5JSRA

New mechanistic insight from substrate and product bound structures of the metal-dependent dimethylsulfoniopropionate lyase dddq
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
190
Chain Sequence
b'MTLENVLEAARHLHQTLPALSEFGNWPTDLTATGLQPRAIPATPLVQALDQPGSPRTTGLVQAIRSAAHLAHWKRTYTEAEVGADFRNRYGYFELFGPTGHFHSTQLRGYVAYWGAGLDYDWHSHQAEELYLTLAGGAVFKVDGERAFVGAEGTRLHASWQSHAMSTGDQPILTFVLWRGEGLNALPRMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethlysulfonioproprionate lyase DddQ
molecule tags Lyase
source organism Ruegeria lacuscaerulensis (strain dsm 11314 / kctc 2953 / iti-1157)
publication title New Mechanistic Insight from Substrate- and Product-Bound Structures of the Metal-Dependent Dimethylsulfoniopropionate Lyase DddQ.
pubmed doi rcsb
total genus 54
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 4.4.1.3: Dimethylpropiothetin dethiomethylase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16867 DMSP_lyase Dimethlysulfonioproprionate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jsrA00
3OTFA 1YFYA 4Z82A 2EVXA 3LA2A 3H7JA 4AQ2A 4HSJA 1ZZ6A 4I02A 4ZU4A 4B29A 3CLPA 3OF1A 3CL1A 3BALA 5I0UA 4O9GA 1SEFA 4IEPA 1ZZBA 2FMYA 1DGRA 5FQ0B 2UY8A 5FPZA 1ZRDA 4MGKE 4PJYA 3SHRA 4YRDA 4XFHA 5CADA 4HVOA 2CGPA 2VPVA 3H3UA 4R52A 4LTAA 3R6SA 4I3PA 1WA4A 2DCTA 3NVCA 2B5HA 2BGCA 2BNOA 3DL3A 4XEZA 3ST7A 4ZU7A 1RTVA 2ET7A 3E6BA 4GULA 2GAUA 1GQHA 3O14A 3IWZA 5LEKA 4QM8A 4FAGA 2ZKLA 1DZRA 2QCSB 2UYBA 1O3QA 3U0ZA 3NW4A 1UIJA 1CAXA 2WC2A 4L11A 4E2SA 1YFUA 3L2HA 5CU1A 4O9EA 2IC1A 1CAWA 2PQQA 4MH0E 3ES1A 3S0MA 2GC1A 4WVZA 4K8FA 2N7GA 4MGYE 1Q3EA 2PHDA 1VJ2A 4I09A 3JZVA 2PAMA 4PIYA 4FAHA 4E2GA 4D7SA 5EFUA 2F4PA 5I8TA 4LEJA 3KMHA 3RYRA 1O7FA 3D82A 4I0AA 4XFAA 1WLTA 2IXCA 4KU8A 4IEZA 2OA2A 4AVCA 1CAVB 2BEOA 4XFIA 1QXRA 4QGNA 3EQEA 2IXKA 4ZU5A 2Q30A 3KCCA 2V09A 2QDRA 5C8WA 5KHKA 4PIZA 5FLHA 1OI6A 2Q1ZB 3EJKA 4LUKA 4UBGA 1J58A 4IEVA 5JSRA 4NVPA 4YARA 5F1RA 1O3RA 1QXJA 3PLQA 4IEYA 1UD1A 1Y9QA 3I59B 3ROUA 3SXWA 2ETEA 3U11A 4BH9A 2Z2SB 4HBNA 5BPXA 1ZRRA 1EYBA 5E1RA 2OYZA 4IEXA 4WZCA 3LA3A 4IESA 1YFXA 3EO6A 1OMIA 1ZZ9A 2PA7A 3EHKA 2B8MA 1LB2A 2EAAA 2Q0AA 3FX3A 2IXJA 3MZHA 2GC2A 4OFGA 1VP6A 2XHKA 5FPXA 4YNIA 3SCFA 5BXXA 3KGLA 4PIXA 2XKPA 1WGPA 2HJIA 4XFGA 3M3IA 3E6CC 1ZREA 1ZRCA 2ET1A 3SMHA 3UKVA 3N4MA 4A2UA 1RUOA 4KL1A 1GQGA 2QVSB 1YLLA 3OD0A 5EZWA 5FLIA 3WW1A 3CEWA 2P17A 3FHIB 4HMZA 3OGJA 1NYWA 5KBFA 5C6CA 3QACA 3C3VA 2CV6A 4Q0UA 2O8QA 4HLTA 5JR7B 5BY5A 3H1YA 3H3ZA 3KSCA 1X8MA 4LULA 4MGZE 4XFFA 2CAUA 4P9GA 3LWCA 2XLGA 5BV6A 2VQAA 4UXAA 3ELNA 1YHFA 2MNGA 1CGPA 1V70A 5JCTA 1CAXB 4Q0QA 3MYXA 4KU7A 2VECA 3H7YA 1FXZA 3BCWA 4AVBA 3NKTA 4H7LA 1Q5OA 1CAWB 1OFNA 4AXOA 1X8EA 3D0JA 4IEWA 2D5FA 1QWRA 1O3TA 3PVBB 1SFNA 5AVPA 4DINB 1RUNA 1PM7A 1DZTA 4R8HA 3H1WA 1J3QA 2B9UA 1CAVA 1RGSA 4XF3A 3U10A 5KHIA 2XL9A 2K9ZA 1ZZ8A 4XF4A 2WFPA 4ORFA 5KHHA 4BIFA 4L2NA 1XRUA 4HN1A 2I45A 3BPZA 2PAEA 2D93A 2MPFA 3H1MA 3NSTA 4AQ6A 3CO2A 3EBRA 3LOIA 4Z07A 1FI2A 5T3NA 2Z69A 4Q0PA 1XE8A 1YUDA 4MX3A 1IPJA 2GC3A 4F7ZA 3I59A 4BYYA 4JTNA 2ATFA 1EPZA 4FT8A 1NXMA 2OZ6A 2UY9A 4HN0A 1NE6A 1CX4A 3ETQA 4KWJA 3IBMA 3FZ3A 4JTOA 3H9AA 2D40A 2PTMA 3OCPA 4XF1A 3RDIA 3BU7A 4QX5A 2BNNA 3KGZA 1CAUB 4I01A 2QJVA 4X6QB 1JUHA 3LA7A 4KWKA 4QXKA 4META 1HW5A 3D0SA 2MHFA 3TNQA 1O5LA 1NZCA 2H6BA 3HT1A 3VHRA 3ACLA 1ZZCA 2H6CA 4EWEA 2Y0OA 1YFWA 2XKOA 5FCCA 5J7MA 3RYPA 1X82A 3S7IA 4IERA 3DN7A 2IXIA 4F8AA 1J59A 3E5XA 1UW8A 5I0RA 5KHGA 2KXLA 1ZX5A 5FLJA 3IIAA 2IXHA 4JV4A 3CF6E 4MV2A 4D7TA 3CJXA 4EWAA 1EP0A 4XFCA 4RD7A 2H0VA 4J1XA 3ES4A 3RYKA 1ZZ7A 1TQ5A 3E6DA 4XF9A 2C0ZA 2ZCWA 1L3JA 3WW3A 5JSOA 3GBFA 4HSLA 4MZUA 1O4TA 4EV0A 4LA3A 2D5HA 4EROA 3G7DA 3NL1A 3PNAA 4YYOA 3H8UA 1X7NA 5I0SA 1FT9A 1XE7A 4CYDA 1OD5A 2EA7A 2PAKA 2FQPA 3DV8A 4X6RB 1NE4A 1ZNPA 5E16A 5KHJA 2GU9A 5LRSA 1H1MA 1LRHA 1I5ZA 4XETA 2XL7A 4LLOA 4XF0A 3LAGA 1H1IA 4EWDA 5FQ0A 5I93A 1J3RA 2XGXA 3USSA 4IEOA 4HZFA 1U12A 4J1WA 3I7DA 1DGWA 3HQXA 3MDPA 4JVAA 2IXLA 1UCXA 1ZVFA 2QNKA 4Q29A 1UPIA 4MGIE 2GZWA 3SCHA 4IEUA 2GH2A 1PMIA 3HT2A 5K8SA 3E5UA 3H50A 4OLLA 5I8YA 3MPBA 4HVQA 2Q4SA 5JAXA 4KWLA 3RNSA 1RL3A 2O1QA 3NJZA 3E5QA 4N9IA 3E97A 1ZRFA 3IDCB 3IDBB 5LEJA 5CVRA 3DKWA 4IEQA 3LZZA 1CAUA 3HIFA 4FBFA 5HI0A 4E2QA 1LR5A 4LA2A 1LKNA 1RC6A 5BUVA 2OPKA 4Q0SA 4MUVA 5J3UA 1Q43A 4AVAA 4N9HA 4WBBA 5I91A 3QOPA 2PHLA 3B02A 4QM9A 5J48A 1EY2A 1QY4A 4QMAA 1O5UA 2PYTA 4QGLA 4I2OA 1IPKA 3S7EA 3SCGA 2PFWA 1G6NA 2GC0A 3FFQA 2OZJA 1SQ4A 3WW4A 3BB6A 4UBHA 5I0TA 3M70A 2K0GA 4XFBA 1Y3TA 2XLAA 5FDBA 1UIKA 3WW2A 3FE5A 1O3SA 5D1IA 4Q0VA 4YSFA 2CAVA 2BYVE 3GYDA 1J1LA 1YWKA 2E9QA 1J3PA 2BNMA 2UYAA 3FWEA 3UKTA 3RPQA 3ZDSA 5I8SA 4BHPA 3UKNA 3FJSA 4I0BA 3TNPB 4QGMA 4HVRA 4TLFA 5JSPA 2XLFA 3I54A 2HKXA 1I6XA 1VR3A 4LUMA 5LRRA 4IETA 3RZZA 4ONUA
chains in the Genus database with same CATH superfamily
