5JSHA

The 3d structure of recombinant [nifese] hydrogenase from desulfovibrio vulgaris hildenborough in the oxidized state at 1.30 angstrom
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
283
Chain Sequence
GTLTGERPPVFWLQGQGCTGCSVTLLNSVHPSIADVLLKVISLEFHPTVMAWEGEHAIEHMRKVAEKFKGKFFLVIEGSVPVEADGKYCIIGEANHHEISMVDALKEFGPNAAAVLAVGTCAAYGGIPAAEGSETGATAVSKFLGDNGIKTPVVNIPGCPPHPDWIVGTVVLALDAIKKNGLEGGLAEVVKVLDSDGRPTPFFGRNIHENCPYLDKYDEGVMSATFTDKVGCRYDLGCKGPMTMADCFERKWNGGVNWCVQNAVCIGCVEPDFPDGKSPFYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The direct role of selenocysteine in [NiFeSe] hydrogenase maturation and catalysis.
pubmed doi rcsb
source organism Desulfovibrio vulgaris (strain hildenborough / atcc 29579 / ncimb 8303)
molecule tags Oxidoreductase
molecule keywords Periplasmic [NiFeSe] hydrogenase, small subunit
total genus 83
structure length 283
sequence length 283
ec nomenclature ec 1.12.7.2: Ferredoxin hydrogenase.
pdb deposition date 2016-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 5jshA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 5jshA02
3ZEAA 4KO3S 4UCQA 4GD3Q 4UCXA 4IUBS 3USCS 1UBMS 4URHA 5A4FS 4OMFG 4UE3S 4CI0B 4KN9S 1WUJS 3CUSA 3AYXB 1UBHS 5A4IS 1UBTS 4UPEA 3ZE7A 5JSHA 1WULS 1H2AS 2FRVA 4IUDS 4U9HS 4UE6A 4KO2S 4UEQA 5D51S 3ZE6A 4UQLA 1CC1S 1YRQA 2WPNA 1UBJS 1E3DA 3H3XA 5JSYA 3ZE8A 3AYZB 5JT1A 4KO1S 3RGWS 1FRFS 1UBLS 1UBKS 1WUIS 1YQ9A 3MYRA 3CURA 4IUCS 4UE2A 1WUHS 1WUKS 3UQYS 3ZE9A 3USES 5ADUS 5JRDS 1UBRS 4KO4S 5JSUA 4KL8S 4UCWA 1YQWA 1H2RS 4UD2A 1UBUS 5JSKA 4TTTS 4UQPA 4UEWA 4UD6A 4UPVA 4C3OB 5A4MS 4U9IS 1UBOS 1FRVA
chains in the Genus database with same CATH superfamily
1UFQA 1QORA 3HJFA 2C59A 3UB2A 1JKMA 3NPMA 4RX1A 4DQXA 1YWGO 3EC1A 5HOEA 3BXPA 4YAWA 5JAZA 2OKGA 2VH5R 2P8JA 3UXYA 4AJ2A 2GHRA 1DHRA 3DKIA 2I4TA 1E9EA 2I4IA 3DUFB 3LCJA 4QXAA 1N2BA 1U5CA 1YBAA 4Z0HO 3T9EA 1QK5A 2CDCA 5FBRB 3DL7A 4H6VA 1FTYA 1CP2A 2HNBA 2XRFA 3EIOA 3LHKA 2QTBA 4KQHA 2G1AA 4BFZA 2XVAA 3KAPA 1PYGA 1V9CA 3BB1A 3I37X 3OA0A 2R5WA 3AR3A 4P34A 4OI1A 3T54A 1DEKA 1G8MA 2ZYIA 3L40A 1OWMA 1PVDA 2EERA 4G5XA 4ND2A 3EMVA 4PX5A 4RHEA 2JLXA 2VNAA 3ZXXA 5KHAA 1TKCA 1V8FA 1OIVA 2BE9A 3THWB 4LNUA 5DLEA 1YKGA 2EX0A 4HEJA 2Q2QA 3UC5A 1WCXA 1Y3FE 2O0HA 4Y0NA 3ZDCA 1X13A 2X7HA 5EZYF 4O1IA 3X0DA 1CIJA 3U3DA 2GN9A 4ZYYA 2ZRAA 4O5AA 2V55B 1DAOA 2X0IA 1IZ8A 3IT2A 2W6CX 4I4LA 2YS7A 4JSTA 5KQLA 3HUUA 2ZRQA 3IUNA 2FWRA 1OLSB 2AEJA 3NC0C 4INPA 2Y6UA 3JALA 1DKQA 3WKCA 4DVJA 5EKSA 1XN4A 2QQ0A 2P2LA 3GJYA 1ZESA 3F1LA 5IULC 4N5NA 2P4HX 1A9XB 2O3TA 4B3SB 4K0KB 1X8LA 2YJGA 5HCUA 3VPCA 4EGFA 5HM6A 3K6SB 3GQBA 3KXPA 5AJWA 1A50B 1PVVA 1COZA 1H9AA 3E7DA 2Q4OA 2VPYA 3H9GA 1U8FO 2MYTA 4A1FA 1X3SA 1XTUA 3KTAB 1JJBA 2C9CA 1HOXA 1QV9A 3C7KA 5FT9A 4UMEA 4F6RB 2BUBA 3OZXA 4IH9A 2W6QA 4GQBA 2C58A 4CGYA 3F73A 2IGTA 3WIOA 3AINA 1Y3CE 4FBLA 4IAOA 3V4RA 1WVMA 2R4QA 1H2XA 4EG7A 2GF2A 2CFCA 2W2LD 5G1OA 4F3RA 3GLGE 3GFBA 3LQFA 3QF4B 4G09A 3L0IB 1THZA 1Q0UA 2OG1A 3AW9A 4AULA 4ZFNA 1ISHA 2PQ6A 3B6MA 3FFWA 3OF2A 1IAQA 2CXRA 2POCA 1FVHA 1W87A 3C6ZA 4O4LB 3WIDA 1MC5A 4YWHA 5HFNA 4AS2A 1L7EA 2W8ZA 5JZSA 1PEYA 2QN3A 5AJTA 4J90A 4EW3A 5IJZA 4PCLA 4JU9A 1NW9B 4D74A 2NSYA 3AVUA 1SULA 3WLNA 3DTVD 1FDUA 1Y3HA 1JSXA 2V7PA 4H4EA 4RTQA 7AT1A 1ZOLA 5HQTA 4X90A 2FFQA 3AR7A 3OCJA 1MTZA 3KQMA 4JLMA 4C88A 1K6EA 1KO7A 1WW3A 2E7ZA 1BW9B 1SBYA 3DWEX 5K4GA 1XD8A 4K26A 1YB4A 4G67A 3DOHA 3EHEA 3K8QA 1NMZA 3RHFA 2P1DA 1T8RA 3VR6H 3R3HA 4UDXX 1M8FA 1RHUA 2EKBA 5G4LA 1TZKA 3SJUA 2YHBA 5B2EA 1O2DA 2C97A 1GPJA 2REQB 2ZSFA 4KQXA 3ANSA 4NNPA 4ZRNA 3UJAA 4BE4A 2O7NA 1OU0A 2B5OA 2W42A 3JAWA 4BEVA 2JJ1A 3CB2A 3UB3A 1IEXA 1RADA 3TQOA 1BRTA 4NV3A 5FBKA 3MUOA 3E7FA 3G68A 2ZRDA 1V2GA 2DGDA 1EWYA 4G86A 4Z5XA 3TVDA 2A7XA 4I3FA 4ZV7A 4B46A 3BJRA 4U7HA 3S27A 3RYCA 4Y9TA 1I7NA 1R6BX 1QWOA 3S81A 5ECDA 5AKJA 3HCEA 4X6LA 5ITZB 5F98A 1UBKS 3VSEA 3EYWA 3WJ2A 1QHEA 4WK0B 3GJXC 4W7HA 4PGGA 4MWCA 1QCZA 5FOUA 4M0DA 3DVQX 3WIBA 3UOWA 1NVVR 4Q01A 4FMPA 5E3IA 2UXCB 1TZCA 1FDSA 2HA4A 3LUGA 4TSRA 3EZ7A 4BNGA 4DA4A 4JBHA 1MJFA 3R24A 4DKJA 1FY2A 2JJYA 5FYQA 4CNQA 3K6JA 4C14A 4CTMA 3LPCA 2UXDB 1WY5A 1FTGA 1Z5WA 1Z68A 2OGSA 1NI4A 3C5HA 1ZJ4A 3DDCA 3EUWA 1SQ0A 1J00A 5EJAA 3LZ6A 2INGX 2B3TA 1UPFA 2BFFB 2QL7A 3ESQA 3G2HA 4GOJA 2WA2A 3TMAA 1N5IA 3VDMA 2XB9A 4AKTA 4CLHA 2P30A 3O4VA 4K9KA 3C87A 3D0RA 4IMPA 2G7ZA 4IDDA 3CUYA 2R8YA 2FNAA 1C3OB 3L02A 2VG8A 2AVDA 3FWHA 3OOHA 3UMMA 2NYRA 4KUEA 1FFAA 5ESXA 4BUJA 4RIGA 5ADWA 4CKCB 4OB8A 1ACMA 5LM3A 1JA9A 3WRXC 3QX7A 1MBZA 4Y6RA 3II6X 1GCUA 2DJ5A 3MWEA 3H84A 3ZEAA 3DWIA 4EF5A 3OOEA 3MM4A 4L07A 4CG1A 1XF9A 4KR0A 4NBUA 4H1TA 2W58A 4F8JA 3IXQA 2BMWA 4LE2A 4JT2A 5AW7A 4FD2A 4IP0A 2UVPA 4CHTA 3E82A 5C7LO 2BGGA 3ADDA 2HSZA 1Q44A 2QAGB 2CEKA 3N28A 5LYYA 2Y1FA 1QCYA 4K87A 2W6MA 2Q0SA 3O8QA 4OXNA 4TS3A 3FNIA 5A5EA 9ABPA 5KO2A 1ZICA 1PSDA 5T3YA 4G23A 1EU1A 1NBAA 1YVEI 1UEIA 3DTVA 1TKBA 1U3GA 2BFDA 2Q1YA 3UA4A 2R1TB 1IY9A 4PYKA 1FZTA 1UBUS 3DSRA 1HE3A 2ANBA 2AR9A 4U2CA 2XMSA 2FEPA 3A4VA 3X3HA 5JZOA 3BVPA 3HA5A 5DI3A 2VRWA 4JNKA 2JIPA 5JPIA 1ISGA 1Y9EA 1ZAKA 2X2EA 