5JSRA

New mechanistic insight from substrate and product bound structures of the metal-dependent dimethylsulfoniopropionate lyase dddq
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
190
Chain Sequence
MTLENVLEAARHLHQTLPALSEFGNWPTDLTATGLQPRAIPATPLVQALDQPGSPRTTGLVQAIRSAAHLAHWKRTYTEAEVGADFRNRYGYFELFGPTGHFHSTQLRGYVAYWGAGLDYDWHSHQAEELYLTLAGGAVFKVDGERAFVGAEGTRLHASWQSHAMSTGDQPILTFVLWRGEGLNALPRMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethlysulfonioproprionate lyase DddQ
publication title New Mechanistic Insight from Substrate- and Product-Bound Structures of the Metal-Dependent Dimethylsulfoniopropionate Lyase DddQ.
pubmed doi rcsb
source organism Ruegeria lacuscaerulensis (strain dsm 11314 / kctc 2953 / iti-1157)
molecule tags Lyase
total genus 54
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 4.4.1.3: Dimethylpropiothetin dethiomethylase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16867 DMSP_lyase Dimethlysulfonioproprionate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jsrA00
1ZRCA 4HMZA 5I93A 4Z82A 3I54A 4ZU7A 5EFUA 3IBMA 3QOPA 4UBGA 5I0SA 1OMIA 1X7NA 4TLFA 4QGLA 1O5LA 4XF4A 1ZRRA 3LZZA 4HZFA 4OFGA 1SFNA 5FDBA 5I0UA 2QCSB 2MHFA 4Q0VA 3DL3A 1YLLA 5FQ0B 4DINB 4HVQA 1X8EA 1EY2A 1NE6A 5I91A 3E5XA 5I0RA 4XFCA 1RTVA 3NL1A 5KHJA 2UYBA 3EJKA 1TQ5A 3HT1A 4AQ2A 1PMIA 4Q0UA 2UYAA 3I59A 4FAGA 2B5HA 5F1RA 3VHRA 4YYOA 3DV8A 3QACA 2BNOA 3IWZA 4FAHA 4I2OA 3LA2A 1CAVA 4Q0SA 4IERA 2E9QA 1CGPA 3N4MA 2IXIA 4PIZA 2OZ6A 2ET1A 1LKNA 1IPKA 2QJVA 4IETA 2D93A 1J3PA 3MYXA 5JSPA 2ZKLA 1CAWB 3M70A 3CEWA 3LOIA 4Z07A 3H50A 2D40A 5HI0A 3DKWA 5I8SA 3OTFA 3ETQA 4AVAA 3NKTA 1J1LA 3E5UA 3BALA 5LEKA 2KXLA 2QDRA 3KMHA 3BCWA 4K8FA 3KGZA 4I09A 3SCFA 4IEZA 1FXZA 1XRUA 4D7SA 1WGPA 2C0ZA 2O1QA 1CAVB 2IC1A 3OD0A 1FI2A 2BYVE 3B02A 3BB6A 2EA7A 5BY5A 4OLLA 4LLOA 4QM8A 1LB2A 1HW5A 4R52A 4Q0QA 4QX5A 2ET7A 1ZVFA 2CGPA 5KHHA 2H6CA 3U10A 3SCGA 1SQ4A 2OPKA 3ROUA 5J48A 5BPXA 2PFWA 1PM7A 5C8WA 5T3NA 1I5ZA 3ES1A 4I0AA 3LWCA 2GU9A 5JSOA 2PYTA 4HSLA 2HKXA 4HVOA 1RL3A 3MPBA 3U11A 1VR3A 1XE7A 3WW1A 5C6CA 5CVRA 2F4PA 1ZX5A 5J3UA 5KHKA 3UKTA 3O14A 3NW4A 1GQGA 4UBHA 4MX3A 4MH0E 3OCPA 4IEPA 3H8UA 4XFIA 4QGNA 4F7ZA 3ELNA 4QGMA 3KGLA 4MV2A 1RC6A 4XF3A 3JZVA 1I6XA 1U12A 5BUVA 2OA2A 2CAVA 4I0BA 4HSJA 1WLTA 3E6CC 4KU8A 4EWAA 1YFUA 4WZCA 3C3VA 2IXJA 2Q0AA 3IIAA 2IXKA 4LEJA 4WVZA 1VJ2A 3S7EA 1Y9QA 2V09A 2GH2A 4MGZE 1RGSA 4D7TA 2D5FA 1RUNA 3PVBB 4HBNA 4N9IA 3M3IA 4XFHA 4BYYA 4J1XA 2UY8A 2PQQA 1UW8A 4NVPA 3HQXA 4XFBA 3H7YA 5FCCA 3SMHA 1Q5OA 2PAEA 4HLTA 1JUHA 4KWKA 3DN7A 3NVCA 3CJXA 4O9GA 1ZNPA 4XFFA 1EPZA 5LRSA 1J58A 3H3ZA 4LA2A 3G7DA 4IEYA 2N7GA 1ZZCA 3ZDSA 1LRHA 2DCTA 3MDPA 2XHKA 2Q30A 4B29A 1LR5A 1DGWA 4PJYA 2PAMA 2GAUA 1SEFA 4E2GA 4N9HA 1GQHA 2MNGA 2WC2A 3CL1A 5JCTA 3RZZA 2Z2SB 2GC3A 1UIKA 3I59B 1O3QA 3FX3A 3D0SA 2Q1ZB 2Z69A 5J7MA 1NZCA 2B9UA 2I45A 4IEXA 2OYZA 4FT8A 3KSCA 3EHKA 1ZRFA 2UY9A 1G6NA 5BV6A 4META 3E5QA 1ZREA 5I8TA 4BH9A 4ONUA 3FE5A 3EQEA 4XFGA 4XF9A 2VECA 1ZZ8A 3ST7A 4IESA 3NJZA 3OF1A 2ZCWA 4PIYA 2PAKA 2K9ZA 1YWKA 4Q0PA 1Q43A 4BIFA 2CV6A 2BNNA 3H1WA 3EO6A 4QM9A 1L3JA 4AQ6A 2PHDA 4IEUA 4EWDA 3BPZA 4E2SA 1ZZBA 1CAUA 2Q4SA 4I02A 4IEQA 3LAGA 3RYKA 2IXLA 4RD7A 1NXMA 3WW4A 3MZHA 4EWEA 4YSFA 4GULA 5JR7B 3ACLA 2BEOA 4YRDA 5I0TA 1UPIA 3USSA 4YNIA 2IXHA 1CAXA 3FFQA 3RNSA 4XF1A 4MGKE 1YFWA 3LA7A 1UD1A 3OGJA 5FPZA 3H1MA 4KL1A 3LA3A 5LRRA 4MGYE 1QWRA 2PHLA 4LUKA 3D0JA 2H0VA 2XGXA 4X6QB 1CAUB 1OI6A 3SHRA 4E2QA 2BNMA 4P9GA 1IPJA 5K8SA 4HN0A 2IXCA 4UXAA 4FBFA 2VQAA 4ZU4A 5CADA 3FWEA 4I01A 1UIJA 3H9AA 4BHPA 1CAWA 2K0GA 3FZ3A 3CF6E 2GC2A 4LA3A 4QXKA 2WFPA 3EBRA 4LULA 1CAXB 2HJIA 2PA7A 3GYDA 4MUVA 4XFAA 3RDIA 1OFNA 4HN1A 3CO2A 3FHIB 1YUDA 2ETEA 4IEVA 2Y0OA 1YFXA 1ZZ9A 4AVCA 5BXXA 3HIFA 3SXWA 1J3QA 5FPXA 3CLPA 1O5UA 2XKPA 2XLFA 4LTAA 5FLHA 1XE8A 3RYRA 2CAUA 4L11A 1V70A 1YFYA 2BGCA 2QVSB 3E6BA 3UKVA 1X8MA 5FLIA 1EYBA 1Y3TA 1DZTA 4EV0A 3E97A 3S0MA 3IDBB 2VPVA 2PTMA 3BU7A 2XLAA 2XKOA 3UKNA 1H1IA 1RUOA 3D82A 1QXRA 3S7IA 1VP6A 4EROA 4MGIE 5JAXA 2O8QA 2XL7A 4J1WA 4JTOA 5KHGA 1DGRA 2XLGA 1OD5A 4WBBA 5E1RA 1H1MA 3TNQA 5D1IA 3RYPA 2GC1A 4IEOA 4CYDA 3I7DA 1NYWA 4MZUA 4IEWA 3TNPB 2FMYA 2MPFA 3KCCA 4H7LA 4JVAA 1CX4A 4AXOA 3NSTA 1ZZ6A 4ORFA 4PIXA 4HVRA 4R8HA 1QY4A 4X6RB 3E6DA 5EZWA 5KHIA 2FQPA 1EP0A 5LEJA 1X82A 1O3SA 5AVPA 2EAAA 5JSRA 1O3RA 4F8AA 4LUMA 4XEZA 2GZWA 4JV4A 2OZJA 4KWLA 4XETA 4QMAA 1J59A 1UCXA 3SCHA 5KBFA 1O4TA 1ZRDA 4YARA 1Q3EA 4KWJA 3PLQA 4XF0A 2GC0A 5FLJA 5E16A 1FT9A 5CU1A 2EVXA 1O7FA 2XL9A 3R6SA 4A2UA 4I3PA 3L2HA 4L2NA 4ZU5A 4KU7A 1QXJA 2H6BA 5FQ0A 5I8YA 4Q29A 3H1YA 1J3RA 3H7JA 2D5HA 2P17A 2ATFA 4O9EA 1YHFA 1O3TA 3WW3A 1ZZ7A 1DZRA 3IDCB 4JTNA 3WW2A 3FJSA 1WA4A 3RPQA 3HT2A 4AVBA 3U0ZA 3ES4A 3GBFA 3H3UA 2QNKA 3PNAA 1NE4A 2B8MA
chains in the Genus database with same CATH superfamily
