5JT4A

L16a mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
b'EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans
molecule tags Electron transport
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jt4A00
3DE9A 4EIYA 4D4NA 3ZQVA 5JS5A 5JSLA 1E85A 2YLIA 1CGOA 2J9BA 4JEBA 2YLGA 4D4XA 3ZTZA 4U9EA 4U9DA 3C62A 2XLDA 2XL8A 1YZCA 2XLOA 3FOPA 4CDVA 3QW0A 1A7VA 4CDAA 2XLEA 2YL1A 3M79A 2BC5A 4CJOA 2J8WA 4CIPA 5JVEA 2XLHA 3HNIA 1QQ3A 2YL3A 2XLWA 4IB4A 3M4BA 3C63A 3HNJA 2YKZA 3NMIA 1YYXA 4N4WA 5JUAA 3QVZA 3M15A 3ZTMA 2YL7A 1APCA 3DE8A 3NMJA 1GQAA 4L6RA 1CPQA 5JLIA 1M6TA 5B3IA 2YLDA 4JKVA 1NBBA 3HNKA 3TOLA 4CDYA 2QLAA 2XLVA 5AGFA 1CGNA 2XL6A 4JEAA 1E86A 2XM0A 2XM4A 1QPUA 1YZAA 4ULVA 1E84A 1BBHA 1CPRA 4WGZA 3NMKA 4N6HA 1S05A 3IQ5A 4NC3A 256BA 4CJGA 1JAFA 3L1MA 2YL0A 4IAQA 3U8PA 3ZWIA 3QVYA 4CX9A 4WGYA 5JT4A 3VRCA 5JRAA 1MQVA 1EKYA 4IARA 3ZQYA 1LM3B 3HNLA 3FOOA 1YYJA 2XLMA 2CCYA 1E83A 5JP7A 1RCPA 4ER9A 3QW1A 4JE9A 3M4CA 3IQ6A 3TOMA
chains in the Genus database with same CATH superfamily
4EUKB 2OCCC 3UMIA 2WZFA 3O39A 3AG1C 2A6EF 4CS9A 1LPEA 2E87A 1JRAA 3U5SA 2GWWA 4IJJA 1QVXA 1U89A 1WWPA 3EHNA 4U5BE 4B6IA 4C3EA 3EGXB 3AGUA 1JPNA 3TK0A 3H65A 2OKUA 2EINC 3RFYA 2IM8A 2LK4A 1CGOA 2IBFA 3DJNB 3N2ZB 4G7ZF 4C7OB 4D4XA 2YLGA 1GGQA 1OCOC 4J32B 4BJ1A 2IOQA 3UMHA 5F5HA 3ZTZA 2DYRC 2L9JA 4N6CA 5A6BD 3C62A 4LACB 3O6XA 2XRHA 1LS4A 2XL8A 3L8IA 4C3BA 3HJCA 4CS8A 3FDQA 2WZGA 3FOPA 3JT1A 1LVKA 3C18A 1D1BA 1OR2A 1A7VA 1Z23A 2RSEB 3KH2A 3G4ZA 2NUPB 2YL1A 3M79A 5AC4A 4MW8A 2BC5A 3UR3C 2J8WA 1T9KA 3BRJA 3EGXA 2ASRA 3C8ZA 3S28A 2NUTB 4G0HA 4LLCA 1KTMA 3ASOC 4PJLA 1C02A 4ULWA 3H2VA 2X51A 4YL3A 2DYSC 1R5ID 2A6HF 2Q9BA 3HNIA 4C7OA 4XTKA 1EI7A 2YL3A 3DI5A 3SXZA 3MX3A 4IGGA 4AL0A 5L3QA 2HMQA 1C03A 1FAPB 1L7CA 1OCRC 1UG7A 5BQHA 4IB4A 3ZIBA 3ZSUA 2IXMA 4U5EE 4N06A 1LI7A 3C8GB 5KYNA 3HNJA 2YKZA 3UMKA 5L0GA 4HFKB 4U5CE 4WJ0A 4CS9C 2FAPB 4YJWA 4N4WA 2OQMA 2Y3BA 3LLIA 2BE5F 5JUAA 4LERA 2XSEA 2NUPA 4Z9IA 4XWJA 1NSGB 2Q3TA 2MWQA 4KI2A 1A41A 4W8KA 2OEVA 2QNLA 4DRHB 1YJGA 2PFDA 2P1AA 2YHSA 3JRMO 4C3DA 3UGPA 1VYKA 4OIPF 1RKEB 4O6NA 3U9MA 2BL2A 4A2NB 4DVZA 3AQBA 2R7UA 3EH1A 1ZVZA 5K0IA 4CSAC 3EG9B 2FGYA 1M57C 1M2VB 1ORSC 5B3IA 1D0XA 1MMDA 2A69F 4JKVA 1NBBA 1KNYA 3S84A 2AVKA 1MNEA 4XPXA 4UDVA 3HLZA 1VTMP 1Q0DA 3TJ5A 2J7PD 4CDYA 5KYWB 3C8GA 2ETSA 1MMAA 3Q7LA 4JEAA 1JMWA 1TWGA 2XM0A 4R32A 4RD9A 4PR9A 4I44A 2Y3HA 1SZIA 1E84A 4LDQA 4WGZA 3RQEA 1HMDA 3NMKA 3GM1A 1S05A 5T3TA 3EFOB 3GWLA 3SXYA 4JIOA 1T5OA 3K1IA 3AQCA 2HSBA 3R2PA 256BA 4O7GA 1G4WR 3NKEA 1ZHWA 1RKEA 1D1CA 4DRIB 4ZLDA 3MBGA 3UGOA 1VB5A 4NY3A 3T6GB 4ONSA 3U8PA 1M2VA 1S7ZA 1AVOB 2ZXWC 3T6BA 1V55C 3HTKC 3X1OA 2M64A 3W2WA 4MVQA 4BJ6A 4WABA 1JOGA 5JRAA 5KYWA 1SMYF 4O6YA 1W2WA 2LD6A 2NSGA 3K1HA 3IPMO 5T3WA 