1IA 3B13A 4DBQA 5GONE 2WDQA 3RYHE 2J4GA 4XBFB 4ZS3A 3VRAA 5DQWA 3AE5A 1M62A 3OVUA 3AXJA 2Q9QB 4FJOA 4YJ3E 2YOEA 4IGUA 4P0BA 3QOFA 1UCUA 4F8HA 4IDQA 2HHHT 3QC9A 2ODVA 2CHOA 1Y01A 3SFDA 4IT4A 3AA0B 4EEDA 4B3MT 1US7B 2MBGA 4DVDA 4DV1T 2WU5A 2W4XA 3GN5A 1H7CA 4BA9A 4O2BE 3E22E 4O4LE 5ABEA 4JI6T 5FVKA 5LHHB 3DTOA 4ZI3C 2W67A 3UUXB 1D0XA 4JI8T 1UURA 5ABGA 2ZMAA 1MIVA 4WBOA 3V5SA 3RKGA 3PUAA 5L2LA 2DNXA 4UV8B 2JQHA 2UUBT 3ZC1A 3O4XE 4NXNT 4O4IE 2NW8A 2OLTA 3RLFF 4K0KT 2VKJA 2CPTA 4JLEA 5LBQB 4YT0A 5LJNA 4ZI3D 1UX4A 4G63A 1HNZT 3I1AA 4IDPA 3K3QC 2G0UA 3Q5EA 3PUYF 4DR1T 5FY0A 3AE8A 2YKSA 3UUNA 4DV6T 5BR8T 4HGAA 3W15B 4IDOA 2DI4A 5HAXA 5HWXA 4KBMB 5AQKB 4EB6E 3GA8A 2XAQB 4H9SE 4WYVA 4X65T 1HG5A 2H7VC 2XASB 1YKHB 3ZMTB 2VVSA 2XHEB 4DV2T 4GKKT 5HXRA 4DR6T 3HKBE 4QXCB 3SS1A 4YJ2E 5ABFA 4JI0T 1N36T 3RQWA 4EAHA 5L47A 4YTPA 2C0SA 5FKYA 2ODUA 1BR2A 5C8YE 5HCJA 5AQVB 1KNRA 3NKZA 4IE5A 1ZP0A 1NENA 2VB6A 3N9MA 3JAFA 4IREA 2KXPB 1G8XA 1KFYA 2XQ5A 5AQTB 3WAKA 2HH7A 2VASA 4B3RT 5HYAA 2V7KA 2ZM0A 2KSRA 4U3CA 2XUEA 2HN1A 4X1KE 3KDSE 5FXZA 3C4ZA 3PU3A 3CWZB 4YTNA 3ZEFB 4COFA 1FMVA 2JQKA 2C5KT 2KWIB 5AQSB 3NZPA 4IL9A 1CUNA 1L0VA 5FVLA 1X79A 3PDYA 2LE8A 5LA6E 3ZMVB 2IIUA 1MMNA 5LBMA 3FZFB 1KNPA 4U2YA 4QHOA 2CEAA 2I6HA 1VCSA 4JI7T 2XPKA 2F4VT 3RIFA 2EHOA 2XAHB 2HN2A 4JYAT 3LG7A 2RPAA 2V6YB 3RPUA 1YXRA 4JI2T 5FP3A 1WR6A 4H9RC 4OFZA 3EDVA 5LGNB 2LHNA 4OYJA 3AB3B 2BG9E 2L8KA 2M6IA 3ZPOA 2QYWA 3N2OA 3ZLIA 3G06A 5LNKA 4QWNB 2W00A 4AQFA 4UIGA 3QB5A 3RYCE 1U5PA 4KHZF 5JDFA 2ZM8A 5EK4A 1WR0A 2X9WA 2BG9A 4TV8E 3JC6C 4QX8B 4YXDA 4AXPA 1I6ZA 2LM2A 3RF1A 3FBLA 2H89A 4DUYT 4TZ4C 4CN6A 2Q9QD 4GKJT 1D1CA 2KLQA 2E2AA 2V7JA 3IF8B 3CX7B 3HKCE 4HN9A 1HS7A 4LF7T 4OHFA 2LOPA 2E9XB 3JC6D 3O9XA 3RH3A 2V7LA 3LSVA 4I50E 5DJQC 4Q25A 3OPCA 2K3WA 3ZYLA 4TNVA 3Q5DA 3N9OA 5JDMA 3AEDA 2V26A 4PJLA 1XDOA 4HWCA 4TWFA 2W63A 4ANJA 4DUZT 3SRZA 4Z90A 3ANWB 3UFEA 3RYFE 2UXXB 3KV4A 2N2NA 4A97A 4MHCA 4ZOLE 4E7SA 5LJMA 5L4HA 1IBKT 1YQ4A 5BMVE 2D5UA 2JQQA 1M7KA 3Q2MA 1XNRT 4UXNB 3ETUA 2QRXA 3CX8B 5EK3A 1SHZC 2X9YA 4I55E 1Y64B 2E5LT 2Y48B 3Q9DA 2VWAA 2VVNA 2LSIA 3PUWF 3T1HT 1IJ6A 5HEOA 2BS3A 5FYMA 5KX5E 4U7YA 5HXCA 3AE3A 4HFHA 2NOXA 1W9RA 1BR4A 2KMFA 1T72A 2LJLA 4AQGA 3M3ZB 3RIUC 4PFPA 3MXZA 3ZJ1A 5CA1E 3MZKB 2CMRA 2BKPA 3EVYA 2VQFT 2WB5A 4X62T 1HNXT 2CWYA 4TNWA 3H37A 2NTXA 4YSYA 2FJBA 3ZCJA 1WLXA 1OEDA 4GYRA 1HCIA 4DV3T 4TX5A 3UFGA 2DL1A 3OYZA 2OV9A 5L3EB 3F2EA 4DR7T 2BZBA 3UQ4A 5FXWA 4GIWA 1N32T 4DR2T 3P8CD 5AQQB 4XZCA 4HFDA 5JVDE 2IDOB 4HWIB 4HWHA 1X9BA 3VKGA 4H9PC 1ZEEA 2UU9T 2YN6A 1IAPA 2WM9A 3HKEE 5AQJB 1OXZA 2NP9A 3AXJB 4JI5T 1UK5A 4CQIA 4ERRA 2CE7A 3F57A 4CXWA 2N1GA 4DMWA 4DR4T 2NW9A 3ZYKA 2BVMA 5LMUT 4PAGA 2OA5A 2B1EA 4HFIA 5LGTB 4UF0A 4X1IE 4ZHQE 3J9X1 4EV6A 3UUMA 1FJGT 4IE0A 4PJMA 2W66A 3GN5B 3K1SA 4EGWA 1IBMT 4TN7B 4DR5T 1J1JA 3BQKA 5JDNA 4CN4A 3E0ZA 4IE6A 3AEEA 2LSGA 2XQAA 4JBWF 3OTOT 3UU5A 2V7MA 4CXYA 3QK6A 4LMJA 4AKHA 2LT3A 5FY7A 2H3RA 3NRXA 2V1DB 3A5XA 5JR9C 2CLYB 5F8PA 2P9BA 2WWVA 5H6QB 5AQNB 1WCRA 4JUYA 2M67A 1HR0T 3D0TA 3OYXA 3RQUA 4BJNA 4ILAA 2W61A 5FXVA 1D1AA 3ZC0A 4PFOA 3UT5E 2IHR1 3UU3A 4I4TE 2WMNA 4ZEYA 2CBJA 5M4YA 2JMHA 5CB4E 2XAFB 5J2UE 2JRKA 4GK5E 5HXEA 2KZ7B 2E9XC 5LGUB 4B3TT 1LRZA 2UXNB 1D0YA 3I9WA 4I0UA 3HKDE 3UUBA 3KV5A 3R6NA 4PK4A 4OK0A 4P09A 4DO0A 3JADA 4YSXA 5ABHA 3L3PA 4U33A 4LF4T 1S94A 5LG4A 2LRLA 2D9DA 1YD8G 4CI3B 1MNEA 1D0ZA 2KNDA 2E9XD 3I0QA 2JMKA 3Q5WA 4GK0E 4ASKA 2XJ7A 4ILBA 3U78A 3RX6A 4CI1B 3GMIA 3RKOA 3QB5K 3BQIA 3UU6A 3CMLA 3T1YT 4WBNE 3P4QA 3FXDB 2CXFA 4ILUA 4YTMA 2ACXA 3JCFA 2X66A 3UQ7A 5JQGE 1SUMB 5E0OA 3CK6A 4NIQA 2WCAA 3P50A 3TLVA 1N34T 1U4QA 1QUUA 1HX1B 3VKHA 5EK2A 4H9NC 4EYUA 2HPLA 