5JT4A

L16a mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans
molecule tags Electron transport
molecule keywords Cytochrome c'
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jt4A00
3FOOA 4D4XA 2YLGA 3M4CA 3ZTMA 2XL8A 4JE9A 5JRAA 4U9DA 3HNIA 1QQ3A 2XLMA 1APCA 3M4BA 2J8WA 2XLDA 3QVZA 3FOPA 2XLHA 3HNKA 4CJGA 1JAFA 4U9EA 5B3IA 2YL7A 2XM0A 4JKVA 4WGYA 1NBBA 1GQAA 3QW1A 2YL3A 4CDAA 4IARA 3IQ6A 4CX9A 1LM3B 3L1MA 1A7VA 4JEAA 4EIYA 4JEBA 3C62A 4CIPA 2XLOA 3ZWIA 4NC3A 1EKYA 1YYJA 1S05A 5JVEA 1CPQA 3QVYA 5JUAA 1E83A 5JP7A 1E85A 4ER9A 4D4NA 2QLAA 1BBHA 3TOLA 4CDVA 5JT4A 5JS5A 3C63A 3HNJA 3M79A 4IAQA 5JSLA 2XLWA 3QW0A 1E84A 1YZCA 1E86A 3ZQYA 1M6TA 3ZQVA 3DE8A 2YKZA 3VRCA 1CPRA 1QPUA 256BA 3NMIA 4ULVA 1YYXA 3IQ5A 1RCPA 1YZAA 4L6RA 4CDYA 2YLDA 2XLVA 3TOMA 3U8PA 2YL1A 1MQVA 1CGOA 2YL0A 4N6HA 2YLIA 3M15A 4N4WA 2BC5A 2XM4A 3NMKA 3DE9A 5JLIA 2XL6A 4IB4A 4CJOA 2XLEA 1CGNA 3ZTZA 2J9BA 4WGZA 2CCYA 3HNLA 5AGFA 3NMJA
chains in the Genus database with same CATH superfamily
1ZHTA 3NKEA 3BEHA 2YLGA 1HW1A 2RD9A 4YT8A 3GEHA 4HFFB 1M2OA 1NSGB 2CNWA 2EILC 2GFHA 3ZTMA 2GA0A 3JT1A 1D0XA 2IXPA 3GEIA 2WVNA 4G78A 4JTCB 5JRAA 4PK4A 3FHDA 5KYYA 2W4BA 3AQCA 3HNIA 1NG1A 4Q7CA 2PBEA 2G62A 3GWLA 3LEVA 1H9TA 5TJ5E 4AX2A 3O6XA 4KNVA 3JSEO 4MVSA 3ZC4A 4N6CA 4LDKA 1J8YF 2ICWG 3X2QC 3EH2A 2IM8A 3AG3C 2A6EF 3FOPA 1ORJA 2EPOA 1O5HA 1HE1A 4U9EA 3TJ5A 4WGYA 1NBBA 4C7OB 3F47A 3VYWA 3QW1A 4CS9A 2H7BA 4OIRF 4BJTA 1OW7A 1SYQA 2WVQA 1D0YA 2X51A 1SR2A 4LERA 4WABA 3LS0A 1YAUO 1VMAA 4U5GA 4KNWA 4H4KC 2RSEB 4CX9A 2EPMX 3L8JA 4IRUA 3MLGA 2Q4FA 2FGYA 1K40A 2R7QA 4XWJA 3HKKA 5D91A 1MMGA 1Z23A 5E3CA 5KYXA 4DVZA 3NKDA 2IYLD 4JEAA 3T6JA 3G4ZA 3B0PA 2HV7A 3C62A 2IOQA 2EIMC 3K6BA 3LLIA 3MYFA 4CIPA 2FFHA 3JYYA 2IXOA 4KC9A 5B1BC 1LVKA 1TWAA 4NC3A 1U0BB 4PJNA 1FTSA 2D5RB 2P7VA 3G4XA 5D92A 4BJ6C 2NUTB 1EKYA 2OKUA 5JUAA 2YQYA 2EPNA 3GEEA 4D4NA 2LFDA 1I4YA 5JT4A 3W2WA 1MMNA 3N24A 4X0RA 2KK1A 1WWPA 1V55C 3LNRA 2QTVA 3EGXB 2LSEA 2HJ3A 2XLWA 3LUTB 3DD7A 4PJLA 1JR8A 3VF0A 3G50A 3JCUQ 1ZHYA 4AK9A 4XEVA 2Q9BA 1CGME 3B29A 1BR1A 2R7VA 4H54A 4JTAB 3U8VA 1UFBA 1XZQA 3ZQVA 4ANJA 3SXYA 4P6IC 4XTKA 2EINC 4NTFA 3K1IC 4DBQA 1QPUA 1JOGA 5BQHA 5KYNA 1T01A 2PX3A 2R7OA 1YYXA 2A0UA 1ZW2A 4U5DE 1YARO 4AL1A 5E3AA 3RVZA 4EBBA 4XEFA 3WHNA 1YZAA 4L6RA 1SMYF 1TWCA 2LFFA 2KNHA 1Q0KA 2VH3A 2V3CC 1M56C 1IZMA 3SXZA 1TFOB 4NY3A 4DXWA 1MQVA 1CGOA 4YT2A 1FMWA 5EGYA 1EI7A 3MFNA 2YL0A 1WTYA 5CI9A 2VCBA 3IPMO 4N6HA 2YLIA 3N0TA 3J06A 1O3UA 2OQMA 3EJNA 4O6MA 2OCCC 3S28A 1PD0A 1TWHA 1KTMA 2XM4A 2KJGA 1TFKB 2I15A 3NMKA 2CYDA 2EPLX 4EBJA 2F22A 1BR2A 2R03A 3US6A 4Z9HA 5L0DA 3UMKA 2P61A 2CCYA 3GANA 1ZHXA 1NLXA 1JMWA 1SF8A 3DKAA 4HEAJ 3V5ZA 2G3KA 4YK5A 3QTHA 1OXBA 1W2WA 4D4XA 4MVQA 2L9JA 2ZD9A 3H2UA 4MTFA 3T4RA 3Q6MA 