5DS6A 3I4UA 2QE9A 1T6IA 3ATPA 1O5HA 2Q9AA 3AG2C 2XLMA 3RVZA 2CCYA 2G3KA 4W8PA 2OEXA 5JP7A 3EJNA 4YWQA 2HFIA 4ER9A 4JE9A 3EFOA 3M4CA 3IQ6A 3TOMA 4JJGA 4EBKA 2CGEA 4GQHA 1OKKD 2XXAB 2V26A 4HEAJ 3EGDB 3G50A 4D4NA 4I1OB 2EPOA 3AG4C 5KYUB 3LEVA 1LE4A 4ZLCA 2J9VA 3BEHA 3PDMP 3W8HA 2W4BA 3JRTA 5B1BC 2PF4E 5CI8A 2R7WA 4E17A 4QI0A 1V54C 2YLIA 4CBEA 3DXJF 1VYIA 2NSFA 4EWCA 1AUEA 5T1DB 3LLKA 2R02A 4E18A 2LQGA 3RH3A 3T6JA 3SNHA 4BEMJ 5L0HA 3NDBB 1FMWA 1PD1A 4KBLA 4U5GA 3TULA 2XLDA 5COGA 4PACA 2YRFA 4Q4ZF 1OW6A 4MVZA 3K1IC 3QZCA 1M56C 3CSKA 2W45A 1BR1A 3EHMA 3EH2A 2C04A 2XXAA 2Y69C 4CDAA 1VOMA 1H7IA 3EGDA 3E70C 1BZ4A 2OOCA 3V5YA 3U2LA 4CIPA 1KU2A 3GWNA 3LAYA 5KYUA 2O9XA 2A0UA 2IXPA 5JVEA 2KC3A 4JJFA 4BJ6C 2XLHA 3B9QA 3L34A 4YT4A 5L0FA 4F4BA 3CQZA 1TWHA 3RKOF 2W9YA 1I5NA 5B3SC 3B0UX 2R7VA 2GDCA 3L8JA 1XZPA 1OW7A 3U2MA 1RXQA 1DOWA 1OCCC 4AE4B 1HMOA 4Q5SF 2AU5A 1OR3A 2JPUA 3M4BA 3NKDA 1J8MF 2A0BA 4GYTA 4Z9HA 3AGTA 2HZ8A 3X2QC 3S90A 1A7EA 3NMIA 2P61A 1RJ9B 1PCXA 1YYXA 4DXWA 3EQLF 2QUPA 3I5QA 3PCVA 2JX0A 4OD4A 2R05A 1AEPA 1QZXA 1UFBA 4OIOF 1MMNA 3KMIA 3LEOA 4E7SA 1ORYA 4JC7A 5IY5C 3U3BA 3T4RA 5L0DA 3B0VC 4NTAA 2TMVP 3S0XA 3WODF 4MVMA 4JW1A 4XLPF 1M6TA 3CAXA 5L0IA 2OG2A 2HMZA 4U5HA 3GEIA 4AE4A 1Q0MA 4LDKA 2R9RB 3EPVA 1IZMA 1H6GA 4AX2A 4A4AA 1FMVA 2P6VA 1TFOB 4BEJA 2R7TA 4RDAA 4OD5A 1RJ9A 3K66A 1E86A 2G62A 1QPUA 4I3MA 1O3UA 3DM5A 4DVYP 1CPRA 2LFFA 1OXBA 4AK9A 1FNTc 3DMDA 1NU7D 4OINF 4YT2A 3GM2A 1Z63A 3W4YA 5F5FA 5COFA 4H4KC 1D1AA 4HE8D 4ANJA 4OIRF 4P9FA 1M2OA 4JCZA 3SYNA 5A6BA 2YL0A 2NPUA 4FX5A 2FFHA 3DAGA 2NUTA 1SF8A 3U8VA 4IAQA 4QI2A 1MNDA 4XPYA 1HY5A 5BQIA 3OWTA 1V4AA 2D4UA 3ZWIA 1WGWA 2VCAA 3MFNA 1FFHA 2L7AA 3JZ0A 5FCLA 1TR2A 3T9OA 4NCQA 3V5XA 1EA8A 3SXKA 3LNMB 1MQVA 1ZHTA 2R03A 1D0ZA 4CS8C 1EKYA 4IARA 4JTCB 1ZYRF 3ZQYA 1NZEA 1BR2A 3DD7A 1K40A 1BDJB 1LM3B 3LESA 1TWAA 2A68F 4E0HA 2R7SA 1YYJA 2Z15A 4M63A 3ECSA 3VM6A 4YL1A 1NLXA 4XEKA 1G5ZA 2HV6A 3S27A 1RCPA 3IEEA 2ZPAA 5COMA 3U3FA 2R7OA 5F28E 1Z3IX 3DE9A 3GORA 3UNGC 1HE9A 2HS5A 5D92A 3L0IA 3NG1A 5DS4A 4DOZA 1GS9A 2XL4A 2ZXOA 3GODA 3GANA 2JD3A 1EQ1A 2OJQA 1SYQA 4EKWA 2B0JA 3EG9A 4JVSA 2UUHA 2C03A 1U6HA 3EZHA 1TKNA 3RQFA 1E85A 2G3VA 2XS8A 3LNRA 2J9BA 4JEBA 1FR0A 3ZC4A 2I15A 1R4TA 3SXMA 3GEEA 1Q0FA 3W2VA 4BJ5A 3WAQA 4YT5A 4U9DA 2ZD9A 1U0BB 5DQZA 1ZW3A 2ICWG 3JYHA 2R7XA 1YZCA 4CDVA 1G8XA 1V74B 3QW0A 2PBEA 1ST6A 5CIVA 5E3AA 2KSFA 4J30B 4K7BA 3MYFA 4PJMA 2CNWD 2J0WA 2CDQA 2B0HA 1TFKB 3B29A 2Q7RA 3TD7A 4DRJB 4CJOA 2J7PA 3KL4A 5KYYB 3F46A 3GEHA 1Y6DA 1O87A 3N24A 1OXKA 4KC9A 5DQTA 4DBQA 4H54A 2MHRA 3POVA 2H7OA 3B71A 2HV7A 3ZVRA 3M1CB 2IYLD 2P7VA 3RYLA 2VB6A 5BUOA 1QQ3A 1VLTA 1MMGA 1VMAA 2VC9A 4NTFA 2CYDA 2LFDA 4JRZA 2X0CA 5A6KA 3C63A 2HJMA 1F1MA 5DVWA 1OQCA 1VLSA 2Y3DA 2YEVA 3MLGA 3JSZA 1PV3A 3VF0A 