1DQ6A 2VCBA 2ZX0A 3LA2A 1WMFA 1S4CA 4FOQA 1OVSA 5DXDA 1GOFA 1CN1A 2YY1A 2ZAHA 5LWBA 2W08A 3WNKA 2FZ2A 3CL1A 3N7MA 2J1UA 1OT5A 1C57A 1JN2P 5A7PA 3UESA 4R9BA 3VBOC 1RUF1 5ISLA 2D3RA 4CEYA 2AGSA 3ZVXA 1BBT2 5HV4A 1OHFA 4A7YA 3OBAA 1V6OA 1W2OA 3AYCA 1APNA 2JD4A 3N9OA 2VTXA 2V5YA 2OW4A 1GYKA 2GDFA 1OQDA 4A3ZA 2UWAA 2XJPA 3OGVA 3ZFEB 4LTAA 4UFLA 2PLV3 2XVKA 4XMAA 3NVCA 2BGCA 1JOPA 4UOJA 5A6ZA 3DL3A 2RVAA 4O7XA 2R1BA 4ZONA 4GULA 4RS5C 1XU2A 2CGNA 4XZUG 5F3IA 3VZJA 4AI9A 5A32A 1GQHA 2R32A 2ZGKA 1DYKA 2ARAA 1STMA 3IWZA 1AR92 5T5LA 4QM8A 4FAGA 4PQQA 4FCAA 2ZKLA 3QBQA 3NNMA 4KWUA 2QCSB 2AUYA 4XJAA 3ZSKA 1BCXA 2GALA 4DB5A 4ZPIA 1F35A 3V56A 4BXSV 1KJLA 4DUWA 4Y33A 1MZFA 2QQUA 4X8NA 3U0ZA 1O8PA 1UIJA 2WC2A 4L11A 4E2SA 5K0UC 2XWBB 2AZ5A 1LHOA 3TN91 2RG4A 1GP5A 5FMBA 2RS53 3DF0A 2PQSA 3D3AA 4JX0A 4O9EA 2IC1A 3OY8B 4W6YA 1POV3 1ULPA 2ZHNA 4DS0A 5DAQA 2PQQA 2ZHMA 3BGAA 3LE0A 4RQPB 3VKFC 5GZCA 1AXYA 3S0MA 3PVNA 2EXKA 2O0OA 2RMU3 4WVZA 2CDPA 5ANNA 3SNMA 4RSUA 4MGYE 4MXWA 1Q3EA 4PLOA 4EYUA 1QXPA 2TEPA 4WM7A 4BM8A 3ME2A 4KMQA 1C8NA 2FZ1A 5JZGC 3OJBA 1LOEA 5I8TA 4LEJA 4PF5A 4RL7A 4D8MA 4D0QA 2WNUB 4FSJA 2Y8KA 3D82A 1GNZA 3ABZA 2ZHKA 4KU8A 2D44A 1RUJ1 2RR12 2XUEA 4AVCA 5DN2A 3AZZA 4XFIA 1G7YA 1BZWA 5A6XA 4UW3A 4GJZA 1CIYA 4QX1A 3VBHB 1HV0A 1H30A 4XIOA 1HRI2 2W92A 1O91A 4HK8A 2V09A 3QD6A 4XC9A 1D0GA 2JX9A 2JIGA 4GWIA 5C8WA 4XDQA 3KCYA 5KHKA 1F15A 5L7OB 4PIZA 4OMCA 4NPLA 3PJQA 3J7NA 4AVTA 4JCKA 3WF0A 5CFCC 1UY0A 2Q5TA 3AP6A 3O0WA 1C8M3 1D2QA 1HDKA 1YI9A 2AENA 1OI6A 3EJKA 4UBGA 1A6CA 4IEVA 2CGOA 2IVJA 3CMGA 2VZUA 4Q4X3 4XAAA 4YARA 1HKDA 1RINA 1ENXA 1UD1A 4QB1A 3I59B 2ZAAA 5GLZA 3ROUA 1R092 3A22A 4AYUA 3TRSB 2E26A 4FTSA 1W2TA 4NIIA 2XQRA 2D6PA 3U11A 4HBNA 4IE7A 4K1ZA 3T0DA 1ZRRA 1RUG2 2OYZA 1BEV1 4JKLA 4IEXA 5FZ8A 3LA3A 3THTA 2J1AA 4CCMA 2A6XA 1RHI1 5LB6A 4EE2A 1OMIA 4BQ1A 2PA7A 3HQUA 1RVF1 4SBVA 1ULCA 4TYSA 2Q0AA 2DF7A 5CG8A 4CDQB 4CUAA 3JBG1 1AR82 3WDXA 4ASMB 1QJZA 1VP6A 2W94A 3G6JB 5FPXA 3WCSA 1SMVA 4UFMA 3SCFA 2J22A 2E31A 1UAIA 2WFF1 4NMIA 3VZMA 2BVBA 5A3TA 2XH6A 3KGLA 4ISRA 1WGPA 2A3YA 2HJIA 1KGYA 3VL8A 4COZA 3BTYA 4QKNA 2V5DA 1PVXA 3SMHA 5K9YA 4LE4A 3UKVA 5L9RA 4B1LA 3N4MA 1UL9A 2B42B 2EIBA 2R041 2X09A 4KL1A 5HXVA 1QQP3 3OGSA 1RIRA 3BKZA 2QVSB 1YLLA 3F2ZA 1Z7S1 3U1XA 2WYSA 1W0OA 5FZ4A 2F4LA 2P17A 5ERLA 4HMZA 1NYWA 5TSWA 3C3VA 1TZOA 2GN3A 4A6OA 5SV8A 1RUC2 1AHSA 4DO0A 1L7QA 2R062 3VKMA 4COVA 1RXFA 1HB1A 4RQPC 1PO23 1XOYA 4MGZE 4XFFA 2CAUA 3ZIWA 4CU6A 4IL7A 3MO4A 2XLGA 1VBC2 2A5ZA 4LO6B 2VMGA 2JDMA 2VR4A 3ELNA 1YYNA 1U5XA 2Y6GA 1BEV3 1V70A 2BOJA 2ZGPA 4QDRA 3UGHA 3K2OA 4Q0QA 4BOWA 1Z78A 5FXXA 3M7AA 4IV1A 1F31A 4HOOA 4QD2A 2MEV2 4AFAA 1TME1 2LS6A 3KT1A 3NKTA 4H7LA 1Q5OA 1WLDA 1IQAA 4AVBA 2GNMA 1CAWB 4XJZA 2NZ9A 4RQPA 4AXOA 2XJSA 1X8EA 1BVVA 1LOAA 4GMP1 2RS11 2QFEA 2X05A 2BFUL 5K0UB 4IEWA 3MFAA 5AC91 1GOGA 1QWRA 1R083 3TB0A 1HB2A 1O3TA 2RM23 1NQDA 4XDOA 1GZWA 5A6QA 1G86A 1PM7A 4M0NA 5E6HA 5FP8A 1KEXA 1WW4A 5IAXA 1MEC3 1FOD2 3AMPA 1QKQA 2W5FA 3AP9A 4D6QA 1VBA2 4J6GA 4PDWB 1JH5A 3WNXA 2FDJA 4QXCA 4XF3A 4AAXA 1RJ8A 4V1PA 3AJYA 2RDQA 1WLCA 4ZKTB 1UZ0A 2WR9A 5FP4A 3C7OA 4B4PA 1AR71 3ZFGB 1ZZ8A 1W2AX 3CZUA 3CNAA 3KV6A 4XF4A 5FYIA 1JZ7A 5KHHA 2OKXA 2ADDA 5FYTA 1POV0 1NAEA 2JE8A 4HN1A 2JECA 1XB9A 3LQCA 1KJRA 4N53C 3RQ0A 4CP9A 3O5SA 5HBAA 5IVCA 2MPFA 3H1MA 5JMCA 5IK4A 3LOIA 4Z07A 3ILFA 1SACA 3OEAA 4XDPA 5DDJ1 1T6GC 2VL4A 5AFBA 2QQJA 2WO2A 4FFIA 1GNHA 2OIIA 2GP3A 4Q4Y1 3VBUA 1XE8A 1DLCA 3VDBA 1HN1A 3NWKA 4OHZA 2GC3A 4GH4B 3FBMA 3I59A 1LHUA 1QJU3 4BYYA 4JTNA 4MLOA 2D97A 5FWEA 2D3PA 3SH4A 1NXMA 3T2PA 1I9RA 3KT7A 1J84A 2Y26A 4IE5A 3J9SA 4LHSA 2R30A 3FL7A 5EV7A 3IBMA 3HEIA 2IFRA 5FR3A 3FZ3A 4R9CA 3LGRA 1L7LA 3PIJA 4ITCA 2WS92 4XUQA 3SEEA 1X9TA 4OI4A 1OLMA 3IN9A 4XF1A 3FMGA 4QX5A 1TNFA 1RVF3 2CDOA 2X5IA 2ZEWA 1AJOA 1MZ6A 1C1FA 1AL21 2ZACA 3NJVA 3USUA 3ZOIA 1CAUB 3HPNA 2QJVA 1PNFA 3KZ4C 5FYUA 3WNOA 3WDYA 3PJYA 3N7JA 1AUYA 1OD3A 3MF6A 2P37A 3GZEA 4ZY9A 2WNVC 3HT1A 5B4NA 4M01A 4A45A 2BDRA 2X10A 2H6CA 2ZTNA 1VRH2 4EWEA 1UO9A 1JYTA 1AYM1 3CBNA 2A6WA 2Y0OA 3I3BA 1BMV1 3DXUA 2RJ2A 4WVVA 5C71A 1G9AA 2VMCA 1ND3C 3LIGA 4FFHA 5FZIA 5J7MA 4XBNA 1X82A 3S7IA 3ON7A 1N1SA 3AC0A 4YZ2A 3JQXA 3E5XA 3NV1A 3U07A 4AEMA 1QMJA 1QOTA 1DGRN 5FBZA 2IVIB 4LHLA 3IMNA 3VV1A 3N35A 2DU0A 4YVSA 4QPIA 4G9SB 2E7QA 4XJWA 1W6MA 3IIAA 5ABJB 4JV4A 3ACFA 1W6PA 3CF6E 4OMDA 1JYWA 3MIEA 3CJXA 4F83A 1ZBA3 2ZHLA 4BQXA 2FDIA 1ASJ1 1AXZA 3ZYFA 4LBQD 5IYYA 1OUXA 3ZFGC 1TQ5A 2Z79A 3PTYA 2WLPA 5HCHA 4RFT0 1QIQA 1ND3B 1V00A 3N9PA 1VAVA 4A7ZA 4AHZA 1Y9GA 1W9YA 2BWCA 2AREA 1O4TA 2W9XA 4QQLA 3MGUA 4FTBA 5LATA 3AZWA 4GWMA 1GZWB 4Y20B 3G7DA 3NL1A 5DAVA 1C5IA 5JPNB 3PNAA 3W5NA 2G4IA 1X7NA 1V6KA 1FT9A 3HR9A 1U5YA 2XVGA 3Q8AA 5BNOB 1FYUA 3KF5A 3VD4A 4YG3A 3I2JA 3PVOA 1OD5A 2EA7A 1TVGA 2FQPA 4QX8A 2VTFA 5FFOC 3DYMA 1NE4A 3MF9A 5C7GA 1ZNPA 4K8RB 5CG9A 1LAJA 2HEVF 2W68A 2I2SA 1WA6X 5DUUA 3RJ2X 3WNPA 2GU9A 3EMRA 1GBGA 2XJVA 2ZMKA 5F9TA 1LRHA 2ZEXA 1LCLA 1I5ZA 1YJLA 4QPGB 1DIWA 2WL1A 3KV4A 2DDUA 4LHKA 3JBG2 1LOBA 3LAGA 2D3SA 3NNGA 4PF1A 4UI9L 5FZFA 5K4LA 3WINE 2CU5A 2A6ZA 1JHJA 2HWD3 3UJOA 1QJU1 3WF4A 1S55A 1VAKA 1N3OA 1U12A 3PUSA 2WQZC 4YM1A 4RS5B 2XJQA 3T2QA 1XSQA 4M00A 1EV13 2P4EA 1UQXA 4XAEA 5GKAC 4CA9A 4CTEA 1UCXA 2CSGA 1PZ8A 4U2AA 3ZFEA 1QU0A 1UPIA 3SISA 4F3JA 3A23A 2Z4FA 4Z92B 2GH2A 2Q1MA 4Z1VA 3LB9A 1HRV2 1PVC2 2ZJCA 2ZX4A 4COWA 2P3JA 