4PI0A 2JENA 3TYJA 1ZRCA 3T0DA 3R05A 3OGSA 3ILRA 3INAA 4MVTA 5I93A 4YW2A 3ZIWA 4P02B 4YWAA 3OPTA 4AFCA 1IS5A 3GBWA 2VZRA 1BEV3 1AX0A 5I0SA 3VV1A 3AKRA 1X7NA 3LZZA 4AQSA 1UU5A 5FYHA 2ZEZA 4DZGA 1SG3A 2Q8DA 4Q0VA 4IQPA 3C2UA 1GFF2 3WEZA 1GSLA 5KXDA 1OHFA 2GDFA 2EALA 2CGNA 3DPRA 1NE6A 2RV9A 5EIYB 1FMD3 2XG3A 4C8DA 5FR3A 3P1IA 2YBSA 2UYBA 2R063 1AX2A 5FZ1A 2Q1FA 2O0OA 3MIFA 5LASA 4EQVA 5BNQA 1I1EA 2CGOA 1RUC2 2VOVA 2RDNA 5BNOA 4IV1C 4XUPA 1TQ5A 5FYVA 2WWUA 4URAA 2UYAA 4V1PA 1TMF1 1UX6A 3VHRA 1COV1 4HANA 3VHNA 1NCRB 4Q4V3 2YBKA 1ASJ3 2RS32 4LE4A 2XJVA 3GJBA 1XC6A 4GB32 4CVUA 1G9DA 1CGPA 2YFUA 1H2NA 3WX5A 5FAXA 3N4MA 2ZEWA 2IXIA 3VHPA 1SBFA 2ET1A 2PELA 3ZDVA 2NPIA 1QOTA 1D7PM 3GZTB 2QJVA 4IETA 1MZEA 3I2KA 3KVBA 1H9PA 3BVCA 4K8RB 2BJSA 3AL5A 2EIGA 5GLUA 3CEWA 4BM8A 5DAQA 3THTA 2JKBA 4BWOA 5FUNA 5KC6A 1G9AA 3WLUA 1WMEA 5FUIA 1TE1B 2ZPXA 3OTFA 3MIDA 1QDOA 3ETQA 5F9TA 4JGYA 4KI5M 4QXHA 4P08A 3CBNA 5GALA 5A70A 4GJZA 1DYOA 1PK6B 5CG9A 2WFF1 1RUC3 1UY0A 4NAMA 5FPAA 1N3OA 3T0BA 3U07A 1W0NA 1ONAA 2W47A 3OBAA 4NHLA 2PHUA 5DAWA 5BNPA 4AHXA 1WGPA 2C0ZA 3ZYJB 2TBVA 5CISA 3DXUA 4GH4B 3LPFA 1XNDA 5ABJC 3IMMA 4R9BA 1QJU1 4ZZ8A 5K4LA 1FI2A 2BYVE 4QHBA 2XR4A 1GOHA 1GZTA 2EA7A 1H9WA 2YC0A 4GB33 1JZ3A 4OLLA 4P9YA 4K20A 3ECQA 4CUAA 1O4YA 3O1OA 2C5DA 2A6XA 3RVHA 1GZCA 4XYXA 3F95A 2C9KA 4YZ3A 2FDKA 1LJ7A 2ET7A 1REFA 2Y26A 4GWIA 2ZGTA 1DYKA 4FVVA 4HT1T 1IG3A 4OCTA 4YVWB 3VL9A 5LA0A 3JXSA 4ZS2A 5HXVA 2IVJA 3ACHA 5CKMA 3ZXGA 5KHHA 4E8CA 5APAA 3SCGA 1GQPA 2OPKA 1POV1 3SEPA 4AI9A 4FCAA 3VZMA 4BQ3A 2ZGMA 2WNVB 5F5AA 4NIHA 3ZYFA 1H30A 3JBG1 3MUY1 3AC0A 3KV5A 4AHZA 4BIOA 5CBLA 2D6KA 2QQPA 1RUJ1 4IDZA 5L9BA 2RE9A 1HKDA 2OT7A 1XB9A 5JSOA 2FCUA 5E88A 1GOFA 1AJOA 2HKXA 3B7MA 5ISLA 1HB1A 1CPNA 2ILMA 4UYBA 3BOWA 1LHVA 1Y4WA 4EN0A 4QX0A 4W4ZA 1XE7A 2BP6A 2C6SA 4Q27A 3VKNA 4GKYA 3G6JB 1QJEA 5CA6A 3NNMA 3O14A 3OBRA 3LIHA 4YGCA 1WW4A 3T2PA 5C8CB 1RVF2 2D6MA 2ZGOA 4MX3A 3RZJA 4N43B 4NRPA 2GNTA 5JZGB 5LA1A 2WAAA 2W1WA 4QGMA 2R041 1DQ1A 4RQPC 2P6CA 1U12A 2XJTA 2OA2A 1GBGA 1J1TA 1QH7A 4FPYA 3M7AA 4YZ2A 4EZ4A 1JZ5A 1AL23 3KZ4C 1OUXA 2I07B 1O8SA 1R093 4I0BA 2ADDA 2TUNA 3E6CC 2JXAA 3POGA 1R1A1 1LOFA 5FZDA 3WUCA 3B3QE 3MLKA 1JHNA 4EWAA 3KF5A 4Y1VA 3C3VA 1H8TC 2BTVC 2IXJA 4G4FA 2XH6A 1GZWA 3AP7A 5A7WB 2DVGA 2SBAA 3IIAA 3M8LA 1XNTA 4FPOB 1C8M2 4LEJA 3WSOA 4QPGA 2V09A 5LBCA 2Y6FA 3JD72 4M3CA 4XACA 4A7YA 3LFIA 4D69A 1GZ9A 2DFBA 1RGSA 1L7RA 1O6UA 2B45X 2WO7A 2GMEA 1NCQA 3KV9A 3SQOA 1MACA 4NMIA 3NV1A 4A6SA 1HN0A 4W65A 2HWE1 2ZX4A 5GZFA 5IVFA 3AP6A 4HBNA 3KT4A 1RUI2 1IG0A 2XJQA 1NA1C 4N9IA 1W2AX 4XMIA 1W8UA 1XBFA 4AVSA 1IOAA 3M3IA 5L9RA 4BYYA 1Z78A 2PQQA 1UW8A 2VTXA 4Y33A 1RVF3 2ES3A 1F4HA 2XVKA 1FATA 3H7YA 3USUB 3RZHA 2A7AA 3SMHA 4Q4Y2 2PAEA 3AB0A 3ZFGC 3GZUC 3OOXA 3CDZB 4Q1RA 5DG2A 4IE4A 3NVCA 3POYA 3CJXA 5L36A 1ODNA 4GWJA 4KQ7A 2XBO2 3WZ1A 3WNMA 1UU6A 3RSJA 4A41A 1EPZA 4XDOA 5C9AA 3DPRB 5K0UA 5C3SA 4FOWA 1PO12 3H3ZA 1ZBA2 2X8KA 3G7DA 2RS52 2VVEA 4RQPA 3W58A 4LO8A 3RWKX 1LR5A 4PJYA 3JD73 2PAMA 2GAUA 5GJ6A 4DY5A 1ZYBA 2ARCA 1A3KA 1F8VA 1RJ7A 1PX4A 4LO5B 4Z92B 3GCXA 3LDBA 4Q26A 5FY5A 2RG4A 1B35B 2BU9A 4PHZA 5BNOB 1ND2B 4WVVA 2O8OA 3U1XA 3ZXAC 5FYUA 5JPMB 4GWMA 1OOPA 1RUI3 5FZ4A 4EYUA 2A3XA 1QIQA 2WSVA 4C0HA 2E63A 2PHTA 3D0SA 3FX3A 3KB5A 5GKAC 5J7MA 1W3VA 1CONA 1O91A 2W1QA 5IVCA 3IDAA 1RUF1 5IK7A 4IEXA 3ZXKA 5LZ6A 4NE9A 1Y7BA 1APNA 3I4IA 2ZBJA 5JOZA 1PNGA 1HDKA 4ISRA 4U36A 4Q4Y3 3WF1A 5SV8A 1G6NA 3VBRA 1DZQA 2EIBA 2LROA 2LW8A 3AZZA 3NV3A 5BV6A 5JXGA 1D0GA 1I9RA 1GNYA 4P5HA 3E5QA 1JZ7A 2EF6A 1ZREA 2GMMA 4QT6A 4UFLA 1QNYA 4KG0A 3EQEA 2ARBA 2XBO3 2DFCA 2IVIB 4UWDA 4XFGA 3VD7A 3D4KA 3POSA 4XJ9A 3KHCA 1AF9A 1PMHX 1BJQA 1PO13 4QX1A 1ZBA3 4ARYA 2C9AA 2RS53 4AG4A 1PVC2 3L2YA 3NJZA 1IKPA 1LENA 3N9PA 2ZCWA 2W2IA 4XIOA 4RFT0 1YEWA 2ZGRA 3I3MA 3WNNA 5C3PA 4W8JA 2Y6JA 3OYWA 2CV6A 5FYTA 1VE0A 1W9YA 4AI2A 3FMGA 5T5OA 3WDUA 1VMJA 3SEEA 3EO6A 1JYVA 4MSVA 2WRAA 2WQ8A 4AQ6A 3BGAA 5T50A 4CU6A 5BNPB 2B9VA 1QEXA 5CFDC 2X10A 2Z79A 3POWA 1QOSA 4FOQA 4QB2A 4EWDA 3BPZA 3UYJA 4CDWA 4DUXA 1W6NA 2QTWB 4JDNA 4BPZA 4NIGA 4IEQA 3LAGA 4UFMA 1V9U2 2JD9A 1VRBA 2WZR1 1NXMA 3WW4A 3MZHA 4AWDA 5FO9B 2FZ2A 4NRMA 5FWJA 4V2VA 1PGSA 2VD7A 4EWEA 4B4PA 2ZGKA 5GLVA 2PHWA 3SITA 1ZM1A 3WY6A 1NXD1 3I2HA 3ZFEC 1KS5A 4QX7A 2R1DA 2WT0A 3LOBA 2R0HA 1Z7S2 4HONA 4FP2A 3USSA 1JOJA 5FZBA 1QQP2 4YNIA 4QB6A 1RHI1 4QXBA 1AJKA 1OSGA 4ATEA 5FZFA 2E7AA 3N9LA 1UF2C 3SC7X 1LEDA 3MLJA 1KFUL 1PVC3 3TEYA 2EICA 1YFWA 3LA7A 3B94A 4R4XA 1XNCA 3T2OA 3WOGA 2IWGB 5FMDA 1CIYA 1CZSA 4S2DA 2LALA 2AEYA 4CCEA 3PUHA 1REEA 2BVVA 2BOIA 1OI6A 1YQ8A 4NOTA 4NHKA 3QH6A 2OKXA 3VBFC 4Y22B 1K5JA 2WL1A 4JAAA 2YU1A 1UX7A 1WW6A 2BNMA 3AVRA 5JOYA 1IPJA 2RJ2A 3AKTA 2CWMA 2IXCA 4FBFA 1VMFA 3FWEA 4I01A 4NPMA 1BVP1 2DCZA 5L19A 3FZ3A 3WQ7A 1QGLA 4LA3A 4UW5A 3KCYA 4K40A 4LULA 2VMHA 2ORZA 4Q2FA 4UFJA 3AK0A 3MV11 4LITA 5GZEA 1JYNA 1QMJA 1UY4A 4CP2A 5A33B 1Z7S3 5DUXA 2ZXQA 3TBDA 4XUNA 4LBOA 2YV8A 4DFSA 2JDUA 2J1UA 2Y0OA 1ZZ9A 1RITA 4BK4A 1BCXA 2G4IA 2YROA 1J3QA 2VXJA 3AMMA 3K3NA 4XJAA 5DZFA 5FZ3A 3CLPA 5A32B 3UGHA 4E27A 3J7LA 5CZKA 4LTAA 2CAUA 1NCQB 4F3JA 3AKPA 2QVSB 4G9SB 2ZA9A 3UKVA 1X8MA 4C91A 4UFKA 5FLIA 3CIHA 1DZTA 5HCBA 2HWC1 4PBPA 3E97A 5F6LB 3S0MA 1AUYA 1O4ZA 4OMDA 4KMQA 3D82A 1EAH2 2ZZQA 4PLMA 2J1VA 3ZN5A 5FZLA 4EROA 2XL7A 2QE3A 3AMNA 5KHGA 1V6LA 1V6NA 3RFRA 1XNKA 2C24A 4UW6A 1DGRA 3UL2A 3FC0A 