2IUBA 1MMAA 2X9XA 3ZCIA 2V5DA 3AE4A 3LJCA 3TLSA 3CQGB 4V1Av 4KMCA 3IA3A 2YU1A 3S4UA 4P1NA 3AAIA 5LMNT 3GWHA 3I9YA 2Y6XA 2K48A 4ZZBA 1BR0A 2SPCA 3K8PC 3CKDA 5CFBA 2EHOB 3ZSSA 2NW7A 2UUCT 4M1PA 4DV5T 4YLHA 2MPKA 2H7OA 4IIJE 3RIUA 5HEUA 5FXXA 5A1LA 3OJAA 4ADZA 5JDQA 3QNUA 2X0LB 2MOZA 1E7PA 4JI3T 2QGSA 4ZI2C 5AQOB 3MACA 5FY1A 3FZMB 3LK2B 3P4RA 2XAJB 3P4WA 4X20E 5CGMA 5ETWA 2L3LA 2YDSA 3MK7C 2DWKA 5LXTE 4DIDB 4LMLA 4L9IA 3RGLA 3HL6A 2BG9B 3CX6B 1OWAA 4ZI2D 4OX9T 5FL1A 4X1YE 4TWDA 2X9HA 2XM2A 4F6RC 3B5MA 3TLTA 3CQXC 2M6BA 5JTGA 4IE4A 2Q9QC 3L8RA 2RA1A 3RIAA 4YHHT 4IL4A 2WDVA 2CXLA 3P7IA 3ABVA 1XZYA 4O2AE 4DMVA 5LHGB 3AA1B 2X0HA 1EZ3A 4H63H 4A98A 2WU2A 5IUXA 2CLYC 3TLUA 1JNZA 4H9OC 2VURA 1HX8A 5FL0A 3DP7A
chains in the Genus database with same CATH topology
1MIYA 4TX5A 4O2BE 3ZYMA 3E22E 3TKLB 4O4LE 3LBXB 4N78D 5EZYE 3OYZA 5H6RB 2YK0A 1VRBA 5LHHB 3DTOA 4ZI3C 5L3EB 2C5JA 3F2EA 3UUXB 1D0XA 2J1DG 1YW0A 4GYSA 2ZMAA 4JEHB 2BZBA 5FXWA 4GIWA 1MIVA 2LSJA 4WBOA 3V5SA 3IEEA 3PUAA 5L2LA 2DNXA 4UV8B 3P8CD 3FHNA 4UVBB 3ZMUB 4EZHA 3ZC1A 2X67A 3KBTA 3O4XE 4XZCA 3N9NA 4O4IE 5JVDE 3KVAA 4B6XA 4AKGA 2MTQA 2NW8A 5JR9A 3B57A 3VKGA 4H9PC 1ZEEA 3FXEB 3O1JA 2VKJA 1IAPA 4JLEA 5LBQB 2WM9A 3HKEE 3EDUA 5LJNA 1OXZA 4EIWA 2NP9A 4KP3C 4CQIA 4ZI3D 1UX4A 2WAUA 1HTJF 4G63A 4PW8A 4ERRA 5L3FB 2CE7A 3I1AA 3OKQA 3F57A 3K3QC 2G0UA 3C51A 4CXWA 2N1GA 2XQYA 2C5IT 4DMWA 5LHIB 4QKNA 1V9DA 5FY0A 2NW9A 3ZYKA 3UUNA 2BVMA 2IAKA 4PAGA 3R84B 4HGAA 5LP6E 1Z0PA 3F31A 2HPJA 4IE7A 2OA5A 3CQCB 2B1EA 3W15B 1QSDA 2DI4A 1FIOA 4UF0A 5HAXA 5LGTB 5HWXA 4X1IE 4ZHQE 5LOVE 1LKXA 4KBMB 3H3AA 3J9X1 3UUMA 4EB6E 2NWBA 4IE0A 3GA8A 4ZS2A 2XAQB 1YKEB 4H9SE 4PJMA 5ADXL 2E9XA 1HG5A 2H7VC 5J1GA 2XASB 3GN5B 3PUQA 1YKHB 3ZMTB 2XHEB 3M65A 5KDMC 2A3DA 4ISSA 5HXRA 4TN7B 2PFVA 4IHJE 3HKBE 4QXCB 3SS1A 5L3CB 3BQKA 1NAFA 5JDNA 3LK42 4EOZB 4YJ2E 3E0ZA 4IE6A 3SWHA 3RC8A 4AKRB 4PK6A 2KT9A 4L0RA 2LSGA 2GK9A 2V7MA 2BDEA 3RRCA 4CXYA 3QK6A 4EAHA 2WMOA 2DHRA 4AKHA 2C0SA 3HR0A 2I59A 2LT3A 5FY7A 2ODUA 1BR2A 2H3RA 5C8YE 4UVCB 1AJ3A 3AA6B 3N9QA 3NRXA 2YU2A 4UV9B 3UTKA 2LSKA 5JR9B 2V1DB 2N9DA 3A5XA 5JR9C 2Y8DA 2A72A 3PE0A 4IE5A 2CLYB 5F8PA 3J7Yq 3KINB 2VB6A 5L3BB 1KK7A 2P9BA 2PBIA 1T98A 3AVSA 4I43B 3N9MA 5H6QB 3NBXX 2D2SA 2KXPB 1G8XA 4HE8A 3WAKA 3WAJA 1IJ5A 4JUYA 2M67A 2HH7A 2VASA 5HYAA 3D0TA 3AAEB 3OYXA 4BJNA 2DLRA 2PG8A 2V7KA 2ZM0A 2W61A 3K3NA 4ISTA 5L3DB 4G2AA 5FXVA 4EZ4A 1O3XA 2XUEA 2A2FX 4CXXA 1D1AA 5LYJE 5JREA 3ZC0A 4PFOA 3KDSE 4X1KE 3C4ZA 5FXZA 3CVRA 3UT5E 4EXTA 3PU3A 3CWZB 3SOLA 2X68A 4I4TE 2WMNA 3ZEFB 5M4YA 1D1BA 2JMHA 3FB2A 4HEAA 5CB4E 3VU7H 2XAFB 1FMVA 3AA7B 4FI5A 5J2UE 2EHOC 3C4WA 5CA0E 5DABA 5L3GB 3N2GE 4O4JE 2JRKA 2C5KT 4MLKA 4GK5E 3KVBA 4AI6A 5HXEA 2KZ7B 2E9XC 3N9PA 2KWIB 5JDHA 5LGUB 3EUHA 1LRZA 2UXNB 2ZLYA 5AFUL 1D0YA 3NZPA 1WRDA 4BJMA 3I9WA 1CUNA 3HKDE 2CCQA 3KV5A 3BQLA 3R6NA 4PK4A 4Z8XA 4OK0A 4P09A 4DNDA 3ZMSB 2DWGA 4DO0A 4U74A 3LK3B 1X79A 3L3PA 4GOUA 1HF8A 4NUVA 4TV9E 2KINB 2IC6A 1S94A 2WSSV 5LG4A 3PDYA 1S35A 1VOMA 2LE8A 4MALA 5LA6E 2K24A 3ZMVB 1B7TA 4YFSA 2CXDA 2NTYA 4CI2B 4YHJA 1MMNA 5LBMA 3ZMZB 3V5UA 1YD8G 2EHOD 3PURA 1MNEA 4QHOA 4CI3B 1D0ZA 2CEAA 3I0OA 2KNDA 2E9XD 1MMDA 3PUGA 4HTEA 4UEMA 3AAAB 3I0QA 3OBVE 4MFRA 2JMKA 4PJNA 2XTLA 3Q5WA 4GK0E 2X51A 4ASKA 4H9QC 4E7ZA 4P0AA 4AQFC 2QA7A 2D0UA 3LBXA 2EHOA 4WW0A 2XAHB 5FMNA 3RX6A 3U78A 3N2KE 4CI1B 2VKDA 3LG7A 3GMIA 3K3OA 2VKHA 5JRCA 4AKIA 4MBQA 3C64A 3RKOA 2W0GA 3E08A 2E8IA 3PUSA 4J2CA 1MIWA 2K9AA 5KMGP 5JDGA 3RPUA 4U72A 3NZQA 3BQIA 5FP3A 5F3JA 3CMLA 1WR6A 4WBNE 4UVAB 1E1HB 4H9RC 4OFZA 2LOSA 3EDVA 4WNKA 3PU8A 5LGNB 2LHNA 3FXDB 2CXFA 4ILUA 5FNVE 1IZNB 2K5BB 2ACXA 2CA5A 4OYJA 2X66A 3AB3B 2PJQA 3KFWX 