2HHCA 3L0DA 1WY7A 2PL5A 3ACCA 1ZM3A 5TMBA 1GPLA 1RC8A 4IDOA 3UPDA 5IEJA 4QPJC 4WDQA 3CKYA 2N1BA 4XM2A 4YUWA 2YBDA 1HL7A 2J0EA 3F3KA 4DLYA 4FYHA 4LNHA 3HVJA 2A0YA 4HUQB 3ZY5A 1OASA 3EZ9A 4K6HA 5TVGA 4EG1A 2AQ8A 4HLUC 3R7BA 1JHXA 3UG7A 5A4DA 2QX9A 3NM6B 3QFTA 4B7XA 3MJDA 1WTCA 1CRQA 4FE3A 4RYLA 4DJAA 1XRRA 2J07A 2HBYA 1NXSA 4QVKA 3V5NA 4RVFA 4KKXB 2YXLA 2OFFA 2REOA 4OIMA 3UMSA 3HA2A 4FI3F 4CCSA 3G2OA 2YVAA 2EU8A 3E8MA 4QICA 1A2KC 2H85A 1V9LA 2GEDA 5BRJA 4W5OA 1FTWA 1KS9A 1K4YA 2PX2A 2VUSA 4QFDA 4XVHA 3U60B 4B5KA 3QLUA 2JLQA 2YVQA 5B6JA 3RDPA 1J99A 3INNA 4PO8A 3WYDA 2X13A 1PCXA 5HE8A 4HWSA 2XZDA 1JFTA 3ACBA 4DUPA 1LBIA 4FJ2A 5CLJA 1NFQA 5BSVA 3GDGA 1ZPDA 3V42A 4C2AA 4I3GA 4JFRA 1JHYA 1R8JA 1L7PA 2HJGA 4F2GA 1N33B 1XEFA 1D9XA 3PD7A 1IZZA 1PT9A 3COPA 2ZANA 3DO6A 1NHWA 3IAHA 2AFIA 4J0GA 3BORA 3B82A 4U8GA 4B74A 4BO9A 5HIJA 1YXMA 2H5IA 4NBNA 4YR7A 2IS6A 3WQBA 2KX7A 1E5XA 3QEJA 1ZONA 1WSDA 4IIEA 2ONYA 4E6PA 3BXGA 5LJLA 2ZSJA 4OBXA 3QVWA 3WWCA 1RCUA 2BISA 2V8OA 4WKBA 1UMBB 4TMWA 5J47A 1IU9A 4JDUA 3K2IA 4R6WA 5C8ZA 3BULA 1V26A 3I6YA 5EKUA 1DX9A 4QTZA 5EA2A 5J4HA 3NWEA 3IEVA 3GG2A 4NI5A 3PEEA 4FZJA 2Q8QA 2GBIA 3BEDA 3UOAB 5FAXA 3LP6A 3VKGA 2HNKA 2NQ8A 3GYBA 4BZXA 2XGOA 1ZUD1 4J6EA 1XT6A 2A9QA 3BKWA 4OBBA 1J56A 1PX0A 3PGMA 2CVZA 2WRZA 2C2GA 2FB9A 2E55A 2BIFA 3RW9A 3IP1A 1DUIA 1XAJA 1XEXA 5HTOA 4O02B 3OEHA 2C95A 3Q4GA 3RFFA 3CEJA 3H2ZA 2Y4OA 4MYTA 1EH5A 1E18A 3B3AA 3D31A 1CVLA 2VDWB 5DHAA 4DEVA 5L3QB 4JOCA 1D7OA 2CMKA 2QM0A 3AFHA 3DW1X 1QRAA 3JWEA 5J1TB 4E31A 2MDTA 4EZIA 3HWX1 5IHPA 3AUTA 1Y6QA 2O2EA 4G5FA 1W4CA 4BNHA 1JKJA 4LYYA 3MYYA 4LZWA 1GFSA 1AXEA 2HL6A 3IILA 3U17A 3ELWA 4DRXB 1NBOA 2M32A 5BOVA 1ESNA 2QQEA 4B17A 5LUAA 2BHNA 3VTAA 4NPAA 3UUGA 2HUNA 4IEFB 4MVJI 1FK8A 4K9PA 4MB0A 2OESA 3QBEA 3T1OA 1G4HA 2Q3BA 4ZO7A 3HB1A 3FHTA 4FXPA 3PTZA 1MAWA 2YOFA 2DTXA 2VDNB 3CRMA 2BGNA 4OG2A 4B0PA 4Y2PA 4BVAA 3LUKA 4X1YA 1L5HA 1DJLA 5HZGA 2H2HA 2PGOA 4TMXA 2IC5A 4XWAA 3EIFA 2X1VA 3PXAA 4C7MA 5L3VA 5JDIC 3EF0A 4DR3B 1M0WA 3IOMA 3K1ZA 4QUHA 4FOPA 3PQ2A 4EPXA 2IEZA 3EASA 3U4IA 1WEHA 3TLJA 3KQNA 1Z39A 2PQ0A 2OFOA 1E7SA 1WUKS 4LTMA 421PA 3BMCB 3EISA 2UDPA 2ZVJA 3LD9A 4MUAA 3FKJA 4B6PA 3NBYC 4K40A 1I3MA 2GMWA 3GD5A 2C1EA 2WG2A 4QYIB 2J3HA 3S55A 3GEBA 1MO3A 2OZEA 1DQYA 1PFVA 3D43A 1H1LB 3M6UA 4NPHA 3VDNB 1EWKA 1UIMA 5JEDA 1XLTA 3HBJA 2VDKB 3FBTA 4KN9S 2ZAGA 2PO5A 2PRKA 4PPGA 4KZPA 3SN6A 4MICA 5ALLA 1PFQA 2W2TA 4HK4A 3AGPA 2QG6A 1KI6A 3STTA 3ZWXA 1LJLA 4QXOA 4RMNA 1EE2A 3LLMA 3R0JA 1EAMA 4IL5A 4TSFA 2CXPA 1UOOA 1VL2A 2WOOA 4ARBA 1GM5A 1V7ZA 4G36A 4HQ0A 4DV6B 2HM7A 4ZYXA 1XV5A 2P4SA 4AJ9A 4MULA 2VP2A 5K2OA 1JR2A 3VR5A 1ZUNA 1C3LA 4PAOA 2IY9A 3LU1A 1QDEA 2AMJA 3EIWA 4PNEA 1RQLA 1XHLA 2VN8A 1RYZA 3F74A 2ZTSA 2VBGA 3F9RA 3R5FA 5FPHA 1IULA 2VPWA 3COSA 3V1KA 3FOAA 1E2DA 2OO7A 2XIJA 1GL6A 2ROQA 3S28A 2PKWA 4F2HA 2XDQB 1HY3A 4OSPA 2ZT7A 3HB0A 2IUUA 2P6UA 3UGQA 2QVXX 2XWQA 1HNWB 2DETA 2VKQA 2EKQA 4L5IA 4AX4A 5J2TA 3QOYA 2FPRA 3KQSA 4Z3KA 2HQ1A 3DFUA 3ZE0B 1DMSA 2VF8A 2W6NA 1R4MA 1IWPB 4ALMA 4GL4A 4C5AA 3FTDA 1L4NA 3G8DA 4KPGA 3UJCA 3TSYA 4LZOA 1ADFA 2F8SA 2WHPB 4J43A 1KDZA 2YV1A 3NCTA 1QG6A 3E9EA 1WU7A 4F9FA 2CK3A 3KM0A 1LRJA 4G41A 1YOVB 5A4AA 4KKVA 1WMSA 2QD5A 4HADA 3ZDEA 1ZIDA 2OYCA 3LY8A 3TWOA 4XZ3A 1RM3A 2GD2A 4BBZA 2IL1A 4Z4HA 5HIKA 4JBGA 1YA8A 2PR2A 2RGUA 2CXHA 2J7KA 3FYUB 3EPPA 4YQFA 4EYKA 1H4VB 1PVOA 5F9FA 5G02A 3M0EA 5DYYA 4EHJA 1E9DA 5AXAA 3AEKA 4Y9SA 1UQTA 3TBHA 4JQCA 5AH0A 3HZOA 3H5VA 1HKHA 4JITA 4F3KA 3AFNA 3LLCA 2HMYB 2D8MA 4U00A 7ADHA 1E92A 3Q11A 4RU1A 3N2NA 3JRXA 1IQRA 5HF6A 4YNBA 2WLSA 4M7PA 4C4YA 1QK3A 2YOGA 3KKQA 1LPNA 5CBPA 1U9ZA 3U7QB 3F8TA 2CY0A 3ZLJA 1DPGA 3FKQA 3UCXA 4EA7A 4Y2UA 4YAJA 3HU1A 5J5CA 3EPLA 4HEA1 4MVJM 4LPKA 1MH1A 4KWHA 3VAYA 4BKOA 1EIWA 5HR5A 5E9WA 2GHIA 4RY9A 1YAJA 4J29A 5DX8A 3QW4B 4CM4A 4IHAA 4P54A 2F1HA 1DRJA 4MINA 4FZVA 3U1VA 1V1MB 3TZHA 1B6TA 1E5VA 1YCFA 3IUPA 1VKZA 3LT1A 5EIEA 1R0XA 5I9TA 2YV3A 2QJRA 2NZYA 5C32A 4O2BA 1L8QA 4WZZA 5L9AA 1IG0A 4FUQA 1PJQA 4R3UC 1K7SN 1BOFA 2B8EA 1JJIA 1GKUB 2OZLB 2QLLA 2RI6A 2Q46A 2V3VA 1K8ZB 2YJTD 4NTZA 4DWOA 1FP2A 1GPH1 2O3UA 5D1HA 2GNPA 3PQCA 4G26A 3ROPA 5JWHA 3VRHA 1AXRA 4O63O 4Q82A 4A8JC 2Y1GA 4HH4A 4N3AA 4TX1A 4NBKA 4ER7A 4DE5A 4AY2A 1KVUA 4UM5A 1U1IA 4OGGA 3MGAA 1OWNA 3NHJA 3H9QA 1KVQA 3KE8A 4HFNA 4C30A 2UYGA 1PQWA 2P9FA 4RE6A 1SB8A 4JLAA 1JLLA 4R7ZA 2BKAA 4FR5A 2QPLA 5DM2A 3C8ZA 5FI5A 4AUNA 1R9GA 1T9ZA 5FBLB 1S02A 3D7NA 4YAKA 3ROKA 3RVMA 3MT7A 1LDGA 3QIAA 3C74A 4LDPA 1MRZA 1Y63A 1Z6PA 1IOLA 5H3HA 3RU9A 4F21A 3ONEA 1YVPA 2N1MA 3N53A 2E4AA 3O8QB 5ESDA 3TZLA 1NOIA 1OY1A 4G1MB 5F35A 2G0AA 2BSAA 2AFRA 3QMWA 5GOZA 4NULA 2ZZNA 2P5SA 1QHGA 2BTQA 2MINA 2CJPA 3JD0A 3FSRA 1QU3A 2NU8B 1RS0A 3CR7A 7MHTA 2HADA 3F6YA 4YJ2B 3G7SA 1R50A 5ADHA 2AIRA 2R60A 3ZVMA 4NFHA 4CKCA 2BI7A 4WINA 5T3UA 3GEEA 1UZMA 4LWPA 4TWJA 5B6PA 1C7IA 1RHQA 2F43B 4EVQA 1YFZA 1IUOA 1L3CA 2G8LA 2OO5C 1BN6A 3X1DA 2X8BA 5JAMA 3NC1C 1VJGA 2H9AA 3ILHA 4HAUA 4WXEA 2V7TA 2LGJA 1BXGB 2RHLA 2YZNA 1P2DA 2IDMA 3KVNA 2YIJA 2H1CA 4R1SA 1A4IA 2G06A 3FUCA 4RESA 2BRUC 4DIDA 2XBUA 4U6SA 1HDYA 1KOFA 1T8TA 4JYMA 