3DJUB 2XL8A 1NZEA 4JE9A 4MVZA 4F4BA 2ZXRA 2LQGA 4U9DA 1OQCA 4O79A 2YRFA 4BJ6A 1JPNA 1YLMA 4O7GA 4CSAA 4HFKB 2Y39A 2HV6A 5L0GA 1GM5A 2TMVP 3M4BA 2AU5A 3RKOF 2ASRA 5L3VA 4I3MA 1ORYA 2A68F 5DLJA 3QVZA 2BL2A 1XWJA 4IJJA 3HTKC 2VASA 4J30B 1JAFA 5B3IA 1QSPA 4C3DA 5DS5A 1WOLA 3FVYA 2QE9A 2PP4A 4CDAA 2NSGA 1OR2A 2XL4A 3KL4A 3O10A 3QZCA 1OXKA 3RYLA 2KQ9A 3A11A 4MW8A 4Z9IA 4BJ5C 5DS4A 1EQ1A 2CW0F 1I5NA 1Q0FA 4XQ1A 1NU9C 2A0BA 2L6HA 1NU7D 1H7IA 1YA7O 3ABMC 3O55A 4RDAA 3EG9A 3DXJF 2DGJA 4A4AA 1ZHWA 2V26A 5K0IA 1ZW3A 2YWAA 2XSEA 3JSZA 2YVKA 4JEBA 1LPEA 5A6AA 3JYHA 1C02A 3GORA 4P9FA 1FFTC 4MVUA 4NTBA 3RQFA 2J46A 3UGPA 5AC4A 1F1MA 3W2VA 4AE4A 1OKKD 1YYJA 3EZHA 5JVEA 3F46A 4IGGA 4DOZA 1LI5A 5DS6A 3UMHA 1LI7A 2H8AA 3KKBA 1E83A 3LEOA 4K1OA 4ER9A 1Y6DA 4XEKA 1T9KA 1BBHA 2J7PD 4OIPF 4XPWA 2Q7RA 4BG0A 1T6IA 3JRMO 3HNJA 5COMA 2FAPB 1T6UA 1VYIA 3JRTA 3X1OA 4YT4A 1HMOA 1YVIA 2HMZA 3M79A 3L34A 5JSLA 4CS8A 4BPMA 2R7TA 1VK5A 3QW0A 3RFYA 3NDBB 1Z6AA 1TKNA 3RIPA 1M57C 3L0IA 3MYIA 2AVKA 3QMKA 2IXMA 2WB7A 3JTLO 5F28E 2CGEA 3DMDA 2AWCA 3I4UA 1D0ZA 1G4US 2W9YA 4K0DA 3CAXA 3SP1A 3C8GB 2R7WA 4OIQF 1MMDA 1FNTc 1Q0DA 2Y3DA 3GM1A 4G7ZF 1CPRA 4MS2A 1Y4CA 2DI3A 1BZ4A 1Z7Qc 1ZU5A 4ULVA 5KYWA 1FFHA 1OR3A 2M4EA 2R02A 2HUJA 3EHMA 3PHF2 4YL0A 3UNGC 2J0WA 3EG9B 4R32A 2LD6A 2HSBA 5KYYB 2Y69C 1RXQA 4EUKB 3OEOA 4OD5A 5T3WA 5CI8A 3V5XA 2CDQA 2WL8A 3AOUA 3DI5A 3U8PA 1DOWA 2L7AA 2YL1A 3SEOA 2Y3BA 3AGTA 1GS9A 2HKVA 4O6YA 3RVYA 5L0FA 4QI0A 1R4TA 2OEXA 2HZ8A 2O9XA 4N4WA 3UGOA 4E17A 1ZHZA 2P1AA 4MTOA 3IEEA 3DE9A 5B1AC 4CS7A 5JLIA 2XL6A 2OU6A 1CGNA 2OG2A 2J9BA 4JJFA 4YN0B 2DB4A 4CIHA 3U0CA 4UDVA 3B9QA 2C03A 1H6GA 3U2MA 3GWNA 2NSFA 2J9VA 3SYNA 4OIOF 3FOOA 4Z9JA 1ZU4A 3GODA 3M4CA 1A0BA 3W8HA 2PX0A 1HMDA 4KBLA 4MVMA 3GM3A 3B0VC 1NFOA 2OEVA 4YJWA 3TK0A 3VM6A 2WZGA 3RQEA 3HLZA 4XLPF 5B3SC 4CS9C 3W4YA 2Q00A 3NYMA 1G4WR 3LLKA 2KSFA 1APCA 4OINF 3ASOC 3C8ZA 2J8WA 2Q3TA 2XLDA 3JZ0A 5BQGA 4DVYP 2EIJC 4JCHA 3Q6NA 4QI2A 4MNDA 2B0JA 4ONSA 3HNKA 4E0HA 1VLSA 1LS4A 3RW0A 2CNWD 3S84A 1V4AA 3PMRA 2LP4A 3K7DA 5HSWA 3PCVA 3S9OA 2YL7A 2XM0A 3AG4C 4U5FE 4DRIB 3CQZA 4IAOA 1GQAA 1D1CA 1MNDA 1SZIA 4XLNF 2JPUA 3V5YA 1QLEC 3UR3C 1OCOC 1PV3A 5E33A 3IQ6A 4G7OF 1Z5ZA 5KYUA 4MVRA 3DM5A 4C3BA 2B0HA 1D1AA 4YWQA 2J9UA 1N1CA 5DQZA 3TULA 3FXHA 2UUHA 3L1MA 2LK4A 3FDQA 5DVWA 4GYTA 1ZZPA 1A7VA 2HFIA 2LCHA 4EIYA 4JURI 3FMSA 3NYJA 1EA8A 2XLOA 2R7UA 3ZWIA 1LKXA 2J7PA 2D4UA 2ZXWC 3O39A 5AC5A 1S05A 4U5EE 1RMVA 5L0JA 1ZYRF 1CPQA 1Z63A 4JJGA 5JP7A 4J7TA 1E85A 3KPHA 3R2PA 3V7OA 2NUPA 1V74B 2DYRC 2QLAA 3ASNC 3C8GD 3TQOA 4CDVA 1E2XA 3IQCA 1VB5A 2L6GA 3M1CB 3C63A 4PACA 1FR0A 5L0CA 2L81A 4PR9A 4ULWA 2NG1A 1RJ9B 2OJQA 2PFDA 4FWVA 3U9MA 5F5HA 3K1IA 1FAPB 2HJMA 4IAQA 4QDLA 3R7CA 1YA9A 3DAFA 2M64A 1L3PA 4JZAA 4J7YA 3PDMP 2AWYA 