2L8KA 2JPFA 5JQGE 3ZPOA 5JDLA 3C4XA 3ESLA 5E0OA 3ZJ2A 3ETVA 3N2OA 3ZLIA 4KUMB 1U4QA 3DJBA 5LNKA 4QWNB 3ANWA 2W00A 1QUUA 1NWMX 4AQFA 5LCYA 2IC9A 4UIGA 3RYCE 2LHRA 2ES0A 2DCFA 1U5PA 3RC3A 3VKHA 4OYKA 5JDFA 3HA4A 2ZM8A 5EK2A 1BR1A 5EK4A 2X9WA 1WYCA 4H9NC 1WYBA 4TV8E 4EYUA 2HPLA 1MMAA 5IHYA 3JC6C 4QX8B 2X9XA 3ZCIA 4CZZB 3KBUA 4IDZA 4C90A 4QX7B 5HWYA 3KV9A 4AXPA 3LJCA 4H63V 3Q5XA 4HFVA 4BAYB 3FBLA 3CQGB 4V1Av 2YINA 4KMCA 4TZ4C 2Q9QD 3IHRA 3N9LA 3L09A 3LFMA 2YU1A 1ZKEA 1HFAA 1D1CA 3S4UA 1G73A 2KLQA 3AAIA 2D0TA 2V7JA 2RP4A 3GWHA 3MJXA 2VL8A 4UF0B 5TAOA 2CM0A 3I9YA 2Y6XA 3IF8B 3C98B 1LVFA 2K48A 3CX7B 2Z6EA 1BR0A 2SPCA 3K8PC 2BVLA 3CKDA 3HKCE 2Q9QA 4HN9A 1HS7A 2EHOB 4OHFA 3AVRA 2V7IA 2LOPA 2NW7A 2E9XB 3JC6D 3O9XA 5JRCB 3CPZA 4M1PA 3VHLA 4YLHA 3RH3A 5J2TE 2V7LA 3BK9A 4PJJA 2H7OA 4IIJE 5FXXA 2XAGB 5A1LA 4I50E 5DJQC 3OJAA 4HKAA 3O1HA 1ZHCA 2ZM2A 3FBZA 4ADZA 1ZV4X 5JDQA 3ZN1B 2X0LB 2MOZA 3WI3A 2QGSA 5IYZE 5HXHA 3T8OA 3ZYLA 4ZI2C 3N9OA 5JDMA 3ONXA 2V26A 3MACA 5FY1A 2VKOA 4PJLA 3LK2B 3MA9A 2W63A 3RYIE 2XAJB 4ANJA 4X20E 3SRZA 3RRWA 3C50A 5ETWA 4O8SA 4JEUB 3ANWB 3UFEA 2L3LA 3UULA 3MK7C 2DWKA 4PK5A 5LXTE 3RYFE 2UXXB 2YEVC 1FEWA 4L9IA 3KV4A 2LSYA 2N2NA 2WBLA 2LEHA 1FMWA 3HL6A 2IW5B 3NRYA 4MHCA 1UX5A 3CX6B 4ZOLE 3MKDA 4E7SA 1OWAA 5LJMA 3KV6A 4UELA 4PNIA 2MYSA 4ZI2D 1MNDA 4TUYE 4C91A 4X1YE 4QXBB 5BMVE 2L9QA 4EYYR 2WWUA 2D5UA 2JQQA 3O1IA 3Q2MA 3B13A 4DBQA 4UXNB 5GONE 3ETUA 3CX8B 3RYHE 5EK3A 1SHZC 2X9HA 4K0UA 4XBFB 2X9YA 4I55E 1Y64B 3ZN0B 4ZS3A 4A56A 2Y48B 1SA0E 4F6RC 3N5LA 3Q9DA 2VWAA 5DQWA 4DBRA 5HXSA 2LSIA 1IJ6A 3CQXC 4ZI7E 2LM9A 5FYMA 2Q9QB 4FJOA 4AKLA 4IE4A 4NUUA 2Q9QC 3HI2A 4YJ3E 2VK9A 5HXCA 5KX5E 2NOXA 2RA1A 4IGUA 1BR4A 2KMFA 1KNZA 2CXLA 2LJLA 3P7IA 4P0BA 4O2AE 4AQGA 5JH7E 1UCUA 4PFPA 3MXZA 4XAXB 4DMVA 3ZJ1A 3PTRB 5LHGB 1HG2A 3AA1B 5DQVA 3MZKB 5CA1E 2W62A 2CMRA 1EZ3A 3QC9A 3EVYA 2ODVA 4O4HE 2CWYA 3H37A 3U3IA 3QUJA 4H63H 4QXHB 2NTXA 3AA0B 2JJ9A 2KWHA 1US7B 2CLYC 2MBGA 1MMGA 4H9OC 3ZCJA 4L5GA 4DVDA 1WLXA 4GYRA 1HCIA 2CWOA 3GN5A 3IBPA 1H7CA 1HX8A 1LVKA 4BA9A 3DP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRC B;  5JR9 B;  5JRC A;  3ZC1 A;  5JRE A;  5JR9 A;  3ZC0 A;  5JR9 C; 
#chains in the Genus database with same CATH topology
 1MIY A;  4ZXL A;  3LBX B;  2XM1 A;  4NXM T;  5H6R B;  2YK0 A;  1VRB A;  2C5J A;  3AEB A;  1YW0 A;  4GYS A;  3AEF A;  4JEH B;  3JAE A;  5HEH A;  3FZH B;  3PUX F;  3ZMU B;  2FBW A;  2FJE A;  5AQP B;  4LFC T;  3PUV F;  3N9N A;  3KVA A;  4B6X A;  5JR9 A;  4EIW A;  5AQU B;  4AIS A;  1HTJ F;  5L3F B;  3OKQ A;  4KHP T;  3C51 A;  2ZM6 T;  2XQY A;  5LHI B;  1V9D A;  2WDR A;  2XSB A;  5LP6 E;  4IE7 A;  1QSD A;  1FIO A;  1LKX A;  3H3A A;  2NWB A;  3EAB A;  1YKE B;  1W09 A;  1OED B;  5ADX L;  2E9X A;  4LFA T;  3PUQ A;  4ISS A;  4IHJ E;  2LKH A;  3NWI A;  3SWH A;  3RC8 A;  4AKR B;  4PK6 A;  2KT9 A;  4L0R A;  4B3S T;  3EHZ A;  5KXJ A;  2A9U A;  2DHR A;  2I59 A;  3AA6 B;  3N9Q A;  4UV9 B;  2N9D A;  3KIN B;  2CRB A;  1KK7 A;  2PBI A;  1T98 A;  4U2Z A;  2PTF A;  1IJ5 A;  2BBJ A;  4A5X A;  3AAE B;  2DLR A;  2PG8 A;  5L3D B;  5AQF B;  4WZX A;  2B76 A;  1W0B A;  5LYJ E;  2WY2 A;  2X68 A;  4HFC A;  1KEY A;  1R8I A;  3FB2 A;  4HEA A;  4FI5 A;  2EHO C;  3C4W A;  5C2T A;  3N2G E;  4MLK A;  3A7M A;  3KVB A;  4AI6 A;  3N9P A;  4LF6 T;  3EUH A;  5AFU L;  2BKO A;  2XQ4 A;  4BJM A;  2CCQ A;  3BQL A;  3AE6 A;  4DND A;  3AE1 A;  4U74 A;  3LK3 B;  3P4P A;  5J0Z A;  4NUV A;  2KIN B;  2WSS V;  1VOM A;  4MAL A;  2K24 A;  1B7T A;  1QLB A;  2CXD A;  2NTY A;  4CI2 B;  3V5U A;  2EHO D;  1MMD A;  4UEM A;  3AAA B;  1CHU A;  4PJN A;  2XTL A;  4E7Z A;  2X51 A;  4AQF C;  2QA7 A;  2D0U A;  