3KB1A 4YP5A 2FSVC 4TTIA 1I1NA 1RJWA 3NIGB 3PWKA 4GRAA 4NPCA 2FFBA 2I65A 4WMLA 4X6UA 3GPIA 5L6LB 4C4PA 2PRIA 5C1BA 1RRCA 2BPOA 3HCWA 3VAZA 4JYPA 2A5LA 3D6NB 4L73A 4F86A 4RF5A 5MFZA 3K09C 2G9QA 3KBBA 3OPMA 1ZK2A 5AT1A 2DWPA 5FBQB 3S5UA 2H4WA 2QZ9A 4V3BA 1TFUA 1YCHA 2ATVA 5HIIA 3GRKA 4W5WA 2IP4A 3LDUA 1UBRS 3NYRA 4NBVA 2B30A 3HN6A 1BD3A 5ES3A 1ILWA 1AGNA 1XYYA 1G6HA 2QIPA 3F4LA 1OTHA 2EFGA 2MSCB 5DI3B 2H1VA 1EWRA 3I1FA 3PDWA 2NYVA 4TXLA 3GGJA 2VPZA 3DVSX 4N0DA 8LDHA 1VGQA 3RUIA 2C3PA 4H4DA 5CW2A 2V74B 5T6BA 3EC7A 1SKYB 3BL8A 4HQRA 5IM5A 1CX9B 2GZMA 4DDMA 3PA8A 1HURA 5JZMA 4KE9A 2I6UA 1Y89A 2D54A 2XAAA 3HCRA 5IDYA 4C6TB 2QN2A 1X19A 4WXRA 3WRYA 5KC9A 2XWSA 4YCJA 2PGNA 2QTCA 1RXVA 4F5WA 1N2CB 1UXHA 2QQFA 3A9CA 3QW2A 2QEQA 2WT4A 3KEMA 2NM0A 4IIJB 3C43A 3TEFA 2PGXA 3UENA 5C7IO 2FPIB 4Q47A 4I14A 4REOA 4QYIA 4MW4A 4LYDA 2A1TR 1OI3A 3RAJA 3IUSA 3CVWA 2XNSA 4UW9A 4YJHA 3WGOA 4EFLA 2ONZA 5KNCA 2ICAA 5FTWA 4KFUA 4PNPA 3DC7A 4GNKA 2EOAA 2WKQA 1CKEA 2DUNA 4BIIA 1NBMA 3UAYA 3R5JA 2QX6A 1U6KA 4RKEA 1XWFA 2CVQA 2GM5A 2Q1TA 4FOOA 2GAOA 5BQ5A 2JEOA 1SC4A 5C8YA 3WI7A 1F2UB 3RQSA 5AW2A 2UXBB 2JDID 5B7NA 2REXB 4M22A 1EK1A 2RC5A 1HG1A 3DZKA 1N4AA 2AYYA 4KMRA 5EKXA 2X5OA 3LQQA 3RVRA 1MCZA 4ND4A 2GX6A 2C42A 5EHXA 3W5CA 2CE2X 1R8QA 5GMOA 2FEMA 3FFXA 1AGYA 3IUBA 1JSCA 1P0PA 5LB2A 1E5QA 4Q7KA 4PG8A 3LNCA 4N0EA 2CHFA 2MMGA 1PJTA 3WKAA 2PL9A 2ZUDA 3JQ8A 1LRKA 4JSYA 3TW8A 4L5BA 3PDIA 1UBEA 3WLHA 1NONA 1YT5A 3DDUA 3Q9NA 1D5CA 2IH4A 1QAOA 2OQ2A 1A9XA 1XFAA 4GLJA 2FWNA 5CMLA 3KVYA 3GT7A 1BKYA 1DUVG 4IS2A 1PJZA 3QE3A 3GJ8A 4GSLA 3RYHB 1E2BA 2I9KA 1R0BA 4MW5A 4MW1A 2IHBA 2HQBA 2V0NA 5LDDC 3ZDDA 3VSDA 3TZQA 2PXCA 4OQXA 4R8SA 3OCXA 1PZHA 1U7ZA 3JSXA 4BAGA 4RADA 4EEXA 1FX1A 5IC6A 3MTDA 3FG9A 1ZW1A 1YR9A 2OECA 1MX3A 1Q57A 1Z0FA 2QZJA 3T1QA 4F4FA 4ZCQA 5HTKA 3JYNA 2FDCA 2J6CA 5ALPA 4MCHA 3D7SA 2FVYA 4X9XA 5EUBA 1VGRA 3DF9A 3K0AA 3FJ1A 3WWYA 1I0ZA 1V16A 2WVHA 1I7PA 4OYRA 4KDCA 4PYQA 3EDYA 4UCXA 2IYUA 2HV8A 3FJOA 5CFLA 1ZITA 3HNOA 3HACA 3NRBA 5IVIA 4QBIA 2GUWA 3JQQA 2X15A 3IP3A 2PANA 3E1GA 4MNTA 2HHHB 4EY5A 5B3LA 4A92A 3LLVA 2H1WA 3MGCA 4V0SA 1DOHA 2MSLA 2QT1A 3IP5A 3M82A 5DN6A 1B8VA 4BO2A 1XCOA 5E6UB 2CHGA 3RE1A 2WZCA 2JARA 1BX0A 1IVNA 3OOSA 1HRKA 1ZBQA 5PNTA 7REQB 3MMPA 3QLUC 4F5ZA 4LYEA 4WOCA 3RVJA 3WB1A 1H1TA 1ZC4A 5P21A 2PZJA 3DC2A 1M2JA 2IT1A 3WGVA 4AZSA 3KQLA 4C6HA 4KQ6A 4HSEA 3RSHA 1LW6E 1T2DA 4XFJA 2OBYA 2NXEA 2PD4A 4O29A 5JMPA 3B2QA 4BB9A 3L49A 4YVFA 1Q22A 1FMCA 1U7DA 4NH4A 4R8MA 4C06A 2XUQA 1Z5ZA 3CNLA 1MQSA 3GRZA 4FHCA 4GP7A 4BLQA 3NV9A 2G17A 2CL0X 2V7QA 1NNSA 3BXOA 4QSHA 3BMNA 1V8OA 4MWSA 1XTSA 1SBTA 2DWUA 5UKDA 5DCWA 2QF7A 3X1YA 1GL9B 4LXTA 4FLFA 1WU8A 2OXEA 1G21A 1JSZA 5J58A 2D2EA 4TVBA 2ASVA 3IPLA 2IU3A 4XD7D 2G0TA 3RVBA 4Q6WA 5A5DA 5FWXB 2QAIA 1K6IA 2EJWA 4YO8A 2HLHA 4CTOA 2Q41A 2OCXA 3G5UA 3OE7D 4RCVA 4QGHA 4BV9A 1CFZA 1P2VA 4HR7A 4INAA 4JLBA 4A8JB 3M9WA 3G8YA 5KAPA 1K86A 1UBGA 4TT3A 1ABFA 1S3SA 3FNHA 3P94A 1DC5A 3FR7A 3MJSA 4BP9A 2QORA 4OHBA 3SC3A 3M34A 4GOKA 3U9SA 1FC0A 1ADYA 4JMPA 3NVAA 2BFPA 2CSUA 4S05A 4DV1B 1RRGA 4WCFB 5J2TF 5BSUA 1WPGA 3V1UA 3C3BA 3VOSA 3WQSB 1P1JA 2JHAA 3RGWS 2XE8A 4ZQFA 4V1CA 3TUZC 1EXMA 2JIBA 3EF1A 4HB3A 4JEUA 5TNXA 5JECA 1ANKA 1T0UA 1YR3A 4YRMA 3SJZA 4PN7A 3ANYB 1YQUA 3HH8A 1KRHA 1KMMA 3I32A 4H7KA 3V7YA 2O8BA 4U0KA 1Z3CA 5HVNA 1CR1A 2IH5A 2GFQA 1TM5E 1QGDA 4EMSA 1G1AA 2JCVA 1ULBA 1Z37A 2AZDA 4R16A 5AHWA 4HG2A 2FPGB 1D0IA 2DFDA 3NR2A 4F9GA 2LPMA 3PZBA 4XOUA 1R4NB 4EHBA 2PA3A 3KXLA 3P9YA 4QFCA 3ZDRA 2QRMA 3LUPA 4O0MA 4ILKA 4E5KA 1NP6A 4PG5A 3R4VA 3TW6A 2E85A 3H9BA 3BSWA 2JRCA 3DXFA 4CF4A 1UK6A 2PZMA 2R9VA 3GI1A 1R5JA 2WAOA 1GD1O 5DHSA 5JCXA 2QW8A 3RAGA 3ZDXB 2P62A 3MCWA 5JE8A 5KHLB 3CTMA 1JEQA 3FNRA 3BFKA 2Y92A 1I14A 4G8JA 5CLHA 4KL8S 2HTEA 1ZL2A 2BSQA 4PF1A 2N47A 4HFJA 3U9TA 5A5FA 1O57A 1N8KA 3QVKA 3TQHA 4YMVA 7GPBA 4V1CI 5FAKA 5KB3A 2FI1A 3QKRA 4YQZA 3UB4A 1ECFA 5FWAA 1JRLA 3RS9A 3GELA 4HF7A 2Q5QA 1TCUA 1EFTA 3UYLA 3I2YX 3VR4A 4LDJA 3VI3B 3ETDA 4FW9A 2CFIA 3M81A 3SSNA 1AVTA 1R18A 4C89A 5C7YA 2OGTA 4FC7A 1F6BA 1QPGA 5EUCA 5BQOA 4B8ZA 2WTAA 2PWPA 2A94A 1MOSA 2IWRA 2E21A 1EFPB 1NJGA 1F6DA 4LI3X 4HGYA 2Y1XA 5DN6D 4Y2GA 3STWA 5GTDA 3AJDA 3BWEA 4N3NA 4JSRA 4P33A 3FYSA 4Y9RA 3RS3A 3HB9A 3LMKA 4BJ5A 1H6BA 3P26A 5JD3A 5GIPE 1YB7A 2A5YB 3WDSA 1RCTE 2DFTA 2XCOA 3DKKA 4M3NA 1NRWA 3U3JA 5I3CA 3D2LA 1YE5A 3AF1A 1V8PA 3AKEA 1U2TA 4LJYA 5ALRA 2JFZA 2XGGA 3CU5A 3TTSA 4F2PA 3LNTA 4HGQA 5LZ2A 3MJRA 3G59A 2AHRA 1YHZA 2VYND 2OVFA 4Q1FA 3FROA 3QSYA 3E61A 2WP8J 4X5OA 4MV3A 4E6EA 3BH7A 4OI2A 2QA5A 2OHXA 3VR6D 1NFFA 2ZYUX 1E58A 1RBYA 2R751 5AMXA 3WSWA 5CD1A 1RZRA 4ICIA 1RRVA 4QPDA 3OE1A 3K73O 1G20A 1G7CA 2A0UA 3QU9A 4FYVA 4JMLA 5BN4A 5GVRA 1YKFA 2PWAA 1VJDA 1WE2A 5EEHA 5EXTA 5F9MA 5H3CA 4YAGA 4DB2A 5D6NA 2EEZA 1CR2A 1GQSA 3R4CA 4KACA 3X1MA 2AFIB 4EPVA 3K4QA 3VPDA 4GLLA 2E4VA 5C1DA 1CUWA 1P39A 1BSVA 2PTHA 2H7YA 1R0LA 3CCFA 4HHEA 5BORA 1QYXA 1N6HA 2X3FA 3DT9A 5K6AA 4ABYA 5K3CA 2IS1A 1USWA 4KO8A 3UJBA 1Y33E 5DK6A 3T3HA 1KOGA 1B8OA 1SHTX 4E7OA 2FX5A 2ATEA 4I19A 3OFNA 1XZHA 4XCVA 2QTLA 3NHPA 1JR3D 3L1HA 1USIA 1KK1A 