5JT4A

L16a mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
b'EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
molecule tags Electron transport
source organism Alcaligenes xylosoxydans
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jt4A00
1E85A 1CGNA 3ZTZA 1NBBA 1YZAA 4IARA 3C62A 3ZQVA 2J9BA 5AGFA 3C63A 1YZCA 2YL0A 4CJOA 4IB4A 2XLHA 1GQAA 2XLDA 3QW1A 4EIYA 2YL1A 3QVYA 1YYJA 2XLWA 3M4BA 4JE9A 3HNJA 4N6HA 3HNLA 5JT4A 3NMJA 2BC5A 4CX9A 2XL8A 1QPUA 2CCYA 4ULVA 3HNIA 2XM4A 5JUAA 5JP7A 2YLDA 1APCA 2XLEA 2XLOA 4WGYA 3FOPA 3NMIA 4IAQA 1YYXA 3L1MA 1JAFA 1QQ3A 4U9EA 5JVEA 3IQ6A 4D4NA 3ZTMA 1E83A 3FOOA 2YL3A 4CDAA 3TOMA 4CJGA 3DE8A 4JEAA 2XM0A 1BBHA 3QVZA 2YL7A 4JEBA 5JLIA 1CPQA 3M79A 4WGZA 3TOLA 3VRCA 5B3IA 3ZWIA 3IQ5A 4ER9A 1CPRA 2XLMA 4D4XA 1M6TA 3U8PA 4NC3A 5JSLA 256BA 1LM3B 1CGOA 2J8WA 4CDVA 1MQVA 4JKVA 4U9DA 3DE9A 2XL6A 1E86A 3NMKA 4CDYA 3QW0A 5JRAA 4L6RA 2XLVA 3M4CA 1E84A 1S05A 3HNKA 5JS5A 2YKZA 4CIPA 4N4WA 3M15A 3ZQYA 2QLAA 1A7VA 1RCPA 2YLGA 1EKYA 2YLIA
chains in the Genus database with same CATH superfamily
4U5CE 5HSWA 5KYWB 1HW1A 4XEFA 3HLZA 1HY5A 1YZAA 3BEHA 3T6GB 4PACA 3K7DA 4CSAC 4HFFB 2ICWG 3GEIA 3C62A 4AE4A 3EHMA 5AGFA 1F1MA 1YZCA 2YL0A 3UMKA 1K40A 5B1AC 2HZ8A 1D0XA 2M4EA 2KW3C 4BEJA 3EGXB 2HV6A 1K04A 4C7OA 2XLHA 3LLKA 1GQAA 2PNOA 5KYXB 1DOVA 2VH3A 1FR0A 3DAGA 1UG7A 1Q0DA 3A9CA 4A2NB 4J7YA 1RKEB 2EIJC 2IYLD 1TQGA 2QNLA 1VK5A 2YHSA 3G50A 1PCXA 4J32B 4PJLA 4I1MA 5A69A 1BR1A 2D4UA 3IQTA 4JE9A 4XPXA 3HNJA 2B0HA 2HV7A 2QUPA 1FMVA 3HNLA 3NMJA 3KH2A 4MVZA 5FZTA 2V3CC 1MMGA 2WVQA 3W8HA 4W8PA 1G5ZA 4ONSA 3EPVA 1J8MF 3HKKA 4YK5A 4ULVA 1ZHZA 2Q7RA 1OQCA 4CIHA 2PF4E 3U9MA 4JTAB 5KYWA 3DMDA 3WODF 1OW6A 3I5QA 2YLDA 3NYJA 3VF0A 1APCA 1ZHYA 5IY5C 2AVKA 1FFHA 2XLOA 4JVSA 4YWQA 4CSAA 1MMDA 1CGME 4I3MA 1HMDA 2J9UA 4O79A 2ZXOA 5DS5A 3AQCA 4LERA 3FXHA 2J46A 3NMIA 1YA9A 2YVKA 1Z23A 1BR2A 4CS7A 1PD0A 2GWWA 1ZW3A 3RH3A 1QQ3A 2CGEA 2A68F 1JPJA 1NFNA 1R5ID 2HKVA 3JT1A 3LAYA 1NFOA 4U9EA 1WGWA 2OEXA 4HEAJ 3PCVA 4GEHA 3US6A 3RVZA 1E83A 1YJGA 2QE9A 3EJNA 4PJJA 4ANJA 4CDAA 4CS8C 1TR2A 3MFNA 3NRHA 2JD3A 1RKEA 3AJMA 3FAPB 1GS9A 3DE8A 3K1IA 2O9XA 2YL7A 2R7TA 4K7BA 3AGTA 1ZYRF 2R7OA 3X1OA 3M79A 2FFHA 3PMRA 3TOLA 1WN0A 3GODA 3W8IA 1Z5ZA 3ZWIA 5DS6A 1O5HA 3RQFA 4ER9A 1G8XA 2R7QA 1V55C 2XLMA 3T4RA 4U5FE 2A6HF 3VM6A 3SXZA 2OEVA 2YQYA 3U8VA 3U8PA 4DJ9A 4G78A 1YAUO 3HJCA 3M1CB 2VASA 3T6JA 1Q0KA 3W2VA 5DQZA 1OCZC 3RYLA 1T9KA 4J30B 4YL1A 4BJ5C 5L0JA 1Q0FA 3GWLA 2EPKX 1ZU5A 4JCZA 4LLEA 1HE1A 5T3TA 2DYRC 3J06A 2R7VA 4JKVA 3S29A 3CSKA 3DZAA 3GM2A 4P9FA 2J7PD 3NMKA 3TJ6A 3U2MA 2KJGA 4MTOA 4L6RA 1AEPA 4EUKB 3POVA 2RD9A 2ZXRA 5L0FA 4JTDB 3M4CA 4AK9A 4O7GA 4DBRA 4Q7CA 4C3BA 3L0IA 2W45A 1BDJB 1VOMA 4BG0A 1E84A 1BZ4A 2R7UA 2Y69C 4DOZA 2LP4A 2PX3A 4DXWA 