3ZFFA 2XDVA 4Q4X2 1W99A 1N1TA 1PHMA 3N9OA 3RYPA 2BBAA 4JQRA 5CNAA 3B69A 5ACA2 1ZBE1 4JRLA 4FFIA 4XZUG 1QJZA 1CJPA 2J7MA 3I2DA 3Q8BA 4W6WA 1E57A 3VBUC 4AR2A 5C9AB 3SLIA 1NQDA 4DXTA 5K0UB 4R9AA 2WR9A 1S0DA 2VNRA 1W6OB 2VTFA 2BWAA 1IGOA 5SV5A 4R8HA 2DF7A 5A3NA 1NCRC 4WVMA 1AYN1 2HLEA 3KS7A 4RN5A 4Q8LA 2DTYA 1JN2P 3JUUA 1HXS2 4URTA 3ZYHA 1VMHA 5FZAA 1R64A 3FUOA 5LA2A 1UXXX 2OVUA 5FRAA 4J6GA 2SLIA 3CZJA 3FBYA 3ZX7A 4ASLA 3SH4A 1ZA4A 1W6QA 2EAAA 2WJSA 5A80A 1OUSA 5F39A 1VBE1 4BQ1A 4E9KA 2JIJA 3V56A 4LUMA 1EAH3 1W9WA 4JV4A 4XEZA 1PGL1 1VALA 1LHNA 5H9QA 3I2FA 1J59A 2ZHNA 2DVBA 4GWNA 4PF5A 3T1MA 4D0QA 1Q3EA 4IE5A 4D6RA 4M01A 2VAUA 1WWYA 4UAPA 5FLJA 4GKXA 5E16A 3VBRB 5A7SA 1W39A 5FV3A 3RZLA 1O7FA 2XL9A 3NAPC 1PK6C 1U5XA 4FPLA 1RYYA 5ACA3 5I8YA 2WZEA 5DAVA 2QQJA 2XQXA 1D4M1 2Y6GA 4Q29A 1J3RA 1KQRA 3H7JA 2WWSA 4N7IA 1DLLA 1B09A 2D5HA 3UGFA 4GH4C 2P17A 2FDIA 1YHFA 5CFCC 1IQAA 5DZEA 2A75A 2VZ1A 1VBC2 4ET7A 2W94A 3T30A 3MIBA 4QKBA 1UYPA 3OGVA 1HXS3 1DZRA 3IDCB 4JTNA 2R32A 3OYWB 3RPQA 2FDFA 2WAOA 5DDJ2 2QNKA 1Q56A 1YNAA 1AR71 1ND3C 4YVWC 4RHV1 5CB7A 1V00A 2NQYA 2JKXA 3GHNA 2KM2A 3VBHA 4Z82A 4CDWB 3THDA 4D7YA 1W6NB 1GANA 1LOCA 4CXYA 1WLWA 1W9TA 4LO7A 3C7FA 3IBMA 4IV3A 2OPWA 3ORJA 3QOPA 1F5JA 1S0BA 1KITA 3U14A 1SZBA 1ZRRA 2ZGNA 5FDBA 1CPMA 1SFNA 2C1FA 4CXXA 2RM21 5I0UA 1W8NA 3DL3A 3C7OA 5FUPA 1CQ9A 3KQRA 4GA9A 4OHWA 1GLHA 3FL7A 4BU2A 1N3PA 2QZ2A 3DYOA 5I91A 3VZNA 4DEVA 1UL9A 1RTVA 3NL1A 2VUJA 1DG6A 1XXNA 3WP6A 1WLCA 5C8CC 1REDA 4XQDA 4JCKA 3VBSA 1ENQA 1VBC3 4N43C 5FYMA 4A4AA 2X53S 2RS12 4V2WA 5JXIA 4AFDA 2ID4A 3HT1A 3C8XA 1PMIA 4Q0UA 4BA6A 2HWB1 5JZGC 3ILFA 2IFRA 3WCSA 2B5HA 5F1RA 2BWCA 2Y60A 4IXLA 1W2NA 4YYOA 5FZMA 2GN3A 5L73A 3MW3A 3QACA 5B2GB 1S55A 4JZRA 5BNNA 5DDJ3 4FAHA 3WNLA 2VOTA 5FZ0A 2ZZJA 2A73B 4IERA 2E9QA 1SLCA 1RINA 4Q0SA 3RMXA 4E4SA 1G86A 3I3EA 5C4WB 1WW5A 1TEIA 4BB3A 4DS0A 1EV12 3RJRA 2ARXA 3NNLA 4QAWA 4AOCA 2OZ6A 1VBD3 2PHRA 3RWNA 1A8DA 4XXPA 4CU8A 2BQPA 5FY9A 1DQ2A 1UY2A 3K4ZA 5EPAA 2D93A 1UOBA 2JE7A 1CIWA 5C70A 3K2OA 5JSPA 2VGDA 5A6QA 3ZLIA 3LOIA 2X5IA 3LKJA 5AFBA 3APBA 4NHXA 4CUBA 2E33A 2E26A 3HQRA 3Q8AA 2XWJB 3RQ0A 1W2OA 2D40A 4LHLA 4XPVA 1SDDB 2TNFA 1ULPA 3LQCA 5I8SA 4AHYA 1RIRA 1AR91 3A0KA 2XWBB 4AVAA 2YYOA 3AZVA 2GALA 1J1LA 5I0DA 3AJYA 4DPNA 5EP9A 1JYTA 2WNVA 4H2AA 2VUCA 1UNBA 4LPLA 3GXUA 3TB0A 2BGPA 3KMHA 3BCWA 4HK8A 4QHZA 1FXZA 1XRUA 5AVAA 2RS13 2YFZA 3VDAA 4K3UA 1S0EA 3D8CA 2O1QA 2A70A 1MQTA 5G04L 1HX6A 5KC5A 1CX1A 2VJXA 5JVVA 3OEAA 3BB6A 3IPVA 1RMU1 3BTXA 4RSUA 4OMCA 3S57A 1UYZA 1VBB3 1AL0G 3AYAA 3IN9A 3ZSKA 4GMP3 1EV13 3AP9A 3MIHA 3DPRC 1VRH1 4MXVA 4R52A 2VNVA 2WZ8A 5F8PA 4Y1XA 1NAEA 1OLMA 4QX5A 2YZ4A 4CCKA 4CDXB 2DUOA 5FYBA 2DVAA 2IFWA 4QD2A 3A0NA 1ZVFA 3MPPG 3AMHA 2XVGA 4IGQA 1PZ8A 2KR2A 1G9FA 1TMF2 5DXDA 1JZ8A 1HLCA 1COV2 5BNOC 4XUTA 5T54A 4P00B 5JPNB 2R7EB 4RR3A 1SDWA 2HYXA 3HR9A 3KQ4B 4CU9A 4CUGA 1LGNA 2VO5A 3NWKA 3ES1A 1PZ7A 3MW4A 3LWCA 5FIXA 2GU9A 5FBJA 4WVMB 4B3NA 2PYTA 1YCIA 2MEV3 4HSLA 4W6XA 1Q8QA 1U0AA 3VKLA 4TLGA 3U37A 3ZPYA 1HRI1 3U11A 4AFMA 3GDBA 1LGCA 3M4FA 1Q8VA 3LGRA 4L0PA 5D8AB 5FY0A 2VXRA 2F4PA 1ZX5A 3ZYBA 1LODA 5FKCA 1JS9A 4NWWA 3POEA 1SMVA 2NM1A 2DUQA 1GQGA 4GMP0 3SH3A 3NO8A 5JOWA 1RUG1 2XHNA 4Z2WA 3OCPA 3H8UA 1BMV1 2ZGSA 1GOGA 1NOVA 1PVXA 2DV9A 2WBKA 3J4UH 3ELNA 1LHWA 5FFOC 4F7ZA 1KXGA 3KGLA 3OEBA 3O1VA 1DF0A 4OVEA 4XF3A 4XJZA 3USUA 2HWD1 2Q1MA 1U5YA 1A78A 4P9JA 2WFF2 4HSJA 3AYCA 3MI8A 4JGYC 4LKSA 1RXGA 5JXJA 2NLRA 2A6YA 1PIV3 2JIGA 1TMF3 4AEDA 1QJU2 2DU1A 1COV3 4WVZA 2VVFA 1NUKA 2F4LA 1Y9QA 4PDWB 2GH2A 3S7EA 5A3MA 4XVHA 5BNPC 1C8NA 3S30A 4D8MA 2D5FA 1HQLA 3HNYM 1OA3A 3EXUA 2A71A 5KXBA 2VH9A 4NPRA 2W1UA 4K1YA 1ODMA 1UZ0A 3PVNA 1LAJA 1B35A 3WUDA 1ND2A 2DBNA 3WDTA 4XCAA 2WABA 2E6VA 4NWVA 1PMJX 1PO23 3PTRB 4J1XA 2UY8A 5F2SA 5FMBA 2D6OX 3HQXA 3AM2A 4YM3A 5A3LA 1XYNA 5FCCA 3VBHB 1JTZX 4LJHA 1J83A 3JBG2 4IV3B 1Q5OA 1QXPA 3VN4A 4AF9A 1W05A 1RUJ2 3A23A 4GD4A 3ZKUA 4AI3A 4KWKA 3DN7A 2QQVA 2FBEA 4BE3A 4XQ4A 2WFF3 4O9GA 4WM8A 1RUE1 1RUH1 4LBKA 4QPIA 1ZNPA 2DTWA 1W06A 4HG6B 1OA4A 5EYYA 5FXXA 3K3OA 2JE9A 4YFZA 4HFSA 2D44A 3O12A 3ASIA 4CSWA 1OH4A 2R6QA 2LRPA 2N7GA 1ZZCA 5JWPA 1LRHA 3H8OA 3MDPA 4UW3A 2XHKA 2V73A 2Q30A 4N53A 1DGWA 1F35A 5FZ7A 5FYYA 4DIQA 4E2GA 1GQHA 3KCXA 2R042 2MNGA 4FPKA 4P9LA 1PZ9A 2XJPA 1PX3A 3VBSB 1C1FA 3CL1A 4KGQA 4Z8BA 3N7JA 3CNAA 4M4PA 4RYDA 3UV9A 3V65A 5FOJB 2Z2SB 1H2MA 4K21A 3VZJA 2J1SA 4OHXA 1OURA 4L92A 4Q1PA 4Y24A 2ZOEB 4YG6A 1R1A2 3VKMA 4B8EA 4E4HA 1O3QA 3VL8A 5BNNB 1NZCA 1ZA7A 1HIXA 3MO4A 4LBQA 3QLQA 5HBAA 1CZTA 2B9UA 4I0WB 1CN1A 2RR11 2QFEA 4RL7A 3VDDB 1POV3 4PF1A 3KLSA 1HB3A 1LOFC 1OQEA 3C7EA 4I30A 3MIGA 2RS33 1ASJ1 4FT8A 1BLZA 1DQ0A 1ENXA 1Q8PA 2CY6A 2P34A 2UY9A 3EHKA 4L99A 3I97A 3DYPA 1RUJ3 3H0OA 5D21A 5K9YA 4QPGC 2JDMA 2HWE2 3MICA 3O5SA 4E8DA 3O1RA 1N1SA 2X5IB 2JG8A 3LEGA 1UZYA 2J42A 4N90A 1NCQC 2HYKA 4Y1ZA 5FBZA 5AC91 2D98A 3WDXA 1S1AA 3HBKA 3ZM8A 2DUPA 1WD4A 4ZONA 1XYOA 5FPUA 4H14A 1R081 5LY2A 4IESA 3WP4A 1GNZA 1F15A 3OF1A 3IMNA 5DMYA 3BOPA 5IK8A 3PIJA 1WCKA 1FV3A 4XW3A 2PAKA 2K9ZA 3ENRA 2R043 4BIFA 2WQZC 3I8TA 2WNUA 3O1MA 4LK6A 5JUVA 