2IYNA 1NVEA 4CLRB 4B1FA 1OFUX 1I2AA 2H1HA 2IZ7A 1MNAA 1ULTA 2P77A 2VQ3A 4R9VA 5DLPA 4DMLA 2C9DA 1A7AA 3WZLA 2PFGA 2XD9A 4X20A 3ZYZA 5JJ5A 1EVEA 3A2KA 3NDBB 3VMFA 2ORYA 2VUHB 3BXFA 1YBFA 3KOZA 4IUBS 1G66A 1XVAA 2RGNC 3JD2A 3U16A 1KO8A 1CUYA 2ERYA 2OFXA 3EIHA 4A0RA 2O2HA 3SXPA 1BN7A 5JNRA 2ZT6A 3QXCA 2BM1A 4M54A 4KYVA 5ERYA 1GRCA 2VH2A 2I8AA 4QQ8A 1I6WA 4LHVA 4XEHA 1MABA 3EGEA 2EC5A 3NALA 4M36A 4MRNA 1RWMA 1YR1A 1AN0A 1RBMA 2VP0A 4LUCA 1T3GA 4LZLA 1TJYA 4X6XA 4BBAA 3KSBC 2PSFA 1XSEA 4RFSB 2OHHA 2QVLA 4V02A 2PSEA 3D7KA 3O90A 5CURA 4EECA 4LX8A 1HT0A 3A8TA 3DBLA 4M21A 3S2YA 5IJWA 1EP9A 1KSFX 3T5TA 2I3DA 1QIKA 1X8JA 3H6GA 5K3BA 2CBZA 1JPUA 4EA6A 4DZRA 5MF6A 4YI5A 3R7LA 1QLJA 5E1OA 5L4SA 1T4BA 1ZJ6A 5AK3A 3M70A 1I7SB 4HRVA 3NBFA 4Y18A 4OAQA 4YUVA 3I05A 4OGWA 4UFOA 5H5JA 1U9YA 3GLUA 4NZNA 1NUTA 5DMHA 1ZGBA 4P3XA 4G0UA 4EO7A 1MXFA 1L5HB 2G5TA 2C31A 2ZBPA 4FGSA 1SU6A 3B38A 5LDHA 5KSZA 5EZSA 1A71A 1XF1A 2XXBA 3FYHA 3NP7A 3OZUA 5L3ZA 1FOEB 3PR3A 2JFFA 1G9XA 2H3HA 3EEQA 3IE2A 1J39A 3ZIUA 2Z5LA 4Y2RA 2HHJA 4ESVA 1ES9A 1YL7A 3RYTC 5JXHA 1IUKA 3QA9A 4R4JA 4LGYA 2J9RA 2GN6A 3TMKA 5D85A 4B5LA 1PD0A 4KWTA 4PZCA 2I4OA 3B7PA 4UU1A 1PWEA 1SBIA 2IP1A 4C6TA 4IIBA 5C8YF 4JR1A 3O8OB 1EG7A 1YS1X 1JMYA 3I2HA 4QDUA 3BGDA 2GHTA 4KR7A 1QTQA 3WHIA 3EG9B 1KJWA 4NBWA 4UARA 1C30B 5EXPA 4B32A 2PT7A 4K86A 4B6GA 4DZTA 2FF5A 1TECE 2J67A 2XDWA 1TAQA 3MJ4A 1N0UA 1DCKA 1JFFB 1L4FA 2V4MA 5F4ZA 4D3FA 4Z1MD 1O97D 5GJBA 2HLNA 4H7IA 4Y2JA 3QPWA 2V7GA 4BQRA 4EHKA 1NV8A 5EZQA 1RKXA 5JNTA 2E5LB 2FPLA 1Z22A 1JFRA 1KFBB 1CUEA 2WUVA 2J4CA 5DU2A 2FPXA 1MV8A 3LFTA 1QJ4A 1FSSA 2VOJA 3Q40A 5JXIA 4Q4JB 5LJIA 3CNEA 3RUPA 4V0LA 3UWPA 3DBRB 5F1KA 3OIYA 1ZMBA 1TYZA 1PNTA 2Y2VA 3QUSA 3GB9A 1XMQB 4R51A 4D0GA 1TMGE 1ZA2A 2IY8A 4UU0A 3LUJA 1I2CA 5A0FA 4RF3A 5DPMA 1TMOA 3IV9A 2UVPB 4WLEA 3BD9A 5SZIA 1WJGA 2IU0A 3RYIA 4UXIA 1J0XO 2IPAB 2NQTA 3RVDA 7MDHA 4Z3OA 3ZWOA 4GZ6A 3LGAA 4L57A 1OKKD 1N5KA 2CL7X 4MGHA 2CHVA 3GVCA 4J3NA 1D2NA 5DWDA 1DU4A 4S1VA 3DGFC 1N6LA 4GXTA 1K5PA 2CC2A 1Z13A 3P4UA 4CF5A 4YCNA 1G16A 1IXRC 2ETXA 1IYZA 4KPUB 2HU5A 2SKDA 2Z58A 2G07A 4HJXA 2MJLA 1QGED 2OHJA 2RAUA 2VDPB 2RAPA 3GPLA 2VT3A 2O8DB 3WR5A 4Y2HA 2Q2NA 4E2WA 5U4QA 4MJ3A 4UM9B 3CGGA 1CPYA 2WA1A 3ASYA 4L9RA 1DKLA 4V24A 3FTCA 1IWBB 4G9GA 4I1SA 4HUTA 1LV8A 4ENWA 1X7WB 2GAAA 3K20A 4HGOA 4Z9FA 3VO2A 4RPGA 4YK7A 3UMFA 3ZNQA 4NU5A 3TF5A 3R6LA 4IIDA 3MA0A 4B6OA 3T5CA 4MVJA 4N76A 4PM4A 4CG2A 3L8HA 6ABPA 2YXNA 2VIIA 1N1EA 2ATXA 3FUUA 5IH7A 4RTPA 2HRZA 4ECAA 4N65A 2FMKA 2QWXA 1WVGA 3ILSA 4IXMA 4Q1VA 5CX1B 4MWDA 5G40A 1YE8A 3A6ZA 5A06A 1LF0A 5CM8B 3LGXA 2RBEA 4PWYA 2A1IA 3ZDQA 4QGSA 2C7GA 1FRQA 1NVWQ 3ESZA 4PO1A 3H5IA 1CUVA 3ROFA 1AJEA 3I73A 5I7UA 1JHAA 5DT9A 5ADUS 2BGRA 4NV0A 3JX9A 3DJFA 5J5VA 2EKDA 4X66B 1IZ9A 4MAFA 2QBYB 3OTQA 1KZHA 4WZAE 2FEXA 2PZKA 4Q19A 1USUA 2IDJA 1W6RA 2XNDD 4JI3B 3GAAA 1ZU5A 1CEQA 3QLVA 3TTUA 2MYNA 1WZEA 2Q5EA 4Q4LA 1Y7LA 4RHTA 3SE0A 3IBGA 4B45A 5ARBA 1TUEA 2IBMA 1YZUA 5BYBA 4IIUA 4EFNA 1KFKB 3QKTA 5B1IA 3CW8X 2JLZA 2VOEA 3SFZA 1EJ0A 1ISIA 1YQ9A 4IHJB 3HNPA 4X20B 1ORIA 4U1RA 3MRXA 1CY2A 3LKVA 2Q9BA 3MGGA 2O0LA 3L0ZA 16PKA 3D9QX 3EGDA 3NEYA 2X6RA 5HIMA 1T3TA 1SPXA 3I6BA 3K9CA 3IDQA 4OFZA 4PGMA 1Y9JA 3ECSA 4PQEA 4ZN6A 3VX3A 5I9SA 1IM2A 1GZ3A 4IQ8A 5J1SB 2OCGA 5CITA 3QVOA 3FNEA 1MB4A 1SKBA 2GPBA 3PKIA 1BWRA 1ZUHA 3GLKA 1ZK1A 4F4UA 3B3FA 2R48A 3ZQJA 4E08A 1LFDB 1P62B 1XVVA 5AW0A 4P36A 1GUAA 1L9KA 3UK7A 4XARA 1RNLA 1Q1NA 3AKCA 3QU4A 1ID8A 1ML3A 2BOVA 3DCYA 4IIVA 3AY6A 3TAHA 3K35A 2WF6A 1WDTA 3NLLA 3U1TA 5KYWA 2D6FA 3DVLA 2I99A 3TLXA 2GRUA 3RJ9A 1XWIA 1P17A 5JFTA 4NFYA 5B1DA 3WL3A 4TT8A 4KB5A 4FE7A 1W73A 1U8TA 3GAFA 2MR5A 1VBKA 2AJLI 2EJUA 3RD5A 1SBHA 5TPZD 1KKLA 1RRMA 2QJTA 2UYHA 4F3TA 5E7JA 5EE9A 4CQLA 4D26A 2YNMC 2PIDA 1T1EA 4HDRB 3EA4A 4IKPA 2E2WA 4O4HA 1L1RA 2OXRA 3QX3A 4MXDA 3CF2A 4KFTA 5LWQA 3O1LA 4LWQA 4NSNA 3TGLA 4OQPA 4YJKA 1HK7A 1AA6A 5B3JA 3EOAI 4CGZA 4BWGA 1E3LA 3K0FA 1Y1SA 3F6RA 5EJ8A 2I2WA 3DBLB 4GHWA 4DM7A 3OE5A 1K88A 2J3DA 2CFSA 4EY6A 4W1RA 4ACBA 5B3JC 4CMBA 2NIPA 2J0UA 4CNBA 4EJSC 5JYEA 3U61B 3Q3GE 4N0QA 1MO4A 1SVOA 3AM4A 2IUFA 5LZ9A 1WOMA 5AESA 4CMEC 3O83A 5T8KC 2IV7A 1EM8B 5MGNA 2OMKA 4N8EA 3AWIA 3WP1B 2FSPA 5JS8A 4INOA 2JIMA 1JL3A 2WSLA 3G0BA 4H27A 4TL8A 3V48A 4EW1A 3C8DA 4K3VA 3V4VB 1PV2A 2UUPA 1T9GR 1PKEA 2IXEA 2FPKA 1KXJA 2ZFUA 2ZKLA 2EBHX 2WSIA 4IGEA 4URZR 3ZS9A 4C0LA 5CDTA 4MWTA 2Y77A 1D5WA 1T34A 1TKAA 2V6IA 2QIOA 4KV9A 3T95A 5MN4A 3PL1A 1IG3A 4DIOA 1RI3A 3DLPX 2IU4A 2VHZA 5KX5B 3CX8A 1YZYA 1RP1A 3QI7A 3E0XA 4I50F 5KSPA 3RS2A 3AGQA 1Q0QA 1MEEA 2VJOA 4EDHA 4WECA 1B41A 1KO5A 2XMDA 4GX0A 1Q95A 5CNIA 2K87A 1KK2A 1DFIA 2VNSA 4EITA 3OAAA 2IOFA 3ACDA 1RZRD 1Q7BA 2JZOA 4G4SP 5A3JA 1P4AA 2HK6A 4HGZA 4Q7EA 2QV0A 4KK3A 3USZA 221PA 1C9JA 1KY2A 5B2FA 4RE5A 4BE9A 1PZXA 1SD5A 1Y1TA 3HUFA 4GI2A 4D9HA 1TJ4A 1W96A 1QH8A 2R7KA 5DMXA 1RYBA 3FIUA 3IUJA 4JYAB 3OFVA 1GNSA 3QI2A 2OGUA 4E4YA 5JRJA 3MWEB 4GLOA 2IHYA 3G23A 3P0FA 5JXGA 2DECA 2EQAA 2O7VA 2D3WA 1F4LA 1DTWA 1GL7A 1HQDA 5FEMA 5HK8A 5C81A 4ZEOA 3I6ZA 3LIIA 4TLBA 4DA9A 2Q6IA 1P3DA 4IEIA 1O6FA 1JXMA 5CHYA 3C8HA 3M5PA 