2NUPB 3BRJA 4PJMA 4E7ZA 2WZLA 4EWCA 4O6NA 1XZPA 5IY5C 2Q9AA 5A6JA 4DJ9A 4MQ9F 2PNOA 1M6TA 1S7ZA 1TWGA 4GEHA 4PFOA 2R9RB 3VAYA 5DQTA 3DE8A 2YKZA 1YJGA 3A9CA 3U2LA 3VRCA 1Q0GA 1ST6A 2WVOA 2WZFA 3NMIA 1LE4A 2ETSA 1OW8A 3EH1A 3AG2C 3DM9B 3Q7LA 3WG7C 1UG7A 1TQGA 2YEVA 2HS5A 4CDYA 1VLTA 3FAPB 4W8PA 2KW3C 2XLVA 1FMVA 4XPXA 5COFA 4EBKA 5A6BD 4YL1A 5KYUB 3S0XA 5A6KA 2A69F 3SXKA 1M2VA 1QKRA 2R7SA 3EGDA 1VOMA 1Z3IX 4MVOA 3KH2A 3NRHA 4C7OA 5E2QA 5BUOA 3M15A 2BC5A 3SZRA 3ITFA 3EFOA 3MX3A 4N06A 2GAQA 3EGXA 1HY5A 3NG1A 1TR2A 3ABKC 4PFPA 3H2VA 2YHSA 1MMAA 4IB4A 1VTMP 2QY9A 2Q9CA 3ZTZA 4MW3A 2P0NA 2GWWA 5A69A 3T6BA 1G8XA 4AL0A 1L7CA 2Y3HA 2Z15A 3NMJA 4KI2A 2XS8A 3EGDB 3KYIA 3E9VA 4NCQA 1ZVZA 4G0HA 2R25A 3C18A 3K33A 3LS1A 3RF3A 3S90A 1T5OA 3E70C 2JD3A 4Q4ZF 5KYWB 3S27A 1C03A 1AVOB 1U89A 2VB6A 1YDIA 1QQ3A 3ECSA 4NQFA 2XLMA 2XRHA 1WGWA 2R7RA 4B6IA 4CBEA 4LDRA 5COGA 4U5CE 2R05A 2ZXOA 5T3TA 3KMIA 3KYJA 4J32B 5FZTA 4EKWA 3ZIBA 2XLHA 2A1DD 4FX5A 2LIGA 4C3EA 1JPJA 1A7DA 4PJJA 4CJGA 3MBGA 4MTGA 3C7JA 4A2NB 4JW1A 4JKVA 4CSAC 2HMQA 1DOVA 2YL3A 1QZXA 2KYHA 3GM2A 4P9TA 4DRJB 4IARA 3RH3A 2PF4E 4GQHA 3EQLF 1O87A 2R7XA 2J45A 3FAJA 3DWWA 1WN0A 2P6VA 3OWTA 3U5SA 2DYSC 4YL3A 3AGUA 1RJ9A 2MHRA 2IBFA 3EFOB 4E7SA 1OW6A 1RKEA 1LS1A 1LM3B 4K7BA 3K66A 2NPUA 2KC3A 3B71A 4JC7A 4BEJA 3WAQA 4FAPB 2EIKC 1M2VB 2QNLA 4U5BE 2Y3GA 4XPYA 5HV9A 3POVA 5EHHA 3AJMA 4ZLDA 2NUTA 1RKCA 3SNHA 4JVSA 4BJ5A 5FCLA 3C8GA 1LE2A 3H65A 5GPGB 1PCXA 1PD1A 3U9JA 2C04A 4LLCA 4YT5A 3OA1A 2JX0A 3L8IA 2G3VA 3ZDLA 3QVYA 2OOCA 4I1MA 1ORSC 2GDCA 1R5ID 3U3BA 2XXAA 4E18A 2AP3A 5F5FA 3Q7GA 4LLEA 1OCZC 5T1DB 3TOLA 4E0IA 1B68A 2IXNA 3IQTA 4JCZA 4U5HA 5JS5A 2OJED 5EK0A 3DAGA 3TJ6A 3IHUA 1BDJB 4HE8D 1G5ZA 2YZSA 3SXMA 2ZXPA 1K05A 3ZG1A 4BEMJ 3AG1C 4NTAA 4WJ0A 1E84A 2I8BA 4JRZA 1OKKA 1WATA 3LESA 2H7VC 1YZCA 3WODF 2E87A 5L0HA 1E86A 3B0UX 3AQBA 3DZAA 3T9OA 3ZQYA 1J8MF 3ZSUA 2XXAB 3EZIA 1D1BA 3HJCA 4RD9A 3CEXA 4EHPA 1V54C 2EPKX 4AE4B 1AUEA 3CSKA 5BQIA 3I5QA 3T6GB 3W8IA 2MWQA 1NFNA 2QUPA 3I5PA 4DRHB 1LIHA 4I44A 5L0IA 4CS8C 256BA 1U6HA 4JIOA 2W4MA 1MNEA 2H7OA 3IQ5A 5A6BA 3NYLA 2VCCA 1H9GA 2UUIA 1AEPA 3S29A 3ABLC 1IW7F 1RCPA 4IWBA 1HE9A 4BJ1A 5CIVA 1C17M 1RKEB 1KNYA 1WASA 2YLDA 4I1OB 3ZVRA 2HSQA 2KGOA 1OCCC 2BE5F 3TD7A 3K1HA 5L3QA 4G7HF 3TOMA 1A41A 1GGQA 2W45A 2ZPAA 3EPVA 2J9WA 1A7EA 1K04A 1QVXA 3LJBA 2A6HF 3LAYA 4M63A 2VC9A 3N2ZB 4LDQA 3LNMB 3UMIA 1OCRC 1Q0MA 3U3FA 4Q5SF 4FESA 2X0CA 4OD4A 4W8KA 4LACB 1KU2A 3ATPA 2L6FA 5KYXB 4JTDB 1HW2A 1VYKA 3CZ6A 3RQGA 1JRAA 1T6QA 4RBNA 2XS1A 3EHNA 2J0XA 2VCAA 2XLEA 3DJNB 4CJOA 4DBRA 4WGZA 1I4ZA 1BR4A 3HNLA 4ZLCA 5AGFA 2MYSA
chains in the Genus database with same CATH topology