3U0CA 3QVZA 3M15A 1XZQA 4BJTA 1QSPA 2YL7A 4O79A 2ZXPA 3V7OA 3DE8A 3E9VA 5KYYA 2CW0F 3ABKC 3NMJA 5HV9A 5A69A 4DJ9A 1YA9A 2EPLX 2GAQA 1GQAA 4G78A 4XQ1A 2PX3A 3DAFA 4L6RA 1D0YA 3SZRA 4BJ5C 3LS0A 5JLIA 3NYMA 3RQGA 2WVOA 5L0CA 4NTBA 1Z7Qc 3AG3C 2EPKX 1H9TA 4OIQF 3HNKA 2DI3A 1A0BA 1OKKA 4X0RA 3TOLA 4PJNA 2KK1A 2Q9CA 3NRHA 1RMVA 4QDLA 4Q7CA 5DS5A 2ZXRA 4MTOA 1SR2A 3I5PA 4MS2A 3K6BA 4E7ZA 1YZAA 4ULVA 3US6A 1BBHA 4XLNF 1ZHYA 2VH3A 2WVNA 3FVYA 1J8YF 5A6AA 3TQOA 4NQFA 1LKXA 2Q00A 3K7DA 1Q0KA 4JZAA 4NC3A 4XEVA 1T6QA 1C17M 4CS7A 3JCUQ 2H7BA 3L1MA 1ZHXA 2QY9A 3MYIA 4MQ9F 3OEOA 3FAPB 3SP1A 4E0IA 1CGME 1OW8A 3DZAA 2HSQA 5E33A 3QVYA 4LDRA 4CX9A 2IXNA 3S29A 1JPJA 1YVIA 2WVQA 4U5FE 4P9TA 4CSAA 1WATA 2EIKC 1Y4CA 1ZU5A 1RKCA 3R7CA 2VCCA 5FZTA 2R7RA 2GFHA 3FAJA 2W4MA 4PJJA 3U9JA 2J9UA 3FOOA 2AWCA 3KKBA 4YL0A 3S9OA 3DM9B 3LJBA 3AOUA 2WL8A 1E83A 3G4XA 3Q6MA 2YVKA 3QW1A 4EIYA 3O10A 2I8BA 2Y39A 4J7YA 2EPMX 2RD9A 1XWJA 2OU6A 1LIHA 2DB4A 2KJGA 2DGJA 3ABLC 3C8GD 4FWVA 4HFFB 4FAPB 4CIHA 3IHUA 4MVRA 2VCBA 3RF3A 1ORJA 5EK0A 3PMRA 1ZW2A 1A7DA 3ZQVA 2EILC 2PP4A 2WB7A 1OCZC 5JS5A 5JSLA 1LI5A 1WOLA 3IQTA 2V3CC 2LSEA 2PNOA 2M4EA 2YZSA 2QTVA 4BG0A 4YK5A 4LLEA 5GPGB 3RIPA 3WHNA 3KPHA 1L3PA 4U9EA 4MW3A 4FESA 5E2QA 1I4ZA 5L3VA 1N1CA 2XLOA 4EBBA 5HSWA 1NU9C 3KYIA 3N0TA 1WTYA 2Y3GA 4PFPA 3DKAA 2KW3C 4IAOA 2Q4FA 1I4YA 3K33A 2XLEA 3AJMA 1T01A 1T6UA 2EIJC 2L6HA 4JCHA 2HKVA 1HW2A 3DWWA 4JTAB 3JTLO 2VASA 3B0PA 3LS1A 3CZ6A 1JR8A 3A9CA 2F22A 2H8AA 2MYSA 1YA7O 3IQCA 4GEHA 2IXOA 3GM3A 4YN0B 4MVSA 2LCHA 1FFTC 2H7VC 5CI9A 4MVOA 4PFOA 2WZLA 2KNHA 2XLWA 1PD0A 1YLMA 3FHDA 2P0NA 1HW1A 3QMKA 3SEOA 4RBNA 1YAUO 1NG1A 2KQ9A 1WASA 4EHPA 3RW0A 4IRUA 3TJ6A 4DBRA 1H9GA 2EIMC 2XS1A 3JYYA 5A6JA 1ZHZA 1K04A 1BR4A 2NG1A 3ZTMA 4XPWA 4K1OA 4IWBA 1TQGA 4MTFA 2KYHA 1K05A 1APCA 4JURI 2YWAA 1IW7F 2GA0A 2J45A 3LUTB 5D91A 3QTHA 3Q6NA 1CPQA 3JSEO 2KGOA 2L81A 4EBJA 4AL1A 2J9WA 3ZDLA 1VK5A 3ZG1A 2YLDA 5EHHA 3C7JA 1G4US 1WN0A 3HKKA 3RVYA 4P6IC 5AC5A 2PX0A 1HE1A 1Z5ZA 2OJED 1ZZPA 2QLAA 3NYLA 1LS1A 2HUJA 2XLVA 5AGFA 4U5DE 1CGNA 2R7QA 2LIGA 3ASNC 3ITFA 3Q7GA 5TJ5E 1DOVA 2XM4A 1QLEC 1Z6AA 3PHF2 5DLJA 1TWCA 4N6HA 4BPMA 3J06A 3IQ5A 5BQGA 2R25A 5KYXB 1B68A 2AWYA 2L6FA 3VYWA 1QKRA 4PK4A 1NFOA 3V5ZA 1JAFA 3O55A 4CJGA 1E2XA 1Q0GA 3WG7C 4KNVA 2LP4A 3FXHA 3NYJA 4O6MA 5L0JA 1YDIA 4MTGA 2J0XA 4KNWA 5B1AC 4WGYA 2J46A 4K0DA 5JT4A 2HJ3A 3H2UA 3KYJA 4MVUA 4G7HF 1LE2A 3VRCA 3DJUB 5E3CA 4G7OF 2CNWA 2A1DD 2UUIA 3OA1A 4J7TA 3A11A 4MNDA 1ZU4A 3VAYA 2AP3A 5EGYA 3ABMC 4I1MA 4Z9JA 4XEFA 3W8IA 3HNLA 3EZIA 3F47A 1FTSA 3CEXA 1YARO 1NFNA 3FMSA 4JTDB 4YT8A 2D5RB 2L6GA 2EPNA 2XL6A 1GM5A 5KYXA 2YQYA
chains in the Genus database with same CATH topology