2BNNA 2ZX3A 5IK5A 4UW4A 4QM9A 1L3JA 1POV0 4COYA 3J8F1 1MQTB 4JQTA 5ERLA 5FY8A 4XURA 2Q4SA 4HKWA 3IPVB 2YC4A 1OLQA 5IVJA 3RYKA 2DBIA 4AEJA 2CDPA 4IGPA 4EN8B 1HN1A 4YLZA 3VD4A 5A7OA 1SCRA 1F31A 4Y22A 5C9AC 2ARAA 5T5LA 4XAEA 5K0UC 2VZ3A 2W46A 4LNVA 2ZEXA 4CDUA 4GULA 2Q8OA 4A44A 3BTAA 4C90A 2XB6C 1UYXA 4EZHA 1LGBA 2VG9A 2A1XA 3MHZA 4PLOA 2IXHA 3THCA 4A3ZA 3KV4A 5A33A 1NY71 1LESA 4RR3B 1TVGA 2VOKA 4X8NA 4FFFA 3TN91 5IT6A 2XPJA 1RUF2 1OOPC 5FY1A 4MGKE 5IVEA 3P5BA 2G9FA 4PBOA 2YC2A 2V4AA 2W08A 4UI9L 4BQWA 2PXJA 3CHXA 3OGJA 5FPZA 4COWA 5A32A 2ZGUA 4CCNA 2HEWF 5D2AA 1OBNA 3SKVA 5LRRA 4CCDA 4MGYE 4RGKA 4EN6B 3BTYA 1QWRA 4YPJA 2G9ZA 1SBEA 2JDZA 3WHTA 4Q5OA 2VZQA 3CKHA 2H0VA 2XGXA 3D0JA 4NJ4A 4DRVA 1LOEA 1JU4A 3K51A 4AGRA 4BQ4A 4QDRA 4MOAA 1A34A 2GSYA 5FREA 1OC1A 3JB4C 3VBRC 2JECA 4AFBA 4E2QA 4HL0A 3OJBA 5F2WA 1VIWB 4FQ4A 1LOBA 4P9GA 1W28A 3OY8B 3BN6A 2H0BA 3HAGA 3I3DA 4N8MA 4B7KA 3I49A 2JE8A 3DUIA 3BIWE 4Y20A 2BUKA 1UIJA 2IUWA 3H9AA 4BHPA 4WV8A 3WF0A 2JG9B 5GLZA 1BHGA 2WFPA 3EBRA 3N7KA 5G05L 1GWKA 1CAXB 2HJIA 3NV4A 4OUEA 1CD3G 2EXKA 2VMDA 2CWSA 3KM5A 1OFSA 3BYWA 1AL21 3GBGA 2ZX2A 4HN1A 3AZYA 3FHIB 1R091 4X8PA 4AEDB 2RMU1 4IEVA 4LHNA 1YFXA 1H0BA 3J7MA 5C5UA 4TYSA 5H9PA 3WQ1A 5FPXA 3MEPA 2WZR2 2YGLA 4AFAA 1W6OA 1RUF3 2VBPA 5JDBA 1S0CA 3ZSJA 1MVEA 1JXNA 1XE8A 1W04A 4JKLA 1C8M3 4CDWC 4AVVA 1V70A 2WN3A 3WF3A 2ZKNA 4YZ1A 1EYBA 3P3PA 1M4WA 1Y3TA 2P4EA 3LEMA 3O7OA 4EV0A 2ZAAA 2VW2A 2YY1A 5DZGA 1UOGA 2VPVA 4XHBA 5FY7A 4CEWA 2XLAA 3UKNA 1LNSA 1GWLA 2D97A 3DCQA 1QXRA 5J36A 1UO9A 1VP6A 2AYHA 3VBOA 1RHI2 2O8QA 4J1WA 4G3YC 2NMNA 4P14A 3ZN6B 4ZZ5A 5C5TA 5JAXA 4FOVA 5IFPA 2XLGA 1FNYA 4XTMA 4EN9B 5HV0A 4TN7A 3GALA 1O8PA 2B4KA 5E1RA 1QJY1 5LW9A 2VQUA 3AL6A 3TNQA 1F5FA 2P3JA 3BTZA 3VD9A 3OGRA 4WM8B 4QPIB 3I7DA 1NYWA 3TNPB 4XBLA 1S2EA 4GALA 1N1VA 4LBQD 5IK4A 5J1XA 2MPFA 2BDRA 1JYIA 5KXEA 4JVAA 1CX4A 4A3XA 1I5PA 4PIXA 1K5MB 2PLV2 4M3CF 3BUCA 1S0FA 4FPJA 3E6DA 3BODA 4N53B 4OULA 2IZWA 2WZR3 1LOGA 3EYPA 5KHIA 4XTPA 3KVAA 3WD5A 1SCSA 1EP0A 4KBZA 1H8VA 3N35A 5IUQA 5JI7A 4CTEA 3WXPA 1X82A 2F17A 1O3SA 3HQUA 4WVWA 2VBDA 1VB2A 3D5OA 3VD3A 1C3HA 2OZJA 3JB8A 4LBQB 4QQ2A 2GP5A 4BQ5A 1RHI3 4LBLA 3HPNA 4JC1A 1UCXA 4W50A 1O4TA 1ZRDA 1JU3A 4YARA 3VKFC 2Y6LA 1AR61 4JHZA 1SFPA 4KWJA 1UZZA 4YFWA 5LCWL 2BOJA 5FYZA 2BFUL 3KHBA 1Q8SA 3CJIA 3RJ2X 3L2HA 2HWC2 2H6BA 1WLDA 2VCAA 1URXA 2JG8B 2ZS6B 1T6BX 5CIRA 3LB9A 1KJRA 2G9GA 1HRV1 1ULEA 2PQSA 4HOOA 4O9EA 4XBQA 2PLV3 4QU1A 4XCBA 1O3TA 2GMPA 4QWNA 3V0BB 2UWCA 2K2SA 1ZZ7A 5FZHA 1M06G 1N3QA 2WYSA 4LQRA 2WNUB 2W39A 3U0ZA 4IV1B 3RI9A 5F5CA 4QB1A 1TME1 3H3UA 1SLBA 3ZFFC 1MZ5A 1ZBE2 1JYCA 1H2LA 3PNAA 3U4XA 4HMZA 3O0WA 3POIA 3N7MA 1FOD2 5L7OA 4XOGA 2W87A 1DIWA 5EFUA 5C4WA 4UBGA 2NZ9A 5E8AA 5FPBA 1H2KA 1AYN2 1WUVA 4OFGA 2VVDA 1HQNA 3FLRA 2BRTA 1V9U3 2QCSB 4CP0A 1PM4A 3N9NA 4CDUB 4M00A 5FQ0B 1N47A 4HVQA 2B46X 1JMUB 1X8EA 3RG0A 1EY2A 4PQ9A 2BV4A 1YJLA 3LF7A 2HWC3 5I0RA 4XFCA 5CAZA 4M0NA 3DF0A 5D8AC 4DQAA 4E4ZA 3HNBM 5IW0A 1W8FA 1PGL2 2P3IA 1T2XA 1OLRA 1QQP3 1AR81 2WN2A 1L7QA 1XPWA 2OIIA 3GF6A 3LD8A 4R9DA 1WZXA 2DCYA 2GNBA 2ZJCA 4FXGB 4IW3A 2WNEA 4E4DX 3ACFA 3VDCA 4AQ2A 4ASKA 4CCMA 3UETA 4FAGA 1BQPA 4DXRA 1GNHA 5DN2A 2BNOA 3IWZA 4I3GA 1ZBE3 4HPKA 4IE6A 2AZ5A 1H6YA 2D6NA 2AGSA 2RHPA 3WQ0A 1D4M2 3NMBA 4TXWA 4YM1A 1FOD3 3JQWA 5IYYA 4FQZA 1OXCA 3HOBA 4CUCA 5HXMA 1LHOA 2FZ1A 1AYN3 4Y20B 2ERFA 2BW8A 3AX4A 2W52A 4NHMA 1UY1A 1SBDA 3MYXA 4CDXA 2ZKLA 3TEZA 4XE9A 4HK9A 3V0AA 4YW7A 3W20A 1DQ6A 2PHXA 4MGSA 4Z07A 2QKDA 1X9PA 3A7QA 3AKQA 2DU0A 5HI0A 3DKWA 5FPLA 3ZYGA 1AR72 1MS9A 4QX2A 4RHV2 1SFYA 4JX0A 1BK0A 3MGUA 3NV2A 4CPBA 5EYXA 3NKTA 1GYKA 1ST8A 1I3HA 3BALA 3T09A 3O1SA 1ULFA 4ZY9A 4RS5A 2KXLA 1ACCA 1D0HA 2AREA 3KGZA 1KS4A 4I09A 4Y3OA 4IEZA 4KBBA 5EQUA 3VBHC 4CA9A 1IS3A 3AYDA 1QJFA 4XBNA 1FAYA 1XSRA 4YZ5A 2RM22 3VZLA 1CAVB 4IV3C 2ZHKA 1XQNA 1AYM1 3MFCA 5E89A 4CEWB 5D8AA 3B02A 2E7TA 3KWVA 4JHTA 4MGTA 1NLRA 2DCKA 1RUD1 3IT8A 5DUWA 4COZA 3EB7A 1XU2A 3N7LA 5H9RA 3AP5A 5BY5A 2QQOA 1D4M3 1UKRA 4QM8A 3VBOB 1NG0A 4Q0QA 2JWPA 1U5IA 2GNMA 1YC61 4BOWA 4S2FA 4ZPIA 5F37A 3KV6A 3LEKA 1MS3A 4KG8A 3HEIA 4SBVA 3VDBA 2HWB2 3UNPA 3U10A 3U78A 2RDSA 2WZPP 4Q4X3 4OI1A 2P1BA 4MLOA 5IAVA 1STMA 3ROUA 3VBSC 1HB2A 5BPXA 1PGW1 2VMCA 1AR73 1DGWX 5T3NA 2Y38A 4RHV3 1H8TB 3VD5A 4COUA 4LIVA 3GM8A 5A3OA 1UOJA 3LDRA 1DP0A 4I0AA 4PDWA 3PMSA 5BNNC 1K12A 5JMOA 4HVOA 2WO3A 2WS91 2VM9A 1RL3A 3MPBA 1OD3A 4LHSA 4JGZB 2Y8KA 5C6CA 5CVRA 5KHKA 4Y4RA 3HMYA 5J3UA 3R4UA 5KWRA 5EJZB 3IZOA 2D6LX 4AEMA 5FOBB 5ANQA 3JCIA 1JW6A 1MEC1 4XIKA 5C3QA 4YGBA 1BBT1 4YVSA 4Q4W1 3KT1A 4AI1A 4QGNA 4HXCA 1AR92 3K4AA 2X5IC 1KDKA 1E5HA 2OQ7A 2NMOA 2HWF2 5FMCA 2Y6HA 4FFGA 3WINE 1DDLA 2CAVA 3V64A 3ZFGB 1WLTA 3W59A 1EUTA 4P9XA 4WZCA 2WNVC 1WBFA 2HWB3 3ON7A 4FFHA 1W8TA 3CJIB 1YQ2A 5HCFA 5IVBA 3PUQA 4AE2A 4AQTA 2IXKA 4IL7A 1VJ2A 4AL9A 1RMU2 1OKQA 2JB8A 2VW0A 1JZ4A 1TNRA 4AI8A 1MQTC 2HEYF 1VBA1 3WNPA 3D3AA 4W6YA 3X29B 3ZSLA 1VRH2 2Y33A 2W5FA 1RUNA 2RDQA 3AFKA 4M3CE 2LTNA 1W6PA 4MYEA 1GKBA 3A22A 2Y6KA 4GIQA 3WT3A 1UZWA 1W8WA 3POBA 3SH5A 3H8RA 2E7QA 1HXS1 3UT0A 1EPWA 4PQQA 3WR0A 5IVVA 1UY3A 4QKDA 