3FOOA 4D4XA 2YLGA 3M4CA 3ZTMA 2XL8A 4JE9A 5JRAA 4U9DA 3HNIA 1QQ3A 2XLMA 1APCA 3M4BA 2J8WA 2XLDA 3QVZA 3FOPA 2XLHA 3HNKA 4CJGA 1JAFA 4U9EA 5B3IA 2YL7A 2XM0A 4JKVA 4WGYA 1NBBA 1GQAA 3QW1A 2YL3A 4CDAA 4IARA 3IQ6A 4CX9A 1LM3B 3L1MA 1A7VA 4JEAA 4EIYA 4JEBA 3C62A 4CIPA 2XLOA 3ZWIA 4NC3A 1EKYA 1YYJA 1S05A 5JVEA 1CPQA 3QVYA 5JUAA 1E83A 5JP7A 1E85A 4ER9A 4D4NA 2QLAA 1BBHA 3TOLA 4CDVA 5JT4A 5JS5A 3C63A 3HNJA 3M79A 4IAQA 5JSLA 2XLWA 3QW0A 1E84A 1YZCA 1E86A 3ZQYA 1M6TA 3ZQVA 3DE8A 2YKZA 3VRCA 1CPRA 1QPUA 256BA 3NMIA 4ULVA 1YYXA 3IQ5A 1RCPA 1YZAA 4L6RA 4CDYA 2YLDA 2XLVA 3TOMA 3U8PA 2YL1A 1MQVA 1CGOA 2YL0A 4N6HA 2YLIA 3M15A 4N4WA 2BC5A 2XM4A 3NMKA 3DE9A 5JLIA 2XL6A 4IB4A 4CJOA 2XLEA 1CGNA 3ZTZA 2J9BA 4WGZA 2CCYA 3HNLA 5AGFA 3NMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FOO A;  4D4X A;  2YLG A;  3M4C A;  3ZTM A;  2XL8 A;  4JE9 A;  5JRA A;  4U9D A;  3HNI A;  1QQ3 A;  2XLM A;  1APC A;  3M4B A;  2J8W A;  2XLD A;  3QVZ A;  3FOP A;  2XLH A;  3HNK A;  4CJG A;  1JAF A;  4U9E A;  5B3I A;  2YL7 A;  2XM0 A;  4JKV A;  4WGY A;  1NBB A;  1GQA A;  3QW1 A;  2YL3 A;  4CDA A;  4IAR A;  3IQ6 A;  4CX9 A;  1LM3 B;  3L1M A;  1A7V A;  4JEA A;  4EIY A;  4JEB A;  3C62 A;  4CIP A;  2XLO A;  3ZWI A;  4NC3 A;  1EKY A;  1YYJ A;  1S05 A;  5JVE A;  1CPQ A;  3QVY A;  5JUA A;  1E83 A;  5JP7 A;  1E85 A;  4ER9 A;  4D4N A;  2QLA A;  1BBH A;  3TOL A;  4CDV A;  5JT4 A;  5JS5 A;  3C63 A;  3HNJ A;  3M79 A;  4IAQ A;  5JSL A;  2XLW A;  3QW0 A;  1E84 A;  1YZC A;  1E86 A;  3ZQY A;  1M6T A;  3ZQV A;  3DE8 A;  2YKZ A;  3VRC A;  1CPR A;  1QPU A;  256B A;  3NMI A;  4ULV A;  1YYX A;  3IQ5 A;  1RCP A;  1YZA A;  4L6R A;  4CDY A;  2YLD A;  2XLV A;  3TOM A;  3U8P A;  2YL1 A;  1MQV A;  1CGO A;  2YL0 A;  4N6H A;  2YLI A;  3M15 A;  4N4W A;  2BC5 A;  2XM4 A;  3NMK A;  3DE9 A;  5JLI A;  2XL6 A;  4IB4 A;  4CJO A;  2XLE A;  1CGN A;  3ZTZ A;  2J9B A;  4WGZ A;  2CCY A;  3HNL A;  5AGF A;  3NMJ A; 
#chains in the Genus database with same CATH topology
 1ZHT A;  3NKE A;  3BEH A;  2YLG A;  1HW1 A;  2RD9 A;  4YT8 A;  3GEH A;  4HFF B;  1M2O A;  1NSG B;  2CNW A;  2EIL C;  2GFH A;  3ZTM A;  2GA0 A;  3JT1 A;  1D0X A;  2IXP A;  3GEI A;  2WVN A;  4G78 A;  4JTC B;  5JRA A;  4PK4 A;  3FHD A;  5KYY A;  2W4B A;  3AQC A;  3HNI A;  1NG1 A;  4Q7C A;  2PBE A;  2G62 A;  3GWL A;  3LEV A;  1H9T A;  5TJ5 E;  4AX2 A;  3O6X A;  4KNV A;  3JSE O;  4MVS A;  3ZC4 A;  4N6C A;  4LDK A;  1J8Y F;  2ICW G;  3X2Q C;  3EH2 A;  2IM8 A;  3AG3 C;  2A6E F;  3FOP A;  1ORJ A;  2EPO A;  1O5H A;  1HE1 A;  4U9E A;  3TJ5 A;  4WGY A;  1NBB A;  4C7O B;  3F47 A;  3VYW A;  3QW1 A;  4CS9 A;  2H7B A;  4OIR F;  4BJT A;  1OW7 A;  1SYQ A;  2WVQ A;  1D0Y A;  2X51 A;  1SR2 A;  4LER A;  4WAB A;  3LS0 A;  1YAU O;  1VMA A;  4U5G A;  4KNW A;  4H4K C;  2RSE B;  4CX9 A;  2EPM X;  3L8J A;  4IRU A;  3MLG A;  2Q4F A;  2FGY A;  1K40 A;  