5JIAA 5I8YA 2WA4A 1NCQB 1Z7S2 2G9FA 2P3IA 4FO9A 3X29B 3MPBA 5DAXA 4AHXA 1RUF3 2Q4SA 3RNSA 4KBBA 1G8WA 4N9IA 5EHDA 4ASKA 5JOYA 1HXS3 5FYBA 1S0IA 5C33A 2X5IB 2R061 1V9U3 1KS5A 5LA0A 5DDJ3 1RUJ3 1K5MA 4L8QA 5CVRA 1DYOA 3LZZA 1CAUA 2NMOA 4OZXA 4PI2A 1GKBA 1LR5A 4LA2A 2JWPA 4LE3A 1DGWX 1FMD3 4FTEA 1RC6A 2W1SA 5HCBA 1GICA 4OYUA 4BLJA 5J3UA 5HV0A 4WBBA 4GALA 1LULA 2R1DA 1LNSA 1AYM3 1KITA 4RFRB 4RHV1 3CJIA 1COV2 4QGLA 2DV9A 3AKTA 2WZR3 5IAVA 2RS32 1TME3 1FPN2 1W2UA 5EJ3A 2R0FA 3TBDA 2J7MA 2SLIA 1WKYA 4RA0A 3VZKA 2XJUA 4YW7A 2OZJA 3WW4A 4FFFA 3K51A 1ASJ3 2XJRA 2DUQA 3BB6A 4DUVA 3B9CA 5JXGA 3I97A 4HONA 3UL2A 2UU8A 4OUEA 5KC5A 1W6MB 2WKKA 2VVEA 2YHJA 4JGZA 3RJRA 1ENQA 5ABJA 2ZX2A 3BODA 3ZN6A 5HPOA 2VMIA 1LEDA 3ZXGA 2VM9A 3PIGA 1LHVA 4YM3A 1ODMA 2EIGA 1W39A 1UIKA 4INDA 2Y6FA 1PMJX 3VBRC 3MLKA 1AR72 5ACA2 1PMHX 5JUVA 4GB31 4MGTA 2VY0A 1MQTA 1MQTC 4Y24A 1UKGA 4RGKA 4Q0VA 4I30A 3GYDA 5LA2A 4ZS2A 5FP9A 1WMDA 2QE3A 2BNMA 1Y43B 3M1HA 2HWF2 3PL0A 5H9RA 3ZDSA 2R043 5A7WB 5T52A 1PZ7A 2ARCA 2JG9B 2HWC2 5C3SA 1RUI3 4HVRA 2YDEA 4L9BA 3VKNA 2P3YA 1QNWA 3HNMA 1Q8OA 3RGBA 2ORXA 3IIIA 1S0DA 2XLFA 3I54A 2D7FA 2YG0A 2PHXA 3AFGA 1YQ5A 4LUMA 4MHRA 4UW4A 5JOWA 3KHCA 1DCSA 1SHWB 3PU8A 3RZKA 2JDYA 1IS6A 1YFYA 4Z82A 3AL5A 1KD7A 5LZ6A 4ATEA 2YBSA 4HSJA 3WP3A 1CQ9A 1REDA 2ZGSA 4FI9A 1RUD3 1UX6A 2Y60A 2WNVB 2HWD1 4ZU4A 5JVVA 3WSOA 5I0UA 1SZBA 1TE1B 3LIHA 4QPGA 1ULFA 5CZKA 3VGIA 1OOPB 4NHYA 3WF3A 1ZZBA 5LW9A 1GU3A 4O65A 1MZEA 5FQ0B 2XJTA 2R49A 4MGKE 4PQ9A 4MG2A 1PGW2 1YIFA 4YZ3A 4AHYA 2VUAA 2XBO2 1V0AA 3U37A 1A34A 2NLRA 1ZYBA 2CGPA 1E5SA 1NLSA 3H3UA 4HFSA 5IVEA 2GN7A 4Q27A 2ZPXA 4QXBA 2RS13 1WA4A 2DCTA 5H9QA 4QB2A 1GMMA 3K48A 2BNOA 4XEZA 1KDKA 4ZU7A 2X53S 3AVRA 2ZX3A 4JRAA 5EJ1B 3E6BA 2GAUA 3TEZA 1SLLA 3IAQA 3ZYRA 3MIGA 1H1AA 3AZVA 4NE9A 2FDFA 1R1A3 1DZRA 2ZBJA 1LOGA 3POBA 4FQ4A 4NRPA 4BPZA 1NG0A 3CDZB 3WCRA 5F8PA 1UKRA 5KXDA 3BUCA 2QTWB 1O3QA 2HEWF 3VBHC 1UX7A 2ZGUA 4YVWB 3UGFA 1QJX2 2XQXA 1PGSA 4MSVA 1LECA 1UY1A 4YZ4A 2VAUA 2VVFA 3VKOA 3PHMA 3QH6A 3HNYM 2WZR1 1CAWA 1EUTA 1FX5A 1VLNA 2AEZA 3IDAA 3OG2A 4MH0E 4E8CA 1VRBA 3LCPA 4UF0A 5AVAA 2HWE1 3OUIA 2PHDA 4Y1VA 1VJ2A 2ZX1A 1LGNA 4NWVA 1NA1A 1WD4A 2PAMA 2WA3A 4PIYA 4D7SA 1JZ8A 2A70A 2W1UA 5FZOB 2OS2A 4DXTA 2A6VA 2J1TA 3KMHA 4IW3A 3DEMA 1O7FA 1WCQA 3THCA 3I8TA 1UOGA 3T09A 1WLTA 2IXCA 1OA3A 3GF6A 3M8LA 4PDWA 5HCFA 1AXKA 3ETPA 2WFF3 3HVDA 3F95A 5FZ6A 4ZU5A 2E53A 2V4VA 1W8UA 2ZA9A 4BCUA 2Y6HA 4QU2A 5LBCA 3V64A 3O1TA 1T6BX 4KI5M 2G9GA 5F5AA 1RMU1 2J1SA 2DFBA 3W59A 4CP9B 2WLQA 1W8WA 2WWSA 4BB3A 3A21A 1UMHA 1SBFA 2FCUA 2BV4A 2VCCA 4LR4A 4M3CF 4QT6A 1ZA7A 3ZYHA 4P00B 5C4WC 5EPAA 4B4RA 1JU4A 2V73A 4E4HA 3D8CA 1Y9MA 1W6NA 2FMDA 1QXJA 3AMNA 4IEYA 3HMYA 5G05L 4BLIA 2GMMA 2JG9A 1LESA 4CP2A 3ASIA 3ZSLA 1DBNA 4GH4C 1WBFA 1RUE2 2Y33A 4ET7A 5BPXA 3R4SA 2V72A 2RS52 3LPGA 1UYXA 2BFUS 2JDKA 2HWB2 1OUSA 1ODNA 1OURA 3B69A 5E1RA 1XE0A 2VO5A 1ND2A 2P6HA 1NZIA 1YFXA 3FBYA 1PVC1 3Q8FA 1O4YA 2RMU2 1F5JA 1ZZ9A 4ZS3A 4ZZ8A 2RJKA 4YW5A 3B94A 3DPRC 5FO7B 3FX3A 2HEYF 1VBD2 3MIHA 3OGGA 1S0GA 1DF0A 1QJY2 1ND2C 4OFGA 2XHKA 1N1YA 1BVP1 2YC0A 1FATA 5A3OA 2JXAA 1GOHA 4OQ8A 3BIWE 1D4VB 3MUZ1 4AQTA 2PMWB 4XFGA 1RUH2 1UY3A 2TUNA 2ZGOA 3P3PA 2BZDA 4CCEA 4WV8A 4Q8LA 1NUKA 2VNRA 3M3OA 1ZREA 4AQSA 5FZMA 3WQ1A 4OHXA 5FZCA 4CDQC 4OUMA 3URFA 2YPDA 1RUOA 2VNOA 2XVLA 5FLIA 2R071 5EZWA 1Q8VA 4GMP0 3WW1A 3RWNA 4EN7B 4E9KA 2R16A 3KV9A 1H6YA 4YZ1A 2ZZQA 2ZEZA 4NPRA 1JYCA 5CFDA 4OI1A 1AZDA 5A3UA 3EYPA 1MS5A 1WCDJ 3MPPG 3PDQA 4Q0UA 5FMOS 2O8QA 4Q4X2 2JB8A 4YW4A 1GLHA 2RS31 5FMDA 2W1WA 5F2WA 5BY5A 3H3ZA 3JUUA 1FPN1 5JOZA 1VBB1 3VZOA 3ZXAC 1BQPA 3FHAA 4RHV3 1CX1A 5E89A 4C8DA 1JS9A 3K3NA 4HT1T 4C1XA 2MNGA 4DRRA 3ZPYA 5JCTA 2E32A 3J8F1 1U0AA 4QKBA 3B93A 5AFEA 2VZRA 3SKVA 3AP4A 4AWDA 5CA6A 3NMBA 3U4XA 5CFCB 2DUOA 4LO7A 3UT0A 4B8EA 4EN0A 2QDNA 2W2IA 1H2LA 3W21A 1HX6A 2JG8C 3D0JA 1QH7A 1W06A 2BVVA 1AR83 5FZKA 4GXLA 1PO12 4LO8A 3PVBB 1KRIA 2B9VA 1SFNA 5AVPA 2HWF1 2W47A 4AG4A 4DINB 4GB33 2VH9A 4DMIA 2E33A 3MFCA 3H1WA 2B9UA 2HWC1 4JHTA 3GZTB 4CVUA 4DEVA 4FPEA 1PK6C 2VJXA 2DVBA 2D6MA 2I74A 1C28A 3U10A 2G19A 2V4AA 3LDBA 4BK5A 5A3MA 1G9FA 2G9ZA 4C1WA 2XL9A 2K9ZA 2DBIA 2DCKA 5JDBA 2FDHA 3MUY1 2WFPA 4ORFA 4LPLA 4BIFA 3KS7A 1AX2A 3OSDA 3BPZA 2PAEA 2C4XA 1H4GA 3FFZA 5FPAA 2YGLA 2Y64A 1DQ1A 1OF4A 2R7EB 3WQ7A 5DAPA 4AOCA 4BQ4A 1PNGA 2JDHA 4Q0PA 2O8OA 4LBKA 4MX3A 1JOBA 3I3EA 5H9PA 3A0KA 4QU1A 4F7ZA 4CCKA 3P3NA 4UFIA 3GGLA 4G4FA 5GZDA 4FT8A 2C9KA 1YQ8A 2NPIA 1SBEA 5JPMB 1HLCA 1NE6A 1CX4A 3CZJA 5FP3A 4M4RA 1H8TA 3GHMA 3J26N 3MLJA 3R4UA 5BNNA 5BNQA 4AF9A 1D4M3 4XQWA 1EPWA 1HIXA 1WUVA 1H2MA 4JHZA 3LFMA 4QQHA 5FYHA 2HWE3 1AR91 2BNNA 3OEBA 3JD73 3KGZA 4N53B 1IKQA 4NR1A 4Y1XA 4C91A 5JXHA 2PLV2 4X6QB 5L19A 4KWKA 2VNVA 3ZXFA 5BYNA 4META 5J37A 5FBJA 3VBRB 2MHFA 3NNFA 3WV6A 3TN92 1W8NA 2VD7A 5FY9A 3ILNA 5JLVA 4PDWC 1ZZCA 2UURA 4M0HA 5GZEA 4BK4A 4DFSA 1DGLA 3BOPA 2LM3A 5CYYA 3TYJA 1WZXA 4KH9A 3ZLIA 4CXXA 2XKOA 5FP7A 1U5ZA 1SLIA 1YQ2A 3RYPA 4WM7C 1SLBA 3AP5A 2BBVA 2IXIA 1WLWA 1POV1 5IHRA 2YC4A 3GCXA 3DGTA 5I0RA 2C1FA 2ZKNA 4ZHNA 2VOXA 2XDVA 3AX4A 1IOAA 3K75B 1S0BA 