1LHUA 2VZSA 2YB7A 5L7OB 3HWJA 3VDDA 1OPMA 1AR93 1KRIA 5FXZA 4LBJA 1WCSA 3UJQA 3VLBB 1JUHA 2HWF3 2VUDA 2JICA 3MV01 3OBTA 2WA4A 4RR3C 5A3UA 1AHSA 3IKWA 1S4CA 2ADEA 4FOYA 4ZKTB 3M2MA 1RB8G 3VHOA 1HRI2 3PUIA 2TEPA 3E1F1 1X9TA 5A6ZA 1TNFA 5T5PA 4H7MA 1WKYA 5LRSA 1MS8A 3I2GA 1J58A 2JDKA 4K1ZA 4OUSA 3J7HA 4IEYA 3ME2A 2ZHLA 3ZDSA 4FTBA 1DCSA 4HKOA 1CR7A 4COVA 1GUIA 3H3LA 2ZABA 3K4DA 1RUG2 4INDA 1WW7A 1BMV2 1RMU3 1GP5A 3AFGA 5FP3A 5L9VA 2D6PA 3S5QA 1V6MA 3Q8FA 1NX9A 1S0IA 2PMWB 3ZXEA 4OI0A 1IS4A 4BDVB 1JYXA 4DUWA 1AXKA 5F3IA 1YI7A 2GP3A 3FBMA 1DQ4A 1VRH3 3RZZA 2HWD2 1VAKA 4FTEA 4KWUA 3PU3A 3M3OA 2RJLA 1BK1A 2XVLA 5A3PA 4OUMA 2VR4A 4NPLA 1BYHA 1QNWA 4MO3M 5CKQA 4CPBD 4HPKB 5F5QA 4DOUA 1L7LA 4AEKA 5J09A 2KA3A 3WNXA 4AAXA 3UJOA 1UMHA 5JIUA 3M3CA 3PDQA 2D43A 2DWRA 5F3EA 1ZRFA 4QXCA 2FD8A 4AEDC 3T4HB 2VZTA 2PHFA 1JZ6A 4CP1A 4RGGA 5FMOL 1VBD1 4AVTA 4ONUA 1HRI3 5CKNA 4NROA 3V0AB 2WWJA 1YQCA 2RVAA 3OPWA 3PMEA 4NO4A 2FDGA 5A1LA 2GN7A 4CEYA 1ZZ8A 3HVDA 3ST7A 4CU7A 3J9SA 1B35C 1VAMA 5FZCA 3WV6A 3H8XA 1ND2C 2BFUS 2BPA2 3HN1A 4ES8A 1Q43A 4RS5B 4XC9A 1F9KA 3IAQA 5J37A 2WLPA 1HJFA 3H1WA 1MPXA 5IATA 1SLLA 1NKGA 1RUE2 1RUH2 5FY4A 5FZKA 2PHDA 1MVQA 1QJX1 1QOOA 1WCQA 2CDOA 3WNOA 2O14A 4E2SA 2VU9A 1ZZBA 2I74A 2W0XA 4I02A 2ZX1A 2LS6A 2OX0A 3MF6A 2VZPA 4WM8C 1OVPA 2IXLA 4QPIC 5H9SA 3WG4A 2P2KA 5FYIA 3NJVA 3VBFB 5T5JA 1OT5A 1HQWA 1WMDA 2HBUA 2YHJA 3J7NA 1JUIA 3JQXA 3LDKA 4YG3A 3LEIA 3OY8A 5B4NA 2W9XA 2DVFA 4KNCA 2XUMA 3VGIA 5JLVA 2OXBA 5FZGA 4MG2A 1VBB1 4N53C 4CDQA 3ACLA 5I0TA 1X50A 1UPIA 2CHHA 2JG9A 2R071 2AR6A 5FK7A 1CJDA 4LR4A 1CAXA 2JEMA 1UN1A 1V0AA 3FFQA 1YJKA 2R30A 3B9CA 4EJRA 1SHWB 2RR12 1WA6X 4NIAA 3GCWA 5LA9A 2P37A 3FFZA 3IIIA 1UD1A 2XOMA 4PCRA 5M0TA 1ALYA 5A6XA 1MZ6A 1ASJ2 1GMMA 3H1MA 2E51A 4KL1A 1W2TA 5FO8B 2EIDA 2VOWA 4LUKA 4AGGA 2VULA 1H4HA 5C3RA 5FKBA 2FDHA 3WHUA 1CAUB 1LECA 2MEV1 1RUE3 1RUH3 3SHRA 3NNJA 1W3XA 3K48A 5AC92 3ZKYA 4IGOA 5A1AA 5F3CA 2VOXA 4YVSB 3O1UA 4FPHA 1R082 1TZOA 4BXSV 1J84A 3ACGA 5K8SA 3MBWA 1QF3A 2JG8C 4HN0A 4UXAA 5EJ1B 2AC1A 5E6HA 4ZU4A 3ZN6A 2ZEYA 4O65A 4CCOA 3ZMOA 4CXWA 2JD4A 1CAWA 3OUIA 2DVDA 2EAKA 2K0GA 2I2SA 1HV1A 1FPN1 2GC2A 2YGMA 3CF6E 4AZZA 4DUVA 1OF4A 4KH9A 3LPGA 3N9QA 1LEMA 3RS6A 3N36A 2PA7A 2HBTA 3GYDA 2Y0IA 2ZHMA 3GJAA 3NJYA 4XFAA 1OFNA 1BEV1 3J8F2 1ENRA 3CO2A 2WNUC 1YUDA 2ETEA 3QCWA 4AVCA 5JIAA 3SXWA 3MF9A 3VBUB 3DYMA 1OQDA 3ALQA 2RR13 1IS6A 1PIV1 2XKPA 1K5MA 2XLFA 1QJU3 2QQLA 3K46A 5FLHA 1US3A 5FZ9A 3RYRA 3O1PA 1JOPA 4ZS3A 4FI9A 3RZMA 1YFYA 2BGCA 1SACA 4AHWA 1WCDJ 3NNGA 4QKNA 3FLTA 1AZDA 1ULCA 2DCJA 4NR1A 1FMD1 1W6PB 4XDQA 3IDBB 4NAOA 4WM7A 4FPCA 3BU7A 3UK9A 4NHYA 1K42A 1Y9MA 1RUOA 3PU8A 2R061 2EIEA 3S7IA 5LY1A 4CDUC 3FUQA 5AC93 2A6VA 5FXVA 3MW2A 4NIDA 1NY72 4AYUA 1PO21 3TN92 3M3QA 1QH6A 1R083 3DGTA 1ZRIA 1OD5A 4WBBA 3Q9OA 1H1MA 1F2NA 3O1TA 5J98B 4Q4V1 5D1IA 1GV9A 2GC1A 3ILNA 3JBG3 1WMFA 3PURA 4IEOA 4CYDA 1E5IA 2VL4A 3K75B 4MZUA 4IEWA 5DAPA 4S2HA 4JKMA 3NAPB 1YRZA 4H7LA 4XZPA 1AX1A 3J8F3 3NSTA 4AXOA 4BLJA 1YQ6A 1QY4A 4LE3A 4X6RB 3WP3A 4B4QA 5FZEA 2JDAA 3U75A 5LB6A 3WP5A 5EZWA 2AH2A 1SLIA 3C7GA 2FQPA 5CFCB 2XMLA 3GHMA 1MR5A 1W6MB 3PUSA 4UT5A 5DG1A 1XSQA 2J22A 4OZXA 3S6PA 4XJWA 3V0BA 4LT5A 2ZMNA 5AVPA 3T2QA 3OG2A 4IV1A 1W9SA 4P9IA 4BQYA 1LU2A 1Y9GA 4F8AA 2GZWA 1X36A 2Z5WA 2Q8EA 3ZXFA 1YO8A 1AL22 1KFXL 1ND3B 1S0GA 4KWLA 1RUC1 1R092 2RMU2 4A45A 1R1A3 4XETA 2P5BA 4BMBA 1C5HA 1DU3D 2NN8A 3GGLA 3I3BA 3TN93 1PNFA 1DLCA 3Q8CA 3PLQA 4AW7A 1DGLA 2QQWA 1FT9A 1QDCA 3HBZA 5CU1A 2WO1A 5F32A 2RS31 4FXKB 4NN0A 4A2UA 1UOFA 3UGGA 1DQ5A 1XJAA 4GB31 1V6JA 3QH7A 5CEHA 1QXJA 5FQ0A 5JI9A 3L9JT 3H1YA 4P5YA 2HWE3 1G7YA 1DHKB 3OUHA 2LM3A 4QU2A 4CEYB 5JMCA 2BZDA 4AAPA 5FZOA 3ZMNA 3ZVXA 4CEWC 5TSWA 1QU0A 5FO7B 3PIGA 4H3WA 4JDMA 1V6KA 1V6OA 3URFA 1N1YA 3WW2A 1KDMA 1WA4A 1QJY2 3FJSA 3WCRA 3VBOC 4DXZA 4AVBA 1JOBA 2J1EA 3GBFA 3LE0A 4ZU5A 1W9FA 2VNOA 2GNDA 2P3YA 1NE4A 2B8MA 3NJXA 3GZEA 3RRDA 1LOAA 5EWSA 5C33A 2QQNA 2QQUA 3I54A 4LLFA 4XJ8A 4ZU7A 2HH9A 5FYCA 4A7ZA 2WT2A 5ABJA 2RMU3 2WSUA 1OMIA 3I3QA 2UWBA 4TLFA 4QGLA 1O5LA 4XF4A 5F3GA 2ZGQA 4HZFA 4LBMA 4OQ9A 1VAVA 2PN5A 1FYUA 2MHFA 2A3WA 4CZSA 1YLLA 4DINB 5DUUA 4A7KA 4CDQB 2R0FA 4QPYA 4BQXA 1UQXA 3E5XA 5C3OA 2ZMLA 2WO2A 2B42B 4FTSA 2QZ3A 3OSDA 4JGZC 4CRQA 1JYWA 3LFMA 5KHJA 2ZTNA 1G8WA 3AXDA 3EJKA 1GR3A 5DUVA 3IAPA 4DNYA 1Z0HA 4Z1VA 3ITQA 3BKZA 1ULDA 2QBXA 2DDUA 1AR62 3I59A 5EJ3A 1QJY3 3LSEA 2WLQA 2YPDA 3DV8A 3PJQA 2EXIA 3ZSEA 3A4UA 1C4RA 5BYNA 4I2OA 3LA2A 2HEVF 1CAVA 1LTEA 3AMQA 2WUHA 4OQ8A 1US2A 2XJUA 3AP4A 3WNKA 4PIZA 2V5YA 4MHRA 1HRV2 5FZ8A 3CJIC 2P6HA 2E31A 1LKNA 1IPKA 3PUAA 4HETA 2Z4FA 1J3PA 2J1TA 3CMGA 2OW4A 1GP6A 1CAWB 2VMGA 3M70A 3T4VA 3KT7A 1RVF1 5DQ0A 5EXOA 5KXCA 3H50A 4TTGA 4UOJA 2W68A 4GJYA 5A7NA 1HB4A 3QBQA 4IE0A 1TME2 1OF3A 2WINB 4OI4A 2JJ6A 5HPOA 2K46A 2ZGLA 1WCUA 5LEKA 3E5UA 1AXYA 4D6SA 1H8TA 2QDRA 5FMOS 3ZPOA 4K8FA 1VB4A 5IWFA 3SCFA 1FV2A 4B1LA 4BCUA 4D7SA 1GU3A 5L7OC 4OYUA 4XHXA 1XU1A 1YYNA 5FP9A 3P6BA 2EXHA 1AR63 4NIIA 4LKEA 4BQ2A 2DYCA 4DRRA 5C4WC 4YW6A 3BI3A 2IC1A 2W91A 1UZVA 1WMXA 1SPPA 3OD0A 4JGZA 3DXTA 1C8M1 3I2JA 4WM7B 4RFRB 2UU8A 3JD71 