2CYDA 3AQBA 5JS5A 3I5PA 3SNHA 4U5HA 2YKZA 3IPMO 1NLXA 1T6UA 2C03A 3GANA 4JRZA 1ORSC 4XTKA 5COGA 4C3EA 1FTSA 4CBEA 3TJ5A 1A7VA 4XLNF 2AWCA 4DRIB 3LS0A 3DJNB 4DRJB 1FMWA 1M56C 1B68A 3JCUQ 1ZHXA 3R2PA 1T5OA 1E85A 1LIHA 2NSGA 2H7OA 4E7ZA 2QY9A 1RJ9A 2DB4A 3O55A 2Z15A 1NBBA 3O10A 2L81A 3K1IC 3NDBB 1OW7A 1IW7F 1GM5A 4BJ6C 1ZHWA 3B0PA 2LQGA 2QTVA 4AX2A 3ATPA 3EGDB 3SXKA 1EI7A 2PFDA 2XLDA 4XEVA 3SZRA 1YDIA 2I8BA 2Q9CA 1FAPB 3QW1A 5A6JA 5DQTA 3WG7C 1H6GA 3QVYA 4N6CA 3N2ZB 5CI8A 2NUPB 3ZDLA 4P6IC 3T9OA 3EGXA 3EQLF 1TWCA 2IBFA 5E3CA 4MVSA 1R4TA 2KC3A 3VAYA 2A69F 3ABKC 4BEMJ 3UMIA 4MTGA 4FX5A 3RW0A 2XL8A 2TMVP 3S9OA 1I5NA 1UFBA 1SF8A 2R9RB 4W8KA 3WAQA 2F22A 2GFHA 2HFIA 3KL4A 3NYMA 3WHNA 2CCYA 1D0YA 3JSEO 2KGOA 1LE2A 3AG1C 3K6BA 2LFFA 1D1CA 3JTLO 4JW1A 4RDAA 1O87A 1V54C 4MVMA 2XLEA 2G3VA 1VTMP 1ZZPA 1VLTA 3JSZA 3KYJA 4WGYA 2J0WA 2VCAA 5EK0A 3FDQA 3Q7LA 3UGPA 1KNYA 4G7ZF 1RKCA 3EFOB 3S28A 3FOPA 3JRMO 4MVUA 4IAQA 3QZCA 1YYXA 2ZXWC 3U3FA 4Q5SF 3C18A 3ZC4A 3V5YA 4A4AA 2Y3HA 2ZPAA 3Q6NA 3C8GB 4KBLA 1OKKD 1LE4A 5EHHA 3ZTMA 2W4MA 1ZVZA 1ORJA 1PD1A 3F46A 2OKUA 4E0IA 1G4WR 1GGQA 3TOMA 4FAPB 4JJGA 4CJGA 1WATA 4MNDA 3ZVRA 3U3BA 2XSEA 2KQ9A 3RF3A 5CIVA 4PK4A 5JUAA 3UGOA 1ZW2A 4JEBA 4FWVA 4JCHA 4ZLDA 3K33A 4WGZA 3VRCA 3FAJA 3MX3A 3QMKA 4O6YA 5CI9A 5B1BC 4E17A 1C17M 3IQ5A 1HW2A 1Z6AA 1OR3A 1RMVA 3L8JA 2DGJA 1YVIA 5GPGB 3R7CA 3TK0A 1Q0GA 3ZIBA 4YN0B 4NTBA 4D4XA 2Y3DA 2GA0A 2J0XA 4CS9C 1MNDA 2MWQA 2PBEA 4YL0A 3ZG1A 5FCLA 256BA 1NU9C 3C7JA 4DVZA 2R7RA 4IRUA 2EPLX 1S7ZA 2IXPA 4DVYP 3EZHA 1MQVA 3RVYA 2ASRA 1M57C 4O6NA 3GORA 3IEEA 2EILC 2JPUA 4PFOA 3LJBA 4H54A 5KYUA 1A7EA 4BJ5A 3HTKC 4Z9HA 3DD7A 5BQIA 1YA7O 1D0ZA 3JZ0A 1OXBA 2WZFA 3Q7GA 4XQ1A 2HJMA 2XLVA 5E2QA 4XPWA 4RBNA 3MYIA 4BJTA 4RD9A 2A1DD 2CW0F 3CZ6A 4GQHA 1D1AA 2ZXPA 1Y4CA 4I44A 4LLCA 4Z9JA 1S05A 3RFYA 3B0VC 1VMAA 1OXKA 4LDKA 2C04A 3B29A 3NKEA 5F5HA 4DRHB 1M2VB 3ASOC 3L8IA 4XWJA 5KYUB 3DI5A 3S27A 1T6IA 2YEVA 3H65A 3B9QA 3M15A 4YT5A 1I4YA 1Z3IX 5BQGA 2Q3TA 4P9TA 2QLAA 3T6BA 1BR4A 4YT2A 1RCPA 3DKAA 1MNEA 1QVXA 1TFOB 1WTYA 2LIGA 5KYYA 1T01A 2A6EF 1T6QA 2YLIA 3GM3A 3MYFA 1EQ1A 1LI7A 4BJ1A 1H7IA 2R02A 3KKBA 4IARA 4MS2A 1E2XA 3AG4C 4QI0A 3ZQVA 2XL4A 1YLMA 2J9BA 1ZU4A 2Y3GA 2PP4A 3GWNA 5DS4A 4KI2A 3DM5A 4JC7A 4CJOA 4U5EE 1VYKA 3EHNA 4OD5A 2X51A 1Z63A 1MMNA 3E9VA 3EG9A 3L34A 2L9JA 1K05A 3LESA 3G4XA 4NTAA 4EIYA 2LK4A 2YL1A 3UMHA 4JJFA 2WL8A 2KSFA 3U5SA 1I4ZA 3V7OA 1H9GA 2LCHA 4JIOA 1JR8A 1OR2A 1YYJA 2XLWA 2J45A 5L0HA 3F47A 2R7WA 1KTMA 3MBGA 1H9TA 1MMAA 3VYWA 2ZD9A 2GDCA 2P0NA 4XLPF 1QPUA 4G7HF 3SYNA 1TWHA 3HNIA 4MVRA 4EKWA 1VYIA 2NUTB 1L3PA 3KPHA 4EHPA 3EFOA 3ABLC 3E70C 2P61A 4PFPA 2VCBA 5JP7A 4IAOA 2L7AA 4C3DA 5L0IA 3O6XA 1AVOB 2I15A 3JRTA 3I4UA 2KK1A 1V4AA 1G4US 3S0XA 1QLEC 2WVNA 5L3VA 4QI2A 5COMA 2JX0A 