5C3OA 2HH9A 3ZYBA 1CZTA 3LOBA 4E4SA 1H2KA 4MHUA 2QZ3A 4IUGA 3GM8A 2DCJA 2ZXQA 1UY4A 5DUWA 2EXJA 4CEWA 4BE3A 3HQRA 2GNDA 5FZLA 3ZFFC 4RD7A 2H0VA 3ZXDA 4J1XA 4X8PA 3ES4A 2D98A 4QX3A 4PT6A 1SFYA 4GKYA 2WAOA 3MEPA 5C9AA 2GSYA 4XF9A 1HN0A 2X5IC 2XG3A 4BA6A 4BMEA 1W6OA 5JSOA 5F39A 4K40A 3GBFA 4XHXA 5K0UA 4C90A 1NY71 2WSUA 1FAYA 3NJXA 2DU1A 1HXS1 3FN9A 4Y5TA 1Q8PA 3VZNA 4LBNA 1NKGA 1UMIA 4XQ4A 5GLWA 3BN6A 5JOXA 1XE7A 5D8AA 4GKXA 4QB6A 5CKQA 3KCXA 4AGRA 5E8AA 4LMFA 1UN1A 3DV8A 1R1A1 2VUJA 5EP9A 4Q4W3 1VBB3 1OH3A 3LEIA 1PGL2 3SH5A 5FV3A 2EXIA 2OT7A 3ZMNA 1JYNA 4JQTA 1XJAA 1KQRA 3W20A 4FQZA 2WNVA 1RHI2 4CU8A 5IK5A 1H1MA 3FC0A 4WVMB 5KR7A 4I0WB 3IT8A 3WDTA 3VKLA 1OOPA 2XL7A 4LLOA 2VZQA 4FPGA 5EXOA 2WO3A 1H1IA 1B09A 1Q56A 1QJY1 5FKBA 1RUG3 2XGXA 4PBPA 3H8OA 5EJZB 4HZFA 3ITQA 4IDZA 2W3JA 2BOIA 4CDXA 1DGWA 2JDAA 2B45X 2A7AA 2PHTA 4C0BA 3MDPA 4JZRA 3LFIA 2QNKA 1ZVFA 5A33A 1TMF3 4IE6A 4NN0A 1OLQA 5FZGA 2GZWA 2RDNA 4LO4B 1PMIA 2XOMA 4V2WA 4LO5B 5JI9A 2YC2A 2ZGQA 3E5UA 3HT2A 5K8SA 1OOPC 2NYYA 2ZGRA 5BNOC 4XILA 2R072 4D3WA 3OUJA 2VVDA 5A1AA 4UFJA 1H8TB 3ALQA 5JAXA 2C24A 3AYEA 5C3QA 1AR62 4AK3A 1JTZX 4Y3OA 3E97A 4Y1UA 4L99A 2R6QA 3C7HA 4JDOA 2RM21 5DQ0A 5FPBA 2DBNA 1ALYA 3N7KA 3FUOA 3ZDVA 5LEJA 4IEQA 2VBPA 2PHUA 3TEXA 3VBOA 1VBC1 4XZPA 3VBFB 4XW3A 4GZ9A 3VZLA 5A7SA 4URAA 3RI8A 2D6OX 3I3MA 1QJFA 4ZXKA 1LKNA 3MIFA 3HBKA 1CR7A 2VNGA 4H2AA 1RUC3 1XYNA 2ZGNA 3POGA 4MUVA 1Q43A 2Y38A 5T5OA 1UZVA 3D6EA 3JU9A 4N9HA 1R091 4R4XA 1GZTA 1VBE2 2P6CA 1UU6A 3P5BA 4QM9A 5FWJA 2WRAA 5FY8A 3ZXJA 5EWSA 4Y5SA 1UOJA 2JJ6A 4QMAA 1O5UA 3Q8EA 4UW6A 4D94A 1RJ7A 4YWAA 2RV9A 1IPKA 3K4AA 3S7EA 2DVAA 3T4HB 3KHBA 3LD8A 1G6NA 4XQDA 2QQPA 4TSVA 4BQYA 1N47A 1PO11 4PBOA 1LEMA 4CCNA 2ORZA 2DVFA 2W39A 2BP6A 4AW7A 4YGCA 2YUEA 3ATGA 3WP4A 1AYN2 5FZ7A 4CZSA 5C5UA 5C8CC 4KBZA 1EV12 4KGQA 5DUVA 4OQ9A 4P9WA 4CCCA 1AR81 5F6LB 2VW0A 1BBT3 3CJIC 1R081 3NRUA 2KM2A 5F5IA 3M70A 1JBCA 2OQ6A 2XLAA 3R0RA 3AKSA 4JQRA 4XUNA 1MEC1 5FDBA 4XXAA 2VW1A 3AVSA 3THDA 2Y34A 1S2KA 4R9DA 1NLQA 5J09A 2BJSA 3I4IA 3FE5A 2WN3A 1O3SA 2KR2A 3H3LA 1MS8A 3J4UH 4YSFA 1W04A 4LITA 4AE2A 3TOJA 5DAWA 1DZQA 2DFCA 1W6OB 3RPQA 3ZN5A 2VOWA 4N90A 3KM5A 4AVVA 2NMNA 4BHPA 5DDJ2 3TNPB 1KFUL 2ID4A 3AYDA 4H7MA 1BHGA 3POIA 4TLFA 5FPLA 4Y20A 2YROA 1BJQA 4B7KA 3WHTA 4XJUA 5FIXA 3ZFEC 3VBSA 2HKXA 2ERFA 1XU1A 1XNDA 1ZBE3 2EF6A 1OH4A 2AR6A 4NOTA 5LRRA 1SBDA 4IETA 5LASA 1NLRA 4PCRA 3FLRA 2AEYA 4ONUA 2EVXA 1W9SA 2ARXA 1JU3A 1ZZ6A 5FPVA 3VLBB 3I2OA 1W0NA 4MGQA 3O1SA 2P2KA 4Y22B 4OHVA 4B29A 3CLPA 3ECQA 3PUAA 3BALA 1TME2 1VPHA 4GAZA 1F9KA 1SEFA 4IEPA 3WY6A 5T55A 4CCOA 1DGRA 2UY8A 5F2SA 3U78A 1ASJ2 5FXZA 2P1BA 1QDCA 5CEHA 1ZRDA 2QQKA 1KFXL 1CPNA 5AC92 3IKWA 3E1F1 1WCUA 1K45A 5G04L 4CDXB 4YRDA 1D4M1 3L9JT 1XSRA 4HVOA 5EYYA 3HOBA 3POSA 2VZSA 4R52A 3WT3A 4I3PA 2GH8A 1HRI3 1VBA1 1ZM1A 1FNZA 2FDKA 3I2DA 4XJ9A 3ZFFB 1WW5A 3LDRA 1S2BA 2B7YA 1DQ0A 1RMU3 2W87A 5FY5A 3O14A 1DYPA 1OKOA 1WMXA 3AK0A 3KVAA 3NAPA 2BU9A 2PN5A 3MIDA 4IV3C 4JGYB 5LEKA 5A3WA 2K2SA 3B5LB 1GSLA 1IS5A 1N1TA 1QHDA 2GNBA 2P3KA 2UYBA 4IE0A 3T4VA 5I0DA 1K5MB 1CAXA 1WW6A 1YFUA 1F4AA 1YC61 3NNLA 1US3A 4IV1B 3VB9A 5CU1A 4Q4Y2 1GNYA 3VDDC 1RUD1 3U14A 2VZ3A 1OSGA 4FP3A 2GC1A 4DY5A 2MEV3 5FYYA 3I2GA 3RZHA 5DUXA 2R0HA 2Q8EA 1PO21 4AFCA 1PM4A 3CJIB 4DZGA 5CKNA 4FAHA 3OGRA 4E2GA 1MVEA 1ZBA2 3KQRA 1FV2A 1NY72 5EFUA 2F4PA 5FO8B 1QOOA 5FZ3A 4QPIC 3RYRA 1WWYA 3HJRA 3AKQA 4I0AA 5F6KA 3BTZA 3Q8CA 3J8F3 4QX2A 2OA2A 4HL0A 1CAVB 2BEOA 4E27A 2WAAA 4IGQA 4QGNA 3GBWA 2IXKA 1AL22 3WP6A 3AP7A 1SDDB 4HKLA 4Q4V2 2IWGB 3KCCA 4S2GA 2QDRA 1OC1A 3ZN6B 5IVBA 3ZFGA 1MS1A 3W58A 4XABA 2L9LA 5D2AA 5JZGB 4LHNA 4COUA 3T08A 3WNMA 4CUBA 1UYZA 3RVHA 1JZ3A 1JUIA 3D4KA 5FLHA 5FYVA 2Q1ZB 1C3HA 1MQTB 2OQ7A 3ZIXA 2ENRA 2BWAA 4NWWA 5LBFA 2J1RA 2A1XA 4LK6A 1VRH1 4LBMA 3ILRA 4NVPA 4R4ZA 5F1RA 5BNNC 5FRAA 4Y4RA 1EAH2 5EQUA 3T3YA 2VW2A 5A7WA 1V6LA 2J42A 3DECA 3PLQA 1XC6A 3BPSA 4GH4A 4DY3A 3PVEA 4FPCA 4JAAA 4Z8BA 3SXWA 5LA9A 2Y0IA 4HKWA 1QJX3 2VQUA 3VUOA 3POFA 4HETA 3VDAA 1D7PM 1MACA 1HJFA 4LOTA 3VBSC 3APBA 2PHFA 4YW3A 2X8KA 3POYA 4NHXA 1TG7A 3LSDA 4NHLA 1ZBE1 4UWDA 3VD7A 5F32A 2KD7A 2OPWA 5T5PA 4NIHA 4P9JA 4LKEA 3MI8A 4MYEA 5BNNB 4WM8C 3RZLA 4H14A 3ZN4A 2XUMA 4XIKA 3EHKA 5A80A 1GQPA 1LB2A 1JZ2A 2EAAA 1SG3A 2IXJA 2NM1A 3MZHA 2GC2A 4LK7A 5SV5A 4N53A 3QLQA 4HG6B 4XMIA 2VMEA 2H0BA 4YNIA 1SFPA 1X50A 4P9LA 1YCIA 4LBLA 3OOXA 5FXVA 3IPVB 1J83A 5BXXA 3AZXA 2VGDA 4YG0A 1E5RA 1S1AA 3E6CC 4QHZA 2VZVA 1ZRCA 3KF3A 4SLIA 1JHNA 3S30A 1DP0A 4M4PA 4CP1A 5DZEA 5A3LA 1GQGA 3OD0A 4UT5A 5D21A 4A42A 1WMEA 2P34A 3CEWA 3H0OA 5JIUA 3FHIB 2W52A 1MS3A 5J96B 5KBFA 2Z42A 2CV6A 2DURA 2LALA 3A0NA 3RG0A 1FV3A 3LEGA 1OA4A 4LULA 3KSCA 1X8MA 2EIEA 2QKDA 4JGYA 2HBUA 4W65A 5EIYB 2B46X 1W8FA 2A73B 3MW4A 4P9GA 3LWCA 2CY6A 4QPIB 3T0AA 5BV6A 3OPZA 1YRZA 4ES8A 3ENRA 4Z2AA 1R1ZA 1VMJA 5GLUA 4DQAA 4P08A 5L9VA 1YHFA 1VALA 4XCAA 3T2TA 2XMLA 3HN1A 1CAXB 3ZYJB 4FOYA 5ANQA 2RHPA 3H7YA 2RS33 1QJU2 1FXZA 4FPYA 1LGBA 3BCWA 5FYCA 1ONAA 1W03A 4IV3A 1URXA 5L36A 4WZFA 1K42A 3WG2A 4A6SA 3WNNA 4P9IA 1BBT1 3I2HA 4JKKA 3N9MA 3WOGA 4UFKA 3H42B 4UF0B 4MXWB 2JE9A 