3DE9A 4EIYA 4D4NA 3ZQVA 5JS5A 5JSLA 1E85A 2YLIA 1CGOA 2J9BA 4JEBA 2YLGA 4D4XA 3ZTZA 4U9EA 4U9DA 3C62A 2XLDA 2XL8A 1YZCA 2XLOA 3FOPA 4CDVA 3QW0A 1A7VA 4CDAA 2XLEA 2YL1A 3M79A 2BC5A 4CJOA 2J8WA 4CIPA 5JVEA 2XLHA 3HNIA 1QQ3A 2YL3A 2XLWA 4IB4A 3M4BA 3C63A 3HNJA 2YKZA 3NMIA 1YYXA 4N4WA 5JUAA 3QVZA 3M15A 3ZTMA 2YL7A 1APCA 3DE8A 3NMJA 1GQAA 4L6RA 1CPQA 5JLIA 1M6TA 5B3IA 2YLDA 4JKVA 1NBBA 3HNKA 3TOLA 4CDYA 2QLAA 2XLVA 5AGFA 1CGNA 2XL6A 4JEAA 1E86A 2XM0A 2XM4A 1QPUA 1YZAA 4ULVA 1E84A 1BBHA 1CPRA 4WGZA 3NMKA 4N6HA 1S05A 3IQ5A 4NC3A 256BA 4CJGA 1JAFA 3L1MA 2YL0A 4IAQA 3U8PA 3ZWIA 3QVYA 4CX9A 4WGYA 5JT4A 3VRCA 5JRAA 1MQVA 1EKYA 4IARA 3ZQYA 1LM3B 3HNLA 3FOOA 1YYJA 2XLMA 2CCYA 1E83A 5JP7A 1RCPA 4ER9A 3QW1A 4JE9A 3M4CA 3IQ6A 3TOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DE9 A;  4EIY A;  4D4N A;  3ZQV A;  5JS5 A;  5JSL A;  1E85 A;  2YLI A;  1CGO A;  2J9B A;  4JEB A;  2YLG A;  4D4X A;  3ZTZ A;  4U9E A;  4U9D A;  3C62 A;  2XLD A;  2XL8 A;  1YZC A;  2XLO A;  3FOP A;  4CDV A;  3QW0 A;  1A7V A;  4CDA A;  2XLE A;  2YL1 A;  3M79 A;  2BC5 A;  4CJO A;  2J8W A;  4CIP A;  5JVE A;  2XLH A;  3HNI A;  1QQ3 A;  2YL3 A;  2XLW A;  4IB4 A;  3M4B A;  3C63 A;  3HNJ A;  2YKZ A;  3NMI A;  1YYX A;  4N4W A;  5JUA A;  3QVZ A;  3M15 A;  3ZTM A;  2YL7 A;  1APC A;  3DE8 A;  3NMJ A;  1GQA A;  4L6R A;  1CPQ A;  5JLI A;  1M6T A;  5B3I A;  2YLD A;  4JKV A;  1NBB A;  3HNK A;  3TOL A;  4CDY A;  2QLA A;  2XLV A;  5AGF A;  1CGN A;  2XL6 A;  4JEA A;  1E86 A;  2XM0 A;  2XM4 A;  1QPU A;  1YZA A;  4ULV A;  1E84 A;  1BBH A;  1CPR A;  4WGZ A;  3NMK A;  4N6H A;  1S05 A;  3IQ5 A;  4NC3 A;  256B A;  4CJG A;  1JAF A;  3L1M A;  2YL0 A;  4IAQ A;  3U8P A;  3ZWI A;  3QVY A;  4CX9 A;  4WGY A;  5JT4 A;  3VRC A;  5JRA A;  1MQV A;  1EKY A;  4IAR A;  3ZQY A;  1LM3 B;  3HNL A;  3FOO A;  1YYJ A;  2XLM A;  2CCY A;  1E83 A;  5JP7 A;  1RCP A;  4ER9 A;  3QW1 A;  4JE9 A;  3M4C A;  3IQ6 A;  3TOM A; 
#chains in the Genus database with same CATH topology
 4EUK B;  2OCC C;  3UMI A;  2WZF A;  3O39 A;  3AG1 C;  2A6E F;  4CS9 A;  1LPE A;  2E87 A;  1JRA A;  3U5S A;  2GWW A;  4IJJ A;  1QVX A;  1U89 A;  1WWP A;  3EHN A;  4U5B E;  4B6I A;  4C3E A;  3EGX B;  3AGU A;  1JPN A;  3TK0 A;  3H65 A;  2OKU A;  2EIN C;  3RFY A;  2IM8 A;  2LK4 A;  1CGO A;  2IBF A;  3DJN B;  3N2Z B;  4G7Z F;  4C7O B;  4D4X A;  2YLG A;  1GGQ A;  1OCO C;  4J32 B;  4BJ1 A;  2IOQ A;  3UMH A;  5F5H A;  3ZTZ A;  2DYR C;  2L9J A;  4N6C A;  5A6B D;  3C62 A;  4LAC B;  3O6X A;  2XRH A;  1LS4 A;  2XL8 A;  3L8I A;  4C3B A;  3HJC A;  4CS8 A;  3FDQ A;  2WZG A;  3FOP A;  3JT1 A;  1LVK A;  3C18 A;  1D1B A;  1OR2 A;  1A7V A;  1Z23 A;  2RSE B;  3KH2 A;  3G4Z A;  2NUP B;  2YL1 A;  3M79 A;  5AC4 A;  4MW8 A;  2BC5 A;  3UR3 C;  2J8W A;  1T9K A;  3BRJ A;  3EGX A;  2ASR A;  3C8Z A;  3S28 A;  2NUT B;  4G0H A;  4LLC A;  1KTM