2UUIA 3TD7A 2IM8A 3V5XA 4E18A 2G3KA 3AGUA 2CNWA 2DYSC 2NUTA 2Q00A 2RSEB 4NCQA 3NYLA 3MLGA 5E3AA 2YWAA 4CS9A 4OIPF 4XEKA 4OINF 2G62A 3U2LA 4MVOA 1OCCC 5JVEA 1QZXA 4MW8A 3QTHA 5T3WA 2X0CA 4NY3A 3IQ6A 4F4BA 5D92A 4EBKA 1RXQA 2YL3A 3AOUA 4MVQA 5TJ5E 3NG1A 5AC4A 4JZAA 2OOCA 3A11A 4PJNA 3PHF2 3IHUA 3AG3C 4MTFA 1HMOA 4KNWA 5JLIA 3EH2A 4NTFA 4IGGA 1CPQA 3TULA 2L6FA 3EZIA 1SYQA 1ZHTA 4O6MA 1XZQA 1OKKA 1PV3A 3W4YA 1LI5A 1OCOC 2Y39A 3Q6MA 2EPMX 4LDQA 3RQGA 2J7PA 1SZIA 1RJ9B 1VB5A 2WZLA 2KYHA 3ITFA 5JSLA 2Q9BA 3LEOA 3H2UA 4EBBA 5F5FA 2AU5A 2J8WA 3CQZA 1OW8A 1VLSA 1LS4A 2EIMC 2P6VA 3ASNC 2R25A 3JYYA 4CDVA 4E7SA 3X2QC 2WB7A 2J9WA 4BPMA 1A7DA 2XXAA 1U89A 3DE9A 3N0TA 2XL6A 4OIOF 1JOGA 2XRHA 2GAQA 2BE5F 4H4KC 4CDYA 2R7XA 3QW0A 2IOQA 2IXOA 3SXYA 4YT4A 4OIRF 2Q9AA 1Z7Qc 2VB6A 2OG2A 4YL3A 4K1OA 2MHRA 5AC5A 5A6BD 1FFTC 1WOLA 4K0DA 3IQCA 3DJUB 4ULWA 3LUTB 2WZGA 3JYHA 5D91A 2XXAB 3SEOA 1TWGA 4Z9IA 3SXMA 2YLGA 1HE9A 4ZLCA 2J9VA 2NPUA 5DLJA 3UR3C 4AL1A 5B3SC 4YJWA 2Y3BA 5T1DB 1CGNA 2AWYA 3ZTZA 1NSGB 4KC9A 1LPEA 2XS1A 4QDLA 4HFKB 2FAPB 4G0HA 2R7SA 3B71A 3CEXA 1NZEA 3C63A 3KMIA 1W2WA 2OU6A 2H7VC 2P1AA 4IB4A 5A6BA 5KYYB 2HMZA 2HJ3A 3OWTA 1V74B 1Y6DA 2L6HA 3NKDA 3OA1A 3GEEA 3DM9B 1M2VA 4Q4ZF 2EPNA 5EGYA 2NSFA 3GM1A 4X0RA 4DBQA 5E33A 3CAXA 2V26A 3M4BA 2E87A 4MQ9F 5A6AA 4N6HA 5JT4A 4PR9A 3C8GD 5KYNA 2BC5A 1IZMA 2LSEA 3K66A 3GEHA 4WJ0A 4CX9A 2HSQA 1JRAA 2A0BA 4E0HA 3U0CA 4JTCB 1A0BA 2CDQA 3RIPA 3ECSA 2OCCC 4CS8A 2R05A 1TWAA 2XM4A 1Q0MA 1NU7D 3FMSA 2PX0A 4J7TA 3ZSUA 4PJMA 1QKRA 2OQMA 2YRFA 2D5RB 2VC9A 2HMQA 3O39A 1JMWA 1TFKB 4LACB 2P7VA 2M64A 3RKOF 1J8YF 2EPOA 3OEOA 2VCCA 1LVKA 3DWWA 4U5GA 3LEVA 4FESA 4N06A 1DOWA 1O3UA 3EH1A 2IXMA 4I1OB 4UDVA 5HV9A 2XS8A 3L1MA 1XWJA 1JAFA 4R32A 1EA8A 2W9YA 4U5BE 4GYTA 3LLIA 2IXNA 1SR2A 1KU2A 1M2OA 1WWPA 2FGYA 5F28E 2ETSA 3FOOA 4D4NA 3TQOA 3W2WA 3S84A 2H7BA 2NUPA 3K1HA 2CNWD 3LS1A 1NG1A 1ST6A 3ABMC 3BRJA 1U0BB 2MYSA 4JEAA 2XM0A 1TKNA 1BBHA 3EG9B 3QVZA 3V5ZA 5KYXA 2R03A 2EINC 2EIKC 3EGDA 3G4ZA 1L7CA 5COFA 4U5DE 3C8GA 2B0JA 5B3IA 2UUHA 4AE4B 1D1BA 2KNHA 1CPRA 3AG2C 1M6TA 1QSPA 3LNMB 4IWBA 4EBJA 2LD6A 3B0UX 4LDRA 4B6IA 1SMYF 4OIQF 4NC3A 2W4BA 2HUJA 1LM3B 1LKXA 2AP3A 1CGOA 5L0DA 4G7OF 1YARO 1JPNA 2H8AA 4HE8D 3FVYA 4YT8A 5L0GA 2Q4FA 3RQEA 4AL0A 1WASA 2HS5A 2OJQA 1U6HA 4U9DA 2YZSA 4WABA 1N1CA 5A6KA 1E86A 1AUEA 3N24A 3FHDA 4JURI 4EWCA 5JRAA 1LS1A 5DVWA 4BJ6A 4KNVA 2OJED 4IJJA 4MW3A 2LFDA 5K0IA 2NG1A 3PDMP 5L3QA 4XPYA 3HNKA 3C8ZA 1A41A 1C03A 2HSBA 1ORYA 1C02A 2DI3A 3SP1A 4OD4A 4CIPA 5L0CA 4N4WA 5BQHA 4M63A 1OCRC 2BL2A 3DAFA 3LNRA 3U9JA 3ZQYA 4C7OB 4NQFA 1XZPA 3UNGC 3S90A 3DXJF 1FNTc 5BUOA 3H2VA 2WVOA 1EKYA 2A0UA 2L6GA 3KYIA
chains in the Genus database with same CATH topology