2W1SA 3OB8A 1G9CA 1UKGA 2CNAA 3BIEA 3VB9A 1NA1A 4MADA 2D3PA 2XJSA 4LLOA 5IJRA 4ZHNA 1LB2A 1HW5A 2D3RA 1BXHA 1C1LA 1HRV3 2WQ4A 3O0XA 4YG0A 1AR82 1RUI1 1SLTA 3ZSMA 1GICA 4FPEA 5A7PA 1KJLA 1Q8OA 3LIGA 1QKQA 3B93A 3WVJA 4Q8KA 3WG1A 3WF4A 2CGPA 3OUJA 4LO4B 5IHRA 2A3YA 4LO6B 2H6CA 2OUJA 4QQHA 1OLME 1SQ4A 3MLLA 4D3WA 3ZFGA 4DMIA 5J48A 4JGYB 2PFWA 5J96B 1C28A 1TME3 1PM7A 3NNFA 1LCLA 3QD6A 4LK7A 5GZDA 3T3YA 5C8WA 5K7PA 1I5ZA 5FK8A 4Q4Y1 2WDBA 3ACIA 4ASMB 1CZVA 2XONA 2R1BA 1XNBA 5C7GA 3FHQA 2D3SA 5JXHA 2J1AA 2QDNA 2XBO1 1YIFA 3NQHA 5EHDA 3TRSB 1VR3A 4IE7A 3WW1A 1OA2A 4TZDA 1XYPA 5LK7B 1BVVA 5HV4A 1OKOA 1PO11 3UKTA 1ZBA1 2Z42A 3NW4A 1XNAA 2RS51 5A3TA 4QDSA 4UBHA 2X29A 3ABZA 4MH0E 5FP7A 2VZVA 4IEPA 5DAXA 2YUEA 4XFIA 4QX8A 3AZXA 4QKFA 4YW3A 4CDXC 4LKDA 2AEZA 4UF0A 4MV2A 1RC6A 2EXJA 3JZVA 1D2QA 3T0AA 4CCJA 1I6XA 5BUVA 1OH3A 3OPZA 2ZGPA 3AYEA 5FP8A 3WDYA 2RDRA 1AR83 3ZYIB 3LSDA 2CTVA 4HKLA 3T08A 5F7UA 5FYSA 1IHMA 5LBFA 4KU8A 4SLIA 1YFUA 4YM2A 2CL2A 4RS5C 1AYM2 3OD4A 2Q0AA 2VCBA 4MXWA 1C5IA 2VC9A 4CP9A 4OHYA 4M4RA 1C57A 4GAZA 1HV0A 4MGZE 1RUD2 1CESA 4D7TA 5FZOB 1W0PA 3ATGA 2ZMKA 1KEXA 3J26N 1VBE2 4QHOA 3ZO0B 2E53A 4JDOA 3PVBB 3JU9A 3HN3A 3R4DB 1KD7A 2PLV1 1BKZA 2BGOA 4EE2A 4TWTA 3MIEA 1JZ2A 3BU0A 2D7FA 4XFHA 5DPNA 3GZAA 2Y64A 5FP4A 2V5DA 3OGGA 4NVPA 1PVC1 1UAIA 4R9CA 4QDQA 4Y26A 4XFBA 4YW5A 4LKFA 5FZIA 1PGW2 5CFDA 4QQOA 3RZKA 4Z2AA 5ABJB 4HLTA 1S2KA 5HCHA 5IFTA 4KGGA 1UYYA 2OS2A 1IQDC 4QX3A 2WS92 1GP4A 1MS5A 1W2UA 3H42B 1RXFA 1GZWB 1S0JA 2YPJA 4FP3A 3PVEA 4XFFA 4PDWC 5GLWA 5A7QA 1A6CA 5KR7A 4QPGB 2VW1A 4M3CB 2BVBA 4LA2A 3WG3A 3ZXLA 1AXZA 1V9U1 4C1WA 5FTTC 3ZFEA 1AYM3 3PHMA 2DCTA 2FMDA 2VBBA 4YM0A 4ARXA 5JOXA 1MEC2 3IB3A 4PI2A 1BBT2 4B29A 4Q4W2 2YDEA 1SEFA 4LOTA 4N9HA 3T1LA 1RUD3 5LBBA 4ISQA 2DURA 3BPSA 2VZUA 1OPOA 2UWAA 2WC2A 3CQOA 4YGEA 5IVYA 1VBE3 5JCTA 1RJ8A 4YVSC 1Z7S1 4L97A 4OHZA 3DECA 4QQPA 1MS0A 2GC3A 4TSVA 1QQP1 1UIKA 3HNMA 4Y5TA 3I59B 5C71A 4LOSA 5FWEA 2Q1ZB 1MS1A 2Z69A 1H1AA 4A42A 5FZ6A 1ULOA 2VZOA 1TG7A 4NRQA 3AJZA 1W8ZA 2JDPA 2I45A 2V4VA 1NLSA 3F2ZA 2OYZA 5B4XA 5A6YA 3KSCA 5F6KA 4N7UA 1NLQA 1V6IA 2B39A 3I2IA 1VBA2 3VBFA 1H4GA 2JDHA 2W95A 1GWMA 2JB4A 2OQ6A 4META 3ZOIA 1FOD1 4YZ4A 2RJKA 4JKKA 5I8TA 3ZR6A 3POFA 4DO0A 5GZGA 4BH9A 2WS93 3TOJA 3FE5A 1F4AA 1YQ5A 3EMRA 4RQPB 3U4SA 4ATFA 4XF9A 2WKKA 3VZOA 3ZXJA 2JDNA 3ZIXA 4LORA 2VECA 2OUHA 4RA0A 2YMZA 5DABA 2F6BA 4F83A 1W90A 3AKSA 1VLNA 1MEC3 4L8QA 2B7YA 1BBT3 4LXLA 2E32A 4S2GA 2FCVA 4Q4W3 3D6EA 5EV7A 4PIYA 1YWKA 4Q0PA 4LIUA 2BBVA 1MS4A 4MHUA 1OOPB 3I2OA 2J1RA 1EUUA 2YBPA 1YXWA 3RI8A 2VTXJ 4XAAA 3CZUA 3NKGA 3WF2A 4NUBA 5FJKA 1K45A 3TAYA 3N9MA 2CSGA 3VDDC 4IEUA 4B7EA 4UFIA 1E5RA 1UPSA 1FX5A 1X33A 1SPPB 1FNZA 1CAUA 2QQMA 4FO9A 1XOYA 3FLPA 1SLAA 2A6ZA 2RM23 4J25A 4A6OA 5F5IA 3VZKA 4RD7A 4OZOA 4Y4YA 1NA1B 4XXAA 2R49A 3RZGA 2NYYA 3DEMA 4CCLA 2WYFA 3W5MA 1UMIA 4ITCA 2BERA 5HCAA 3WQBA 3WG2A 3ZYPA 3NRUA 1AVBA 1VBA3 2G1MA 4LMFA 4YSFA 5JR7B 1D4VB 3LCPA 1T6GC 2V72A 2BEOA 4YRDA 1EAH1 4O61A 4Y5Z0 4DXSA 2VE1A 4XJUA 1S2BA 1CWPA 1W0OA 2G19A 3RNSA 3PL0A 2WA3A 4XF1A 5LK5A 1WBLA 3VKOA 3Q8EA 3SKJE 2CYFA 3B9IA 1VPHA 4YW4A 3R0RA 4XILA 5A3WA 4CCCA 4Q4X1 4BLIA 3VBUA 4BXFA 1UXZA 3R4SA 3ZFEB 5ACA1 3LA3A 3TEWA 3ZR5A 2PHLA 2W3JA 2C4XA 4DB5A 1NCRA 2R16A 4X6QB 4OHVA 1W8HA 3MFAA 1W8OA 2ORXA 1VBD2 4AGVA 3PTYA 5LBEA 3ZXDA 4WZFA 2VNGA 1UU4A 4BJ0A 2QUOA 1JHJA 1UMZA 4O7XA 2NP0A 4H55A 1XE0A 1H6XA 4MGQA 3O0VA 3CU7A 2L9LA 4UF0B 4B4RA 1BZWA 2X09A 2VQAA 2Q8CA 5CADA 1KGYA 3W5NA 4CEYC 5JR2A 2VMEA 1ENSA 2X05A 4K7JA 4K9SA 2VMIA 4QXKA 4L9BA 2JDYA 4QQLA 4XUQA 2WT1A 4MUVA 1DFQA 3RDIA 2C26A 2QQIA 4PT6A 1NT0A 1QJX2 4P9WA 2UURA 3AMPA 4XABA 3B00A 4MXWB 4YGDA 3HIFA 5BXXA 2XQRA 4CP9B 5A1FA 3NAPA 1PK6A 2FCTA 2GH8A 3B5LB 3W21A 1O5UA 1POQA 3TEXA 3HJRA 1DYPA 2Y34A 4D94A 3PJYA 4L11A 4FSJA 1DGRN 3E6BA 1LULA 4GH4A 2ENRA 4Y1UA 5CFCA 4BISA 1IZ3A 1VBB2 1W6MA 2PTMA 1O59A 4B1MA 2XKOA 2QQKA 1H1IA 2R072 3MUZ1 3AZWA 4XUOA 5GM0A 1DBNA 3FHAA 1NZIA 5FXWA 4BZ4A 4ZXKA 5FJHA 4MGIE 4GXLA 4JTOA 1VBC1 4C0BA 1ULGA 3RGBA 3FN9A 4PLNA 4CDQC 4XQWA 5CFDB 1ND3A 2JG9C 3KD4A 4YVWA 3UESA 4RGAA 5IAXA 2A5ZA 3PVOA 1W03A 2FDJA 5DDJ1 4LHKA 3ZN4A 2AACA 2VQ0A 2KD7A 2W92A 2XUEA 3SISA 4Y1YA 3M1HA 3TWIA 4ES9A 5LWBA 3M3EA 2HWF1 2FMYA 3GNEA 1K3IA 1E5SA 1UWWA 2MEV2 3KCCA 1JODA 1P8JA 4K6BA 5GLTA 4CE8A 4R4ZA 1QJX3 4XDPA 4YW1A 1ZZ6A 2YU2A 1IPSA 1MZFA 4FPFA 4HVRA 2CU5A 4LBNA 4ORFA 5LATA 3T2TA 3S5AA 2VUAA 1R1ZA 1JH5A 1CVNA 1YI9A 1OVSA 3AXEA 1U5ZA 3IM0A 4BMEA 1G9BA 5CG8A 2VY0A 1RUG3 3W9AA 3AVSA 3P3NA 1Y43B 3WDWA 4Y5SA 2VCCA 3N3HA 5LEJA 2FHRA 4FPGA 4D6QA 5C8CA 1FPN2 4XMAA 1WD3A 1O3RA 4N43A 5JSRA 5T55A 5AFEA 2HWD3 2ZAHA 3B01A 4QPWA 3ZYRA 3ZFFB 2R073 5JZGA 2VQTA 1BEV2 1JI6A 2AENA 3A21A 2Q5TA 5T52A 4DEQA 4QMAA 3SCHA 1NQJA 5KBFA 1LU1A 2JX9A 1HJGA 2RS11 3RMYA 4BK5A 3K77A 1D2SA 3SNMA 3THPA 3VUOA 4ZXEA 1PIV2 5ANNA 4XF0A 2GC0A 1JBCA 2ZX0A 5GZCA 4GZ9A 2EVXA 1OQ1A 2WIIB 1IKQA 3R6SA 3ETPA 2YXSA 2ZACA 4I3PA 4L2NA 5A7WA 3KF3A 1FMD2 1K5MC 2WNOA 4KU7A 4DY3A 4GQ7A 4C1XA 2XXZA 2VCMA 4GMP1 1EV11 5FPVA 4M0HA 2AUYA 2R062 2ATFA 2LUWA 2YG0A 5CYYA 4U2AA 3HD8B 4WM7C 3C7HA 4AI0A 3POJA 1YIPA 3WW3A 1PO22 4IUGA 4UFHA 4AK3A 2P3KA 2XJRA 3IDEA 4EN7B 1QHDA 4OI2A 4JRAA 3HT2A 1W6QB 2VMFA 3ES4A 4Q4V2 3OBZA 1A8MA 2A6WA 3WDVA 3DKQA 1FPN3
chains in the Genus database with same CATH topology
2JENA 3TYJA 1ZRCA 3R05A 3ILRA 3INAA 4MVTA 5I93A 4YW2A 3ZIWA 4AFCA 1IS5A 3GBWA 1BEV3 1AX0A 5I0SA 3VV1A 3AKRA 1X7NA 3LZZA 4AQSA 1UU5A 4DZGA 4Q0VA 4IQPA 3C2UA 1GFF2 1GSLA 5KXDA 1OHFA 2GDFA 2EALA 2CGNA 3DPRA 1NE6A 1FMD3 2XG3A 2UYBA 2R063 1AX2A 5BNQA 3MIFA 2O0OA 1I1EA 2CGOA 1RUC2 2VOVA 5BNOA 4IV1C 1TQ5A 2UYAA 4V1PA 1TMF1 1UX6A 3VHRA 1COV1 4HANA 3VHNA 1NCRB 4Q4V3 1ASJ3 2RS32 4LE4A 2XJVA 4GB32 1CGPA 1H2NA 3WX5A 5FAXA 3N4MA 2IXIA 3VHPA 1SBFA 2ET1A 2PELA 2NPIA 1QOTA 3GZTB 2QJVA 4IETA 1MZEA 1H9PA 5GLUA 4BM8A 2EIGA 3CEWA 3THTA 2JKBA 4BWOA 5KC6A 1G9AA 3WLUA 1WMEA 1TE1B 2ZPXA 3OTFA 3MIDA 1QDOA 3ETQA 5F9TA 4JGYA 5GALA 5CG9A 1PK6B 2WFF1 1RUC3 1N3OA 3U07A 1ONAA 4NHLA 2PHUA 5BNPA 4AHXA 1WGPA 2C0ZA 3ZYJB 2TBVA 4GH4B 1XNDA 5ABJC 4R9BA 1QJU1 1FI2A 2BYVE 4QHBA 2EA7A 1H9WA 2YC0A 4GB33 4OLLA 4P9YA 4K20A 3ECQA 1O4YA 2C5DA 2A6XA 1GZCA 4XYXA 4YZ3A 1LJ7A 2ET7A 1REFA 2Y26A 4HT1T 2ZGTA 1DYKA 4FVVA 4YVWB 3VL9A 5HXVA 3ZXGA 5KHHA 3SCGA 2OPKA 1POV1 4FCAA 3VZMA 2ZGMA 2WNVB 1H30A 3JBG1 4AHZA 5CBLA 4BIOA 2QQPA 2D6KA 1RUJ1 2RE9A 1HKDA 5JSOA 5E88A 1AJOA 2HKXA 3B7MA 1CPNA 2ILMA 3BOWA 1LHVA 1XE7A 4Q27A 3VKNA 4GKYA 3G6JB 5CA6A 3O14A 3OBRA 4YGCA 5C8CB 1WW4A 1RVF2 2D6MA 2ZGOA 4MX3A 4N43B 2GNTA 5JZGB 4QGMA 2R041 1DQ1A 4RQPC 1U12A 2XJTA 2OA2A 1GBGA 1J1TA 1QH7A 4FPYA 3M7AA 4YZ2A 1AL23 3KZ4C 2I07B 1R093 4I0BA 2TUNA 3E6CC 2JXAA 1R1A1 1LOFA 3WUCA 3B3QE 3MLKA 1JHNA 4EWAA 4Y1VA 3C3VA 1H8TC 2BTVC 2IXJA 4G4FA 2XH6A 1GZWA 3AP7A 4BQ1A 2DVGA 2SBAA 3IIAA 3M8LA 4EN0A 4FPOB 1C8M2 4LEJA 4QPGA 2V09A 3JD72 4M3CA 4A7YA 4D69A 1GZ9A 2DFBA 1RGSA 2B45X 2GMEA 1NCQA 1MACA 3NV1A 4W65A 2HWE1 2ZX4A 5GZFA 3AP6A 4HBNA 3KT4A 1RUI2 2XJQA 1NA1C 4N9IA 4XMIA 4AVSA 1IOAA 3M3IA 4BYYA 1Z78A 2PQQA 1UW8A 1RVF3 2ES3A 2XVKA 1FATA 3H7YA 3USUB 2A7AA 3SMHA 4Q4Y2 2PAEA 3AB0A 3ZFGC 3GZUC 5DG2A 4Q1RA 3NVCA 3POYA 3CJXA 5L36A 4KQ7A 2XBO2 3WZ1A 1UU6A 3RSJA 1EPZA 5C9AA 3DPRB 5K0UA 4FOWA 1PO12 3H3ZA 1ZBA2 2X8KA 3G7DA 2RS52 2VVEA 4RQPA 3W58A 4LO8A 1LR5A 4PJYA 3JD73 2PAMA 2GAUA 5GJ6A 4DY5A 1ZYBA 1A3KA 1F8VA 1RJ7A 4LO5B 4Z92B 4Q26A 1B35B 5BNOB 1ND2B 4WVVA 2O8OA 3ZXAC 5JPMB 4GWMA 1OOPA 1RUI3 2A3XA 2WSVA 4C0HA 2E63A 2PHTA 3D0SA 3FX3A 3KB5A 5GKAC 5J7MA 1CONA 1O91A 1RUF1 5IK7A 4IEXA 1Y7BA 1APNA 3I4IA 2ZBJA 5JOZA 1PNGA 1HDKA 4ISRA 4U36A 4Q4Y3 5SV8A 1G6NA 3VBRA 1DZQA 5BV6A 3AZZA 3NV3A 1D0GA 1I9RA 4P5HA 3E5QA 1ZREA 2EF6A 2GMMA 4QT6A 1QNYA 4KG0A 3EQEA 2ARBA 2XBO3 2DFCA 4XFGA 4AI8A 3D4KA 3POSA 4XJ9A 1AF9A 1BJQA 1PO13 1ZBA3 2C9AA 2RS53 4AG4A 1PVC2 3L2YA 3NJZA 1IKPA 1LENA 2ZCWA 4XIOA 4RFT0 2ZGRA 3OYWA 2CV6A 4AI2A 3FMGA 5T5OA 3WDUA 3EO6A 4MSVA 5BNPB 4AQ6A 5T50A 5CFDC 3POWA 2Z79A 1QOSA 4FOQA 4EWDA 3BPZA 4CDWA 1W6NA 4BPZA 4JDNA 4IEQA 3LAGA 1V9U2 2WZR1 1NXMA 3WW4A 3MZHA 4AWDA 5FO9B 2FZ2A 1PGSA 4EWEA 4B4PA 2ZGKA 5GLVA 2PHWA 3SITA 1ZM1A 3WY6A 1NXD1 3ZFEC 1KS5A 2R1DA 2WT0A 3LOBA 2R0HA 1Z7S2 4FP2A 3USSA 1JOJA 1QQP2 4YNIA 1RHI1 1AJKA 1OSGA 4ATEA 2E7AA 1UF2C 1LEDA 3MLJA 1KFUL 1PVC3 1YFWA 3LA7A 3B94A 4R4XA 1XNCA 3WOGA 2IWGB 4S2DA 2LALA 1REEA 2BVVA 1OI6A 4NOTA 4NHKA 3QH6A 3VBFC 4Y22B 2WL1A 4JAAA 5JOYA 1WW6A 2BNMA 1IPJA 3AKTA 2CWMA 2IXCA 4FBFA 3FWEA 4I01A 1BVP1 2DCZA 5L19A 3FZ3A 3WQ7A 1QGLA 4LA3A 4UW5A 3KCYA 4K40A 4LULA 2VMHA 4Q2FA 3AK0A 5GZEA 1QMJA 4CP2A 5A33B 1Z7S3 5DUXA 3TBDA 4LBOA 2YV8A 4DFSA 2Y0OA 1ZZ9A 1RITA 1BCXA 2G4IA 2YROA 1J3QA 3AMMA 4XJAA 5A32B 5DZFA 3CLPA 4E27A 4LTAA 2CAUA 1NCQB 4F3JA 3AKPA 2QVSB 4G9SB 2ZA9A 3UKVA 1X8MA 4C91A 5FLIA 1DZTA 5HCBA 2HWC1 4PBPA 3E97A 5F6LB 3S0MA 1AUYA 1O4ZA 3D82A 1EAH2 2ZZQA 4PLMA 3ZN5A 4EROA 2XL7A 2QE3A 3AMNA 5KHGA 1V6LA 1V6NA 1XNKA 4UW6A 3UL2A 1DGRA 3ZFFA 3FC0A 4Q4X2 1N1TA 1PHMA 3RYPA 4JQRA 5CNAA 3B69A 5ACA2 1ZBE1 4JRLA 1QJZA 1CJPA 3I2DA 4W6WA 1E57A 3VBUC 5C9AB 3SLIA 1NQDA 5K0UB 4R9AA 1S0DA 2VNRA 1W6OB 2BWAA 1IGOA 5SV5A 4R8HA 2DF7A 1NCRC 4WVMA 1AYN1 3KS7A 4Q8LA 2DTYA 1JN2P 3JUUA 1HXS2 4URTA 3FUOA 2OVUA 5FRAA 4J6GA 2SLIA 3FBYA 3ZX7A 4ASLA 3SH4A 1ZA4A 1W6QA 2EAAA 2WJSA 4E9KA 1VBE1 3V56A 4LUMA 1EAH3 4JV4A 4XEZA 1PGL1 1VALA 1LHNA 5H9QA 1J59A 2ZHNA 2DVBA 4GWNA 4PF5A 3T1MA 1Q3EA 4M01A 5FLJA 4GKXA 5E16A 3VBRB 1W39A 1O7FA 2XL9A 3NAPC 1PK6C 1U5XA 4FPLA 5ACA3 5I8YA 1D4M1 4Q29A 1J3RA 1KQRA 3H7JA 2WWSA 4N7IA 1DLLA 1B09A 2D5HA 4AFDA 4GH4C 2P17A 1YHFA 5CFCC 1IQAA 5DZEA 2A75A 1VBC2 3MIBA 1HXS3 1DZRA 3IDCB 4JTNA 2R32A 3OYWB 3RPQA 5DDJ2 2QNKA 1Q56A 1YNAA 1AR71 1ND3C 4YVWC 4RHV1 5CB7A 1V00A 2NQYA 3GHNA 2KM2A 3VBHA 4Z82A 4CDWB 4D7YA 1W6NB 1GANA 1LOCA 1WLWA 4LO7A 3IBMA 4IV3A 3QOPA 1F5JA 1S0BA 1KITA 1ZRRA 2ZGNA 5FDBA 1CPMA 1SFNA 2C1FA 2RM21 5I0UA 3DL3A 1CQ9A 3KQRA 4GA9A 4OHWA 1GLHA 1N3PA 2QZ2A 5I91A 3VZNA 1UL9A 1RTVA 3NL1A 2VUJA 1DG6A 1XXNA 3WP6A 1WLCA 5C8CC 1REDA 4XQDA 4JCKA 3VBSA 1ENQA 1VBC3 4N43C 2X53S 2RS12 4BA6A 3HT1A 5JZGC 1PMIA 4Q0UA 2HWB1 3ILFA 2IFRA 3WCSA 2B5HA 5F1RA 2BWCA 4IXLA 4YYOA 5B2GB 2GN3A 5L73A 3MW3A 3QACA 1S55A 5BNNA 5DDJ3 4FAHA 2ZZJA 2A73B 4IERA 2E9QA 1SLCA 1RINA 4Q0SA 3RMXA 