A;  3ASO C;  4PJL A;  1C02 A;  4ULW A;  3H2V A;  2X51 A;  4YL3 A;  2DYS C;  1R5I D;  2A6H F;  2Q9B A;  3HNI A;  4C7O A;  4XTK A;  1EI7 A;  2YL3 A;  3DI5 A;  3SXZ A;  3MX3 A;  4IGG A;  4AL0 A;  5L3Q A;  2HMQ A;  1C03 A;  1FAP B;  1L7C A;  1OCR C;  1UG7 A;  5BQH A;  4IB4 A;  3ZIB A;  3ZSU A;  2IXM A;  4U5E E;  4N06 A;  1LI7 A;  3C8G B;  5KYN A;  3HNJ A;  2YKZ A;  3UMK A;  5L0G A;  4HFK B;  4U5C E;  4WJ0 A;  4CS9 C;  2FAP B;  4YJW A;  4N4W A;  2OQM A;  2Y3B A;  3LLI A;  2BE5 F;  5JUA A;  4LER A;  2XSE A;  2NUP A;  4Z9I A;  4XWJ A;  1NSG B;  2Q3T A;  2MWQ A;  4KI2 A;  1A41 A;  4W8K A;  2OEV A;  2QNL A;  4DRH B;  1YJG A;  2PFD A;  2P1A A;  2YHS A;  3JRM O;  4C3D A;  3UGP A;  1VYK A;  4OIP F;  1RKE B;  4O6N A;  3U9M A;  2BL2 A;  4A2N B;  4DVZ A;  3AQB A;  2R7U A;  3EH1 A;  1ZVZ A;  5K0I A;  4CSA C;  3EG9 B;  2FGY A;  1M57 C;  1M2V B;  1ORS C;  5B3I A;  1D0X A;  1MMD A;  2A69 F;  4JKV A;  1NBB A;  1KNY A;  3S84 A;  2AVK A;  1MNE A;  4XPX A;  4UDV A;  3HLZ A;  1VTM P;  1Q0D A;  3TJ5 A;  2J7P D;  4CDY A;  5KYW B;  3C8G A;  2ETS A;  1MMA A;  3Q7L A;  4JEA A;  1JMW A;  1TWG A;  2XM0 A;  4R32 A;  4RD9 A;  4PR9 A;  4I44 A;  2Y3H A;  1SZI A;  1E84 A;  4LDQ A;  4WGZ A;  3RQE A;  1HMD A;  3NMK A;  3GM1 A;  1S05 A;  5T3T A;  3EFO B;  3GWL A;  3SXY A;  4JIO A;  1T5O A;  3K1I A;  3AQC A;  2HSB A;  3R2P A;  256B A;  4O7G A;  1G4W R;  3NKE A;  1ZHW A;  1RKE A;  1D1C A;  4DRI B;  4ZLD A;  3MBG A;  3UGO A;  1VB5 A;  4NY3 A;  3T6G B;  4ONS A;  3U8P A;  1M2V A;  1S7Z A;  1AVO B;  2ZXW C;  3T6B A;  1V55 C;  3HTK C;  3X1O A;  2M64 A;  3W2W A;  4MVQ A;  4BJ6 A;  4WAB A;  1JOG A;  5JRA A;  5KYW A;  1SMY F;  4O6Y A;  1W2W A;  2LD6 A;  2NSG A;  3K1H A;  3IPM O;  5T3W A;  5DS6 A;  3I4U A;  2QE9 A;  1T6I A;  3ATP A;  1O5H A;  2Q9A A;  3AG2 C;  2XLM A;  3RVZ A;  2CCY A;  2G3K A;  4W8P A;  2OEX A;  5JP7 A;  3EJN A;  4YWQ A;  2HFI A;  4ER9 A;  4JE9 A;  3EFO A;  3M4C A;  3IQ6 A;  3TOM A;  4JJG A;  4EBK A;  2CGE A;  4GQH A;  1OKK D;  2XXA B;  2V26 A;  4HEA J;  3EGD B;  3G50 A;  4D4N A;  4I1O B;  2EPO A;  3AG4 C;  5KYU B;  3LEV A;  1LE4 A;  4ZLC A;  2J9V A;  3BEH A;  3PDM P;  3W8H A;  2W4B A;  3JRT A;  5B1B C;  2PF4 E;  5CI8 A;  2R7W A;  4E17 A;  4QI0 A;  1V54 C;  2YLI A;  4CBE A;  3DXJ F;  1VYI A;  2NSF A;  4EWC A;  1AUE A;  5T1D B;  3LLK A;  2R02 A;  4E18 A;  2LQG A;  3RH3 A;  3T6J A;  3SNH A;  4BEM J;  5L0H A;  3NDB B;  1FMW A;  1PD1 A;  4KBL A;  4U5G A;  3TUL A;  2XLD A;  5COG A;  4PAC A;  2YRF A;  4Q4Z F;  1OW6 A;  4MVZ A;  3K1I C;  3QZC A;  1M56 C;  3CSK A;  2W45 A;  1BR1 A;  3EHM A;  3EH2 A;  2C04 A;  2XXA A;  2Y69 C;  4CDA A;  1VOM A;  1H7I A;  3EGD A;  3E70 C;  1BZ4 A;  2OOC A;  3V5Y A;  3U2L A;  4CIP A;  1KU2 A;  3GWN A;  3LAY A;  5KYU A;  2O9X A;  