1E85A 1CGNA 3ZTZA 1NBBA 1YZAA 4IARA 3C62A 3ZQVA 2J9BA 5AGFA 3C63A 1YZCA 2YL0A 4CJOA 4IB4A 2XLHA 1GQAA 2XLDA 3QW1A 4EIYA 2YL1A 3QVYA 1YYJA 2XLWA 3M4BA 4JE9A 3HNJA 4N6HA 3HNLA 5JT4A 3NMJA 2BC5A 4CX9A 2XL8A 1QPUA 2CCYA 4ULVA 3HNIA 2XM4A 5JUAA 5JP7A 2YLDA 1APCA 2XLEA 2XLOA 4WGYA 3FOPA 3NMIA 4IAQA 1YYXA 3L1MA 1JAFA 1QQ3A 4U9EA 5JVEA 3IQ6A 4D4NA 3ZTMA 1E83A 3FOOA 2YL3A 4CDAA 3TOMA 4CJGA 3DE8A 4JEAA 2XM0A 1BBHA 3QVZA 2YL7A 4JEBA 5JLIA 1CPQA 3M79A 4WGZA 3TOLA 3VRCA 5B3IA 3ZWIA 3IQ5A 4ER9A 1CPRA 2XLMA 4D4XA 1M6TA 3U8PA 4NC3A 5JSLA 256BA 1LM3B 1CGOA 2J8WA 4CDVA 1MQVA 4JKVA 4U9DA 3DE9A 2XL6A 1E86A 3NMKA 4CDYA 3QW0A 5JRAA 4L6RA 2XLVA 3M4CA 1E84A 1S05A 3HNKA 5JS5A 2YKZA 4CIPA 4N4WA 3M15A 3ZQYA 2QLAA 1A7VA 1RCPA 2YLGA 1EKYA 2YLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E85 A;  1CGN A;  3ZTZ A;  1NBB A;  1YZA A;  4IAR A;  3C62 A;  3ZQV A;  2J9B A;  5AGF A;  3C63 A;  1YZC A;  2YL0 A;  4CJO A;  4IB4 A;  2XLH A;  1GQA A;  2XLD A;  3QW1 A;  4EIY A;  2YL1 A;  3QVY A;  1YYJ A;  2XLW A;  3M4B A;  4JE9 A;  3HNJ A;  4N6H A;  3HNL A;  5JT4 A;  3NMJ A;  2BC5 A;  4CX9 A;  2XL8 A;  1QPU A;  2CCY A;  4ULV A;  3HNI A;  2XM4 A;  5JUA A;  5JP7 A;  2YLD A;  1APC A;  2XLE A;  2XLO A;  4WGY A;  3FOP A;  3NMI A;  4IAQ A;  1YYX A;  3L1M A;  1JAF A;  1QQ3 A;  4U9E A;  5JVE A;  3IQ6 A;  4D4N A;  3ZTM A;  1E83 A;  3FOO A;  2YL3 A;  4CDA A;  3TOM A;  4CJG A;  3DE8 A;  4JEA A;  2XM0 A;  1BBH A;  3QVZ A;  2YL7 A;  4JEB A;  5JLI A;  1CPQ A;  3M79 A;  4WGZ A;  3TOL A;  3VRC A;  5B3I A;  3ZWI A;  3IQ5 A;  4ER9 A;  1CPR A;  2XLM A;  4D4X A;  1M6T A;  3U8P A;  4NC3 A;  5JSL A;  256B A;  1LM3 B;  1CGO A;  2J8W A;  4CDV A;  1MQV A;  4JKV A;  4U9D A;  3DE9 A;  2XL6 A;  1E86 A;  3NMK A;  4CDY A;  3QW0 A;  5JRA A;  4L6R A;  2XLV A;  3M4C A;  1E84 A;  1S05 A;  3HNK A;  5JS5 A;  2YKZ A;  4CIP A;  4N4W A;  3M15 A;  3ZQY A;  2QLA A;  1A7V A;  1RCP A;  2YLG A;  1EKY A;  2YLI A; 
#chains in the Genus database with same CATH topology
 4U5C E;  5HSW A;  5KYW B;  1HW1 A;  4XEF A;  3HLZ A;  1HY5 A;  1YZA A;  3BEH A;  3T6G B;  4PAC A;  3K7D A;  4CSA C;  4HFF B;  2ICW G;  3GEI A;  3C62 A;  4AE4 A;  3EHM A;  5AGF A;  1F1M A;  1YZC A;  2YL0 A;  3UMK A;  1K40 A;  5B1A C;  2HZ8 A;  1D0X A;  2M4E A;  2KW3 C;  4BEJ A;  3EGX B;  2HV6 A;  1K04 A;  4C7O A;  2XLH A;  3LLK A;  1GQA A;  2PNO A;  5KYX B;  1DOV A;  2VH3 A;  1FR0 A;  3DAG A;  1UG7 A;  1Q0D A;  3A9C A;  4A2N B;  4J7Y A;  1RKE B;  2EIJ C;  2IYL D;  1TQG A;  2QNL A;  1VK5 A;  2YHS A;  3G50 A;  1PCX A;  4J32 B;  4PJL A;  4I1M A;  5A69 A;  1BR1 A;  2D4U A;  3IQT A;  4JE9 A;  4XPX A;  3HNJ A;  2B0H A;  2HV7 A;  2QUP A;  1FMV A;  3HNL A;  3NMJ A;  3KH2 A;  4MVZ A;  5FZT A;  2V3C C;  1MMG A;  2WVQ A;  3W8H A;  4W8P A;  1G5Z A;  4ONS A;  3EPV A;  1J8M F;  3HKK A;  4YK5 A;  4ULV A;  1ZHZ A;  2Q7R A;  1OQC A;  4CIH A;  2PF4 E;  3U9M A;  4JTA B;  5KYW A;  3DMD A;  3WOD F;  1OW6 A;  3I5Q A;  2YLD A;  3NYJ A;  3VF0 A;  1APC A;  1ZHY A;  5IY5 C;  2AVK A;  1FFH A;  2XLO A;  4JVS A;  4YWQ A;  4CSA A;  1MMD A;  1CGM E;  4I3M A;  1HMD A;  2J9U A;  4O79 A;  2ZXO A;  5DS5 A;  3AQC A;  4LER A;  3FXH A;  2J46 A;  3NMI A;  1YA9 A;  2YVK A;  1Z23 A;  1BR2 A;  4CS7 A;  1PD0 A;  2GWW A;  1ZW3 A;  3RH3 A;  1QQ3 A;  2CGE A;  2A68 F;  1JPJ A;  1NFN A;  1R5I D;  2HKV A;  3JT1 A;  3LAY A;  1NFO A;  4U9E A;  1WGW A;  2OEX A;  4HEA J;  3PCV A;  4GEH A;  3US6 A;  3RVZ A;  1E83 A;  1YJG A;  2QE9 A;  3EJN A;  4PJJ A;  4ANJ A;  4CDA A;  4CS8 C;  1TR2 A;  3MFN A;  3NRH A;  2JD3 A;  1RKE A;  3AJM A;  3FAP B;  1GS9 A;  3DE8 A;  3K1I A;  2O9X A;  2YL7 A;  2R7T A;  4K7B A;  3AGT A;  1ZYR F;  2R7O A;  3X1O A;  3M79 A;  2FFH A;  3PMR A;  3TOL A;  1WN0 A;  3GOD A;  3W8I A;  1Z5Z A;  3ZWI A;  5DS6 A;  1O5H A;  3RQF A;  4ER9 A;  1G8X A;  2R7Q A;  1V55 C;  2XLM A;  3T4R A;  4U5F E;  2A6H F;  3VM6 A;  3SXZ A;  2OEV A;  2YQY A;  3U8V A;  3U8P A;  4DJ9 A;  4G78 A;  1YAU O;  3HJC A;  3M1C B;  2VAS A;  3T6J A;  1Q0K A;  3W2V A;  5DQZ A;  1OCZ C;  3RYL A;  1T9K A;  4J30 B;  4YL1 A;  4BJ5 C;  5L0J A;  1Q0F A;  3GWL A;  2EPK X;  1ZU5 A;  4JCZ A;  4LLE A;  1HE1 A;  5T3T A;  2DYR C;  3J06 A;  2R7V A;  4JKV A;  3S29 A;  3CSK A;  3DZA A;  3GM2 A;  4P9F A;  2J7P D;  3NMK A;  3TJ6 A;  3U2M A;  2KJG A;  4MTO A;  4L6R A;  1AEP A;  4EUK B;  3POV A;  2RD9 A;  2ZXR A;  5L0F A;  4JTD B;  3M4C A;  4AK9 A;  4O7G A;  4DBR A;  4Q7C A;  4C3B A;  3L0I A;  2W45 A;  1BDJ B;  1VOM A;  4BG0 A;  1E84 A;  1BZ4 A;  2R7U A;  2Y69 C;  4DOZ A;  2LP4 A;  2PX3 A;  4DXW A;  2CYD A;  3AQB A;  5JS5 A;  3I5P A;  3SNH A;  4U5H A;  2YKZ A;  3IPM O;  1NLX A;  1T6U A;  2C03 A;  3GAN A;  4JRZ A;  1ORS C;  4XTK A;  5COG A;  4C3E A;  1FTS A;  4CBE A;  3TJ5 A;  1A7V A;  4XLN F;  2AWC A;  4DRI B;  3LS0 A;  3DJN B;  4DRJ B;  1FMW A;  1M56 C;  1B68 A;  3JCU Q;  1ZHX A;  3R2P A;  1T5O A;  1E85 A;  1LIH A;  2NSG A;  2H7O A;  4E7Z A;  2QY9 A;  1RJ9 A;  2DB4 A;  3O55 A;  2Z15 A;  1NBB A;  3O10 A;  2L81 A;  3K1I C;  3NDB B;  1OW7 A;  1IW7 F;  1GM5 A;  4BJ6 C;  1ZHW A;  3B0P A;  2LQG A;  2QTV A;  4AX2 A;  3ATP A;  3EGD B;  3SXK A;  1EI7 A;  2PFD A;  2XLD A;  4XEV A;  3SZR A;  1YDI A;  2I8B A;  2Q9C A;  1FAP B;  3QW1 A;  5A6J A;  5DQT A;  3WG7 C;  1H6G A;  3QVY A;  4N6C A;  3N2Z B;  5CI8 A;  2NUP B;  3ZDL A;  4P6I C;  3T9O A;  3EGX A;  3EQL F;  1TWC A;  2IBF A;  5E3C A;  4MVS A;  1R4T A;  2KC3 A;  3VAY A;  2A69 F;  3ABK C;  4BEM J;  3UMI A;  4MTG A;  4FX5 A;  3RW0 A;  2XL8 A;  2TMV P;  3S9O A;  1I5N A;  1UFB A;  1SF8 A;  2R9R B;  4W8K A;  3WAQ A;  2F22 A;  2GFH A;  2HFI A;  3KL4 A;  3NYM A;  3WHN A;  2CCY