1S2EA 1UF2C 4XCBA 4I3GA 2ES3A 3UYJA 2C26A 4AEKA 1RUNA 5C3PA 1W3VA 4E4ZA 1DZTA 4A44A 2QQIA 5FZDA 1RUH3 4R8HA 3RMYA 2WBKA 3KVBA 4OULA 1JZ5A 1RB8G 3C7GA 3GZUC 4Q1RA 1QQP2 2VOKA 3IAPA 4FPJA 4PLNA 1DDLA 1IG0A 3MICA 5A3PA 4R9AA 2Y6LA 3ZR5A 5KHIA 1W9TA 2FHRA 4QQPA 1IGOA 3K4ZA 2JDUA 1QGLA 4NHMA 3CQOA 2YU1A 3JB4C 4NPMA 4Q4W1 4L2NA 4LKDA 2YV8A 2YGMA 4MO3M 1RUI2 1VRH3 2KA3A 2VZ1A 1PIV2 1A3KA 3WF2A 4FPHA 4XUPA 1SLCA 1CJDA 3ZKUA 3EBRA 1S0EA 3KT4A 4IE4A 3DXTA 2AC1A 4XTPA 1C5HA 4HXCA 2GMPA 1LOFA 3L2YA 3ZKYA 3JBG3 1COV1 4RS5A 1Y7BA 1YUDA 3WG3A 1IPJA 5A33B 2E51A 1QDOA 1PX3A 2ATFA 3FLTA 1EPZA 4YPJA 1SLAA 1I1EA 4YGEA 1LODA 1MZ5A 2B39A 2HYXA 4BQ5A 2UY9A 4OUSA 3NV3A 4LKSA 4XHBA 2J1VA 3AJZA 4D6SA 2JDPA 4B4QA 5FOBB 3ETQA 2VCAA 4KWJA 1G9DA 4WM8A 4AEDB 2JENA 1VB2A 3M4FA 3J7HA 2D40A 1HRV3 5FJHA 1GFF2 1IG3A 2A71A 2PTMA 2W1QA 4LKFA 3VHNA 3PU3A 1XQNA 4TTGA 3PUHA 1IQDC 4W50A 3O1VA 1LHNA 4QPGC 1RUF2 2VULA 4K6BA 1AX0A 4TN7A 2XR4A 4GB32 4HK9A 3I2IA 5B2GB 3KWVA 3T1LA 3VBFA 3A7QA 1W0PA 3MW2A 4I01A 1OVPA 1JUHA 3LA7A 4PHZA 3IPVA 2XONA 1NXD1 2WDBA 3D0SA 3DPRA 1M06G 2FCVA 1QJX1 4CU9A 1O5LA 4OI2A 2YU2A 4NRMA 4RYDA 2BGOA 2AYHA 1FMD2 3GXUA 3JXSA 2A3WA 1OPOA 1FNYA 1YFWA 5F7UA 4DXZA 1C8M1 1S0JA 5T54A 3DN7A 1IS3A 2RE9A 2ZGTA 3LSEA 1PO22 4FPOB 4FXKB 1BK1A 3LDKA 1YO8A 3HWJA 3AZYA 1RUE1 4F8AA 5LCWL 1UW8A 4N7IA 5L7OC 1ZBA1 3RZMA 2JICA 4CDWC 3BI3A 2CTVA 2VUDA 2W46A 3WDVA 5KHGA 1BEV2 3VHOA 1US2A 3WR0A 1D0HA 5FLJA 2JG8B 2IXHA 4JGZB 1REFA 2SBAA 1IHMA 2DUPA 1W05A 2RMU1 2ZABA 4NRQA 5IWFA 4D7TA 5FYZA 5IJRA 1NA1C 3V0BA 5FYSA 1EP0A 2VCMA 2WT0A 3OPTA 4K9SA 4XFCA 4DRVA 5C70A 4GA9A 3RYKA 5A1LA 4XXPA 1OA2A 3E6DA 4Q1PA 2ZCWA 1DQ4A 5CFCA 5FO9B 5KXBA 3SQOA 4P9YA 2BBAA 2QZ2A 1Z7S3 3AMHA 4HSLA 2WT2A 2DTYA 2OX0A 4MZUA 1RITA 4AFBA 5FY4A 1O6UA 1EAH1 4LA3A 2D5HA 4CSWA 4EV0A 2R042 2RR11 3VD3A 4YYOA 3H8UA 3KV5A 1PHMA 1RYYA 5B4XA 1YI7A 4QKDA 3VBSB 4P02B 3TN93 1EUUA 2PAKA 1IZ3A 4LIUA 4XBQA 3VBUC 1V6NA 5E16A 1OQEA 4QPWA 5F5CA 4DEQA 1HV1A 4Y22A 2QQVA 5FREA 4AI1A 3WLUA 1W8ZA 4CEYB 5FUIA 3O1MA 5FQ0A 5I93A 4GD4A 1GWKA 4A4AA 4ISQA 1J3RA 3N9QA 3USSA 1HB3A 2Q1FA 5FY0A 3WG1A 2VOTA 3GDBA 2EALA 3TWIA 3I49A 4J1WA 3BU0A 2YYOA 4YFWA 2P5BA 3RMXA 1DU3D 1WD3A 4JVAA 5FZHA 3W5MA 4Q29A 3MLLA 2DCZA 5E88A 3SCHA 2VMDA 1AX1A 1OBNA 3C2UA 3GBGA 3SKJE 2QQLA 1JYVA 1XNBA 1QJY3 2ZMLA 5IK8A 3KB5A 4XE9A 4CCJA 4TZDA 2F17A 4CDXC 1YXWA 4AEDA 1RVF2 1JW6A 2VXRA 4KWLA 1FOD1 3NJZA 1AR73 2O1QA 3E5QA 4LORA 5CB7A 1ZRFA 2WO7A 3BVCA 2JE7A 3P1IA 2W95A 4RGAA 3DKQA 4YVSC 3IDBB 3Q9OA 3HN3A 3DCQA 3LF7A 1OLME 1H8VA 4QWNA 4S2FA 1CVNA 3DKWA 5A3NA 1X36A 5D8AC 1JI6A 3UETA 4FBFA 3HIFA 4IV1C 4BXFA 4Q8KA 4E2QA 5HI0A 2CHHA 3AYAA 3VBRA 4GQ7A 4EN8B 2D6KA 2OPKA 3EB7A 3JQWA 1OF3A 4Q0SA 3MHZA 4BISA 4D7YA 2YB7A 4AVAA 1VBC3 2BGPA 5I91A 2A3XA 4PLMA 2BERA 1YIPA 1RHI3 4AGGA 1JMUB 1EY2A 1GWMA 1QY4A 2ADEA 4CP0A 4WM7B 4BU2A 4LXLA 5DMYA 1RUG1 4I2OA 2VZOA 2VG9A 3NV2A 3SCGA 5FZOA 1XNKA 4BIOA 4CPBD 5KXEA 4QHOA 2WN2A 4DUXA 4CCDA 3CKHA 1GV9A 3FFQA 1AVBA 3DYPA 3M2MA 2VC9A 3WDUA 1SQ4A 3AM2A 4LBJA 4DXSA 4GJYA 2VXJA 2QQNA 1LU1A 1K5JA 5JXJA 2JG8A 5LK7B 1CESA 4Q2FA 3HBZA 3R05A 1W9FA 2WFF2 1K3IA 2NQYA 3V0BB 1QJEA 3FUQA 1Y3TA 1N3PA 5F5QA 1PO13 1FOD3 3WW2A 3RFRA 1NCRA 4P14A 1TEIA 1UNBA 1VBA3 3IMMA 2RS12 4XTMA 5C8CB 2PLV1 2WO1A 5D1IA 2BPA2 2CAVA 1V9U2 1J1LA 1KXGA 3KQ4B 3M3CA 1POQA 1J3PA 2YBKA 4XBLA 5DZFA 2UYAA 1AR93 2XB6C 3UKTA 4M3CE 1JZ6A 5IW0A 2JD9A 5A7NA 1GP6A 3UKNA 2F6BA 2JIJA 1WCSA 3RZGA 4ES9A 4M3CB 3B01A 3AKRA 1RUC1 3OYWB 3WQBA 1A8MA 1CZSA 4AFDA 1BMV2 4Z2WA 3ZSJA 4XUTA 4XVHA 1IPSA 3V0AA 3RS6A 2CL2A 1MS9A 4OVEA 3GJBA 3OTFA 5FUNA 3H7JA 4AQ2A 3C7FA 1V6IA 2VUCA 4I02A 2WZEA 2WQ8A 1CWPA 3OF1A 4QKFA 1S0FA 2YXSA 3BYWA 3CIHA 4GWNA 1K5MC 4D6RA 4O9GA 2QUOA 2FMYA 5FTTC 5KXCA 1CD3G 1LOCA 1B35C 5FPZA 2CWSA 2WS93 4YLZA 1H8TC 4ZXEA 5FPUA 4UFHA 3WX5A 4PJYA 2RR13 3SHRA 5BNPA 1MS0A 2QQMA 4XFHA 1DG6A 1DQ5A 3FHQA 4NHKA 1PVC3 4FPLA 3B7MA 2JEMA 5ACA3 4FOWA 2VPVA 5CADA 3B00A 2QBXA 3LKJA 4QX0A 2VTXJ 3O0VA 3R6SA 2LUWA 3AXDA 3O1RA 2B5HA 1E57A 5CFDB 3ST7A 3O1UA 3IDEA 3Q8BA 1RTVA 1UZYA 2ET7A 2AACA 3QCWA 3H8RA 4AEDC 1UOBA 1HXS2 1WBLA 1B35A 1C8M2 4GIQA 2JG9C 2VMHA 1Q8QA 5L9BA 2D6NA 5J98B 3RWKX 3POWA 2IZWA 2BW8A 4KGGA 4OI0A 5JXIA 2FDGA 2EXHA 4EZ4A 3WD5A 5ABJC 5C3RA 1O59A 5F3GA 2XHNA 4KQ7A 2D43A 3AFKA 1PGL1 3NW4A 1QNYA 1R093 1UXZA 3S57A 4H3WA 1ZRIA 3L2HA 1XNCA 4CDUC 2ZS6B 1W90A 3N36A 5KC6A 5JMOA 4CU7A 3O1OA 1AYM2 3W9AA 3WUDA 1UY2A 3ES1A 4Q5OA 3N9LA 1CIWA 4K8FA 2N7GA 1LGCA 2WNOA 4RR3C 1VAMA 2HBTA 3ORJA 3WNLA 1FPN3 1S0CA 3K4DA 4I09A 2ARBA 2VOVA 2X29A 3JZVA 3LPFA 1UZZA 1IS4A 2IUWA 4LOSA 4TXWA 5LBBA 2Y6JA 2O14A 4XYXA 2FBEA 2FD8A 2WZPP 1BK0A 4JC1A 3VDDB 4YW2A 2WS91 1CONA 1K12A 4XFAA 4OCTA 1XBFA 4IEZA 5AC93 4GWJA 4NIGA 1UXXX 3ZO0B 5FY7A 1XNAA 1QXRA 1W2NA 2PHRA 1UU5A 4S2DA 4TWTA 3EQEA 4NIAA 1X9PA 1RXGA 1VB4A 5DG2A 4OHYA 2YZ4A 4K7JA 3A4UA 4UW5A 2Q30A 3U4SA 4UAPA 2D6LX 1AR61 3NKGA 3J7LA 4YM2A 2WWUA 4XJ8A 5H9SA 1CPMA 5FZ1A 1O4ZA 1GR3A 1VMHA 5DABA 3T0BA 1LU2A 1UU4A 4N8MA 2WABA 2G1MA 4IGOA 5FK8A 2HWF3 3WG4A 4LUKA 3C7EA 4G3YC 4RR3B 1J58A 5JWPA 5JSRA 4AGVA 4LNVA 1XXNA 4LLFA 1O3RA 1NOVA 2R063 