5JT4A

L16a mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans
molecule tags Electron transport
molecule keywords Cytochrome c'
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jt4A00
4WGYA 1YZAA 1YYXA 3HNIA 2QLAA 2XLWA 4D4XA 4JE9A 2CCYA 4IARA 4N4WA 1A7VA 2J8WA 5JP7A 5JVEA 2YL3A 4JEBA 2J9BA 4D4NA 2XLVA 3IQ5A 4CJOA 3ZQYA 3M79A 4ER9A 1GQAA 3C62A 4N6HA 3FOPA 3TOLA 3ZWIA 2YLDA 4CJGA 1EKYA 3ZTZA 1E85A 3C63A 4JKVA 4CDAA 4EIYA 1QQ3A 1MQVA 2XLEA 3L1MA 1CGOA 3ZQVA 5JRAA 3M4BA 4CDYA 5AGFA 4IAQA 3ZTMA 1CGNA 1S05A 256BA 2YLGA 4CIPA 3VRCA 3TOMA 1QPUA 2XLDA 1JAFA 4U9EA 5JS5A 2XLOA 1RCPA 3HNLA 1M6TA 3U8PA 3IQ6A 1CPQA 4CDVA 1CPRA 1LM3B 2XM0A 2YL0A 4U9DA 3FOOA 3NMJA 2XLMA 1YYJA 3DE8A 2XL8A 4ULVA 1E86A 2YLIA 5JSLA 3DE9A 2YL1A 3QW0A 2YL7A 4L6RA 2XLHA 3M4CA 1E83A 4CX9A 3HNJA 1E84A 1BBHA 2XM4A 4NC3A 3M15A 3HNKA 3NMKA 2BC5A 1NBBA 3QVYA 4JEAA 2YKZA 4WGZA 3QVZA 5B3IA 5JUAA 3QW1A 5JT4A 3NMIA 5JLIA 4IB4A 1YZCA 1APCA 2XL6A
chains in the Genus database with same CATH superfamily
2A69F 2CNWA 3T6BA 2D5RB 3A9CA 4JTDB 2ZPAA 2XS8A 2NSFA 2FFHA 4O6NA 2QLAA 4YL0A 4K0DA 4O6MA 4FESA 1VTMP 1ZU5A 3S27A 3SP1A 2EPOA 2WZGA 2NUPB 5CIVA 4PJNA 1MNEA 2M64A 4MVZA 4CS9A 2CCYA 4IARA 3L8JA 4UDVA 1Q0GA 1A7VA 4KNVA 3GODA 4BJ5A 4BEJA 1JPJA 1V74B 3ATPA 2LD6A 4G7ZF 1L7CA 2Q00A 4W8KA 2LCHA 1VK5A 4MVQA 3TJ5A 2V26A 1TWGA 3U3BA 3UGPA 4NY3A 4A4AA 4MTFA 4YJWA 4D4NA 2XLVA 3AG3C 3IHUA 4C3BA 2XXAB 3ZSUA 1SR2A 1HW1A 2R9RB 1LPEA 2CW0F 2KQ9A 2R02A 4BJ6A 4ER9A 4YT2A 2IYLD 2WVOA 3LJBA 1ZW3A 5COMA 3JCUQ 4BJTA 4O79A 4EKWA 1MMNA 4CS8A 3R2PA 3NRHA 2LSEA 3TJ6A 3JRMO 3ZWIA 2DI3A 2OJQA 2R7XA 4XLPF 1L3PA 2UUHA 3I5PA 3UMHA 4I3MA 2NPUA 2KYHA 4I44A 3T6GB 2Q7RA 5DQTA 2KK1A 4E0IA 3AG4C 1R5ID 3C63A 4XPXA 3KYJA 3RIPA 1WGWA 1FAPB 3L1MA 4AL0A 4A2NB 4JJGA 3HLZA 3T4RA 1LE2A 3ABKC 3ECSA 2VC9A 2ZXWC 5JRAA 3LLKA 3M4BA 3CEXA 3FAJA 4JIOA 1V4AA 4MVSA 1BR4A 1CGNA 3ZTMA 2XXAA 2F22A 2YLGA 2EIJC 4IJJA 5L0DA 1OQCA 2P7VA 3ASOC 4MTGA 4JTAB 1QSPA 1BZ4A 2GFHA 3TD7A 4PK4A 4XPWA 2VASA 3TOMA 4Z9HA 1I4ZA 1FMVA 2Q3TA 1LE4A 1NU9C 1ORSC 3GEIA 