A;  1D0Y A;  3JSE O;  2KGO A;  1LE2 A;  3AG1 C;  3K6B A;  2LFF A;  1D1C A;  3JTL O;  4JW1 A;  4RDA A;  1O87 A;  1V54 C;  4MVM A;  2XLE A;  2G3V A;  1VTM P;  1ZZP A;  1VLT A;  3JSZ A;  3KYJ A;  4WGY A;  2J0W A;  2VCA A;  5EK0 A;  3FDQ A;  3Q7L A;  3UGP A;  1KNY A;  4G7Z F;  1RKC A;  3EFO B;  3S28 A;  3FOP A;  3JRM O;  4MVU A;  4IAQ A;  3QZC A;  1YYX A;  2ZXW C;  3U3F A;  4Q5S F;  3C18 A;  3ZC4 A;  3V5Y A;  4A4A A;  2Y3H A;  2ZPA A;  3Q6N A;  3C8G B;  4KBL A;  1OKK D;  1LE4 A;  5EHH A;  3ZTM A;  2W4M A;  1ZVZ A;  1ORJ A;  1PD1 A;  3F46 A;  2OKU A;  4E0I A;  1G4W R;  1GGQ A;  3TOM A;  4FAP B;  4JJG A;  4CJG A;  1WAT A;  4MND A;  3ZVR A;  3U3B A;  2XSE A;  2KQ9 A;  3RF3 A;  5CIV A;  4PK4 A;  5JUA A;  3UGO A;  1ZW2 A;  4JEB A;  4FWV A;  4JCH A;  4ZLD A;  3K33 A;  4WGZ A;  3VRC A;  3FAJ A;  3MX3 A;  3QMK A;  4O6Y A;  5CI9 A;  5B1B C;  4E17 A;  1C17 M;  3IQ5 A;  1HW2 A;  1Z6A A;  1OR3 A;  1RMV A;  3L8J A;  2DGJ A;  1YVI A;  5GPG B;  3R7C A;  3TK0 A;  1Q0G A;  3ZIB A;  4YN0 B;  4NTB A;  4D4X A;  2Y3D A;  2GA0 A;  2J0X A;  4CS9 C;  1MND A;  2MWQ A;  2PBE A;  4YL0 A;  3ZG1 A;  5FCL A;  256B A;  1NU9 C;  3C7J A;  4DVZ A;  2R7R A;  4IRU A;  2EPL X;  1S7Z A;  2IXP A;  4DVY P;  3EZH A;  1MQV A;  3RVY A;  2ASR A;  1M57 C;  4O6N A;  3GOR A;  3IEE A;  2EIL C;  2JPU A;  4PFO A;  3LJB A;  4H54 A;  5KYU A;  1A7E A;  4BJ5 A;  3HTK C;  4Z9H A;  3DD7 A;  5BQI A;  1YA7 O;  1D0Z A;  3JZ0 A;  1OXB A;  2WZF A;  3Q7G A;  4XQ1 A;  2HJM A;  2XLV A;  5E2Q A;  4XPW A;  4RBN A;  3MYI A;  4BJT A;  4RD9 A;  2A1D D;  2CW0 F;  3CZ6 A;  4GQH A;  1D1A A;  2ZXP A;  1Y4C A;  4I44 A;  4LLC A;  4Z9J A;  1S05 A;  3RFY A;  3B0V C;  1VMA A;  1OXK A;  4LDK A;  2C04 A;  3B29 A;  3NKE A;  5F5H A;  4DRH B;  1M2V B;  3ASO C;  3L8I A;  4XWJ A;  5KYU B;  3DI5 A;  3S27 A;  1T6I A;  2YEV A;  3H65 A;  3B9Q A;  3M15 A;  4YT5 A;  1I4Y A;  1Z3I X;  5BQG A;  2Q3T A;  4P9T A;  2QLA A;  3T6B A;  1BR4 A;  4YT2 A;  1RCP A;  3DKA A;  1MNE A;  1QVX A;  1TFO B;  1WTY A;  2LIG A;  5KYY A;  1T01 A;  2A6E F;  1T6Q A;  2YLI A;  3GM3 A;  3MYF A;  1EQ1 A;  1LI7 A;  4BJ1 A;  1H7I A;  2R02 A;  3KKB A;  4IAR A;  4MS2 A;  1E2X A;  3AG4 C;  4QI0 A;  3ZQV A;  2XL4 A;  1YLM A;  2J9B A;  1ZU4 A;  2Y3G A;  2PP4 A;  3GWN A;  5DS4 A;  4KI2 A;  3DM5 A;  4JC7 A;  4CJO A;  4U5E E;  1VYK A;  3EHN A;  4OD5 A;  2X51 A;  1Z63 A;  1MMN A;  3E9V A;  3EG9 A;  3L34 A;  2L9J A;  1K05 A;  3LES A;  3G4X A;  4NTA A;  4EIY A;  2LK4 A;  2YL1 A;  3UMH A;  4JJF A;  2WL8 A;  2KSF A;  3U5S A;  1I4Z A;  3V7O A;  1H9G A;  2LCH A;  4JIO A;  1JR8 A;  1OR2 A;  1YYJ A;  2XLW A;  2J45 A;  5L0H A;  3F47 A;  2R7W A;  1KTM A;  3MBG A;  1H9T A;  1MMA A;  3VYW A;  2ZD9 A;  2GDC A;  2P0N A;  4XLP F;  1QPU A;  4G7H F;  3SYN A;  1TWH A;  