2NP0A 4CEWC 2HLEA 1OXCA 1REEA 3LEKA 2EICA 3DUIA 3T30A 3HAGA 1C1LA 1Y9QA 1QOSA 4C0HA 4QAWA 1UMZA 2VE1A 4M3CA 3T2OA 2ETEA 3VHPA 2XXZA 3ZPOA 4BH9A 5IVFA 2Z2SB 4NUBA 3POEA 4W4ZA 3WDWA 4RHV2 2DYCA 4LJHA 2JKXA 1EYBA 1PX4A 4YG6A 1PK6A 3V0AB 4WZCA 3S5QA 4IESA 5FKCA 3EO6A 3GCWA 4IGPA 4P9XA 4A7KA 2WZ8A 3ZXKA 3MV01 2BQPA 5CAZA 2WSVA 2LW8A 1VMFA 2B8MA 3PTRB 3UV9A 1EV11 1X33A 4XOGA 1R082 4CUGA 5IT6A 5IVYA 2RM22 1DLLA 2BUKA 4YW1A 1PZ9A 1GUIA 4YGBA 3WXPA 2WJSA 1ENSA 1M4WA 2XBO3 3O0XA 4PIXA 2XKPA 1MEC2 3JB8A 3M3IA 2R073 4CXYA 2EAKA 3WEZA 3ZYGA 4ATFA 3OPWA 4NROA 5ACA1 4JRLA 1LHWA 4FFGA 5FMOL 1GANA 1AJKA 3K3OA 2Q8OA 1ACCA 1J1TA 1AR63 2ET1A 2W0XA 4A2UA 1HRV1 4L0PA 4OZOA 4EZHA 3WP5A 2JDZA 5GZGA 1Q8SA 3UNPA 3OGJA 1SLTA 3PUIA 5C6CA 1HB4A 3K77A 1ULDA 2VZTA 1U5IA 3OD4A 3KLSA 3QACA 4K1YA 4W6XA 5FOJB 4JGYC 3TEYA 1R1A2 3WUCA 1LENA 2YPJA 3NNJA 3S6PA 5K7PA 2NN8A 4Y1ZA 4H55A 2CYFA 5A32B 4HLTA 5GLVA 2K46A 1YQ6A 3H1YA 5JR7B 5C4WA 2ZGLA 1EAH3 1F2NA 4YVSB 2WYFA 4FXGB 5FZEA 1R64A 4ASLA 1W6PB 3AMMA 4YW6A 2VQAA 4QQ2A 1AYN1 4UXAA 5FJKA 3TAYA 4AR2A 4CPBA 1JOJA 4K21A 5LK5A 4QHBA 1CGPA 5GALA 4LBOA 4YVWC 1UYYA 4YVWA 2CWMA 5LY1A 1LOFC 2ZZJA 3MYXA 4KU7A 2VECA 4NJ4A 5DZGA 4K3UA 1DFQA 1GZ9A 5FXWA 5LA1A 2RDRA 1H9WA 1UWWA 3AKPA 5C9AB 1VIWB 1OFNA 2E7TA 1L7RA 1ND3A 2A6YA 3VDCA 4E4DX 1PGW1 4RN5A 1V9U1 2D5FA 3GJAA 2DCYA 2DVDA 1NA1B 1D4M2 4YFZA 1BXHA 4AZZA 4QQOA 4DPNA 4CDUA 2DTWA 4V2VA 4B1MA 3BTXA 4TLGA 5C9AC 1ULOA 2QQWA 1J3QA 3J7MA 3JD72 4AHWA 5CISA 2YMZA 1KS4A 3ZR6A 4AI3A 1CJPA 1CAVA 1RGSA 3SC7X 2VMFA 2UWBA 4ARXA 5T5JA 4LBQA 4CUCA 5T50A 1WW7A 1SCRA 3VD5A 3I3DA 2Z5WA 1VE0A 4BZ4A 4JDNA 4YM0A 1W9WA 4FOVA 3O7OA 4WVMA 5HCAA 5JZGA 3LEMA 1HQNA 1XRUA 2I45A 3ZYPA 1XYPA 3V65A 2D93A 3NSTA 4AQ6A 4DXRA 3CO2A 3OBTA 2JB4A 1VBE1 4RR3A 1W3XA 5FZ0A 1FI2A 1NX9A 1DQ2A 3B9IA 5T3NA 2RDSA 4P5HA 2Z69A 5JR2A 3BOWA 3ZXLA 4FP2A 3GZAA 1RUD2 3PMEA 3S5AA 2VBDA 4KG0A 2GMEA 2HWB3 3ZM8A 3CU7A 4AVSA 1GP4A 2C6SA 5FK7A 4MOAA 5APAA 3VD9A 2XWJB 5CKMA 3ZMOA 4ARYA 2WQ4A 2OVUA 3MW3A 4YGDA 2OZ6A 4AFMA 4FPKA 1TMF2 4O61A 4HN0A 4MVTA 1NCQA 1JYXA 5F37A 4AI2A 1JZ4A 3MIBA 4JTOA 1ZA4A 3H9AA 1YQCA 5A7OA 3HNBM 3OCPA 1H6XA 1HQWA 2WNEA 4JKMA 2Q8DA 3RDIA 1AF9A 3UJQA 4W8JA 4XUOA 3BU7A 3T1MA 1F8VA 1W6QB 1JXNA 1W8HA 5EYXA 4CDWB 4CDQA 2I07B 3VBOB 5FZBA 2JDNA 5IUQA 4QDSA 4QXKA 3SH3A 3TEWA 1A8DA 1HW5A 1NCQC 3AMQA 4Q26A 1TNRA 4BWOA 5FMCA 3AB0A 3TNQA 1NZCA 2H6BA 3VHRA 3ACLA 2WT1A 2BRTA 4CCLA 4BQ3A 1I3HA 4B7EA 1MS4A 1OPMA 3RZJA 4OHWA 4CEYC 3NO8A 1SCSA 1NQJA 5FCCA 3O1PA 4D69A 4IERA 1PIV3 2YBPA 2CNAA 2J1EA 4Y4YA 5F3CA 1J59A 1XYOA 2RS51 3HD8B 4BQWA 2HWB1 5C4WB 3PUQA 3NJYA 2KXLA 2HWD2 3WZ1A 4U36A 1ZX5A 2YFUA 4HANA 4HPKA 4A41A 1YEWA 4AL9A 3IB3A 3AL6A 1AYN3 4NAMA 3PURA 2LROA 4MV2A 4EWAA 2ILMA 1NT0A 3SEPA 4S2HA 4IQPA 4Q4V1 2E7AA 1NCRB 1G9CA 3I2FA 4CXWA 1ZZ7A 1JODA 1N1VA 5GZFA 2DVGA 1D2SA 4IV3B 2XBO1 5C8CA 3ACHA 1ENRA 3OBRA 3ZXEA 5CBLA 2HWE2 1GWLA 1O8SA 2C0ZA 2LTNA 1UZWA 4N43B 3WHUA 4EN6B 1CZVA 1L3JA 3WW3A 2WUHA 1IKPA 5IK7A 3GNEA 1AL23 3C8XA 2TNFA 4NO4A 2WINB 5IFPA 3M3QA 1SPPB 3OUHA 4L97A 2WWJA 4EROA 1RUJ2 3OYWA 4RGGA 3WQ0A 5A6YA 4XURA 4CDUB 2EIDA 3POJA 5I0SA 1V6MA 5FUPA 4CYDA 4QDQA 2ZMNA 1HRI1 4LIVA 4JGZC 4WVWA 2B4KA 3AXEA 2VU9A 1W8OA 4MGSA 4XPVA 4X6RB 4MXVA 3BIEA 4LBQB 2DWRA 1ZBE2 2C9AA 3WVJA 2OXBA 5KHJA 3VN4A 3GALA 3EXUA 3ACIA 4NAOA 1Y4WA 3THPA 5LRSA 1RUE3 1YNAA 3N7LA 5IVJA 3RSJA 3UGGA 1COV3 3I2KA 3K46A 4FVVA 5FY1A 5FZ9A 5J36A 4XETA 2Q8CA 1LJ7A 2WZR2 5FAXA 4Y1YA 4XF0A 5GJ6A 1XNTA 3ACGA 3O12A 3SITA 4EWDA 2E63A 1WCKA 4EQVA 3VBFC 1UYPA 2YFZA 2C5DA 4IEOA 5A1FA 5CFDC 4QXHA 1I5PA 3IM0A 1BLZA 5BNPB 3I7DA 3VBUB 1MR5A 4UYBA 3ZX7A 1VBD3 3HQXA 4AAPA 4DNYA 2IXLA 3NQHA 1XPWA 2AH2A 4MGIE 2PHWA 4IEUA 3GHNA 4AEJA 4ZZ5A 3UK9A 4MADA 1G9BA 1YJKA 1OKQA 1KDMA 2QQOA 4AI8A 3H50A 5M0TA 3KD4A 1MPXA 4Y5Z0 4OLLA 5A7QA 2JKBA 3NV4A 3ZFFA 3ZSEA 1B35B 4WM8B 5LBEA 4HVQA 4A3XA 5KWRA 4HKOA 5DPNA 2ZOEB 3NAPB 1VBD1 1A78A 1RL3A 4KNCA 1AL0G 5JI7A 1OQ1A 1MVQA 3IDCB 4IXLA 3VDDA 4YZ5A 1ULGA 1RMU2 1LTEA 2PELA 4N7UA 5A70A 1W6QA 4CDWA 1E5IA 2VQ0A 3USUB 3ZYIB 2HWC3 3JCIA 3I3QA 3R4DB 4KG8A 4B3NA 4BMBA 4Q4W2 4BJ0A 3VL9A 1H9PA 3OY8A 3DPRB 4JDMA 2E6VA 1RUI1 2ZEYA 5LY2A 5BUVA 1F4HA 5J1XA 1QF3A 1PIV1 3MBWA 2UWCA 5L73A 4BQ2A 4FPFA 3QOPA 2PHLA 3B02A 3P6BA 4Q4Y3 4QPYA 1UPSA 2GP5A 2OUHA 5J48A 3H8XA 2LRPA 3CHXA 3INAA 2XPJA 3ZSMA 1OLRA 2OUJA 5GM0A 2PYTA 4EJRA 4XACA 4W6WA 2VBBA 2PFWA 2HYKA 3PMSA 1Z0HA 2GC0A 1N3QA 1P8JA 3QH7A 5CIRA 3SLIA 3M3EA 2WNUA 2WNUC 4Y26A 4CE8A 1ULEA 5IFTA 1H2NA 3U75A 5DG1A 1W99A 3N3HA 4BDVB 5FYMA 2PXJA 4UBHA 4N43C 4DOUA 4GMP3 3VBHA 1C4RA 4CRQA 3OBZA 3JD71 4J25A 5I0TA 2K0GA 2VQTA 3J8F2 4HPKB 5FZAA 1QQP1 2VZPA 1DHKB 3MV11 4E8DA 2MEV1 1NCRC 4QX7A 4XFBA 5HXMA 5L7OA 4CEWB 3NAPC 1RUH1 1BKZA 1W28A 1OFSA 2TBVA 4Q4V3 1E5HA 2GNTA 4COYA 1W8TA 3RRDA 4URTA 1GZCA 2BYVE 1YWKA 2E9QA 3N9NA 5GLTA 4N43A 2WIIB 4PI0A 1H4HA 3FLPA 2FCTA 1V6JA 1W6NB 3FWEA 5CNAA 1HJGA 5I8SA 1HQLA 1QH6A 1QEXA 3FJSA 2A75A 4I0BA 1F5FA 1H0BA 4L92A 4LQRA 4QGMA 1JYIA 3B3QE 4LT5A 1FMD1 5BNPC 1SPPA 5C5TA 1T2XA 2ZGMA 2IFWA 4P5YA 4NIDA 4Q4X1 1UOFA 3WF1A 3RI9A 4AI0A 3DYOA 5JSPA 1SDWA 2RJLA 4DIQA 4K20A 1I6XA 1VBE3 1VR3A 3OB8A 1VBB2 2BTVC 1PK6B 3BTAA 3IZOA 1ND2B 3D5OA 5D8AB 5BNOA 5IATA 4EN9B 1ST8A 2Y6KA 1TMF1 3RZZA 5IVVA 1BYHA 2W91A 5F3EA