2A0U A;  2IXP A;  5JVE A;  2KC3 A;  4JJF A;  4BJ6 C;  2XLH A;  3B9Q A;  3L34 A;  4YT4 A;  5L0F A;  4F4B A;  3CQZ A;  1TWH A;  3RKO F;  2W9Y A;  1I5N A;  5B3S C;  3B0U X;  2R7V A;  2GDC A;  3L8J A;  1XZP A;  1OW7 A;  3U2M A;  1RXQ A;  1DOW A;  1OCC C;  4AE4 B;  1HMO A;  4Q5S F;  2AU5 A;  1OR3 A;  2JPU A;  3M4B A;  3NKD A;  1J8M F;  2A0B A;  4GYT A;  4Z9H A;  3AGT A;  2HZ8 A;  3X2Q C;  3S90 A;  1A7E A;  3NMI A;  2P61 A;  1RJ9 B;  1PCX A;  1YYX A;  4DXW A;  3EQL F;  2QUP A;  3I5Q A;  3PCV A;  2JX0 A;  4OD4 A;  2R05 A;  1AEP A;  1QZX A;  1UFB A;  4OIO F;  1MMN A;  3KMI A;  3LEO A;  4E7S A;  1ORY A;  4JC7 A;  5IY5 C;  3U3B A;  3T4R A;  5L0D A;  3B0V C;  4NTA A;  2TMV P;  3S0X A;  3WOD F;  4MVM A;  4JW1 A;  4XLP F;  1M6T A;  3CAX A;  5L0I A;  2OG2 A;  2HMZ A;  4U5H A;  3GEI A;  4AE4 A;  1Q0M A;  4LDK A;  2R9R B;  3EPV A;  1IZM A;  1H6G A;  4AX2 A;  4A4A A;  1FMV A;  2P6V A;  1TFO B;  4BEJ A;  2R7T A;  4RDA A;  4OD5 A;  1RJ9 A;  3K66 A;  1E86 A;  2G62 A;  1QPU A;  4I3M A;  1O3U A;  3DM5 A;  4DVY P;  1CPR A;  2LFF A;  1OXB A;  4AK9 A;  1FNT c;  3DMD A;  1NU7 D;  4OIN F;  4YT2 A;  3GM2 A;  1Z63 A;  3W4Y A;  5F5F A;  5COF A;  4H4K C;  1D1A A;  4HE8 D;  4ANJ A;  4OIR F;  4P9F A;  1M2O A;  4JCZ A;  3SYN A;  5A6B A;  2YL0 A;  2NPU A;  4FX5 A;  2FFH A;  3DAG A;  2NUT A;  1SF8 A;  3U8V A;  4IAQ A;  4QI2 A;  1MND A;  4XPY A;  1HY5 A;  5BQI A;  3OWT A;  1V4A A;  2D4U A;  3ZWI A;  1WGW A;  2VCA A;  3MFN A;  1FFH A;  2L7A A;  3JZ0 A;  5FCL A;  1TR2 A;  3T9O A;  4NCQ A;  3V5X A;  1EA8 A;  3SXK A;  3LNM B;  1MQV A;  1ZHT A;  2R03 A;  1D0Z A;  4CS8 C;  1EKY A;  4IAR A;  4JTC B;  1ZYR F;  3ZQY A;  1NZE A;  1BR2 A;  3DD7 A;  1K40 A;  1BDJ B;  1LM3 B;  3LES A;  1TWA A;  2A68 F;  4E0H A;  2R7S A;  1YYJ A;  2Z15 A;  4M63 A;  3ECS A;  3VM6 A;  4YL1 A;  1NLX A;  4XEK A;  1G5Z A;  2HV6 A;  3S27 A;  1RCP A;  3IEE A;  2ZPA A;  5COM A;  3U3F A;  2R7O A;  5F28 E;  1Z3I X;  3DE9 A;  3GOR A;  3UNG C;  1HE9 A;  2HS5 A;  5D92 A;  3L0I A;  3NG1 A;  5DS4 A;  4DOZ A;  1GS9 A;  2XL4 A;  2ZXO A;  3GOD A;  3GAN A;  2JD3 A;  1EQ1 A;  2OJQ A;  1SYQ A;  4EKW A;  2B0J A;  3EG9 A;  4JVS A;  2UUH A;  2C03 A;  1U6H A;  3EZH A;  1TKN A;  3RQF A;  1E85 A;  2G3V A;  2XS8 A;  3LNR A;  2J9B A;  4JEB A;  1FR0 A;  3ZC4 A;  2I15 A;  1R4T A;  3SXM A;  3GEE A;  1Q0F A;  3W2V A;  4BJ5 A;  3WAQ A;  4YT5 A;  4U9D A;  2ZD9 A;  1U0B B;  5DQZ A;  1ZW3 A;  2ICW G;  3JYH A;  2R7X A;  1YZC A;  4CDV A;  1G8X A;  1V74 B;  3QW0 A;  2PBE A;  1ST6 A;  5CIV A;  5E3A A;  2KSF A;  4J30 B;  4K7B A;  3MYF A;  4PJM A;  2CNW D;  2J0W A;  2CDQ A;  2B0H A;  1TFK B;  3B29 A;  2Q7R A;  3TD7 A;  4DRJ B;  4CJO A;  2J7P A;  3KL4 A;  5KYY B;  3F46 A;  3GEH A;  1Y6D A;  1O87 A;  3N24 A;  1OXK A;  4KC9 A;  