2R7Q A;  4XWJ A;  3HKK A;  5D91 A;  1MMG A;  1Z23 A;  5E3C A;  5KYX A;  4DVZ A;  3NKD A;  2IYL D;  4JEA A;  3T6J A;  3G4Z A;  3B0P A;  2HV7 A;  3C62 A;  2IOQ A;  2EIM C;  3K6B A;  3LLI A;  3MYF A;  4CIP A;  2FFH A;  3JYY A;  2IXO A;  4KC9 A;  5B1B C;  1LVK A;  1TWA A;  4NC3 A;  1U0B B;  4PJN A;  1FTS A;  2D5R B;  2P7V A;  3G4X A;  5D92 A;  4BJ6 C;  2NUT B;  1EKY A;  2OKU A;  5JUA A;  2YQY A;  2EPN A;  3GEE A;  4D4N A;  2LFD A;  1I4Y A;  5JT4 A;  3W2W A;  1MMN A;  3N24 A;  4X0R A;  2KK1 A;  1WWP A;  1V55 C;  3LNR A;  2QTV A;  3EGX B;  2LSE A;  2HJ3 A;  2XLW A;  3LUT B;  3DD7 A;  4PJL A;  1JR8 A;  3VF0 A;  3G50 A;  3JCU Q;  1ZHY A;  4AK9 A;  4XEV A;  2Q9B A;  1CGM E;  3B29 A;  1BR1 A;  2R7V A;  4H54 A;  4JTA B;  3U8V A;  1UFB A;  1XZQ A;  3ZQV A;  4ANJ A;  3SXY A;  4P6I C;  4XTK A;  2EIN C;  4NTF A;  3K1I C;  4DBQ A;  1QPU A;  1JOG A;  5BQH A;  5KYN A;  1T01 A;  2PX3 A;  2R7O A;  1YYX A;  2A0U A;  1ZW2 A;  4U5D E;  1YAR O;  4AL1 A;  5E3A A;  3RVZ A;  4EBB A;  4XEF A;  3WHN A;  1YZA A;  4L6R A;  1SMY F;  1TWC A;  2LFF A;  2KNH A;  1Q0K A;  2VH3 A;  2V3C C;  1M56 C;  1IZM A;  3SXZ A;  1TFO B;  4NY3 A;  4DXW A;  1MQV A;  1CGO A;  4YT2 A;  1FMW A;  5EGY A;  1EI7 A;  3MFN A;  2YL0 A;  1WTY A;  5CI9 A;  2VCB A;  3IPM O;  4N6H A;  2YLI A;  3N0T A;  3J06 A;  1O3U A;  2OQM A;  3EJN A;  4O6M A;  2OCC C;  3S28 A;  1PD0 A;  1TWH A;  1KTM A;  2XM4 A;  2KJG A;  1TFK B;  2I15 A;  3NMK A;  2CYD A;  2EPL X;  4EBJ A;  2F22 A;  1BR2 A;  2R03 A;  3US6 A;  4Z9H A;  5L0D A;  3UMK A;  2P61 A;  2CCY A;  3GAN A;  1ZHX A;  1NLX A;  1JMW A;  1SF8 A;  3DKA A;  4HEA J;  3V5Z A;  2G3K A;  4YK5 A;  3QTH A;  1OXB A;  1W2W A;  4D4X A;  4MVQ A;  2L9J A;  2ZD9 A;  3H2U A;  4MTF A;  3T4R A;  3Q6M A;  3DJU B;  2XL8 A;  1NZE A;  4JE9 A;  4MVZ A;  4F4B A;  2ZXR A;  2LQG A;  4U9D A;  1OQC A;  4O79 A;  2YRF A;  4BJ6 A;  1JPN A;  1YLM A;  4O7G A;  4CSA A;  4HFK B;  2Y39 A;  2HV6 A;  5L0G A;  1GM5 A;  2TMV P;  3M4B A;  2AU5 A;  3RKO F;  2ASR A;  5L3V A;  4I3M A;  1ORY A;  2A68 F;  5DLJ A;  3QVZ A;  2BL2 A;  1XWJ A;  4IJJ A;  3HTK C;  2VAS A;  4J30 B;  1JAF A;  5B3I A;  1QSP A;  4C3D A;  5DS5 A;  1WOL A;  3FVY A;  2QE9 A;  2PP4 A;  4CDA A;  2NSG A;  1OR2 A;  2XL4 A;  3KL4 A;  3O10 A;  3QZC A;  1OXK A;  3RYL A;  2KQ9 A;  3A11 A;  4MW8 A;  4Z9I A;  4BJ5 C;  5DS4 A;  1EQ1 A;  2CW0 F;  1I5N A;  1Q0F A;  4XQ1 A;  1NU9 C;  2A0B A;  2L6H A;  1NU7 D;  1H7I A;  1YA7 O;  3ABM C;  3O55 A;  4RDA A;  3EG9 A;  3DXJ F;  2DGJ A;  4A4A A;  1ZHW A;  2V26 A;  5K0I A;  1ZW3 A;  2YWA A;  2XSE A;  3JSZ A;  2YVK A;  4JEB A;  1LPE A;  5A6A A;  3JYH A;  1C02 A;  3GOR A;  4P9F A;  1FFT C;  4MVU A;  4NTB A;  3RQF A;  2J46 A;  3UGP A;  5AC4 A;  1F1M A;  3W2V A;  4AE4 A;  1OKK D;  1YYJ A;  