chains in the Genus database with same CATH topology
1DQ6A 2ZX0A 3LA2A 1WMFA 4FOQA 5DXDA 1CN1A 2YY1A 2ZAHA 2W08A 2FZ2A 3CL1A 3N7MA 1C57A 1JN2P 4R9BA 3VBOC 1RUF1 2D3RA 4CEYA 2AGSA 3ZVXA 1BBT2 1OHFA 4A7YA 1V6OA 3AYCA 1APNA 2JD4A 2V5YA 2OW4A 1GYKA 2GDFA 1OQDA 2UWAA 2XJPA 3ZFEB 4LTAA 2PLV3 2XVKA 4XMAA 3NVCA 2BGCA 3DL3A 2R1BA 4GULA 4RS5C 1XU2A 2CGNA 3VZJA 5A32A 1GQHA 2R32A 2ZGKA 1DYKA 3IWZA 1AR92 5T5LA 4QM8A 4FAGA 4FCAA 2ZKLA 3QBQA 4XJAA 2QCSB 2AUYA 3ZSKA 1BCXA 2GALA 4DB5A 3V56A 1KJLA 1MZFA 4X8NA 3U0ZA 1UIJA 2WC2A 4L11A 4E2SA 5K0UC 2XWBB 2AZ5A 1LHOA 3TN91 2RS53 3DF0A 4O9EA 2IC1A 3OY8B 4W6YA 1POV3 2ZHNA 4DS0A 5GZCA 2PQQA 2ZHMA 4RQPB 3VKFC 1AXYA 3S0MA 3PVNA 2EXKA 2O0OA 2RMU3 4WVZA 3SNMA 4RSUA 4MGYE 4MXWA 1Q3EA 4PLOA 1QXPA 2TEPA 4WM7A 4BM8A 3ME2A 1C8NA 2FZ1A 5JZGC 3OJBA 1LOEA 5I8TA 4LEJA 4PF5A 4RL7A 4FSJA 2WNUB 3D82A 1GNZA 2ZHKA 4KU8A 2D44A 1RUJ1 2RR12 4AVCA 3AZZA 4XFIA 1G7YA 1BZWA 4UW3A 3VBHB 1HV0A 1H30A 4XIOA 1HRI2 1O91A 4HK8A 2V09A 3QD6A 1D0GA 2JX9A 5C8WA 4XDQA 3KCYA 5KHKA 5L7OB 4PIZA 4AVTA 3PJQA 4JCKA 5CFCC 2Q5TA 3AP6A 3O0WA 1C8M3 1D2QA 1HDKA 1YI9A 2AENA 1OI6A 3EJKA 4UBGA 1A6CA 4IEVA 2CGOA 4Q4X3 4YARA 1HKDA 1RINA 1ENXA 1UD1A 3I59B 2ZAAA 5GLZA 3ROUA 1R092 4AYUA 4FTSA 3TRSB 2D6PA 3U11A 4HBNA 4K1ZA 1ZRRA 1RUG2 2OYZA 1BEV1 4IEXA 3LA3A 3THTA 2A6XA 1RHI1 1OMIA 4BQ1A 2PA7A 1RVF1 4SBVA 1ULCA 4TYSA 2Q0AA 2DF7A 5CG8A 4CDQB 3JBG1 1AR82 3WDXA 4ASMB 1QJZA 1VP6A 3G6JB 5FPXA 3WCSA 1SMVA 3SCFA 1UAIA 2WFF1 3VZMA 2BVBA 2XH6A 3KGLA 4ISRA 1WGPA 2A3YA 2HJIA 3VL8A 4COZA 1PVXA 3SMHA 5K9YA 4LE4A 3UKVA 3N4MA 1UL9A 2B42B 2R041 5HXVA 4KL1A 1QQP3 1RIRA 2QVSB 1YLLA 1Z7S1 1W0OA 2P17A 4HMZA 1NYWA 5TSWA 3C3VA 2GN3A 5SV8A 1RUC2 1AHSA 2R062 3VKMA 4COVA 4RQPC 4XFFA 1PO23 4MGZE 2CAUA 3ZIWA 4IL7A 2XLGA 1VBC2 2A5ZA 4LO6B 2VMGA 3ELNA 1YYNA 1U5XA 2ZGPA 1BEV3 1V70A 4Q0QA 4BOWA 1Z78A 3M7AA 4IV1A 1F31A 4QD2A 2MEV2 4AFAA 1TME1 3KT1A 3NKTA 4H7LA 4AVBA 1Q5OA 1WLDA 1IQAA 2GNMA 1CAWB 4XJZA 2NZ9A 4RQPA 4AXOA 2XJSA 1X8EA 1BVVA 1LOAA 4GMP1 2RS11 2QFEA 2BFUL 5K0UB 4IEWA 3MFAA 5AC91 1R083 1QWRA 3TB0A 1O3TA 2RM23 1NQDA 1GZWA 1G86A 1PM7A 4M0NA 1WW4A 1MEC3 1FOD2 3AMPA 1QKQA 3AP9A 1VBA2 4J6GA 4PDWB 1JH5A 3WNXA 4XF3A 1RJ8A 4V1PA 3AJYA 1WLCA 4ZKTB 4B4PA 1AR71 3ZFGB 1ZZ8A 4XF4A 3CNAA 5KHHA 1POV0 4HN1A 4N53C 2JECA 1KJRA 3RQ0A 3O5SA 5HBAA 5JMCA 2MPFA 3H1MA 5IK4A 3LOIA 4Z07A 3ILFA 1SACA 5DDJ1 5AFBA 1T6GC 3VBUA 1GNHA 2OIIA 4Q4Y1 1XE8A 3NWKA 4OHZA 2GC3A 4GH4B 3FBMA 3I59A 1LHUA 1QJU3 4BYYA 4JTNA 4MLOA 2D97A 2D3PA 3SH4A 1NXMA 1I9RA 3KT7A 2Y26A 3J9SA 2R30A 5EV7A 3IBMA 2IFRA 3FZ3A 4R9CA 3LGRA 4ITCA 2WS92 4OI4A 4XF1A 3IN9A 3FMGA 4QX5A 1TNFA 1RVF3 2X5IA 1AJOA 1MZ6A 1C1FA 1AL21 2ZACA 3USUA 1CAUB 2QJVA 1PNFA 3KZ4C 3WDYA 3PJYA 3N7JA 1AUYA 3MF6A 2P37A 2WNVC 3HT1A 4M01A 2ZTNA 2H6CA 1VRH2 4EWEA 1AYM1 2A6WA 2Y0OA 1BMV1 4WVVA 1G9AA 1ND3C 5J7MA 4XBNA 1X82A 3S7IA 1N1SA 4YZ2A 3JQXA 3E5XA 3NV1A 3U07A 4AEMA 1QMJA 1QOTA 1DGRN 5FBZA 4LHLA 3IMNA 3VV1A 3N35A 2DU0A 4YVSA 4QPIA 4G9SB 2E7QA 4XJWA 1W6MA 3IIAA 5ABJB 4JV4A 3CF6E 1W6PA 3MIEA 3CJXA 4F83A 1ZBA3 2ZHLA 1ASJ1 1AXZA 4LBQD 3ZFGC 1TQ5A 2Z79A 3PTYA 2WLPA 4RFT0 1ND3B 1V00A 1VAVA 4A7ZA 4AHZA 2BWCA 2AREA 1O4TA 4QQLA 3MGUA 4FTBA 3AZWA 4GWMA 1GZWB 4Y20B 3G7DA 3NL1A 1C5IA 5JPNB 3PNAA 2G4IA 1X7NA 1V6KA 1FT9A 3HR9A 1U5YA 2XVGA 5BNOB 1FYUA 4YG3A 3PVOA 1OD5A 2EA7A 2FQPA 5FFOC 1NE4A 3MF9A 1ZNPA 5CG9A 2HEVF 2W68A 2I2SA 5DUUA 3RJ2X 2GU9A 1GBGA 2XJVA 2ZMKA 5F9TA 1LRHA 1LCLA 1I5ZA 1YJLA 4QPGB 1DIWA 2WL1A 4LHKA 3JBG2 1LOBA 3LAGA 2D3SA 3WINE 2A6ZA 2HWD3 3UJOA 1QJU1 1S55A 1VAKA 1N3OA 1U12A 2WQZC 4YM1A 4RS5B 2XJQA 4M00A 1EV13 4CTEA 5GKAC 1UCXA 1PZ8A 4U2AA 3ZFEA 1QU0A 1UPIA 3SISA 4F3JA 4Z92B 2GH2A 2Q1MA 4Z1VA 3LB9A 1HRV2 1PVC2 2ZJCA 2ZX4A 4COWA 2P3JA 5JIAA 5I8YA 2WA4A 1NCQB 1Z7S2 2G9FA 2P3IA 4FO9A 3X29B 3MPBA 4AHXA 1RUF3 2Q4SA 3RNSA 4KBBA 1G8WA 4N9IA 5JOYA 1HXS3 1S0IA 5C33A 2X5IB 2R061 1V9U3 1KS5A 5DDJ3 1RUJ3 1K5MA 4L8QA 5CVRA 3LZZA 1CAUA 2NMOA 4OZXA 1GKBA 1LR5A 4LA2A 4LE3A 1DGWX 1FMD3 4FTEA 1RC6A 5HCBA 1GICA 4BLJA 5J3UA 4WBBA 4GALA 1LULA 2R1DA 1AYM3 1KITA 4RHV1 3CJIA 1COV2 4QGLA 2DV9A 3AKTA 2WZR3 2RS32 1TME3 1FPN2 1W2UA 5EJ3A 2R0FA 3TBDA 2SLIA 3VZKA 4RA0A 2XJUA 2OZJA 3WW4A 3K51A 1ASJ3 2XJRA 2DUQA 3BB6A 3B9CA 3UL2A 2UU8A 5KC5A 1W6MB 2WKKA 2VVEA 2YHJA 4JGZA 3RJRA 1ENQA 5ABJA 2ZX2A 3BODA 3ZN6A 2VMIA 1LEDA 3ZXGA 1LHVA 4YM3A 2EIGA 1W39A 1UIKA 4INDA 3VBRC 3MLKA 1AR72 5ACA2 4GB31 2VY0A 1MQTA 1MQTC 4Y24A 1UKGA 4Q0VA 4I30A 3GYDA 1WMDA 2QE3A 2BNMA 1Y43B 3M1HA 2HWF2 5H9RA 3ZDSA 2R043 5T52A 1PZ7A 2JG9B 2HWC2 1RUI3 4HVRA 2YDEA 4L9BA 3VKNA 1QNWA 1Q8OA 1S0DA 2XLFA 3I54A 2D7FA 2PHXA 3AFGA 4LUMA 4UW4A 5JOWA 1IS6A 1YFYA 4Z82A 1KD7A 4ATEA 4HSJA 3WP3A 1CQ9A 1REDA 2ZGSA 4ZU4A 1RUD3 1UX6A 5JVVA 2WNVB 2HWD1 5I0UA 1TE1B 4QPGA 1ULFA 3VGIA 1OOPB 1ZZBA 1MZEA 5FQ0B 2XJTA 2R49A 4MGKE 4PQ9A 1PGW2 1YIFA 4YZ3A 4AHYA 2VUAA 2XBO2 2NLRA 1ZYBA 2CGPA 1NLSA 4HFSA 3H3UA 2GN7A 4Q27A 2ZPXA 2RS13 1WA4A 2DCTA 5H9QA 3K48A 2BNOA 4XEZA 1KDKA 4ZU7A 