1FUUA 2XLBA 3ESRA 3NETA 3AUYA 3KX2A 4HPXB 5DVZA 5FJJA 4BBJA 3W6NA 5HJ7A 1MW8X 4W7IA 5KVCA 3B36A 2B83A 4PZDA 3UW3A 3PE3A 4HB4A 1P1BA 4G1UC 1H2AS 1LU9A 1G9SA 2ZUWA 1OGJA 4FMDB 5IH3A 1IEQA 3UVEA 5HP4A 4EB6A 2RHTA 4F8EA 1LBEA 2QD2A 2YWHA 5M5BA 1NBHA 5CJ2A 3BRSA 3FB4A 2FZWA 1A4RA 1A2OA 4MQUA 2DKFA 2FEAA 4K28A 4W7SA 1XRQA 3T5MA 2XRZA 4F2DA 2C4TA 3O6VA 5DCYA 3DP9A 2OVBA 1RMTA 3LP5A 4PSKA 4DXAA 4DCGA 2LNDA 3I2JA 4LDQA 1P6QA 3S99A 1WKVA 1H6AA 2ZIXB 3DAOA 4JVSB 4O4IF 5FWYA 2DEUA 2ZRFA 2X9LA 3B13B 5GIOE 2GA9A 2NVWA 4HGPA 5JTUA 2X4LA 1MX5A 3OIDA 5EJ9A 2X0FA 5F3RA 2FPMA 4TKVB 4J94A 1NQVA 5KSWB 2PZGA 4YY3B 4YRNA 1UPUA 2FW8A 5FULA 2AOUA 2XOEA 3KRTA 4OLJA 4B82A 4C21A 3AR6A 1HTBA 1DARA 2RGDA 4KBFA 1YD7A 1K89A 3QU2A 5T67A 1D2HA 1TU4A 4IGKA 4ZQEA 5AW4A 4HMQA 5FHQA 2FY8A 2NUAA 4XM1A 2C5EA 1SBQA 3NS7A 5KDLA 1Z7WA 2ZR8A 4M8NE 5TEWA 3OD5A 1XCLA 3PSHA 4C3OB 4RD0A 5C18A 2E1RA 3SX4A 1VBMA 2P11A 2R84A 3P9QA 3OY2A 4MROA 3C6MA 1E6LA 4DSTA 1KZGB 1Q3HA 1XD2B 3AOGA 3QLEA 4JD5A 1EA7A 2YUIA 4RW0A 4X1KB 5K5EA 4JGBA 1I3KA 1BW9A 1M76A 1P0IA 1Z36A 1NLMA 2QRGA 2ZRKA 4YC7A 4CODB 4DBVO 2EKPA 1GRQA 5JAHA 3FLAA 2EGGA 4YP7A 2QP3A 4JP8A 2VJKA 1VHWA 3HV0A 4V38A 1A5ZA 5LQKA 4AI6A 3RS7A 4DANA 2VTBB 4RGQA 5K8VA 3JRNA 4I5GA 1L5GB 3UO8B 3DYVA 2J0SA 5ALSA 3M2TA 2WHRA 3EGWA 3QVGA 3U3ZA 3VGPA 3FZNA 1WMBA 3FLEA 2GSDA 3RVLA 3KOXA 1JSLA 1KZ4A 4KG7A 1Z2EA 3IQHX 4Y6GB 1N9GB 4IIYA 4DREA 2TMGA 1X1RA 5GONF 3RYIB 1D4FA 1T2FA 2YRWA 5TMDA 4BX3A 1Z6YA 2OV1A 2ZRNA 1M2FA 2XWPA 3INYA 1YC5A 3MNFA 1FVOA 4MCJA 1UEXC 2JHGA 1UXJA 4TKZA 3JYQA 1N1DA 3OTIA 2XQJA 2NSDA 1XL0A 4EUSA 4QQRA 4UTVA 1O0CA 3OU6A 1P8JA 4Q3CA 2HCFA 2XDQA 1G19A 2FZKA 1NW7A 2GPWA 5JAQA 4EABA 3MTBA 4XDHA 3KBOA 5AJZA 4QJ3A 5AM2A 1ZOPA 4AMBA 3MEQA 2AXNA 4TMTA 3R7WB 4DXHA 4U5QA 2RHRA 4YECA 4LWOA 2YHUA 3U3RA 1JF8A 1E7MA 1ZK3A 4RZ3A 5F7JA 1MD9A 4IDFA 3U6KA 3AUSA 4MWZA 4WNAB 2C92A 2VJPA 4CPDA 1XI2A 2QVCA 1PEKE 3KR0A 2HU8A 4GS5A 3W5VA 4IDBA 4W99A 4LSWA 1GV0A 4KGVA 4TTJA 4LMPA 3L8DA 3BIXA 4RTSA 3JVIA 3QJYA 5T4FA 4JWKA 5TLSA 4BKQA 4J3FA 2CKMA 1TQ2A 1UT8A 3LRPA 3OTHA 4HRAA 5DYNA 2V65A 4BNJA 2JKZA 1ABBA 5IKMA 5IT0A 5BPHA 4KP7A 2VLBA 4YXWA 1O87A 4WZAB 5IJXA 4E1VA 1IIRA 2ONJA 1ZWKA 3RHSA 3BD6A 1CBUA 2D8AA 1QKKA 1C50A 1P7ZA 4L4UA 3RARA 3EQ8A 4EA8A 1RI2A 5JLJA 3ZJVA 2C98A 2JKYA 2F1JA 4O2AF 1GZ6A 4OFXA 4OPMA 3T35A 2O3RA 4JUCA 3FZQA 1N77A 1ZH8A 2GERA 1UKCA 3WRWA 4MYHA 1TQ8A 2C4VA 1YDGA 2HBQA 4CIWA 5C5CA 4NZYA 3BTOA 4ND1A 2VNKA 3AERB 2BM0A 5ALMA 1P3Y1 3AI7A 4CTJA 1HDOA 3IT1A 3WX0A 2OOKA 3ZOKA 2ZCVA 3WIVA 3KO8A 1EK2A 3AEZA 4RJKA 2EFHB 4UTZA 3L0PA 4BNTA 4B73A 2WZQA 3NIDB 4V0KA 3M6XA 1NF3A 4LVUA 2I4LA 4B0OA 3I83A 1L7NA 1DOAA 1QQAA 5HFAA 2ADMA 2YN0A 3HY3A 4S2UA 1EWTA 3TRFA 3L46A 3B78A 3D4OA 3NGLA 2R6DA 2G72A 1L5LA 2VKTA 1TXGA 1IHOA 5TE9A 2EKZA 4YHHB 4NEQA 5TC4A 2OHFA 3UT5B 3K15A 1AMNA 1KI6B 5IN4A 2WD8A 3UW1A 2NP6A 3SQNA 5KBYA 5HE9A 3ZHZA 1UOEA 2FKNA 2AG5A 4P32A 4HQ6A 2ZEJA 2WTMA 1RQ2A 1RW4A 4IGIA 3BA1A 3N74A 1YJQA 3R8FA 4DDKA 4JI1B 3K70D 4XJVA 5DWQA 1VG9B 5IJ0A 1L7OA 2GN1A 2HT6A 1BE0A 2XJ9A 4X85A 1GPNA 3ZTWA 3OHSX 5I47A 1T8UA 2V96A 3GQBB 3K0BA 2X86A 4LDNA 2XF2A 3T5BA 1Z6XA 2QI9F 4W6ZA 1YZLA 3HBLA 2O8EA 1NYLA 1QE0A 4GX1A 2DZDA 3MJEA 4HOYA 2W6JA 5DLYA 4F4DA 1KRXA 1F1JA 2ZB3A 3CLSD 4HX2A 2GB4A 4CEHA 5FP0A 4BJ3A 1RMQA 2ZRIA 1TW2A 4TL7A 1EUCB 5JWOA 1IQUA 1J97A 4N5LA 4ZCSA 1P9WA 2H4ZA 3LUAA 2AYZA 2O2SA 3MWFA 4PTLA 2VF5X 1MJNA 2I34A 2HU7A 1BYIA 3WFIA 4DCMA 3RUFA 1W1WA 3TCKA 4DCOA 3PGLA 3TM5A 5CH8A 1W9HA 4BX8A 2W93A 4MKGA 4FOLA 4I4TB 1D8TA 2B2CA 5CA0B 2RHCA 3GPDG 4F06A 1LI4A 4ODIA 3CT6A 3CXRA 3QYJA 4UXHA 4QUDA 4MKHA 4ZA2A 3C1TA 4Z4CA 2CLDX 2W71A 4UD6A 1ULSA 1IOVA 3V1YA 5F3WB 1H0KA 1N6NA 3NU1A 1T5LA 5J3JA 1E60A 4OOEA 1CUUA 4S35A 4RA6A 3EWSA 4JQSA 3ZV6A 1YI0A 2J4FA 4PBTA 1RYHA 2QYTA 2P4UA 3HDJA 2AJDA 3OO0A 3DE6X 3O73A 2JASA 3I0MA 1FXUA 1KO1A 3DMHA 3FPFA 3LHSA 3OFND 4PLCA 4ZV4A 4IWNA 4IDAA 3A2NA 4IDNA 2EG9A 4EATA 4ER0A 5KU7A 4Z4EA 1C1DA 5AUQA 1EM8A 1RQGA 4RVNA 3I6MA 3V7UA 4FS3A 3VH1A 1JXAA 1I4WA 4DNQA 3TG2A 2FJUA 5CNKA 2PX4A 4ISCA 1WXDA 5CU7A 1CUAA 1B73A 1QHHA 1EX6A 4DIEA 4Q4AB 5HF9A 2JA1A 2R97A 2V8BA 5AVUA 3Q9UA 1Z0UA 2JRLA 3GPCA 3V8RA 4AFNA 4X00A 3D7RA 3N76A 1NWHA 4FOTA 4XLZA 4B71A 3F2VA 4WI1A 1E2JA 4N9QA 4FHFA 3C3DA 4UATA 4YCLA 1MH9A 3RUHA 4AP9A 1ZCJA 2DWQA 1TJNA 3R3UA 2GAJA 3QPUA 5AKHA 1X38A 4BBPA 4QU8A 5E0OA 4IG4A 1Q3TA 2J9YB 2Y93A 2AN5A 1UAGA 2CZCA 5E95A 1E4EB 1N2XA 2B36A 4TT3D 4XX0B 3ON5A 2BZGA 5KQRA 2KW5A 1YFJA 4FGUA 4O2BB 5H81A 2O3SA 5FX2A 2NUTA 1MC8A 4YJ2F 4DNFA 1J06A 1X15A 4U7FA 3ZU6A 1JAYA 2QLJA 1RXEA 4NCAA 4RKYA 3IQIX 1FLNA 3DE5X 3QH4A 4IG9A 3T5AA 1EJBA 4RAQA 3U44B 3IDZA 1MPTA 2RFLA 2D2FA 4OKNA 5BO5A 1NM5A 2XTZA 3K2BA 3BCSA 4Z7QB 4NP6A 3H83A 1FNBA 1T36A 5CVDA 2YVUA 2BCGY 3P9NA 3UFXA 3ZZ1A 3HKDA 2Z98A 4CL0A 1EVLA 2PUGA 4GI5A 1BQ3A 4R3WA 2OUKA 4FYMA 4G65A 3SBXA 3D3WB 3CF6R 3NTVA 2G5CA 1Q5PA 1ITZA 4MPJA 1PL0A 1FA9A 5REQB 1F2UA 2IYRA 1FFBA 2UVQA 4Q9HA 1T5IA 1BH2A 1KJQA 3TKAA 2BJVA 3ICCA 3MGBA 4KREA 2JI6A 3IAM1 1O97C 1JMVA 4PC6A 4IF4A 4QO7A 2H1OA 4B6SA 3DOIA 1GEGA 3WHKA 1FLAA 4UBMA 5T41A 4MW6A 1JFFA 1QE3A 1S7CA 1O6CA 