4WW0 A;  3RHW A;  5JRC A;  4MBQ A;  2W0G A;  3E08 A;  2K9A A;  5KMG P;  3NZQ A;  5F3J A;  1E1H B;  3PU8 A;  5FNV E;  4HFB A;  2K5B B;  3KFW X;  2JPF A;  5AQL B;  3C4X A;  3LDQ B;  1W0A A;  3ZJ2 A;  1J5W A;  3ETV A;  2LKG A;  5AQG B;  4LF8 T;  4KUM B;  3DJB A;  2WZH A;  1NWM X;  2JIW A;  2IC9 A;  2DCF A;  3RC3 A;  4OYK A;  1BR1 A;  1WYC A;  3EAM A;  5IHY A;  3KBU A;  4C90 A;  1UGO A;  3SFE A;  2YDQ A;  4H63 V;  1UUS A;  3Q5X A;  4HFV A;  1JNR A;  2YIN A;  3L09 A;  4HWD A;  2D0T A;  2RP4 A;  3MJX A;  2VL8 A;  5TAO A;  2CM0 A;  2BVL A;  2XQ7 A;  2Q9Q A;  3AVR A;  4LF5 T;  3VHL A;  5J2T E;  1SE7 A;  3BK9 A;  4KX6 A;  4HWF A;  2XAG B;  3ZST A;  3O1H A;  5ABF B;  2ZM2 A;  4DV4 T;  5HXH A;  3T8O A;  5AQI B;  3ONX A;  2VKO A;  2JQ9 A;  3MA9 A;  3RYI E;  1XNQ T;  3AEG A;  3RRW A;  3C50 A;  4O8S A;  5IWA T;  4U31 A;  3UUL A;  2LSY A;  2IW5 B;  3NRY A;  3MKD A;  3KV6 A;  4PNI A;  2MYS A;  5CJ5 A;  4TUY E;  1J5E T;  4C91 A;  2WS3 A;  3AE2 A;  2L9Q A;  4EYY R;  2WWU A;  1ZOY A;  5AQH B;  5AQM B;  4K0U A;  3ZKR A;  3ZN0 B;  4A56 A;  1SA0 E;  3N5L A;  2FJD A;  1OED C;  2CHN A;  4DBR A;  5HXS A;  2UUA T;  2XQ9 A;  3X1D A;  4ZI7 E;  2LM9 A;  1KF6 A;  2UXB T;  4AKL A;  3PUZ F;  4NUU A;  4DR3 T;  3HI2 A;  2VK9 A;  2R6G F;  5C3J A;  3ONJ A;  4LF9 T;  1KNZ A;  2X0Y A;  3TLW A;  5JH7 E;  4JI1 T;  1XDP A;  3CIR A;  4XAX B;  2VQE T;  2QVA A;  3PTR B;  1XMO T;  1HG2 A;  5DQV A;  2W62 A;  2E5V A;  4O4H E;  3U3I A;  3QUJ A;  4QXH B;  2JJ9 A;  2KWH A;  3PJA A;  1YQ3 A;  1MMG A;  4L5G A;  2IML A;  2CWO A;  3IBP A;  1LVK A;  5HWY A;  4AIU A;  3ZYM A;  3TKL B;  4TWH A;  3AEC A;  4N78 D;  5EZY E;  2J1D G;  2NR4 A;  2UXC T;  2CBI A;  4HFE A;  3FZK B;  2LSJ A;  3IEE A;  1WFD A;  3FHN A;  3EI0 A;  4UVB B;  4EZH A;  2X67 A;  3KBT A;  4AKG A;  2MTQ A;  3B57 A;  3FXE B;  2AXD S;  3O1J A;  4QH5 A;  3EDU A;  4KP3 C;  2WAU A;  4PW8 A;  4KI0 F;  2BKN A;  2C5I T;  4QKN A;  5LB7 B;  2J62 A;  3P4S A;  1NEK A;  2IAK A;  3R84 B;  1Z0P A;  3F31 A;  2HPJ A;  3CQC B;  5LOV E;  4ZS2 A;  1T7S A;  3UU4 A;  3PJA J;  5J1G A;  5KDM C;  3M65 A;  2J47 A;  2A3D A;  4NPP A;  3A8Y C;  2PFV A;  5L3C B;  1NAF A;  3LK4 2;  4EOZ B;  2BS4 A;  1E2A A;  2XY8 B;  2GK9 A;  4YSZ A;  2BDE A;  3RRC A;  1VCT A;  2YDR A;  2WMO A;  3HR0 A;  2ACZ A;  4UVC B;  1AJ3 A;  3NVO A;  4U7I A;  2YU2 A;  3UTK A;  5JR9 B;  2LSK A;  2Y8D A;  2V6X A;  2A72 A;  3PE0 A;  3J7Y q;  5L3B B;  2V5C A;  5F5W A;  3AVS A;  4I43 B;  4AQY T;  3FZL B;  3NBX X;  2D2S A;  3ZT6 A;  2V6Y A;  4HE8 A;  2UXD T;  3WAJ A;  4LMK A;  3RI5 A;  3K3N A;  2XQ3 A;  4IST A;  4G2A A;  2BBH A;  1HNW T;  4EZ4 A;  1N33 T;  2XSA A;  1O3X A;  2A2F X;  4CXX A;  4YY3 T;  5JRE A;  5AQR B;  4EXT A;  3CVR A;  1T8B A;  2WQY A;  3SOL A;  1D1B A;  5HEG A;  3VU7 H;  1GQE A;  1Z8U A;  3AA7 B;  4JI4 T;  5CA0 E;  5L3G B;  5DAB A;  4O4J E;  5JDH A;  1XMQ T;  2ZLY A;  1WRD A;  1XWM A;  4Z8X A;  3ZMS B;  2DWG A;  2XZE A;  2FJA A;  4GOU A;  4LFB T;  1HF8 A;  4TV9 E;  4X64 T;  2IC6 A;  3ONL C;  1S35 A;  4Z91 A;  4YFS A;  3UU8 A;  4YHJ A;  5L4E A;  4DV7 T;  3ZMZ B;  3PUR A;  3I0O A;  3PUG A;  4HTE A;  3OBV E;  4MFR A;  2FUP A;  4P0A A;  4H9Q C;  2LRK A;  4IDN A;  3LBX A;  5FMN A;  2MAW A;  3N2K E;  2VKD A;  3K3O A;  4UR9 A;  2VKH A;  4AKI A;  3C64 A;  3ZT7 A;  2E8I A;  3PUS A;  4J2C A;  1MIW A;  5JDG A;  4U72 A;  2W2U A;  3VR8 A;  4UVA B;  2BS2 A;  2LOS A;  4ILC A;  4WNK A;  4JV5 T;  1IZN B;  2CA5 A;  2PJQ A;  2XQ8 A;  4X5T A;  5LG3 A;  5JDL A;  1IBL T;  3ESL A;  3ANW A;  3L39 A;  5LCY A;  2LHR A;  2ES0 A;  2XQ6 A;  3HA4 A;  1DU2 A;  1OED E;  1WYB A;  5HEJ A;  4CZZ B;  2AE9 A;  4IDZ A;  4QX7 B;  3VR9 