2X53S 2ZX3A 4JRAA 3E6BA 2GAUA 1SLLA 3ZYRA 3MIGA 1H1AA 3AZVA 1R1A3 1DZRA 2ZBJA 1LOGA 4BPZA 4FQ4A 1NG0A 3WCRA 5KXDA 1UKRA 1O3QA 2HEWF 3VBHC 2ZGUA 4YVWB 1QJX2 1PGSA 4MSVA 1LECA 4YZ4A 2VVFA 3VKOA 3PHMA 3QH6A 2WZR1 1CAWA 1FX5A 1VLNA 4MH0E 3LCPA 5AVAA 2HWE1 2PHDA 4Y1VA 1VJ2A 2ZX1A 1LGNA 4NWVA 1NA1A 1WD4A 2PAMA 2WA3A 4PIYA 4D7SA 2A70A 2A6VA 3KMHA 1O7FA 3I8TA 1WLTA 2IXCA 1OA3A 3GF6A 3M8LA 4PDWA 5HCFA 1AXKA 2WFF3 4ZU5A 2E53A 2ZA9A 4BCUA 4QU2A 3V64A 2G9GA 1RMU1 2DFBA 3W59A 2WLQA 2WWSA 4LR4A 1SBFA 4M3CF 4QT6A 5C4WC 4B4RA 2V73A 3D8CA 1W6NA 2FMDA 1QXJA 3AMNA 4IEYA 3HMYA 2GMMA 2JG9A 1LESA 4CP2A 3ASIA 3ZSLA 1DBNA 4GH4C 1WBFA 1RUE2 5BPXA 3R4SA 2RS52 2BFUS 2HWB2 3B69A 5E1RA 1ND2A 1YFXA 3FBYA 1PVC1 1O4YA 2RMU2 1F5JA 1ZZ9A 2RJKA 4YW5A 3B94A 3DPRC 5FO7B 3FX3A 2HEYF 1VBD2 3MIHA 3OGGA 1S0GA 1DF0A 1QJY2 1ND2C 4OFGA 2XHKA 1N1YA 1BVP1 2YC0A 1FATA 2JXAA 3BIWE 1D4VB 4AQTA 4XFGA 1RUH2 2TUNA 2ZGOA 3P3PA 4WV8A 4Q8LA 2VNRA 3M3OA 1ZREA 4AQSA 3WQ1A 4OHXA 4CDQC 4OUMA 3URFA 1RUOA 2VNOA 2XVLA 5FLIA 2R071 5EZWA 1Q8VA 4GMP0 3WW1A 3RWNA 4EN7B 4E9KA 2R16A 4YZ1A 2ZZQA 4NPRA 5CFDA 1JYCA 4OI1A 1AZDA 1MS5A 1WCDJ 3MPPG 4Q0UA 5FMOS 2O8QA 4Q4X2 4YW4A 1GLHA 2RS31 5BY5A 3H3ZA 3JUUA 1FPN1 5JOZA 1VBB1 3VZOA 3ZXAC 1BQPA 4RHV3 5E89A 4HT1T 4C1XA 2MNGA 4DRRA 3ZPYA 5JCTA 3J8F1 1U0AA 3B93A 5AFEA 3AP4A 4AWDA 5CA6A 3U4XA 5CFCB 2DUOA 4LO7A 4B8EA 4EN0A 2QDNA 1H2LA 1HX6A 2JG8C 3D0JA 1QH7A 2BVVA 1AR83 4GXLA 1PO12 4LO8A 3PVBB 1KRIA 1SFNA 5AVPA 2HWF1 4DINB 4AG4A 4GB33 2VH9A 4DMIA 3MFCA 3H1WA 2B9UA 2HWC1 3GZTB 4FPEA 1PK6C 2DVBA 2D6MA 2I74A 1C28A 3U10A 5A3MA 1G9FA 4C1WA 2XL9A 2K9ZA 2DCKA 5JDBA 2WFPA 4ORFA 4BIFA 3KS7A 1AX2A 3BPZA 2PAEA 1H4GA 3FFZA 2YGLA 1DQ1A 3WQ7A 1PNGA 4Q0PA 2O8OA 4LBKA 4MX3A 5H9PA 3A0KA 4F7ZA 3P3NA 4G4FA 5GZDA 4FT8A 2NPIA 1SBEA 5JPMB 1HLCA 1NE6A 1CX4A 1H8TA 3GHMA 3J26N 3MLJA 3R4UA 5BNNA 5BNQA 4AF9A 1D4M3 4XQWA 1EPWA 1HIXA 1WUVA 1H2MA 4QQHA 2HWE3 1AR91 2BNNA 3JD73 3KGZA 4N53B 1IKQA 4NR1A 4Y1XA 4C91A 2PLV2 4X6QB 5L19A 4KWKA 3ZXFA 5BYNA 4META 5J37A 3VBRB 2MHFA 3WV6A 3TN92 3ILNA 5JLVA 4PDWC 1ZZCA 2UURA 4M0HA 5GZEA 4DFSA 3BOPA 1DGLA 2LM3A 3TYJA 4KH9A 2XKOA 1U5ZA 1SLIA 3RYPA 4WM7C 1SLBA 3AP5A 2BBVA 2IXIA 1WLWA 1POV1 3DGTA 5I0RA 2C1FA 2ZKNA 2VOXA 3AX4A 1IOAA 1S0BA 3LOBA 4E4SA 1H2KA 2QZ3A 2DCJA 5DUWA 2EXJA 4CEWA 4BE3A 2GNDA 3ZFFC 4RD7A 2H0VA 3ZXDA 4J1XA 4X8PA 3ES4A 2D98A 1SFYA 4GKYA 3MEPA 5C9AA 2GSYA 4XF9A 2X5IC 2XG3A 4BA6A 4BMEA 1W6OA 5JSOA 4K40A 3GBFA 4XHXA 5K0UA 4C90A 1NY71 2WSUA 1FAYA 2DU1A 1HXS1 3VZNA 1Q8PA 4LBNA 4XQ4A 5GLWA 5JOXA 1XE7A 5D8AA 4GKXA 3KCXA 4AGRA 5E8AA 1UN1A 3DV8A 1R1A1 2VUJA 4Q4W3 1VBB3 1PGL2 3SH5A 2EXIA 3ZMNA 1KQRA 4FQZA 2WNVA 1RHI2 5IK5A 1H1MA 3FC0A 4WVMB 4I0WB 3IT8A 3WDTA 3VKLA 1OOPA 2XL7A 4LLOA 4FPGA 5EXOA 1H1IA 1B09A 1Q56A 1QJY1 1RUG3 2XGXA 4PBPA 4HZFA 4CDXA 1DGWA 2B45X 2A7AA 2PHTA 4C0BA 3MDPA 2QNKA 1ZVFA 5A33A 1TMF3 4NN0A 1OLQA 2GZWA 4LO4B 1PMIA 5JI9A 4LO5B 3HT2A 2ZGQA 3E5UA 5K8SA 1OOPC 2NYYA 2ZGRA 5BNOC 4XILA 2R072 4D3WA 2VVDA 1H8TB 3ALQA 5JAXA 3AYEA 1AR62 4AK3A 1JTZX 4Y1UA 3E97A 4L99A 2R6QA 4JDOA 2RM21 1ALYA 3N7KA 3FUOA 5LEJA 4IEQA 3VBOA 2PHUA 3VBFB 1VBC1 4XZPA 4XW3A 3VZLA 3RI8A 2D6OX 4ZXKA 1LKNA 3MIFA 1CR7A 2VNGA 1RUC3 1XYNA 2ZGNA 4MUVA 1Q43A 2Y38A 5T5OA 3JU9A 3D6EA 4N9HA 4R4XA 1R091 1VBE2 1UU6A 4QM9A 3ZXJA 5EWSA 2JJ6A 4QMAA 1O5UA 4UW6A 4D94A 1RJ7A 1IPKA 3S7EA 2DVAA 1G6NA 4XQDA 2QQPA 4TSVA 1N47A 1PO11 4PBOA 1LEMA 2W39A 2DVFA 4AW7A 4YGCA 2YUEA 3ATGA 3WP4A 1AYN2 4CZSA 5C8CC 1EV12 4KGQA 5DUVA 4P9WA 1AR81 5F6LB 2VW0A 1BBT3 3CJIC 1R081 2KM2A 3M70A 1JBCA 2XLAA 3R0RA 3AKSA 4JQRA 1MEC1 5FDBA 4XXAA 2VW1A 1S2KA 4R9DA 5J09A 3I4IA 3FE5A 1O3SA 1MS8A 3J4UH 4YSFA 4AE2A 3TOJA 1DZQA 2DFCA 1W6OB 3RPQA 3ZN5A 2VOWA 4N90A 3KM5A 4AVVA 2NMNA 4BHPA 5DDJ2 3TNPB 1KFUL 3AYDA 4H7MA 4TLFA 4B7KA 4Y20A 2YROA 1BJQA 3WHTA 4XJUA 3ZFEC 3VBSA 2HKXA 2ERFA 1XU1A 1XNDA 1ZBE3 2EF6A 2AR6A 4NOTA 5LRRA 1SBDA 4IETA 1NLRA 4PCRA 3FLRA 4ONUA 2EVXA 2ARXA 1ZZ6A 3VLBB 2P2KA 4Y22B 4OHVA 4B29A 3CLPA 3ECQA 3BALA 1TME2 1F9KA 1SEFA 4IEPA 3WY6A 5T55A 1DGRA 2UY8A 1ASJ2 1ZRDA 1QDCA 1KFXL 1CPNA 5AC92 3IKWA 4CDXB 4YRDA 1D4M1 3L9JT 5EYYA 4HVOA 3POSA 4R52A 3WT3A 4I3PA 2GH8A 1HRI3 1VBA1 1ZM1A 1FNZA 3I2DA 4XJ9A 3ZFFB 1WW5A 1S2BA 2B7YA 1DQ0A 1RMU3 3O14A 1DYPA 4IV3C 3AK0A 4JGYB 3NAPA 2PN5A 3MIDA 5LEKA 2K2SA 3B5LB 1GSLA 1IS5A 1N1TA 1QHDA 2GNBA 2P3KA 2UYBA 1K5MB 1CAXA 1WW6A 1YFUA 4IV1B 5CU1A 4Q4Y2 3VDDC 1RUD1 1OSGA 4FP3A 2GC1A 4DY5A 2MEV3 5DUXA 2R0HA 1PO21 4AFCA 3CJIB 4DZGA 4FAHA 4E2GA 1MVEA 1ZBA2 3KQRA 1FV2A 1NY72 5EFUA 2F4PA 5FO8B 1QOOA 4QPIC 3RYRA 3AKQA 4I0AA 5F6KA 3J8F3 2OA2A 4HL0A 1CAVB 2BEOA 4E27A 4QGNA 3GBWA 2IXKA 1AL22 3WP6A 3AP7A 4HKLA 4Q4V2 2IWGB 3KCCA 4S2GA 2QDRA 3ZN6B 3ZFGA 1MS1A 3W58A 5JZGB 4LHNA 4COUA 1JUIA 3D4KA 5FLHA 2Q1ZB 1C3HA 1MQTB 3ZIXA 2ENRA 2BWAA 4NWWA 1VRH1 4LBMA 3ILRA 4NVPA 4R4ZA 5F1RA 5BNNC 5FRAA 1EAH2 2VW2A 1V6LA 3PLQA 4GH4A 4DY3A 4Z8BA 3PVEA 4FPCA 4JAAA 3SXWA 2Y0IA 4HKWA 1QJX3 3VUOA 4HETA 1MACA 3VBSC 3APBA 2PHFA 4YW3A 2X8KA 3POYA 3LSDA 4NHLA 1ZBE1 5T5PA 4P9JA 4MYEA 3MI8A 5BNNB 4WM8C 4H14A 3ZN4A 2XUMA 4XIKA 3EHKA 1LB2A 2EAAA 2IXJA 2NM1A 3MZHA 2GC2A 5SV5A 4N53A