5DQT A;  4DBQ A;  4H54 A;  2MHR A;  3POV A;  2H7O A;  3B71 A;  2HV7 A;  3ZVR A;  3M1C B;  2IYL D;  2P7V A;  3RYL A;  2VB6 A;  5BUO A;  1QQ3 A;  1VLT A;  1MMG A;  1VMA A;  2VC9 A;  4NTF A;  2CYD A;  2LFD A;  4JRZ A;  2X0C A;  5A6K A;  3C63 A;  2HJM A;  1F1M A;  5DVW A;  1OQC A;  1VLS A;  2Y3D A;  2YEV A;  3MLG A;  3JSZ A;  1PV3 A;  3VF0 A;  3U0C A;  3QVZ A;  3M15 A;  1XZQ A;  4BJT A;  1QSP A;  2YL7 A;  4O79 A;  2ZXP A;  3V7O A;  3DE8 A;  3E9V A;  5KYY A;  2CW0 F;  3ABK C;  3NMJ A;  5HV9 A;  5A69 A;  4DJ9 A;  1YA9 A;  2EPL X;  2GAQ A;  1GQA A;  4G78 A;  4XQ1 A;  2PX3 A;  3DAF A;  4L6R A;  1D0Y A;  3SZR A;  4BJ5 C;  3LS0 A;  5JLI A;  3NYM A;  3RQG A;  2WVO A;  5L0C A;  4NTB A;  1Z7Q c;  3AG3 C;  2EPK X;  1H9T A;  4OIQ F;  3HNK A;  2DI3 A;  1A0B A;  1OKK A;  4X0R A;  3TOL A;  4PJN A;  2KK1 A;  2Q9C A;  3NRH A;  1RMV A;  4QDL A;  4Q7C A;  5DS5 A;  2ZXR A;  4MTO A;  1SR2 A;  3I5P A;  4MS2 A;  3K6B A;  4E7Z A;  1YZA A;  4ULV A;  3US6 A;  1BBH A;  4XLN F;  1ZHY A;  2VH3 A;  2WVN A;  3FVY A;  1J8Y F;  5A6A A;  3TQO A;  4NQF A;  1LKX A;  2Q00 A;  3K7D A;  1Q0K A;  4JZA A;  4NC3 A;  4XEV A;  1T6Q A;  1C17 M;  4CS7 A;  3JCU Q;  2H7B A;  3L1M A;  1ZHX A;  2QY9 A;  3MYI A;  4MQ9 F;  3OEO A;  3FAP B;  3SP1 A;  4E0I A;  1CGM E;  1OW8 A;  3DZA A;  2HSQ A;  5E33 A;  3QVY A;  4LDR A;  4CX9 A;  2IXN A;  3S29 A;  1JPJ A;  1YVI A;  2WVQ A;  4U5F E;  4P9T A;  4CSA A;  1WAT A;  2EIK C;  1Y4C A;  1ZU5 A;  1RKC A;  3R7C A;  2VCC A;  5FZT A;  2R7R A;  2GFH A;  3FAJ A;  2W4M A;  4PJJ A;  3U9J A;  2J9U A;  3FOO A;  2AWC A;  3KKB A;  4YL0 A;  3S9O A;  3DM9 B;  3LJB A;  3AOU A;  2WL8 A;  1E83 A;  3G4X A;  3Q6M A;  2YVK A;  3QW1 A;  4EIY A;  3O10 A;  2I8B A;  2Y39 A;  4J7Y A;  2EPM X;  2RD9 A;  1XWJ A;  2OU6 A;  1LIH A;  2DB4 A;  2KJG A;  2DGJ A;  3ABL C;  3C8G D;  4FWV A;  4HFF B;  4FAP B;  4CIH A;  3IHU A;  4MVR A;  2VCB A;  3RF3 A;  1ORJ A;  5EK0 A;  3PMR A;  1ZW2 A;  1A7D A;  3ZQV A;  2EIL C;  2PP4 A;  2WB7 A;  1OCZ C;  5JS5 A;  5JSL A;  1LI5 A;  1WOL A;  3IQT A;  2V3C C;  2LSE A;  2PNO A;  2M4E A;  2YZS A;  2QTV A;  4BG0 A;  4YK5 A;  4LLE A;  5GPG B;  3RIP A;  3WHN A;  3KPH A;  1L3P A;  4U9E A;  4MW3 A;  4FES A;  5E2Q A;  1I4Z A;  5L3V A;  1N1C A;  2XLO A;  4EBB A;  5HSW A;  1NU9 C;  3KYI A;  3N0T A;  1WTY A;  2Y3G A;  4PFP A;  3DKA A;  2KW3 C;  4IAO A;  2Q4F A;  1I4Y A;  3K33 A;  2XLE A;  3AJM A;  1T01 A;  1T6U A;  2EIJ C;  2L6H A;  4JCH A;  2HKV A;  1HW2 A;  3DWW A;  4JTA B;  3JTL O;  2VAS A;  3B0P A;  3LS1 A;  3CZ6 A;  1JR8 A;  3A9C A;  2F22 A;  2H8A A;  2MYS A;  1YA7 O;  3IQC A;  4GEH A;  2IXO A;  3GM3 A;  4YN0 B;  4MVS A;  2LCH A;  1FFT C;  2H7V C;  5CI9 A;  4MVO A;  4PFO A;  2WZL A;  2KNH A;  2XLW A;  1PD0 A;  1YLM A;  3FHD A;  2P0N A;  1HW1 