3HNI A;  4MVR A;  4EKW A;  1VYI A;  2NUT B;  1L3P A;  3KPH A;  4EHP A;  3EFO A;  3ABL C;  3E70 C;  2P61 A;  4PFP A;  2VCB A;  5JP7 A;  4IAO A;  2L7A A;  4C3D A;  5L0I A;  3O6X A;  1AVO B;  2I15 A;  3JRT A;  3I4U A;  2KK1 A;  1V4A A;  1G4U S;  3S0X A;  1QLE C;  2WVN A;  5L3V A;  4QI2 A;  5COM A;  2JX0 A;  2UUI A;  3TD7 A;  2IM8 A;  3V5X A;  4E18 A;  2G3K A;  3AGU A;  2CNW A;  2DYS C;  2NUT A;  2Q00 A;  2RSE B;  4NCQ A;  3NYL A;  3MLG A;  5E3A A;  2YWA A;  4CS9 A;  4OIP F;  4XEK A;  4OIN F;  2G62 A;  3U2L A;  4MVO A;  1OCC C;  5JVE A;  1QZX A;  4MW8 A;  3QTH A;  5T3W A;  2X0C A;  4NY3 A;  3IQ6 A;  4F4B A;  5D92 A;  4EBK A;  1RXQ A;  2YL3 A;  3AOU A;  4MVQ A;  5TJ5 E;  3NG1 A;  5AC4 A;  4JZA A;  2OOC A;  3A11 A;  4PJN A;  3PHF 2;  3IHU A;  3AG3 C;  4MTF A;  1HMO A;  4KNW A;  5JLI A;  3EH2 A;  4NTF A;  4IGG A;  1CPQ A;  3TUL A;  2L6F A;  3EZI A;  1SYQ A;  1ZHT A;  4O6M A;  1XZQ A;  1OKK A;  1PV3 A;  3W4Y A;  1LI5 A;  1OCO C;  2Y39 A;  3Q6M A;  2EPM X;  4LDQ A;  3RQG A;  2J7P A;  1SZI A;  1RJ9 B;  1VB5 A;  2WZL A;  2KYH A;  3ITF A;  5JSL A;  2Q9B A;  3LEO A;  3H2U A;  4EBB A;  5F5F A;  2AU5 A;  2J8W A;  3CQZ A;  1OW8 A;  1VLS A;  1LS4 A;  2EIM C;  2P6V A;  3ASN C;  2R25 A;  3JYY A;  4CDV A;  4E7S A;  3X2Q C;  2WB7 A;  2J9W A;  4BPM A;  1A7D A;  2XXA A;  1U89 A;  3DE9 A;  3N0T A;  2XL6 A;  4OIO F;  1JOG A;  2XRH A;  2GAQ A;  2BE5 F;  4H4K C;  4CDY A;  2R7X A;  3QW0 A;  2IOQ A;  2IXO A;  3SXY A;  4YT4 A;  4OIR F;  2Q9A A;  1Z7Q c;  2VB6 A;  2OG2 A;  4YL3 A;  4K1O A;  2MHR A;  5AC5 A;  5A6B D;  1FFT C;  1WOL A;  4K0D A;  3IQC A;  3DJU B;  4ULW A;  3LUT B;  2WZG A;  3JYH A;  5D91 A;  2XXA B;  3SEO A;  1TWG A;  4Z9I A;  3SXM A;  2YLG A;  1HE9 A;  4ZLC A;  2J9V A;  2NPU A;  5DLJ A;  3UR3 C;  4AL1 A;  5B3S C;  4YJW A;  2Y3B A;  5T1D B;  1CGN A;  2AWY A;  3ZTZ A;  1NSG B;  4KC9 A;  1LPE A;  2XS1 A;  4QDL A;  4HFK B;  2FAP B;  4G0H A;  2R7S A;  3B71 A;  3CEX A;  1NZE A;  3C63 A;  3KMI A;  1W2W A;  2OU6 A;  2H7V C;  2P1A A;  4IB4 A;  5A6B A;  5KYY B;  2HMZ A;  2HJ3 A;  3OWT A;  1V74 B;  1Y6D A;  2L6H A;  3NKD A;  3OA1 A;  3GEE A;  3DM9 B;  1M2V A;  4Q4Z F;  2EPN A;  5EGY A;  2NSF A;  3GM1 A;  4X0R A;  4DBQ A;  5E33 A;  3CAX A;  2V26 A;  3M4B A;  2E87 A;  4MQ9 F;  5A6A A;  4N6H A;  5JT4 A;  4PR9 A;  3C8G D;  5KYN A;  2BC5 A;  1IZM A;  2LSE A;  3K66 A;  3GEH A;  4WJ0 A;  4CX9 A;  2HSQ A;  1JRA A;  2A0B A;  4E0H A;  3U0C A;  4JTC B;  1A0B A;  2CDQ A;  3RIP A;  3ECS A;  2OCC C;  4CS8 A;  2R05 A;  1TWA A;  2XM4 A;  1Q0M A;  1NU7 D;  3FMS A;  2PX0 A;  4J7T A;  3ZSU A;  4PJM A;  1QKR A;  2OQM A;  2YRF A;  2D5R B;  2VC9 A;  2HMQ A;  3O39 A;  1JMW A;  1TFK B;  4LAC B;  2P7V A;  2M64 A;  3RKO F;  1J8Y F;  2EPO A;  3OEO A;  2VCC A;  1LVK A;  3DWW A;  