1AMOA 1EFVA 5JAUA 3A3PA 3H99A 1C29B 4IVRA 2NO5A 4Z2AA 3W8DA 3T0GA 2WFLB 3O92A 4LV8B 4YFVA 4DAOA 4GI1A 4XGRA 4IDCA 1C1HA 3HDVA 3PNOA 1ONSA 4EOGA 1ABEA 1EQUA 2GZDA 3E18A 4QOFA 4FHGA 4DJJA 5HNKA 2BH2A 5CIWA 3SP1A 5IC4A 4C7KA 4GQIA 5JCJD 3O1IC 1BVHA 2AQIA 1N6OA 1NBWB 2WIKA 3BSYA 2ODPA 3QHAA 1DTWB 3AOEC 2FN4A 2CJYA 1RIFA 2RAVA 2HK8A 1O54A 3SU8A 4CL3A 4GGOA 3FHOA 1GGFA 3OG9A 4J0CA 2VA9A 3WYNA 1J2RA 2A9FA 1EFAA 1YJCA 5ESRA 3AIOA 4KDFA 5E6RB 1CCWA 3C3KA 5IAEA 3LSYA 1T9HA 3LPLA 3H7IA 5EJGA 1F17A 5AUNB 3FVTA 1SFRA 2CUTA 4TTPA 3PR1A 5CP8A 4CLOB 3AVWA 4W8HA 4WCDA 3L8CA 5SYNA 2EHDA 5BSKA 4QJBA 2CLSA 2IUSA 4ZDJA 2ODBA 4LF8B 4M1WA 4DLRA 2QN8A 3LC7O 1C3VA 3ZKWA 4L0CA 4BNDA 1FPMA 1TJPB 2IYVA 3B3GA 4Q9KA 4AUKA 4D79A 2IHVA 3R3WA 2H1IA 1AK9A 1CZKA 3A1FA 2NAPA 4AJPA 4B6QA 2HLDD 2JGFA 2PGJA 5CGZA 5CVVA 4AJKA 2PX5A 3IELA 5H4HA 3IIJA 1CE8B 4D4IA 4MR8B 3BMQB 3FPAA 4J16A 1YL5A 3AL3A 3VH4A 2AV6A 1NJFA 1FDWA 1XLUA 1NJ1A 1ZSVA 1CUSA 3LC1O 4I2VA 1I4EB 3B9RA 5A2QA 1KZ6A 4PEVA 3L4SO 4QO8A 4XWTA 2TECE 1RPAA 1Z2NX 1A9SA 5ALVA 4S0XA 5MFPA 5D1NA 3P2YA 2RIRA 3C1UA 2O6HA 3QV1A 3WNZA 3A9RA 1QP7A 1AB6A 1GR0A 2YY6A 4KPFC 2PD3A 5ICMA 2O2JA 4EY4A 4LJ9A 3GGOA 1VCOA 3RRNA 1XBTA 4C01A 1BFUA 1XEAA 4WOPA 2OCBA 2JAOA 1LVGA 3ODGA 2PZ8A 2KBEA 4I4TF 4M83A 4WXYB 1OLXB 2YASA 4YRLA 1O95C 2ZVDA 3R23A 4LJ7A 4TLEA 4F84A 3QUAA 3PZRA 2H3EA 2IBTA 2XE4A 3OLCX 2M2IA 2Q4RA 13PKA 4BGVA 3PPIA 4TMFA 3OC0A 1RRPA 1BCRA 2V7QD 3IOBA 1M72A 4MIOA 1BC5A 4D9MA 2FZVA 2HY7A 3NT5A 4CVNA 5KNBD 2ZAIA 2AW5A 3H0KA 3ONFA 1P18A 1YNOA 3FM9A 2YMPA 4YO7A 1PZFA 3OT5A 4XDGA 5HZMA 1M8PA 3GR6A 4R98A 3DZCA 3OQ1A 4WKCA 4DIFA 3LY7A 4ZZ1A 5HEKA 2AFHB 2ZGVA 2W2QA 4CKWB 1HA3A 1KMCA 1VLVA 1Z9BA 2HXGA 2OCLA 4J9VA 1YULA 1Y3AA 1G5PA 3UF0A 4U2FA 4DCUA 4DMRA 3HEMA 3Q3VA 5AUPB 1T35A 3GCDA 3TIXB 4ZJYA 3OCYA 5E3HA 1Y4AE 4GR5A 2X77A 3EPHA 3DE0X 2X5NA 1IM5A 3U4CA 4B3MB 1SD1A 2XZPA 1RAEA 3WNQA 4F96A 3GVPA 4OX9Y 3Q2KA 5BN5B 3ZG6A 1LBSA 4K88A 4Q21A 2Y1DA 4AIIA 3ZR4B 2O07A 3UTCA 1PNQA 3NBQA 4MS4A 4ZO8A 1NLUA 2PGAA 3NBZC 2X0RA 3SDZA 4CF3A 1P0MA 1QG0A 2RGWA 4NCKA 5G1PA 4YJ2A 1R4AA 1JKJB 2AVNA 3AHGA 1U2GA 4PZAA 3GLRA 4OA8A 2Q2WA 2GVDC 3GH1A 1LA2A 4JY7A 1H5NA 4Q1AA 4JJAA 5TQ2B 5IK2D 3WMXA 2ZETA 4QT4A 4YIHA 1RXCA 5IM4F 3U1BA 3HKCB 1WW8A 4G56A 5EYPA 1K7YA 3QEAZ 2JGEA 4QU9A 1HC7A 3K3PA 4TWRA 3RWBA 2WTUA 4TLCA 4Z9AA 3O3CA 1JEQB 1VFPA 2G76A 2DT5A 4GH5A 3FOBA 1MORA 3LWBA 4Q9AA 3BEOA 1EUDB 1LSOA 3QF4A 1DDGA 1N5RA 1R15A 4MIKA 5AUOB 3B1KA 1EDOA 4K9NA 3H86A 5AI9A 2GZRA 5E2AA 1E79D 1LX7A 2YFQA 3TR0A 2AG8A 2X6QA 3GIDA 1JFVA 3P0IA 4E5UA 3HU5A 3FTNA 1UKAA 3EMBA 2WYOA 1FMFA 2XUOA 4B2YA 4FCCA 4C43A 5JQGA 2HIGA 2KHZA 3TOSA 4NE9A 4PLYA 4WZAA 3U44A 1ZD1A 1IVYA 1G8JA 2BI4A 4AC9A 4EHNA 4QYWA 4RMHA 3RRBA 4P81A 1EFDN 3QTLA 1I6MA 4U8HA 3VO9A 1GSHA 1VIDA 3PX2A 5AVZA 2BFCA 4WD3A 1G7RA 2PKQP 2Q1UA 1VE6A 2ZJ7A 1Y9AA 1II8A 1CFJA 2ZRGA 4NNJA 5DH9A 1CYEA 2J0UB 3C4VA 4C07A 3MXTA 1N6IA 4GX5A 1QOPB 3LWNA 3WLAA 4Q12A 1TOAA 2HX1A 2JEZA 3PQ3A 1GR1A 1N6KA 3OPYB 4LHSA 1V11A 1F4VA 5JCOA 5KU1A 1VRWA 1GFIA 1Q83A 1IMJA 1FNMA 3VPFA 4F3YA 1I2MA 4PQRA 5J59A 1N3BA 5FRDA 1ATZA 4YASA 2V6FA 4AKGA 2NNLD 3PDUA 1J8FA 3KFLA 2VPIA 3JWIA 5TX7A 5E3JA 3IL2A 1JHVA 2FZGA 3R7SA 1IY0A 1W44A 2NSJA 4R1LA 1JN0A 4WESB 4XIJA 3ROZA 3REFA 2AR7A 1KH2A 1UP6A 2DBZA 5BN4B 4CN9A 4EP1A 5AW9A 3NTXA 1DX4A 1TT5B 5LQNA 3FOEC 1BMDA 1ESEA 2Z2XA 1TX4B 3OM9A 4CT4B 2ORWA 3GXBA 2ETVA 3ICVA 3QXSA 1UINA 3DVAB 4WUVA 3KTAA 2YX1A 1QO7A 2AG1A 2WPDD 3S44A 3ULKA 1IHYA 1UPXA 3BFPA 1KVTA 2AJCA 1Q20A 2ATCA 4AMGA 4GMHA 3LC0A 3ZD8A 4JI8B 3BGIA 4KAFA 4GC9A 5KNCD 1OAOC 1XTZA 2WHPA 5GAJA 1PL6A 3GJSA 3AFMA 2O6LA 3RHZA 3OJFA 3L1UA 5C37A 4XYMA 4BMCA 1L4KA 1ODLA 1VMIA 1TUGA 1X7WA 1OLSA 4MWBA 5CGQB 1Y1QA 2CYCA 2R1TA 4HLUA 2F3RA 3BTUA 4ZC8A 3RS8A 3VNBA 3GLIA 1SCDA 1NE7A 1OXUA 3KD2A 4P92A 2CJWB 1ORTA 2RG7A 3BE5A 5IFKA 3AM3A 8MHTA 2RHBA 3QOXA 1MO2A 2C9ZA 1GVHA 1UZNA 2ZB2A 3GUHA 3LBFA 1QMPA 3NUQA 4UNNA 2XODA 4B3GA 3KJXA 3NTUA 1C8BA 2VDRB 4MWGA 5FUBA 1AKVA 3ENKA 2R44A 5LCXA 3MHPA 4ALNA 1Z0AA 1SURA 1V3QE 3UMBA 1ZAYA 4WL0A 2ZXEA 1A04A 2NZXA 1FQKA 2X5KO 3S8EA 2PLFA 3VR4D 3O4FA 2FVXA 1RTTA 4BMDA 1U4SA 1W0JA 2IXAA 3A3YA 4UTRA 8GPBA 3PWSA 2XA1A 3LXUX 2IHKA 5LZ7A 2GBLC 2Z4RA 4F6LA 1EDDA 1KKUA 2BFBA 1WCIA 2BE7A 1JHDA 4GGPA 5DGXA 1VIYA 3RLIA 3RR2A 3W8RA 2QBYA 4RM3A 5D87A 2Z1DA 4BJHB 2BEWB 4JEHA 5FR2A 3BD7A 3MJCA 4N6GA 3VKHA 1H4TA 2ZJFA 3NRCA 1MJGA 2OV6A 5GJWC 4MHOA 5FV4A 3VU8A 2E18A 4OU5A 1U0FA 1QVRA 3LBIA 4ND7A 2WYWA 3AEQB 2YFHA 1UKBA 3IPCA 1KVSA 5AM5A 3UY4A 5INTA 3KJFA 2YMQA 3PFCA 1M34A 1A9QA 1SWVA 4FSHA 4LS3A 5F3DA 4EB0A 3EXIB 1L5RA 3LY5A 2PGDA 2GN2A 2UZ1A 2P5TB 1CY6A 1OT5A 5F7OA 5K0NA 1V3TA 1K6JA 1WB6A 2XUZA 1NRXA 3QBDA 3TZCA 1XZMA 1X0VA 3PXDA 4P5PA 2K2QB 1N8NA 2EEPA 1NVMB 2Q5IA 4CLEA 3E03A 3OPYI 4NBSA 1U1FA 2VT2A 4HFRA 2IWHA 1OI4A 1CDZA 3MSXA 4D8XA 3AQ4A 3GGPA 3IEIA 2R8BA 2Q3LA 3EHDA 4PGAA 4RH0A 3U09A 1SM4A 2IYLD 1EUQA 1DWOA 4B3JA 1BDHA 3CZ5A 4EUFA 1U65A 5BSTA 2J7PD 5KNLA 2C0PA 1ST2A 2P68A 1P31A 4XGNA 4MP3A 4KQIA 2ZB8A 4WACA 4PHFA 2VWGA 4BLWA 2C61A 3JCZA 3O8OA 1GO2A 3KB6A 3MS7A 4MVXA 4B4DA 4MVJD 2BFFA 1IQPA 1UXGA 2WJ3A 