A;  3KV9 A;  3H3M A;  3AE7 A;  4BAY B;  3IHR A;  3N9L A;  3LFM A;  1ZKE A;  1HFA A;  2H88 A;  4QH4 A;  1G73 A;  4UF0 B;  3C98 B;  1LVF A;  2Z6E A;  3AE9 A;  2V7I A;  4CN1 A;  5JRC B;  3CPZ A;  3VRB A;  4PJJ A;  4HKA A;  2WP9 A;  1ZHC A;  2WZI A;  3FBZ A;  1ZV4 X;  3ZN1 B;  3WI3 A;  5IYZ E;  3PV0 F;  3ZT5 A;  5HCM A;  3AEA A;  4JEU B;  4ZZC A;  4PK5 A;  2LLY A;  2V8S V;  2I0M A;  2YEV C;  1FEW A;  4X66 T;  2VL0 A;  2WBL A;  2LEH A;  1FMW A;  4EEB A;  1UX5 A;  2BG9 C;  4UEL A;  4DV0 T;  1MND A;  4QH1 A;  4QXB B;  1I94 T;  3O1I A;  3B13 A;  4DBQ A;  5GON E;  2WDQ A;  3RYH E;  2J4G A;  4XBF B;  4ZS3 A;  3VRA A;  5DQW A;  3AE5 A;  1M62 A;  3OVU A;  3AXJ A;  2Q9Q B;  4FJO A;  4YJ3 E;  2YOE A;  4IGU A;  4P0B A;  3QOF A;  1UCU A;  4F8H A;  4IDQ A;  2HHH T;  3QC9 A;  2ODV A;  2CHO A;  1Y01 A;  3SFD A;  4IT4 A;  3AA0 B;  4EED A;  4B3M T;  1US7 B;  2MBG A;  4DVD A;  4DV1 T;  2WU5 A;  2W4X A;  3GN5 A;  1H7C A;  4BA9 A;  4O2B E;  3E22 E;  4O4L E;  5ABE A;  4JI6 T;  5FVK A;  5LHH B;  3DTO A;  4ZI3 C;  2W67 A;  3UUX B;  1D0X A;  4JI8 T;  1UUR A;  5ABG A;  2ZMA A;  1MIV A;  4WBO A;  3V5S A;  3RKG A;  3PUA A;  5L2L A;  2DNX A;  4UV8 B;  2JQH A;  2UUB T;  3ZC1 A;  3O4X E;  4NXN T;  4O4I E;  2NW8 A;  2OLT A;  3RLF F;  4K0K T;  2VKJ A;  2CPT A;  4JLE A;  5LBQ B;  4YT0 A;  5LJN A;  4ZI3 D;  1UX4 A;  4G63 A;  1HNZ T;  3I1A A;  4IDP A;  3K3Q C;  2G0U A;  3Q5E A;  3PUY F;  4DR1 T;  5FY0 A;  3AE8 A;  2YKS A;  3UUN A;  4DV6 T;  5BR8 T;  4HGA A;  3W15 B;  4IDO A;  2DI4 A;  5HAX A;  5HWX A;  4KBM B;  5AQK B;  4EB6 E;  3GA8 A;  2XAQ B;  4H9S E;  4WYV A;  4X65 T;  1HG5 A;  2H7V C;  2XAS B;  1YKH B;  3ZMT B;  2VVS A;  2XHE B;  4DV2 T;  4GKK T;  5HXR A;  4DR6 T;  3HKB E;  4QXC B;  3SS1 A;  4YJ2 E;  5ABF A;  4JI0 T;  1N36 T;  3RQW A;  4EAH A;  5L47 A;  4YTP A;  2C0S A;  5FKY A;  2ODU A;  1BR2 A;  5C8Y E;  5HCJ A;  5AQV B;  1KNR A;  3NKZ A;  4IE5 A;  1ZP0 A;  1NEN A;  2VB6 A;  3N9M A;  3JAF A;  4IRE A;  2KXP B;  1G8X A;  1KFY A;  2XQ5 A;  5AQT B;  3WAK A;  2HH7 A;  2VAS A;  4B3R T;  5HYA A;  2V7K A;  2ZM0 A;  2KSR A;  4U3C A;  2XUE A;  2HN1 A;  4X1K E;  3KDS E;  5FXZ A;  3C4Z A;  3PU3 A;  3CWZ B;  4YTN A;  3ZEF B;  4COF A;  1FMV A;  2JQK A;  2C5K T;  2KWI B;  5AQS B;  3NZP A;  4IL9 A;  1CUN A;  1L0V A;  5FVL A;  1X79 A;  3PDY A;  2LE8 A;  5LA6 E;  3ZMV B;  2IIU A;  1MMN A;  5LBM A;  3FZF B;  1KNP A;  4U2Y A;  4QHO A;  2CEA A;  2I6H A;  1VCS A;  4JI7 T;  2XPK A;  2F4V T;  3RIF A;  2EHO A;  2XAH B;  2HN2 A;  4JYA T;  3LG7 A;  2RPA A;  2V6Y B;  3RPU A;  1YXR A;  4JI2 T;  5FP3 A;  1WR6 A;  4H9R C;  4OFZ A;  3EDV A;  5LGN B;  2LHN A;  4OYJ A;  3AB3 B;  2BG9 E;  2L8K A;  2M6I A;  3ZPO A;  2QYW A;  3N2O A;  3ZLI A;  3G06 A;  5LNK A;  4QWN B;  2W00 A;  4AQF A;  4UIG A;  3QB5 A;  3RYC E;  1U5P A;  4KHZ F;  5JDF A;  2ZM8 A;  5EK4 A;  1WR0 A;  2X9W A;  2BG9 A;  4TV8 E;  3JC6 C;  4QX8 B;  4YXD A;  4AXP A;  1I6Z A;  2LM2 A;  3RF1 A;  3FBL A;  2H89 A;  4DUY T;  4TZ4 C;  4CN6 A;  2Q9Q D;  4GKJ T;  1D1C A;  2KLQ A;  2E2A A;  2V7J A;  3IF8 B;  3CX7 B;  3HKC E;  4HN9 A;  1HS7 A;  4LF7 T;  4OHF A;  2LOP A;  2E9X B;  3JC6 D;  3O9X A;  3RH3 A;  2V7L A;  3LSV A;  4I50 E;  5DJQ C;  4Q25 A;  3OPC A;  2K3W A;  3ZYL A;  4TNV A;  3Q5D A;  3N9O A;  5JDM A;  3AED A;  2V26 A;  4PJL A;  1XDO A;  4HWC A;  4TWF A;  2W63 A;  4ANJ A;  4DUZ T;  3SRZ A;  4Z90 A;  3ANW B;  3UFE A;  3RYF E;  2UXX B;  3KV4 A;  2N2N A;  4A97 A;  4MHC A;  4ZOL E;  4E7S A;  5LJM A;  5L4H A;  1IBK T;  1YQ4 A;  5BMV E;  2D5U A;  2JQQ A;  1M7K A;  3Q2M A;  1XNR T;  4UXN B;  3ETU A;  2QRX A;  3CX8 B;  5EK3 A;  1SHZ C;  2X9Y A;  4I55 E;  1Y64 B;  2E5L T;  2Y48 