4U5G A;  3LEV A;  4FES A;  4N06 A;  1DOW A;  1O3U A;  3EH1 A;  2IXM A;  4I1O B;  4UDV A;  5HV9 A;  2XS8 A;  3L1M A;  1XWJ A;  1JAF A;  4R32 A;  1EA8 A;  2W9Y A;  4U5B E;  4GYT A;  3LLI A;  2IXN A;  1SR2 A;  1KU2 A;  1M2O A;  1WWP A;  2FGY A;  5F28 E;  2ETS A;  3FOO A;  4D4N A;  3TQO A;  3W2W A;  3S84 A;  2H7B A;  2NUP A;  3K1H A;  2CNW D;  3LS1 A;  1NG1 A;  1ST6 A;  3ABM C;  3BRJ A;  1U0B B;  2MYS A;  4JEA A;  2XM0 A;  1TKN A;  1BBH A;  3EG9 B;  3QVZ A;  3V5Z A;  5KYX A;  2R03 A;  2EIN C;  2EIK C;  3EGD A;  3G4Z A;  1L7C A;  5COF A;  4U5D E;  3C8G A;  2B0J A;  5B3I A;  2UUH A;  4AE4 B;  1D1B A;  2KNH A;  1CPR A;  3AG2 C;  1M6T A;  1QSP A;  3LNM B;  4IWB A;  4EBJ A;  2LD6 A;  3B0U X;  4LDR A;  4B6I A;  1SMY F;  4OIQ F;  4NC3 A;  2W4B A;  2HUJ A;  1LM3 B;  1LKX A;  2AP3 A;  1CGO A;  5L0D A;  4G7O F;  1YAR O;  1JPN A;  2H8A A;  4HE8 D;  3FVY A;  4YT8 A;  5L0G A;  2Q4F A;  3RQE A;  4AL0 A;  1WAS A;  2HS5 A;  2OJQ A;  1U6H A;  4U9D A;  2YZS A;  4WAB A;  1N1C A;  5A6K A;  1E86 A;  1AUE A;  3N24 A;  3FHD A;  4JUR I;  4EWC A;  5JRA A;  1LS1 A;  5DVW A;  4BJ6 A;  4KNV A;  2OJE D;  4IJJ A;  4MW3 A;  2LFD A;  5K0I A;  2NG1 A;  3PDM P;  5L3Q A;  4XPY A;  3HNK A;  3C8Z A;  1A41 A;  1C03 A;  2HSB A;  1ORY A;  1C02 A;  2DI3 A;  3SP1 A;  4OD4 A;  4CIP A;  5L0C A;  4N4W A;  5BQH A;  4M63 A;  1OCR C;  2BL2 A;  3DAF A;  3LNR A;  3U9J A;  3ZQY A;  4C7O B;  4NQF A;  1XZP A;  3UNG C;  3S90 A;  3DXJ F;  1FNT c;  5BUO A;  3H2V A;  2WVO A;  1EKY A;  2A0U A;  2L6G A;  3KYI A; 
#chains in the Genus database with same CATH homology
 1E85 A;  1CGN A;  3ZTZ A;  1NBB A;  1YZA A;  4IAR A;  3C62 A;  3ZQV A;  2J9B A;  5AGF A;  3C63 A;  1YZC A;  2YL0 A;  4CJO A;  4IB4 A;  2XLH A;  1GQA A;  2XLD A;  3QW1 A;  4EIY A;  2YL1 A;  3QVY A;  1YYJ A;  2XLW A;  3M4B A;  4JE9 A;  3HNJ A;  4N6H A;  3HNL A;  5JT4 A;  3NMJ A;  2BC5 A;  4CX9 A;  2XL8 A;  1QPU A;  2CCY A;  4ULV A;  3HNI A;  2XM4 A;  5JUA A;  5JP7 A;  2YLD A;  1APC A;  2XLE A;  2XLO A;  4WGY A;  3FOP A;  3NMI A;  4IAQ A;  1YYX A;  3L1M A;  1JAF A;  1QQ3 A;  4U9E A;  5JVE A;  3IQ6 A;  4D4N A;  3ZTM A;  1E83 A;  3FOO A;  2YL3 A;  4CDA A;  3TOM A;  4CJG A;  3DE8 A;  4JEA A;  2XM0 A;  1BBH A;  3QVZ A;  2YL7 A;  4JEB A;  5JLI A;  1CPQ A;  3M79 A;  4WGZ A;  3TOL A;  3VRC A;  5B3I A;  3ZWI A;  3IQ5 A;  4ER9 A;  1CPR A;  2XLM A;  4D4X A;  1M6T A;  3U8P A;  4NC3 A;  5JSL A;  256B A;  1LM3 B;  1CGO A;  2J8W A;  4CDV A;  1MQV A;  4JKV A;  4U9D A;  3DE9 A;  2XL6 A;  1E86 A;  3NMK A;  4CDY A;  3QW0 A;  5JRA A;  4L6R A;  2XLV A;  3M4C A;  1E84 A;  1S05 A;  3HNK A;  5JS5 A;  2YKZ A;  4CIP A;  4N4W A;  3M15 A;  3ZQY A;  2QLA A;  1A7V A;  1RCP A;  2YLG A;  1EKY A;  2YLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...