A;  3QMK A;  3SEO A;  4RBN A;  1YAU O;  1NG1 A;  2KQ9 A;  1WAS A;  4EHP A;  3RW0 A;  4IRU A;  3TJ6 A;  4DBR A;  1H9G A;  2EIM C;  2XS1 A;  3JYY A;  5A6J A;  1ZHZ A;  1K04 A;  1BR4 A;  2NG1 A;  3ZTM A;  4XPW A;  4K1O A;  4IWB A;  1TQG A;  4MTF A;  2KYH A;  1K05 A;  1APC A;  4JUR I;  2YWA A;  1IW7 F;  2GA0 A;  2J45 A;  3LUT B;  5D91 A;  3QTH A;  3Q6N A;  1CPQ A;  3JSE O;  2KGO A;  2L81 A;  4EBJ A;  4AL1 A;  2J9W A;  3ZDL A;  1VK5 A;  3ZG1 A;  2YLD A;  5EHH A;  3C7J A;  1G4U S;  1WN0 A;  3HKK A;  3RVY A;  4P6I C;  5AC5 A;  2PX0 A;  1HE1 A;  1Z5Z A;  2OJE D;  1ZZP A;  2QLA A;  3NYL A;  1LS1 A;  2HUJ A;  2XLV A;  5AGF A;  4U5D E;  1CGN A;  2R7Q A;  2LIG A;  3ASN C;  3ITF A;  3Q7G A;  5TJ5 E;  1DOV A;  2XM4 A;  1QLE C;  1Z6A A;  3PHF 2;  5DLJ A;  1TWC A;  4N6H A;  4BPM A;  3J06 A;  3IQ5 A;  5BQG A;  2R25 A;  5KYX B;  1B68 A;  2AWY A;  2L6F A;  3VYW A;  1QKR A;  4PK4 A;  1NFO A;  3V5Z A;  1JAF A;  3O55 A;  4CJG A;  1E2X A;  1Q0G A;  3WG7 C;  4KNV A;  2LP4 A;  3FXH A;  3NYJ A;  4O6M A;  5L0J A;  1YDI A;  4MTG A;  2J0X A;  4KNW A;  5B1A C;  4WGY A;  2J46 A;  4K0D A;  5JT4 A;  2HJ3 A;  3H2U A;  3KYJ A;  4MVU A;  4G7H F;  1LE2 A;  3VRC A;  3DJU B;  5E3C A;  4G7O F;  2CNW A;  2A1D D;  2UUI A;  3OA1 A;  4J7T A;  3A11 A;  4MND A;  1ZU4 A;  3VAY A;  2AP3 A;  5EGY A;  3ABM C;  4I1M A;  4Z9J A;  4XEF A;  3W8I A;  3HNL A;  3EZI A;  3F47 A;  1FTS A;  3CEX A;  1YAR O;  1NFN A;  3FMS A;  4JTD B;  4YT8 A;  2D5R B;  2L6G A;  2EPN A;  2XL6 A;  1GM5 A;  5KYX A;  2YQY A; 
#chains in the Genus database with same CATH homology
 3DE9 A;  4EIY A;  4D4N A;  3ZQV A;  5JS5 A;  5JSL A;  1E85 A;  2YLI A;  1CGO A;  2J9B A;  4JEB A;  2YLG A;  4D4X A;  3ZTZ A;  4U9E A;  4U9D A;  3C62 A;  2XLD A;  2XL8 A;  1YZC A;  2XLO A;  3FOP A;  4CDV A;  3QW0 A;  1A7V A;  4CDA A;  2XLE A;  2YL1 A;  3M79 A;  2BC5 A;  4CJO A;  2J8W A;  4CIP A;  5JVE A;  2XLH A;  3HNI A;  1QQ3 A;  2YL3 A;  2XLW A;  4IB4 A;  3M4B A;  3C63 A;  3HNJ A;  2YKZ A;  3NMI A;  1YYX A;  4N4W A;  5JUA A;  3QVZ A;  3M15 A;  3ZTM A;  2YL7 A;  1APC A;  3DE8 A;  3NMJ A;  1GQA A;  4L6R A;  1CPQ A;  5JLI A;  1M6T A;  5B3I A;  2YLD A;  4JKV A;  1NBB A;  3HNK A;  3TOL A;  4CDY A;  2QLA A;  2XLV A;  5AGF A;  1CGN A;  2XL6 A;  4JEA A;  1E86 A;  2XM0 A;  2XM4 A;  1QPU A;  1YZA A;  4ULV A;  1E84 A;  1BBH A;  1CPR A;  4WGZ A;  3NMK A;  4N6H A;  1S05 A;  3IQ5 A;  4NC3 A;  256B A;  4CJG A;  1JAF A;  3L1M A;  2YL0 A;  4IAQ A;  3U8P A;  3ZWI A;  3QVY A;  4CX9 A;  4WGY A;  5JT4 A;  3VRC A;  5JRA A;  1MQV A;  1EKY A;  4IAR A;  3ZQY A;  1LM3 B;  3HNL A;  3FOO A;  1YYJ A;  2XLM A;  2CCY A;  1E83 A;  5JP7 A;  1RCP A;  4ER9 A;  3QW1 A;  4JE9 A;  3M4C A;  3IQ6 A;  3TOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...