3EZH A;  5JVE A;  3F46 A;  4IGG A;  4DOZ A;  1LI5 A;  5DS6 A;  3UMH A;  1LI7 A;  2H8A A;  3KKB A;  1E83 A;  3LEO A;  4K1O A;  4ER9 A;  1Y6D A;  4XEK A;  1T9K A;  1BBH A;  2J7P D;  4OIP F;  4XPW A;  2Q7R A;  4BG0 A;  1T6I A;  3JRM O;  3HNJ A;  5COM A;  2FAP B;  1T6U A;  1VYI A;  3JRT A;  3X1O A;  4YT4 A;  1HMO A;  1YVI A;  2HMZ A;  3M79 A;  3L34 A;  5JSL A;  4CS8 A;  4BPM A;  2R7T A;  1VK5 A;  3QW0 A;  3RFY A;  3NDB B;  1Z6A A;  1TKN A;  3RIP A;  1M57 C;  3L0I A;  3MYI A;  2AVK A;  3QMK A;  2IXM A;  2WB7 A;  3JTL O;  5F28 E;  2CGE A;  3DMD A;  2AWC A;  3I4U A;  1D0Z A;  1G4U S;  2W9Y A;  4K0D A;  3CAX A;  3SP1 A;  3C8G B;  2R7W A;  4OIQ F;  1MMD A;  1FNT c;  1Q0D A;  2Y3D A;  3GM1 A;  4G7Z F;  1CPR A;  4MS2 A;  1Y4C A;  2DI3 A;  1BZ4 A;  1Z7Q c;  1ZU5 A;  4ULV A;  5KYW A;  1FFH A;  1OR3 A;  2M4E A;  2R02 A;  2HUJ A;  3EHM A;  3PHF 2;  4YL0 A;  3UNG C;  2J0W A;  3EG9 B;  4R32 A;  2LD6 A;  2HSB A;  5KYY B;  2Y69 C;  1RXQ A;  4EUK B;  3OEO A;  4OD5 A;  5T3W A;  5CI8 A;  3V5X A;  2CDQ A;  2WL8 A;  3AOU A;  3DI5 A;  3U8P A;  1DOW A;  2L7A A;  2YL1 A;  3SEO A;  2Y3B A;  3AGT A;  1GS9 A;  2HKV A;  4O6Y A;  3RVY A;  5L0F A;  4QI0 A;  1R4T A;  2OEX A;  2HZ8 A;  2O9X A;  4N4W A;  3UGO A;  4E17 A;  1ZHZ A;  2P1A A;  4MTO A;  3IEE A;  3DE9 A;  5B1A C;  4CS7 A;  5JLI A;  2XL6 A;  2OU6 A;  1CGN A;  2OG2 A;  2J9B A;  4JJF A;  4YN0 B;  2DB4 A;  4CIH A;  3U0C A;  4UDV A;  3B9Q A;  2C03 A;  1H6G A;  3U2M A;  3GWN A;  2NSF A;  2J9V A;  3SYN A;  4OIO F;  3FOO A;  4Z9J A;  1ZU4 A;  3GOD A;  3M4C A;  1A0B A;  3W8H A;  2PX0 A;  1HMD A;  4KBL A;  4MVM A;  3GM3 A;  3B0V C;  1NFO A;  2OEV A;  4YJW A;  3TK0 A;  3VM6 A;  2WZG A;  3RQE A;  3HLZ A;  4XLP F;  5B3S C;  4CS9 C;  3W4Y A;  2Q00 A;  3NYM A;  1G4W R;  3LLK A;  2KSF A;  1APC A;  4OIN F;  3ASO C;  3C8Z A;  2J8W A;  2Q3T A;  2XLD A;  3JZ0 A;  5BQG A;  4DVY P;  2EIJ C;  4JCH A;  3Q6N A;  4QI2 A;  4MND A;  2B0J A;  4ONS A;  3HNK A;  4E0H A;  1VLS A;  1LS4 A;  3RW0 A;  2CNW D;  3S84 A;  1V4A A;  3PMR A;  2LP4 A;  3K7D A;  5HSW A;  3PCV A;  3S9O A;  2YL7 A;  2XM0 A;  3AG4 C;  4U5F E;  4DRI B;  3CQZ A;  4IAO A;  1GQA A;  1D1C A;  1MND A;  1SZI A;  4XLN F;  2JPU A;  3V5Y A;  1QLE C;  3UR3 C;  1OCO C;  1PV3 A;  5E33 A;  3IQ6 A;  4G7O F;  1Z5Z A;  5KYU A;  4MVR A;  3DM5 A;  4C3B A;  2B0H A;  1D1A A;  4YWQ A;  2J9U A;  1N1C A;  5DQZ A;  3TUL A;  3FXH A;  2UUH A;  3L1M A;  2LK4 A;  3FDQ A;  5DVW A;  4GYT A;  1ZZP A;  1A7V A;  2HFI A;  2LCH A;  4EIY A;  4JUR I;  3FMS A;  3NYJ A;  1EA8 A;  2XLO A;  2R7U A;  3ZWI A;  1LKX A;  2J7P A;  2D4U A;  2ZXW C;  3O39 A;  5AC5 A;  1S05 A;  4U5E E;  1RMV A;  5L0J A;  1ZYR F;  1CPQ A;  1Z63 A;  4JJG A;  5JP7 A;  4J7T A;  1E85 A;  3KPH A;  3R2P A;  3V7O A;  2NUP A;  