B;  3Q9D A;  2VWA A;  2VVN A;  2LSI A;  3PUW F;  3T1H T;  1IJ6 A;  5HEO A;  2BS3 A;  5FYM A;  5KX5 E;  4U7Y A;  5HXC A;  3AE3 A;  4HFH A;  2NOX A;  1W9R A;  1BR4 A;  2KMF A;  1T72 A;  2LJL A;  4AQG A;  3M3Z B;  3RIU C;  4PFP A;  3MXZ A;  3ZJ1 A;  5CA1 E;  3MZK B;  2CMR A;  2BKP A;  3EVY A;  2VQF T;  2WB5 A;  4X62 T;  1HNX T;  2CWY A;  4TNW A;  3H37 A;  2NTX A;  4YSY A;  2FJB A;  3ZCJ A;  1WLX A;  1OED A;  4GYR A;  1HCI A;  4DV3 T;  4TX5 A;  3UFG A;  2DL1 A;  3OYZ A;  2OV9 A;  5L3E B;  3F2E A;  4DR7 T;  2BZB A;  3UQ4 A;  5FXW A;  4GIW A;  1N32 T;  4DR2 T;  3P8C D;  5AQQ B;  4XZC A;  4HFD A;  5JVD E;  2IDO B;  4HWI B;  4HWH A;  1X9B A;  3VKG A;  4H9P C;  1ZEE A;  2UU9 T;  2YN6 A;  1IAP A;  2WM9 A;  3HKE E;  5AQJ B;  1OXZ A;  2NP9 A;  3AXJ B;  4JI5 T;  1UK5 A;  4CQI A;  4ERR A;  2CE7 A;  3F57 A;  4CXW A;  2N1G A;  4DMW A;  4DR4 T;  2NW9 A;  3ZYK A;  2BVM A;  5LMU T;  4PAG A;  2OA5 A;  2B1E A;  4HFI A;  5LGT B;  4UF0 A;  4X1I E;  4ZHQ E;  3J9X 1;  4EV6 A;  3UUM A;  1FJG T;  4IE0 A;  4PJM A;  2W66 A;  3GN5 B;  3K1S A;  4EGW A;  1IBM T;  4TN7 B;  4DR5 T;  1J1J A;  3BQK A;  5JDN A;  4CN4 A;  3E0Z A;  4IE6 A;  3AEE A;  2LSG A;  2XQA A;  4JBW F;  3OTO T;  3UU5 A;  2V7M A;  4CXY A;  3QK6 A;  4LMJ A;  4AKH A;  2LT3 A;  5FY7 A;  2H3R A;  3NRX A;  2V1D B;  3A5X A;  5JR9 C;  2CLY B;  5F8P A;  2P9B A;  2WWV A;  5H6Q B;  5AQN B;  1WCR A;  4JUY A;  2M67 A;  1HR0 T;  3D0T A;  3OYX A;  3RQU A;  4BJN A;  4ILA A;  2W61 A;  5FXV A;  1D1A A;  3ZC0 A;  4PFO A;  3UT5 E;  2IHR 1;  3UU3 A;  4I4T E;  2WMN A;  4ZEY A;  2CBJ A;  5M4Y A;  2JMH A;  5CB4 E;  2XAF B;  5J2U E;  2JRK A;  4GK5 E;  5HXE A;  2KZ7 B;  2E9X C;  5LGU B;  4B3T T;  1LRZ A;  2UXN B;  1D0Y A;  3I9W A;  4I0U A;  3HKD E;  3UUB A;  3KV5 A;  3R6N A;  4PK4 A;  4OK0 A;  4P09 A;  4DO0 A;  3JAD A;  4YSX A;  5ABH A;  3L3P A;  4U33 A;  4LF4 T;  1S94 A;  5LG4 A;  2LRL A;  2D9D A;  1YD8 G;  4CI3 B;  1MNE A;  1D0Z A;  2KND A;  2E9X D;  3I0Q A;  2JMK A;  3Q5W A;  4GK0 E;  4ASK A;  2XJ7 A;  4ILB A;  3U78 A;  3RX6 A;  4CI1 B;  3GMI A;  3RKO A;  3QB5 K;  3BQI A;  3UU6 A;  3CML A;  3T1Y T;  4WBN E;  3P4Q A;  3FXD B;  2CXF A;  4ILU A;  4YTM A;  2ACX A;  3JCF A;  2X66 A;  3UQ7 A;  5JQG E;  1SUM B;  5E0O A;  3CK6 A;  4NIQ A;  2WCA A;  3P50 A;  3TLV A;  1N34 T;  1U4Q A;  1QUU A;  1HX1 B;  3VKH A;  5EK2 A;  4H9N C;  4EYU A;  2HPL A;  2IUB A;  1MMA A;  2X9X A;  3ZCI A;  2V5D A;  3AE4 A;  3LJC A;  3TLS A;  3CQG B;  4V1A v;  4KMC A;  3IA3 A;  2YU1 A;  3S4U A;  4P1N A;  3AAI A;  5LMN T;  3GWH A;  3I9Y A;  2Y6X A;  2K48 A;  4ZZB A;  1BR0 A;  2SPC A;  3K8P C;  3CKD A;  5CFB A;  2EHO B;  3ZSS A;  2NW7 A;  2UUC T;  4M1P A;  4DV5 T;  4YLH A;  2MPK A;  2H7O A;  4IIJ E;  3RIU A;  5HEU A;  5FXX A;  5A1L A;  3OJA A;  4ADZ A;  5JDQ A;  3QNU A;  2X0L B;  2MOZ A;  1E7P A;  4JI3 T;  2QGS A;  4ZI2 C;  5AQO B;  3MAC A;  5FY1 A;  3FZM B;  3LK2 B;  3P4R A;  2XAJ B;  3P4W A;  4X20 E;  5CGM A;  5ETW A;  2L3L A;  2YDS A;  3MK7 C;  2DWK A;  5LXT E;  4DID B;  4LML A;  4L9I A;  3RGL A;  3HL6 A;  2BG9 B;  3CX6 B;  1OWA A;  4ZI2 D;  4OX9 T;  5FL1 A;  4X1Y E;  4TWD A;  2X9H A;  2XM2 A;  4F6R C;  3B5M A;  3TLT A;  3CQX C;  2M6B A;  5JTG A;  4IE4 A;  2Q9Q C;  3L8R A;  2RA1 A;  3RIA A;  4YHH T;  4IL4 A;  2WDV A;  2CXL A;  3P7I A;  3ABV A;  1XZY A;  4O2A E;  4DMV A;  5LHG B;  3AA1 B;  2X0H A;  1EZ3 A;  4H63 H;  4A98 A;  2WU2 A;  5IUX A;  2CLY C;  3TLU A;  1JNZ A;  4H9O C;  2VUR A;  1HX8 A;  5FL0 A;  3DP7 A; 
#chains in the Genus database with same CATH homology