4E4SA 1G86A 5C4WB 1WW5A 1TEIA 4DS0A 1EV12 3RJRA 2ARXA 2OZ6A 1VBD3 2PHRA 3RWNA 1A8DA 4XXPA 2BQPA 1DQ2A 2D93A 2JE7A 1CIWA 5JSPA 2VGDA 3LOIA 2X5IA 3LKJA 3APBA 3RQ0A 2XWJB 2D40A 4LHLA 4XPVA 2TNFA 5I8SA 4AHYA 1RIRA 1AR91 3A0KA 2XWBB 4AVAA 2YYOA 3AZVA 2GALA 1J1LA 3AJYA 4DPNA 2WNVA 3TB0A 3KMHA 3BCWA 4HK8A 1FXZA 1XRUA 5AVAA 2RS13 4K3UA 1S0EA 3D8CA 2O1QA 2A70A 1MQTA 5KC5A 1HX6A 5JVVA 3BB6A 3IPVA 1RMU1 4RSUA 1VBB3 1AL0G 3AYAA 3IN9A 3ZSKA 4GMP3 1EV13 3AP9A 3MIHA 3DPRC 1VRH1 4MXVA 4R52A 3ZXKA 4Y1XA 4QX5A 2YZ4A 4CDXB 2DUOA 2DVAA 2IFWA 4QD2A 3A0NA 1ZVFA 3MPPG 3AMHA 2XVGA 1PZ8A 1G9FA 1TMF2 5DXDA 1HLCA 1COV2 5BNOC 5T54A 5JPNB 4RR3A 1SDWA 3HR9A 1LGNA 3NWKA 3ES1A 1PZ7A 3MW4A 3LWCA 2GU9A 4WVMB 4B3NA 2PYTA 1YCIA 2MEV3 4HSLA 4W6XA 1Q8QA 1U0AA 3VKLA 3ZPYA 1HRI1 3U11A 4AFMA 1LGCA 3M4FA 1Q8VA 3LGRA 5D8AB 2VXRA 2F4PA 1ZX5A 1LODA 4NWWA 1SMVA 2NM1A 2DUQA 1GQGA 4GMP0 3SH3A 3NO8A 5JOWA 1RUG1 4Z2WA 3OCPA 3H8UA 1BMV1 2ZGSA 1NOVA 5FFOC 1PVXA 2DV9A 3J4UH 4F7ZA 3ELNA 1LHWA 1G9DA 1KXGA 3KGLA 1DF0A 4OVEA 4XF3A 4XJZA 3USUA 2HWD1 2Q1MA 1U5YA 1A78A 4P9JA 2WFF2 4HSJA 3AYCA 3MI8A 4JGYC 2NLRA 2A6YA 1PIV3 1TMF3 4AEDA 1QJU2 2DU1A 1COV3 4WVZA 2VVFA 4PDWB 3S7EA 1Y9QA 2GH2A 5BNPC 5A3MA 1C8NA 3S30A 2D5FA 1HQLA 1OA3A 3EXUA 2A71A 5KXBA 2VH9A 4NPRA 4K1YA 3PVNA 1B35A 3WUDA 1ND2A 3WDTA 4NWVA 2E6VA 1PO23 4J1XA 2UY8A 2D6OX 3HQXA 3AM2A 4YM3A 5A3LA 1XYNA 5FCCA 3VBHB 1JTZX 3JBG2 4IV3B 1Q5OA 1QXPA 3VN4A 4AF9A 1RUJ2 4AI3A 4KWKA 3DN7A 2FBEA 4BE3A 4XQ4A 2WFF3 4O9GA 4WM8A 1RUE1 1RUH1 4LBKA 4QPIA 1ZNPA 2DTWA 5EYYA 1OA4A 2JE9A 4YFZA 4HFSA 2D44A 3O12A 3ASIA 2R6QA 5JWPA 2N7GA 1ZZCA 1LRHA 3MDPA 4UW3A 2XHKA 2V73A 2Q30A 4N53A 1DGWA 4E2GA 1GQHA 3KCXA 2R042 2MNGA 4FPKA 4P9LA 1PZ9A 2XJPA 3VBSB 1C1FA 3CL1A 4KGQA 4Z8BA 3N7JA 3CNAA 3V65A 3UV9A 5FOJB 2Z2SB 1H2MA 4K21A 3VZJA 4OHXA 4L92A 3VKMA 4Q1PA 4Y24A 2ZOEB 4YG6A 1R1A2 4B8EA 1O3QA 3VL8A 5BNNB 1NZCA 4LBQA 1HIXA 5HBAA 3QLQA 2B9UA 4I0WB 1CN1A 2RR11 2QFEA 4RL7A 3VDDB 1POV3 3KLSA 1OQEA 1LOFC 4I30A 3MIGA 2RS33 1ASJ1 4FT8A 1DQ0A 1ENXA 1Q8PA 2CY6A 2P34A 2UY9A 3EHKA 4L99A 1RUJ3 3H0OA 5K9YA 4QPGC 2HWE2 3MICA 3O5SA 1N1SA 2X5IB 2JG8A 1UZYA 5AC91 4N90A 1NCQC 2HYKA 4Y1ZA 5FBZA 2D98A 3WDXA 1S1AA 2DUPA 1WD4A 1XYOA 4H14A 1R081 4IESA 3WP4A 1GNZA 3OF1A 3IMNA 3BOPA 5IK8A 1WCKA 1FV3A 4XW3A 2PAKA 2K9ZA 3ENRA 2R043 4BIFA 2WQZC 3I8TA 2WNUA 2BNNA 2ZX3A 5IK5A 4UW4A 4QM9A 1L3JA 1POV0 4COYA 3J8F1 1MQTB 2Q4SA 4HKWA 3IPVB 1OLQA 3RYKA 4AEJA 4EN8B 4YLZA 1SCRA 1F31A 4Y22A 5C9AC 5T5LA 5K0UC 4LNVA 4CDUA 4GULA 2Q8OA 3BTAA 4C90A 2XB6C 1LGBA 2VG9A 4PLOA 2IXHA 5A33A 1NY71 1LESA 4RR3B 4X8NA 2VOKA 3TN91 5IT6A 2XPJA 1RUF2 1OOPC 4MGKE 4PBOA 2G9FA 2W08A 3OGJA 5FPZA 4COWA 5A32A 2ZGUA 2HEWF 5LRRA 4EN6B 4MGYE 1QWRA 1SBEA 2JDZA 3WHTA 3D0JA 2H0VA 2XGXA 4DRVA 1LOEA 3K51A 4AGRA 2GSYA 5FREA 3JB4C 3VBRC 2JECA 4AFBA 4E2QA 4HL0A 3OJBA 1VIWB 4FQ4A 1LOBA 4P9GA 3OY8B 4B7KA 2H0BA 3HAGA 3DUIA 3BIWE 4Y20A 2BUKA 1UIJA 3H9AA 4BHPA 4WV8A 2JG9B 5GLZA 2WFPA 3EBRA 3N7KA 1CAXB 2HJIA 3NV4A 1CD3G 2EXKA 3KM5A 2CWSA 1OFSA 1AL21 3GBGA 2ZX2A 4HN1A 3AZYA 3FHIB 1R091 4X8PA 4AEDB 2RMU1 4IEVA 4LHNA 1YFXA 1H0BA 4TYSA 5H9PA 3WQ1A 5FPXA 3MEPA 2WZR2 2YGLA 4AFAA 1W6OA 1RUF3 5JDBA 1S0CA 3ZSJA 1MVEA 1JXNA 1XE8A 1C8M3 4CDWC 4AVVA 1V70A 2ZKNA 4YZ1A 1EYBA 3P3PA 1M4WA 1Y3TA 3O7OA 4EV0A 2ZAAA 2VW2A 2YY1A 5DZGA 4CEWA 2VPVA 4XHBA 2XLAA 3UKNA 2D97A 5J36A 1QXRA 1VP6A 2AYHA 3VBOA 1RHI2 2O8QA 4J1WA 4G3YC 2NMNA 4P14A 3ZN6B 5JAXA 4FOVA 2XLGA 1FNYA 4XTMA 4EN9B 3GALA 5E1RA 1QJY1 3TNQA 1F5FA 2P3JA 4WM8B 4QPIB 3I7DA 1NYWA 3TNPB 4XBLA 4GALA 4LBQD 1N1VA 5IK4A 2MPFA 1JYIA 5KXEA 4JVAA 1CX4A 4A3XA 4PIXA 1K5MB 2PLV2 4M3CF 1S0FA 4FPJA 3E6DA 3BODA 4N53B 4OULA 2IZWA 2WZR3 1LOGA 5KHIA 4XTPA 3WD5A 1SCSA 1EP0A 1H8VA 3N35A 5IUQA 5JI7A 4CTEA 3WXPA 1X82A 1O3SA 4WVWA 1VB2A 3D5OA 1C3HA 2OZJA 3JB8A 4LBQB 4QQ2A 1RHI3 4LBLA 4JC1A 1UCXA 1ZRDA 1O4TA 4YARA 3VKFC 1AR61 4KWJA 4YFWA 1UZZA 2BFUL 1Q8SA 3CJIA 3RJ2X 3L2HA 2HWC2 2H6BA 1WLDA 2ZS6B 1URXA 2JG8B 5CIRA 3LB9A 1KJRA 2G9GA 1HRV1 1ULEA 4O9EA 4XBQA 2PLV3 1O3TA 2GMPA 3V0BB 2UWCA 2K2SA 1ZZ7A 1M06G 1N3QA 2WNUB 2W39A 3U0ZA 4IV1B 3RI9A 1TME1 3H3UA 1SLBA 3ZFFC 1MZ5A 1ZBE2 1JYCA 1H2LA 3PNAA 3U4XA 4HMZA 3O0WA 3N7MA 1FOD2 5L7OA 4XOGA 1DIWA 5EFUA 5C4WA 4UBGA 2NZ9A 5E8AA 1H2KA 1AYN2 1WUVA 4OFGA 2VVDA 1HQNA 3FLRA 1V9U3 2QCSB 4CP0A 4CDUB 4M00A 5FQ0B 1N47A 4HVQA 2B46X 1X8EA 3RG0A 1EY2A 4PQ9A 1YJLA 2HWC3 5I0RA 4XFCA 5CAZA 4M0NA 3DF0A 5D8AC 4DQAA 4E4ZA 1PGL2 2P3IA 1OLRA 1QQP3 1AR81 4R9DA 3GF6A 2OIIA 2DCYA 2GNBA 2ZJCA 4FXGB 2WNEA 4E4DX 4AQ2A 4FAGA 1BQPA 1GNHA 2BNOA 3IWZA 4I3GA 1ZBE3 4HPKA 2AZ5A 2D6NA 2AGSA 2RHPA 3WQ0A 1D4M2 4YM1A 1FOD3 3JQWA 4FQZA 1LHOA 2FZ1A 1AYN3 4Y20B 2ERFA 2BW8A 3AX4A 2W52A 4NHMA 1SBDA 3MYXA 4CDXA 2ZKLA 4XE9A 4HK9A 3V0AA 1DQ6A 2PHXA 4Z07A 2QKDA 3AKQA 2DU0A 5HI0A 3DKWA 3ZYGA 1AR72 1MS9A 4RHV2 1SFYA 3MGUA 3NV2A 5EYXA 3NKTA 1GYKA 1I3HA 3BALA 1ULFA 4RS5A 2KXLA 1D0HA 2AREA 3KGZA 1KS4A 4I09A 4IEZA 4KBBA 3VBHC 1IS3A 3AYDA 4XBNA 1FAYA 4YZ5A 2RM22 3VZLA 1CAVB 4IV3C 2ZHKA 1XQNA 1AYM1 3MFCA 5E89A 4CEWB 5D8AA 3B02A 2E7TA 1NLRA 2DCKA 1RUD1 3IT8A 5DUWA 4COZA 5H9RA 1XU2A 3N7LA 5BY5A 3AP5A 1D4M3 1UKRA