1V74 B;  2DYR C;  2QLA A;  3ASN C;  3C8G D;  3TQO A;  4CDV A;  1E2X A;  3IQC A;  1VB5 A;  2L6G A;  3M1C B;  3C63 A;  4PAC A;  1FR0 A;  5L0C A;  2L81 A;  4PR9 A;  4ULW A;  2NG1 A;  1RJ9 B;  2OJQ A;  2PFD A;  4FWV A;  3U9M A;  5F5H A;  3K1I A;  1FAP B;  2HJM A;  4IAQ A;  4QDL A;  3R7C A;  1YA9 A;  3DAF A;  2M64 A;  1L3P A;  4JZA A;  4J7Y A;  3PDM P;  2AWY A;  2NUP B;  3BRJ A;  4PJM A;  4E7Z A;  2WZL A;  4EWC A;  4O6N A;  1XZP A;  5IY5 C;  2Q9A A;  5A6J A;  4DJ9 A;  4MQ9 F;  2PNO A;  1M6T A;  1S7Z A;  1TWG A;  4GEH A;  4PFO A;  2R9R B;  3VAY A;  5DQT A;  3DE8 A;  2YKZ A;  1YJG A;  3A9C A;  3U2L A;  3VRC A;  1Q0G A;  1ST6 A;  2WVO A;  2WZF A;  3NMI A;  1LE4 A;  2ETS A;  1OW8 A;  3EH1 A;  3AG2 C;  3DM9 B;  3Q7L A;  3WG7 C;  1UG7 A;  1TQG A;  2YEV A;  2HS5 A;  4CDY A;  1VLT A;  3FAP B;  4W8P A;  2KW3 C;  2XLV A;  1FMV A;  4XPX A;  5COF A;  4EBK A;  5A6B D;  4YL1 A;  5KYU B;  3S0X A;  5A6K A;  2A69 F;  3SXK A;  1M2V A;  1QKR A;  2R7S A;  3EGD A;  1VOM A;  1Z3I X;  4MVO A;  3KH2 A;  3NRH A;  4C7O A;  5E2Q A;  5BUO A;  3M15 A;  2BC5 A;  3SZR A;  3ITF A;  3EFO A;  3MX3 A;  4N06 A;  2GAQ A;  3EGX A;  1HY5 A;  3NG1 A;  1TR2 A;  3ABK C;  4PFP A;  3H2V A;  2YHS A;  1MMA A;  4IB4 A;  1VTM P;  2QY9 A;  2Q9C A;  3ZTZ A;  4MW3 A;  2P0N A;  2GWW A;  5A69 A;  3T6B A;  1G8X A;  4AL0 A;  1L7C A;  2Y3H A;  2Z15 A;  3NMJ A;  4KI2 A;  2XS8 A;  3EGD B;  3KYI A;  3E9V A;  4NCQ A;  1ZVZ A;  4G0H A;  2R25 A;  3C18 A;  3K33 A;  3LS1 A;  3RF3 A;  3S90 A;  1T5O A;  3E70 C;  2JD3 A;  4Q4Z F;  5KYW B;  3S27 A;  1C03 A;  1AVO B;  1U89 A;  2VB6 A;  1YDI A;  1QQ3 A;  3ECS A;  4NQF A;  2XLM A;  2XRH A;  1WGW A;  2R7R A;  4B6I A;  4CBE A;  4LDR A;  5COG A;  4U5C E;  2R05 A;  2ZXO A;  5T3T A;  3KMI A;  3KYJ A;  4J32 B;  5FZT A;  4EKW A;  3ZIB A;  2XLH A;  2A1D D;  4FX5 A;  2LIG A;  4C3E A;  1JPJ A;  1A7D A;  4PJJ A;  4CJG A;  3MBG A;  4MTG A;  3C7J A;  4A2N B;  4JW1 A;  4JKV A;  4CSA C;  2HMQ A;  1DOV A;  2YL3 A;  1QZX A;  2KYH A;  3GM2 A;  4P9T A;  4DRJ B;  4IAR A;  3RH3 A;  2PF4 E;  4GQH A;  3EQL F;  1O87 A;  2R7X A;  2J45 A;  3FAJ A;  3DWW A;  1WN0 A;  2P6V A;  3OWT A;  3U5S A;  2DYS C;  4YL3 A;  3AGU A;  1RJ9 A;  2MHR A;  2IBF A;  3EFO B;  4E7S A;  1OW6 A;  1RKE A;  1LS1 A;  1LM3 B;  4K7B A;  3K66 A;  2NPU A;  2KC3 A;  3B71 A;  4JC7 A;  4BEJ A;  3WAQ A;  4FAP B;  2EIK C;  1M2V B;  2QNL A;  4U5B E;  2Y3G A;  4XPY A;  5HV9 A;  3POV A;  5EHH A;  3AJM A;  4ZLD A;  2NUT A;  1RKC A;  3SNH A;  4JVS A;  4BJ5 A;  5FCL A;  3C8G A;  1LE2 A;  3H65 A;  5GPG B;  1PCX A;  1PD1 A;  3U9J A;  2C04 A;  4LLC A;  4YT5 A;  3OA1 A;  2JX0 A;  3L8I A;  2G3V A;  3ZDL A;  3QVY A;  2OOC A;  4I1M A;  1ORS C;  2GDC A;  1R5I D;  3U3B A;  2XXA A;  4E18 A;  2AP3 A;  5F5F A;  3Q7G A;  