 1MIY A;  4TX5 A;  4O2B E;  3ZYM A;  3E22 E;  3TKL B;  4O4L E;  3LBX B;  4N78 D;  5EZY E;  3OYZ A;  5H6R B;  2YK0 A;  1VRB A;  5LHH B;  3DTO A;  4ZI3 C;  5L3E B;  2C5J A;  3F2E A;  3UUX B;  1D0X A;  2J1D G;  1YW0 A;  4GYS A;  2ZMA A;  4JEH B;  2BZB A;  5FXW A;  4GIW A;  1MIV A;  2LSJ A;  4WBO A;  3V5S A;  3IEE A;  3PUA A;  5L2L A;  2DNX A;  4UV8 B;  3P8C D;  3FHN A;  4UVB B;  3ZMU B;  4EZH A;  3ZC1 A;  2X67 A;  3KBT A;  3O4X E;  4XZC A;  3N9N A;  4O4I E;  5JVD E;  3KVA A;  4B6X A;  4AKG A;  2MTQ A;  2NW8 A;  5JR9 A;  3B57 A;  3VKG A;  4H9P C;  1ZEE A;  3FXE B;  3O1J A;  2VKJ A;  1IAP A;  4JLE A;  5LBQ B;  2WM9 A;  3HKE E;  3EDU A;  5LJN A;  1OXZ A;  4EIW A;  2NP9 A;  4KP3 C;  4CQI A;  4ZI3 D;  1UX4 A;  2WAU A;  1HTJ F;  4G63 A;  4PW8 A;  4ERR A;  5L3F B;  2CE7 A;  3I1A A;  3OKQ A;  3F57 A;  3K3Q C;  2G0U A;  3C51 A;  4CXW A;  2N1G A;  2XQY A;  2C5I T;  4DMW A;  5LHI B;  4QKN A;  1V9D A;  5FY0 A;  2NW9 A;  3ZYK A;  3UUN A;  2BVM A;  2IAK A;  4PAG A;  3R84 B;  4HGA A;  5LP6 E;  1Z0P A;  3F31 A;  2HPJ A;  4IE7 A;  2OA5 A;  3CQC B;  2B1E A;  3W15 B;  1QSD A;  2DI4 A;  1FIO A;  4UF0 A;  5HAX A;  5LGT B;  5HWX A;  4X1I E;  4ZHQ E;  5LOV E;  1LKX A;  4KBM B;  3H3A A;  3J9X 1;  3UUM A;  4EB6 E;  2NWB A;  4IE0 A;  3GA8 A;  4ZS2 A;  2XAQ B;  1YKE B;  4H9S E;  4PJM A;  5ADX L;  2E9X A;  1HG5 A;  2H7V C;  5J1G A;  2XAS B;  3GN5 B;  3PUQ A;  1YKH B;  3ZMT B;  2XHE B;  3M65 A;  5KDM C;  2A3D A;  4ISS A;  5HXR A;  4TN7 B;  2PFV A;  4IHJ E;  3HKB E;  4QXC B;  3SS1 A;  5L3C B;  3BQK A;  1NAF A;  5JDN A;  3LK4 2;  4EOZ B;  4YJ2 E;  3E0Z A;  4IE6 A;  3SWH A;  3RC8 A;  4AKR B;  4PK6 A;  2KT9 A;  4L0R A;  2LSG A;  2GK9 A;  2V7M A;  2BDE A;  3RRC A;  4CXY A;  3QK6 A;  4EAH A;  2WMO A;  2DHR A;  4AKH A;  2C0S A;  3HR0 A;  2I59 A;  2LT3 A;  5FY7 A;  2ODU A;  1BR2 A;  2H3R A;  5C8Y E;  4UVC B;  1AJ3 A;  3AA6 B;  3N9Q A;  3NRX A;  2YU2 A;  4UV9 B;  3UTK A;  2LSK A;  5JR9 B;  2V1D B;  2N9D A;  3A5X A;  5JR9 C;  2Y8D A;  2A72 A;  3PE0 A;  4IE5 A;  2CLY B;  5F8P A;  3J7Y q;  3KIN B;  2VB6 A;  5L3B B;  1KK7 A;  2P9B A;  2PBI A;  1T98 A;  3AVS A;  4I43 B;  3N9M A;  5H6Q B;  3NBX X;  2D2S A;  2KXP B;  1G8X A;  4HE8 A;  3WAK A;  3WAJ A;  1IJ5 A;  4JUY A;  2M67 A;  2HH7 A;  2VAS A;  5HYA A;  3D0T A;  3AAE B;  3OYX A;  4BJN A;  2DLR A;  2PG8 A;  2V7K A;  2ZM0 A;  2W61 A;  3K3N A;  4IST A;  5L3D B;  4G2A A;  5FXV A;  4EZ4 A;  1O3X A;  2XUE A;  2A2F X;  4CXX A;  1D1A A;  5LYJ E;  5JRE A;  3ZC0 A;  4PFO A;  3KDS E;  4X1K E;  3C4Z A;  5FXZ A;  3CVR A;  3UT5 E;  4EXT A;  3PU3 A;  3CWZ B;  3SOL A;  2X68 A;  4I4T E;  2WMN A;  3ZEF B;  5M4Y A;  1D1B A;  2JMH A;  3FB2 A;  4HEA A;  5CB4 E;  3VU7 H;  2XAF B;  1FMV A;  3AA7 B;  4FI5 A;  5J2U E;  2EHO C;  3C4W A;  5CA0 E;  5DAB A;  5L3G B;  3N2G E;  4O4J E;  2JRK A;  2C5K T;  4MLK A;  4GK5 E;  3KVB A;  4AI6 A;  5HXE A;  2KZ7 B;  2E9X C;  3N9P A;  2KWI B;  5JDH A;  5LGU B;  3EUH A;  1LRZ A;  2UXN B;  2ZLY A;  5AFU L;  1D0Y A;  3NZP A;  1WRD A;  4BJM A;  3I9W A;  1CUN A;  3HKD E;  2CCQ A;  3KV5 A;  3BQL A;  3R6N A;  4PK4 A;  4Z8X A;  4OK0 A;  4P09 A;  4DND A;  3ZMS B;  2DWG A;  4DO0 A;  4U74 A;  3LK3 B;  1X79 A;  3L3P A;  4GOU A;  1HF8 A;  4NUV A;  4TV9 E;  2KIN B;  2IC6 A;  1S94 A;  2WSS V;  5LG4 A;  3PDY A;  1S35 A;  1VOM A;  2LE8 A;  4MAL A;  5LA6 E;  2K24 A;  3ZMV B;  1B7T A;  4YFS A;  2CXD A;  2NTY A;  4CI2 B;  4YHJ A;  1MMN A;  5LBM A;  3ZMZ B;  3V5U A;  1YD8 G;  2EHO D;  3PUR A;  1MNE A;  4QHO A;  4CI3 B;  1D0Z A;  2CEA A;  3I0O A;  2KND A;  2E9X D;  1MMD A;  3PUG A;  4HTE A;  4UEM A;  3AAA B;  3I0Q A;  3OBV E;  4MFR A;  2JMK A;  4PJN A;  2XTL A;  3Q5W A;  4GK0 E;  2X51 A;  4ASK A;  4H9Q C;  4E7Z A;  4P0A A;  4AQF C;  2QA7 A;  2D0U A;  3LBX A;  2EHO A;  4WW0 A;  2XAH B;  