2L19A 1NW5A 1YJAA 2F3SA 1U11A 4MS4B 4P31A 1YA6A 4V0NA 1VPTA 9ATCA 2Y9MB 2J3MA 2JCYA 2EZTA 3ML1A 2WU8A 4JXXA 2QJOA 4ID3A 4AF7A 3WGQA 5JARA 1T10A 2OFPA 1T6ZA 2DG2A 3LBAA 3QYPA 4K6MA 4D56A 2J31A 4D5GA 1CY7A 1X80A 1Q0RA 4UZEA 5ALZA 1BKDR 3FWKA 1E5TA 3AZPA 1SR8A 3QU7A 1TAUA 3QF7A 1UM9B 4C6SA 1S8OA 1ZGCA 2ZATA 1MF7A 3QPBA 3E05A 3ZVRA 5LLDA 4AJ4A 4TLAA 2V7WA 2QN1A 5PGMA 2NV2B 2I5PO 5LOVF 1GVNB 3DEHA 5JOQA 3R6DA 3M9XA 1QYRA 2I91A 5CNMA 2R68A 1M34E 2YC2C 3V34A 2YHSA 1DCFA 3OJCA 3FKSA 4LXIA 4C0WA 4GRDA 1HMPA 1JQ3A 2O7QA 2W0MA 1R12A 3ELBA 3F0TA 3HABA 4YRRA 4YREA 4GPEA 4DLLA 5BRAA 5IJ9B 5KEIA 2YIDA 4FK8A 1Q2XA 1UXOA 2AN3A 2J87A 4ITVA 4MI9A 1YC2A 2CMHA 4GKBA 5DULA 3SZ3A 1XP8A 1NYTA 2AWOA 4QULA 3K31A 4NONA 1FBNA 1I9CA 3GFTA 3Q7IA 4W5RA 3N8NA 1IHXA 2HF7A 1YRAA 2IJGX 1RYDA 2Q6OA 3KT6A 1NFRA 4UC0A 3UTDA 4QOHA 1IJKA 3A6FA 3EQ2A 2GFHA 3MLBA 5GM2A 2HO4A 2QVZX 3B3QA 3GCXA 4D8UA 5JSZA 1U0TA 1D7AA 1X94A 2G83A 5CX4A 3LX5A 1YRWA 5AM1A 5IZ4A 1MHPA 1FQOA 1I2ZA 5CVEA 3GLHB 3ZW7A 2VP9A 3SI7A 821PA 4GFDA 3L1VA 1PHRA 1YASA 3FBGA 2Q9AA 4CEIB 2LTAA 4ZT4A 3KNZA 1GNPA 4B40A 3CH7A 4IVPA 2QXUA 2BTOA 1WQ3A 5CB0A 5JADA 1WUYA 3BE8A 1XL1A 5CT4A 1Z18A 5DTEA 1PUIA 3I1IA 3N2KA 3JTEA 4ZHQF 1PJAA 1PBNA 2VBFA 1U7WA 3ESAA 3LQRA 4MQLA 5ICGA 2VQDA 3WFZA 3T7KA 4JI6B 1H2BA 1Z45A 4BIMA 5K0FA 4CV3A 3PC3A 5DGCA 3O3NB 2C78A 3OOYA 5A7FA 3KZXA 4JLOA 3OU2A 2WWTA 5E0KB 1F8GA 1TLTA 3EVDA 3DXXA 1LY1A 2VYCA 1BHSA 1NDHA 1Z6AA 2QSJA 3CG4A 1G2QA 3IMFA 1FUIA 4IYRA 4NS1A 4Y2XA 1KEEA 1TUBA 2FR1A 2O8FA 1X39A 5BMVB 1WD5A 1WP9A 4BNNA 4ZTUB 3LYHA 3UKJA 4JA0A 4DV4B 1ZX1A 3LH5A 5B2ZA 2J1LA 1T43A 4P5EA 1NQUA 5LQCA 3WL8A 3K8YA 2J3JA 5ALWA 3T12A 1GXSA 4TYNA 2I2DA 2QRNA 3PQEA 4KIFA 1FTSA 2JVIA 1AUXA 1G3IA 3L05A 3O82A 1N5JA 4RS3A 1Z17A 4YRPA 4DLUA 4OHUA 1SHLA 4RYDA 5G0TA 4DG9A 2BYTA 2RGXA 1WDLA 2V9ZA 2IX9A 3BAZA 3PQ8A 1V7CA 2VDVE 3HB4X 2CJWA 2R6GA 4RFLA 2NVUB 4E1AA 5JNLA 2A4KA 4F1JA 4CDGA 3SVZA 1JHQA 1RLUA 2GM3A 3CLSC 3ZV4A 1UXKA 3AUJB 4B4OA 5K8TA 2Q5JA 3HV2A 5I4BA 5AVVA 2H2GA 3E81A 4YCBA 1NXPA 1AK2A 1Q7GA 3CPSA 2AH5A 2ID8A 4E5YA 1EPUA 3NKLA 4P93A 1NBEA 3HKCA 4DC9A 1JS1X 2EJCA 3IDSA 4RVCA 4CR6A 5K0EA 1IZYA 1KL7A 2Q2VA 2VF2A 2XTMA 2XTJA 1FF9A 3T7TA 2BFEB 4BB5A 2J8ZA 5L4LA 2QN9A 2GETA 2BUAA 5FOVA 2EWVA 1V1JA 3KDSE 3KR1A 4II7A 4MVJP 1NUAA 4UVGA 5G0VA 4URVR 5B3KA 4G63A 3AL2A 4KDEA 3IHKA 4R83A 3W6OA 3PJRA 1LWNA 4DV0B 4ND5A 3WGIA 3WK6A 2GZ1A 1W47A 1ZOSA 2V58A 3ZGNA 3EPKA 5L4NA 1TEZA 4GL2A 2D5AA 2QMUA 3ADPA 2IPNA 3VPGA 1L4UA 2PVSA 3E3LA 1L0BA 1VJCA 3LGSA 4XEUA 2BMFA 4A9AA 1TGYA 4E21A 2X4GA 3OETA 5JVDB 2VXOA 1L2TA 3S7TA 1XMVA 2HEGA 2RGCA 3UXMA 4D6PA 4D5EA 3AEYA 3ESXA 5C31A 2YWBA 4MOWA 4HSGA 1H05A 1I30A 3EA5A 3DOUA 4HI0E 4BV3A 1SXIA 1J2UA 2AYXA 2W6PA 4BMPB 1PQ4A 5AO9A 4CR7A 4J1TC 4ZT2A 1P29A 1S4QA 2WFZA 2A67A 4KLZA 4LA4A 4ZXPA 1HT3A 1MX9A 3I8XA 4G0MA 1DGQA 4XUCA 1I1QB 3G3EA 4B3XA 4BCCA 1L4YA 4OMDA 4DNXA 5TS2A 3A6LA 3TTYA 4I1VA 4GXNA 4EFKA 2H0QA 2IP2A 4HAXA 4MRSA 4HV4A 1OZHA 4GWGA 1AK1A 2DVMA 4LJKA 3RBXA 4AJHA 3AEKB 1E2KA 2H2AA 1FJHA 1R3DA 1WL8A 1P5JA 2W4QA 3CEPB 1U0BB 3SK0A 4IJQA 1XMJA 2AFHE 3O0TA 3RROA 2ZITA 2QRVA 3TEMA 1SXHA 2V4ZA 2GA8A 1Q6YA 2J4DA 1RI5A 1KA9H 2XVYA 3OOJA 1XQ9A 4L50A 1NG9A 4X1KA 1E1RD 1US8B 3H0CA 2CMDA 2AFIE 3KPJA 4ZVRA 3ID6C 1U6IA 3PUWA 3U2QA 3NWOA 4ZVVA 2WAXA 4BDSA 1FW6A 1J5PA 1G98A 4G5HA 5KTMA 5D3MA 3N9IA 5KCZA 2OE2A 2BKLA 5A6VA 2JF0A 3HGMA 4A2PA 5BV1A 4Z4GA 2VTEA 2JHPA 3BQMB 4UHJA 3VU3A 4ZOLA 1PU2A 4FR0A 4PHHA 5F5LA 1AHPA 3P1JA 1TC1A 2GGSA 4FMCF 4NQRA 3RIXA 5I7AA 3EZ2A 4CW7A 2Q5CA 3GJ3A 3KXKA 3BK7A 5EE1A 5JMTA 1TADA 3K2QA 4OXIA 4H77A 1HOTA 4IHJA 4R2KA 5G4KB 3RM3A 3B2EA 5JS2A 1PFGA 3THRA 5JSFA 1KEKA 1LC0A 1GRNA 1TU3A 1ZK0A 4ZAXA 1O94C 4EJ0A 4RHFA 4D97A 2RGGA 3CY6A 1ZCAA 2VP3A 2AN1A 3WB0A 4Z8YA 4C7OA 1DFHA 3BOSA 4DIMA 2YCLA 4G9BA 2A0FA 3MTJA 5GZ3A 3VFDA 2OBXA 4Q9LA 2JGNA 4F5YA 2QG4A 1K97A 2FPWA 5SZJA 2O2GA 1QHYA 2OD9A 2ZIGA 4GZMA 3ZOZA 1JEAA 1HFEL 3Q6NA 1Z29A 3STHA 1YB5A 5FQOA 3LL4A 1NT2A 3PITA 4LAFA 4WK6A 1IJFA 1UM9A 1PT5A 4K9RA 4PFKA 1SPBS 4E88A 2JBWA 1VA4A 2YZGA 4RTJA 2GXAA 1YZGA 2ZBVA 1YOVA 1CUIA 2WIFA 3F47A 2FG6C 2LE0A 1LC3A 3L1KA 5DTQA 3ER9A 5D5QA 2FG7C 3BGOS 3M9LA 4YRAA 4WN9A 1JQJC 5H9VA 3TJMA 2YV2A 3RB8A 1M54A 3VJMA 2R8OA 3NXKA 1Q84A 3LK6A 3WNDA 4BAUA 3G17A 1AKEA 1QAQA 2IEAA 2OB1A 2VS1A 2PFSA 1TMKA 3PUIA 3EQ6A 4FSDA 4L5YA 4MLCA 1OF1A 4UEWA 3G2KA 4IOLA 1OBCA 3DLCA 3MC1A 2PNFA 3PVZA 1QTRA 3LCVB 1YIDA 3IGFA 3M3PA 3R6GA 4PVDA 3ZBQA 1IJBA 1LBHA 1QIGA 3ZLVA 3G85A 3G88A 3GOHA 5H0IA 3AVTA 1W2WB 2DLDA 3QOWA 3DL2A 1WPRA 3FUXA 1L7MA 1JNXX 1DP4A 2QTNA 6GPBA 1Y80A 2J6BA 5K0TA 1FL9A 4Q02A 3A9VA 1IBCA 1B15A 3WNVA 2NV6A 2JI4A 1Z4QA 2JLWA 1T1RA 1Z4KA 4WOKA 3VJLA 4AN0A 1L8OA 4CCYA 2XZLA 2TRSB 3E1KA 1DRWA 2Q0XA 4TQ9A 1KH1A 2V54A 4RD3A 2YJ3A 2YYAA 4LNUB 2FSIA 2EGHA 4UNIA 1V4VA 3PX3A 4AZ0B 3S2EA 1YBMA 4Y7DA 5NULA 1G18A 4GDMA 3KQOA 1J07A 4ZREA 3DTTA 2L2QA 2VAVA 3EUAA 1KEZA 3KD3A 3MW8A 4UHKA 2YINC 4WRRA 3V2GA 2V97A 1GQRA 3MT9A 3ET4A 3KV3O 1ZH0A 3O4JA 3DB2A 2YNMA 2BJWA 3BMQA 3RU2A 3L4JA 2WHXA 5KUTA 1FPQA 1JJVA 2DOKA 2FEWB 2FUEA 4LXQA 1VHQA 3K7EA 5DNWA 1RLJA 3TIVA 4W5TA 