4LLE A;  1OCZ C;  5T1D B;  3TOL A;  4E0I A;  1B68 A;  2IXN A;  3IQT A;  4JCZ A;  4U5H A;  5JS5 A;  2OJE D;  5EK0 A;  3DAG A;  3TJ6 A;  3IHU A;  1BDJ B;  4HE8 D;  1G5Z A;  2YZS A;  3SXM A;  2ZXP A;  1K05 A;  3ZG1 A;  4BEM J;  3AG1 C;  4NTA A;  4WJ0 A;  1E84 A;  2I8B A;  4JRZ A;  1OKK A;  1WAT A;  3LES A;  2H7V C;  1YZC A;  3WOD F;  2E87 A;  5L0H A;  1E86 A;  3B0U X;  3AQB A;  3DZA A;  3T9O A;  3ZQY A;  1J8M F;  3ZSU A;  2XXA B;  3EZI A;  1D1B A;  3HJC A;  4RD9 A;  3CEX A;  4EHP A;  1V54 C;  2EPK X;  4AE4 B;  1AUE A;  3CSK A;  5BQI A;  3I5Q A;  3T6G B;  3W8I A;  2MWQ A;  1NFN A;  2QUP A;  3I5P A;  4DRH B;  1LIH A;  4I44 A;  5L0I A;  4CS8 C;  256B A;  1U6H A;  4JIO A;  2W4M A;  1MNE A;  2H7O A;  3IQ5 A;  5A6B A;  3NYL A;  2VCC A;  1H9G A;  2UUI A;  1AEP A;  3S29 A;  3ABL C;  1IW7 F;  1RCP A;  4IWB A;  1HE9 A;  4BJ1 A;  5CIV A;  1C17 M;  1RKE B;  1KNY A;  1WAS A;  2YLD A;  4I1O B;  3ZVR A;  2HSQ A;  2KGO A;  1OCC C;  2BE5 F;  3TD7 A;  3K1H A;  5L3Q A;  4G7H F;  3TOM A;  1A41 A;  1GGQ A;  2W45 A;  2ZPA A;  3EPV A;  2J9W A;  1A7E A;  1K04 A;  1QVX A;  3LJB A;  2A6H F;  3LAY A;  4M63 A;  2VC9 A;  3N2Z B;  4LDQ A;  3LNM B;  3UMI A;  1OCR C;  1Q0M A;  3U3F A;  4Q5S F;  4FES A;  2X0C A;  4OD4 A;  4W8K A;  4LAC B;  1KU2 A;  3ATP A;  2L6F A;  5KYX B;  4JTD B;  1HW2 A;  1VYK A;  3CZ6 A;  3RQG A;  1JRA A;  1T6Q A;  4RBN A;  2XS1 A;  3EHN A;  2J0X A;  2VCA A;  2XLE A;  3DJN B;  4CJO A;  4DBR A;  4WGZ A;  1I4Z A;  1BR4 A;  3HNL A;  4ZLC A;  5AGF A;  2MYS A; 
#chains in the Genus database with same CATH homology
 3FOO A;  4D4X A;  2YLG A;  3M4C A;  3ZTM A;  2XL8 A;  4JE9 A;  5JRA A;  4U9D A;  3HNI A;  1QQ3 A;  2XLM A;  1APC A;  3M4B A;  2J8W A;  2XLD A;  3QVZ A;  3FOP A;  2XLH A;  3HNK A;  4CJG A;  1JAF A;  4U9E A;  5B3I A;  2YL7 A;  2XM0 A;  4JKV A;  4WGY A;  1NBB A;  1GQA A;  3QW1 A;  2YL3 A;  4CDA A;  4IAR A;  3IQ6 A;  4CX9 A;  1LM3 B;  3L1M A;  1A7V A;  4JEA A;  4EIY A;  4JEB A;  3C62 A;  4CIP A;  2XLO A;  3ZWI A;  4NC3 A;  1EKY A;  1YYJ A;  1S05 A;  5JVE A;  1CPQ A;  3QVY A;  5JUA A;  1E83 A;  5JP7 A;  1E85 A;  4ER9 A;  4D4N A;  2QLA A;  1BBH A;  3TOL A;  4CDV A;  5JT4 A;  5JS5 A;  3C63 A;  3HNJ A;  3M79 A;  4IAQ A;  5JSL A;  2XLW A;  3QW0 A;  1E84 A;  1YZC A;  1E86 A;  3ZQY A;  1M6T A;  3ZQV A;  3DE8 A;  2YKZ A;  3VRC A;  1CPR A;  1QPU A;  256B A;  3NMI A;  4ULV A;  1YYX A;  3IQ5 A;  1RCP A;  1YZA A;  4L6R A;  4CDY A;  2YLD A;  2XLV A;  3TOM A;  3U8P A;  2YL1 A;  1MQV A;  1CGO A;  2YL0 A;  4N6H A;  2YLI A;  3M15 A;  4N4W A;  2BC5 A;  2XM4 A;  3NMK A;  3DE9 A;  5JLI A;  2XL6 A;  4IB4 A;  4CJO A;  2XLE A;  1CGN A;  3ZTZ A;  2J9B A;  4WGZ A;  2CCY A;  3HNL A;  5AGF A;  3NMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...