5FMN A;  3RX6 A;  3U78 A;  3N2K E;  4CI1 B;  2VKD A;  3LG7 A;  3GMI A;  3K3O A;  2VKH A;  5JRC A;  4AKI A;  4MBQ A;  3C64 A;  3RKO A;  2W0G A;  3E08 A;  2E8I A;  3PUS A;  4J2C A;  1MIW A;  2K9A A;  5KMG P;  5JDG A;  3RPU A;  4U72 A;  3NZQ A;  3BQI A;  5FP3 A;  5F3J A;  3CML A;  1WR6 A;  4WBN E;  4UVA B;  1E1H B;  4H9R C;  4OFZ A;  2LOS A;  3EDV A;  4WNK A;  3PU8 A;  5LGN B;  2LHN A;  3FXD B;  2CXF A;  4ILU A;  5FNV E;  1IZN B;  2K5B B;  2ACX A;  2CA5 A;  4OYJ A;  2X66 A;  3AB3 B;  2PJQ A;  3KFW X;  2L8K A;  2JPF A;  5JQG E;  3ZPO A;  5JDL A;  3C4X A;  3ESL A;  5E0O A;  3ZJ2 A;  3ETV A;  3N2O A;  3ZLI A;  4KUM B;  1U4Q A;  3DJB A;  5LNK A;  4QWN B;  3ANW A;  2W00 A;  1QUU A;  1NWM X;  4AQF A;  5LCY A;  2IC9 A;  4UIG A;  3RYC E;  2LHR A;  2ES0 A;  2DCF A;  1U5P A;  3RC3 A;  3VKH A;  4OYK A;  5JDF A;  3HA4 A;  2ZM8 A;  5EK2 A;  1BR1 A;  5EK4 A;  2X9W A;  1WYC A;  4H9N C;  1WYB A;  4TV8 E;  4EYU A;  2HPL A;  1MMA A;  5IHY A;  3JC6 C;  4QX8 B;  2X9X A;  3ZCI A;  4CZZ B;  3KBU A;  4IDZ A;  4C90 A;  4QX7 B;  5HWY A;  3KV9 A;  4AXP A;  3LJC A;  4H63 V;  3Q5X A;  4HFV A;  4BAY B;  3FBL A;  3CQG B;  4V1A v;  2YIN A;  4KMC A;  4TZ4 C;  2Q9Q D;  3IHR A;  3N9L A;  3L09 A;  3LFM A;  2YU1 A;  1ZKE A;  1HFA A;  1D1C A;  3S4U A;  1G73 A;  2KLQ A;  3AAI A;  2D0T A;  2V7J A;  2RP4 A;  3GWH A;  3MJX A;  2VL8 A;  4UF0 B;  5TAO A;  2CM0 A;  3I9Y A;  2Y6X A;  3IF8 B;  3C98 B;  1LVF A;  2K48 A;  3CX7 B;  2Z6E A;  1BR0 A;  2SPC A;  3K8P C;  2BVL A;  3CKD A;  3HKC E;  2Q9Q A;  4HN9 A;  1HS7 A;  2EHO B;  4OHF A;  3AVR A;  2V7I A;  2LOP A;  2NW7 A;  2E9X B;  3JC6 D;  3O9X A;  5JRC B;  3CPZ A;  4M1P A;  3VHL A;  4YLH A;  3RH3 A;  5J2T E;  2V7L A;  3BK9 A;  4PJJ A;  2H7O A;  4IIJ E;  5FXX A;  2XAG B;  5A1L A;  4I50 E;  5DJQ C;  3OJA A;  4HKA A;  3O1H A;  1ZHC A;  2ZM2 A;  3FBZ A;  4ADZ A;  1ZV4 X;  5JDQ A;  3ZN1 B;  2X0L B;  2MOZ A;  3WI3 A;  2QGS A;  5IYZ E;  5HXH A;  3T8O A;  3ZYL A;  4ZI2 C;  3N9O A;  5JDM A;  3ONX A;  2V26 A;  3MAC A;  5FY1 A;  2VKO A;  4PJL A;  3LK2 B;  3MA9 A;  2W63 A;  3RYI E;  2XAJ B;  4ANJ A;  4X20 E;  3SRZ A;  3RRW A;  3C50 A;  5ETW A;  4O8S A;  4JEU B;  3ANW B;  3UFE A;  2L3L A;  3UUL A;  3MK7 C;  2DWK A;  4PK5 A;  5LXT E;  3RYF E;  2UXX B;  2YEV C;  1FEW A;  4L9I A;  3KV4 A;  2LSY A;  2N2N A;  2WBL A;  2LEH A;  1FMW A;  3HL6 A;  2IW5 B;  3NRY A;  4MHC A;  1UX5 A;  3CX6 B;  4ZOL E;  3MKD A;  4E7S A;  1OWA A;  5LJM A;  3KV6 A;  4UEL A;  4PNI A;  2MYS A;  4ZI2 D;  1MND A;  4TUY E;  4C91 A;  4X1Y E;  4QXB B;  5BMV E;  2L9Q A;  4EYY R;  2WWU A;  2D5U A;  2JQQ A;  3O1I A;  3Q2M A;  3B13 A;  4DBQ A;  4UXN B;  5GON E;  3ETU A;  3CX8 B;  3RYH E;  5EK3 A;  1SHZ C;  2X9H A;  4K0U A;  4XBF B;  2X9Y A;  4I55 E;  1Y64 B;  3ZN0 B;  4ZS3 A;  4A56 A;  2Y48 B;  1SA0 E;  4F6R C;  3N5L A;  3Q9D A;  2VWA A;  5DQW A;  4DBR A;  5HXS A;  2LSI A;  1IJ6 A;  3CQX C;  4ZI7 E;  2LM9 A;  5FYM A;  2Q9Q B;  4FJO A;  4AKL A;  4IE4 A;  4NUU A;  2Q9Q C;  3HI2 A;  4YJ3 E;  2VK9 A;  5HXC A;  5KX5 E;  2NOX A;  2RA1 A;  4IGU A;  1BR4 A;  2KMF A;  1KNZ A;  2CXL A;  2LJL A;  3P7I A;  4P0B A;  4O2A E;  4AQG A;  5JH7 E;  1UCU A;  4PFP A;  3MXZ A;  4XAX B;  4DMV A;  3ZJ1 A;  3PTR B;  5LHG B;  1HG2 A;  3AA1 B;  5DQV A;  3MZK B;  5CA1 E;  2W62 A;  2CMR A;  1EZ3 A;  3QC9 A;  3EVY A;  2ODV A;  4O4H E;  2CWY A;  3H37 A;  3U3I A;  3QUJ A;  4H63 H;  4QXH B;  2NTX A;  3AA0 B;  2JJ9 A;  2KWH A;  1US7 B;  2CLY C;  2MBG A;  1MMG A;  4H9O C;  3ZCJ A;  4L5G A;  4DVD A;  1WLX A;  4GYR A;  1HCI A;  2CWO A;  3GN5 A;  3IBP A;  1H7C A;  1HX8 A;  1LVK A;  4BA9 A;  3DP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...