1L5WA 1I5OA 3G8BA 2R4TA 4OQ4A 4H0FA 4Z99A 5FUMA 2OZLA 2NO7A 4ZO6A 3TR5A 1ESZA 4ARSA 5SYAA 2ZS7A 1R16A 5JSYA 5JJBA 3FDZA 2WQ6A 1YFLA 3G9QA 1VKHA 2EIHA 2IDZA 2VJBA 3ZNNA 4XCQA 2CNWD 4OYYA 2WSMA 3C3XA 5JTTA 3PT5A 2BHLA 3K96A 2ISSD 4FMDF 4B81A 5B3AA 1EVIA 1E5LA 1NR5A 3AJRA 3OQIA 1SZPA 2G25A 1JU3A 1KHTA 2I33A 4YJFA 3D1VA 1RM0A 1XTQA 2GLUA 1IB6A 5DGIA 2FRXA 3O26A 3CCBA 5DDIP 4CUJA 2C2OA 1OZAA 4BL5A 2G1JA 3RSGA 1C8LA 5F73A 3ABSB 4XSHA 3L43A 5AQEA 1XRJA 5IKEA 1XTPA 3ROEA 3PJEA 3GHHA 2YWGA 1W5TA 1GGJA 1USKA 2H4HA 2JIDA 2Z08A 3IKLA 4NFLA 4DNPA 4DMCA 2BGWA 1WKCA 3A3OA 1Y6FA 4Q3BA 3AFGA 3L4BA 3OX2A 3LSTA 1PLLA 2A9VA 3LFUA 4V0RA 5BYKA 2WM2A 4JDPA 4ACAA 1NQ5A 3RSZA 3L6BA 1F48A 1PWYE 4KE8A 2CD7A 1PV1A 1HMYA 1VLHA 2RI1A 4DCPA 4RZQA 4WFJA 3WK5A 2B8JA 3V00A 4MQFA 3F9IA 1JLKA 4ZK6A 2FPOA 2QVBA 3ZXYA 2EJVA 2HPZA 2FH5B 5KYUA 3FF1A 2PAFA 4ZQCB 1MEJA 2EYUA 3CMCO 3Q10A 4A23A 2G4LA 1PL8A 5A0TA 2BR3A 2B1QA 3WGYA 4D4LA 3LWZA 2RK4A 4CMJA 3A14A 5CIYA 1SB9A 2XECA 3AVYA 4KQCA 4KRXA 1CVRA 1Y5RA 5TGTA 2HWWA 5HPYB 3OIVA 1DAKA 1U8AA 2O0KA 4KJXA 2EIXA 1BD4A 5M2QA 2VF7A 1V7PC 1RAHA 3P9KA 3COJA 4RK4A 1CF4A 2ZIUB 4WY5A 3SBEA 1X1SA 3T3MB 2NYAA 2XRMA 3LVBA 4CKXA 2GCOB 4MJXA 4YUXA 1GN9A 4JJIA 3IE0A 1GYQA 1UT6A 1O77A 3ABZA 1L5NA 3TYXA 3VX4A 4EEKA 4C0AC 4EPYA 4NF2A 5CLFA 3RVSA 5C52B 1DXOA 4K6CA 3BICA 3KJQA 1ZHFA 1O9BA 1YZNA 2Z09A 3PE6A 1VYTA 2VP5A 4JBYA 3P2JA 3JAMA 1UDXA 1TT7A 1XZCA 4YYEA 4RTLA 1LKZA 4FDLA 2O0MA 4NOJA 4DJTA 4JGIA 3ADKA 4PSUA 2WWFA 4ZYZA 5FPYA 4GU5A 5DHRA 4FFRA 3GLFE 4DILA 4WBNF 5LXTA 3BRCA 4QX6A 1BS9A 1SWWA 3WIEA 5HKBA 5JDIA 3BIWA 3TS1A 2VHUA 2B0JA 3IT0A 1DEXA 1V39A 1P1KA 5TXGA 1AZSC 2LXNA 3BREA 5HG0A 3SJAA 4OP2A 2ZAMA 1BCSA 1YKSA 3KYIB 4JR0A 1MGPA 2NQ2C 4XGQA 4YCSA 1KNQA 5K8UA 1TRHA 3M4ZA 1SBNE 2DQKA 1UMDB 3SNKA 1NAIA 1IBLB 5ENZA 4OUKX 2HU2A 3RSQA 5FF9A 4A91A 5CT8A 3SBOA 2AKEA 1LK7A 3IKJA 3K2EA 3T5PA 4TRRA 2ABWA 4L28A 1HG0A 1BMTA 1T0PA 3IPRA 2YNMD 4GMKA 3OP4A 3AJ8A 3AUXA 4DC1A 1CUZA 4I6EA 1DO8A 4JC0A 4X91A 3SFVA 5ITZA 3G2QA 5C8YB 4URYR 1NRJB 4IJKA 4OHKA 3NWBA 3F5DA 4YV7A 4LRYA 1Y42X 4D80A 4KQFA 3RI3A 4G0WA 3NC4A 4BO7A 3SDSA 2GPTA 1MGOA 2C8VA 4DMUB 4QM6A 2VC2B 1S96A 5TQJA 3HI6A 1O9GA 2X8WA 4PLGA 4WBXC 3N2GB 3V4SA 4BO5A 1O7JA 1TRKA 4KBGA 2FPIA 3W1VA 3PRJA 4KXWA 2FSVA 4EZBA 2BDTA 4P4GA 3K0EA 3I45A 2O0JA 2VWHA 4E07A 4JP1A 5EE3A 2WYHA 5JQGB 3THYA 5EGNA 1VTKA 3TH5A 4IH4A 1Z4JA 2JAHA 3Q3IA 4BOYA 3DTVB 3T4PA 3K09A 4KQ2A 1TVMA 5LFAA 2YKGA 2PZBA 3RTAA 4DR7B 2HF8A 1I5RA 4IDGA 3QY9A 3PIIA 3I9KA 1PJBA 2AQHA 1X1AA 1XB2A 3CS3A 4R1MA 3GLHE 3U26A 2F8TA 4HYTA 2GRAA 1NN1A 1U2GC 3K6SA 2JS7A 3V9AA 2PKYX 2VT6A 2WF8A 3CN9A 3QPCA 5ERGB 3HRKA 5LBTA 4AMVA 2CV2A 5FNZA 4JJ7A 1P4JA 4RPIA 4YRTA 1E1RA 1T9CA 2HIMA 3D8HA 4OQLA 3JVDA 4JROA 3RBZA 3ENVA 2ZIAA 3VHLB 1NL3A 1VRCA 1LQTA 4L9AA 4WBSA 1DAIA 3EG5A 1T2NA 3SF8A 2QE7A 3FNQA 4I1YA 2AXQA 4FGJA 1V3VA 4JEMA 1NYRA 3PK0A 3CR8A 2R47A 1QNLA 2RB5A 1UC4B 1BX1A 3SLGA 4ARAA 2C2WA 3IDAA 3HI4A 4M53A 5JD6A 4AO6A 4B34A 4RJ2A 3OZIA 2AJTA 1C1YA 3ONVA 2VTDA 3VO8A 4DB4A 4JLPA 2FJPA 1AO0A 3DW3X 3EJWA 2Z5VA 1EBFA 4MIEA 3G82C 5L3SA 1IBKB 5EP2A 2IIBA 4D9CA 4BLSA 3VKUA 1CLEA 2NTNA 4FJ1A 3ZWKA 5EINA 2P9GA 3N6VA 5A7HA 1RQPA 2OXFA 3ETJA 1Y5NA 3B89A 3NH6A 1BDBA 3TEJA 2VWPA 4K9DA 3NJRA 2AOUB 2HA7A 2NXCA 1OLUA 3EB9A 1SUWA 2Q0HA 1D2EA 2A33A 2MSDB 2Q6TA 2RIPA 1LLUA 1Z83A 4G4GA 2GEBA 1U28C 1FUEA 4WSOA 4BPRA 5HRAA 5IRCD 1B7GO 2DSNA 1VPEA 1U7TA 3ZHYA 3MCAA 1P44A 2ZR0A 3FI0A 5IEBA 1U0NA 1U0GA 2XCTB 5AR1A 1EHYA 3JQ6A 3PEWA 1S8FA 1WPXA 1UFOA 2GAFA 4Q3OA 3WLEA 4O4JA 4FDMA 5JBIA 2QT0A 3EARA 1GL3A 3A6KA 3SIWA 3LF1A 1DWPA 2E4XA 5D3KA 4AKEA 4RULA 1R0YA 5AOAA 5JAOA 4JLUA 3PYXA 2Q5OA 3OWHA 4RZSA 4HNVA 4N01A 4GYYA 1T4CB 2CXNA 2QM8A 2XUKA 3AP1A 4MS1A 3SEAA 4WV3A 2W2VA 2DMRA 3UK6A 1US8A 5ALXA 2XF8A 3D8NA 2HBRA 3KPYA 5D3ZA 3HO1A 1RWNA 2QPOA 4M8KA 3F3MA 3F71A 3O84A 5JG7A 4N40A 3Q2IA 1E1YA 3DD5A 3TUJC 3ZE9A 2CYAA 1FNDA 1L7XA 2L82A 3BHJA 1OZ0A 3GNLA 2RGBA 4LMRA 2A4MA 3WGGA 1GNRA 4EKIA 4MI1A 2WTEA 1JWAB 3NTOA 4MGEA 3UMVA 1OIWA 3VDQA 5LNK6 2DQSA 4FYKA 4GZ3A 2YYZA 5BQFA 1WMEA 3R3ZA 5AOBA 3H1GA 4ITRC 4RVDA 5EMLA 3ZD6A 1DMRA 4ESHA 1QQ7A 3GMDA 3IV6A 4ZZ2A 3HB5X 1B0UA 2IE0A 3IULA 4YRZA 4JU8A 2FOIA 1G2OA 3E1SA 1EXDA 4XLTA 1XZIA 3SYNA 4DWVA 4S1TA 1P9LA 2N9UA 3H0EA 1SG0A 3HFRA 3KLMX 2P40A 3KWFA 1IK6A 1RQXA 3R0QA 2I4MA 1KMNA 2CXXA 2PLWA 3SYMA 2E5FA 4E5MA 1DCTA 1C0LA 2BJHA 1AY0A 3VNSA 3Q88A 3VPHA 3W2FA 4HKTA 1H8HD 4QTTB 3NBUA 3P0EA 2H08A 1IZ0A 2HJWA 1OTXA 4QWMA 4WCFC 1M0EA 1MRNA 2CNKA 3V1LA 3LCMA 3LO5A 1Y1RA 3B5EA 4BFCA 1XU9A 2CF6A 4M7OA 4D44A 3V6MA 4Z7JA 3D6AA 2H54A 3IKMB 4UM7A 2PUWA 3CJQA 1I36A 2O2XA 2BELA 1T2UA 1QHXA 4PR0A 1U94A 2P4EA 5EIBC 1ZP6A 2WUDA 4C2BA 2BBWA 1PUXA 1A5SB 1VE5A 4LOAA 5HDBB 1XG5A 4CTKA 1WBBA 1DIRA 1OMOA 3CLTC 2UZ3A 5B58T 3DBOB 3UV3A 2FR8A 1AIPA 4MO2A 1HV8A 1BXZA 5DW3A 5F5NA 5T4HA 2FF7A 2OP0A 1ZRSA 5ESWA 1Z8FA 1E2QA 2OAGA 1WVIA 3GNTA 5JJIA 3ZWWA 4LZNA 4LOKA 2FR8C 3B48A 2NU9A 3HWSA 3PC8A 4TSFD 5BSMA 3RS4A 4ALIA 1MKYA 2RHOA 4HTFB 5BR7A 3HA7A 4ETNA 4JOSA 3QQ5A 4EL5A 4C2UA 1VGVA 4R7GA 5D8DA 1UANA 2ESRA 3MQ2A 1P0FA 3QHQA 1R9MA 1E3EA 3AXTA 2EG5