4U9EA 2OU6A 1Z3IX 2I15A 2OCCC 2OKUA 3X2QC 3ZDLA 2Y3HA 1RCPA 3ABLC 2PFDA 3HNLA 1GS9A 3RQEA 1M6TA 3TQOA 5KYYB 4BG0A 4EWCA 2H7VC 5DS5A 4LLEA 2QTVA 4IRUA 4JCHA 4E7ZA 1CPQA 4CDVA 3F46A 1NG1A 1VLSA 4BEMJ 2EPNA 5A6JA 1IZMA 3EGDA 3U3FA 4AL1A 1NZEA 2ZXRA 4GQHA 1NU7D 1YYJA 5GPGB 3PHF2 2W4BA 3NYJA 1OKKD 2HFIA 2YL1A 3QTHA 1A0BA 2W4MA 4CIHA 4YL3A 2UUIA 3LEVA 4PFOA 2HJ3A 3M4CA 3W8IA 4J7TA 1E83A 2HZ8A 4GYTA 1M2OA 4CX9A 4U5CE 3CAXA 3EH2A 3J06A 5AC4A 3LAYA 2XM4A 3RFYA 1SF8A 3H65A 4NC3A 4MW8A 1VYIA 1WN0A 3X1OA 1Z23A 3B0VC 3K7DA 3OA1A 3HNKA 2R7TA 1AUEA 2Q9CA 4DBRA 2CNWD 5DS6A 1FNTc 1ZHZA 3AG1C 3C8GB 3K6BA 4N06A 3VAYA 5JUAA 2EILC 3EFOB 3QW1A 5JT4A 4MVRA 4Z9IA 1ZVZA 4KI2A 4PACA 4JTCB 2VB6A 4G0HA 4KNWA 4JURI 1W2WA 3BEHA 4U5DE 3WAQA 1APCA 2LK4A 3Q7LA 2O9XA 2AVKA 2C04A 2XL6A 3OWTA 3NG1A 4HFKB 4RDAA 2X51A 1XZPA 1PD1A 2IXPA 2OEXA 2WVQA 3NYLA 3RQGA 3NKDA 4EBBA 1BR2A 5A6BD 5L0HA 4G7OF 5EGYA 2R7VA 2Y3DA 4WJ0A 1GGQA 5FZTA 2A68F 3HNIA 4PJLA 2AWYA 3GM2A 5L3QA 2YRFA 1RMVA 4YT8A 1D0YA 2VH3A 3CZ6A 5A6AA 1F1MA 1FFHA 1WASA 3UGOA 5A69A 3U2MA 1H6GA 1D1CA 2IOQA 5E3AA 1SMYF 4OIOF 2HUJA 3ZVRA 1D1AA 2JPUA 3V5ZA 3JRTA 1OR2A 2AP3A 2RD9A 2VCBA 1J8YF 1LVKA 4K1OA 3U8VA 1LS1A 3EPVA 2GWWA 2YL3A 1OW6A 2J45A 4JEBA 2HMQA 3MYIA 1Q0DA 2XSEA 5CI8A 3Q6NA 2E87A 4CJOA 3SYNA 3IQTA 1M2VB 2EPLX 3M79A 3BRJA 1IW7F 2J0XA 2J0WA 1I5NA 2YQYA 5BQHA 2R03A 1E2XA 1GQAA 3V5YA 1K04A 4EHPA 4O7GA 3UR3C 1ZYRF 2J7PA 4N6HA 2C03A 2A6EF 3FOPA 5L0FA 2HV6A 4E0HA 1NFOA 1EKYA 2PP4A 1M2VA 2R7QA 2LP4A 1U6HA 3Q7GA 4XEFA 5KYUA 4ZLDA 2KNHA 4JKVA 1ZHTA 4C7OA 1RKEA 4CDAA 3N24A 4EIYA 2JD3A 1QQ3A 1D0ZA 2QE9A 3O39A 4NCQA 2Z15A 3V7OA 5A6BA 3C7JA 1ZHWA 2M4EA 3H2UA 4CS7A 3WG7C 4C3EA 1BDJB 1O3UA 4MS2A 2R05A 4I1MA 4CDYA 4YWQA 4IAQA 5L0JA 5DVWA 3JTLO 3RF3A 256BA 4BPMA 4MQ9F 5HV9A 1RKEB 1QZXA 3AQCA 3WODF 3DM5A 3IPMO 4K7BA 1MMAA 3LESA 4IWBA 1ZU4A 1JRAA 2D4UA 1O87A 3GANA 3RKOF 1RKCA 1A7EA 3K66A 3DM9B 3EFOA 3MBGA 3B71A 1HMDA 1TFKB 4XPYA 2HKVA 3EJNA 3U2LA 4ULWA 2IM8A 5KYYA 3POVA 2EIMC 4FWVA 5B1BC 1FR0A 4NTBA 2L6HA 1HY5A 2I8BA 4C7OB 2AWCA 1H7IA 2DB4A 2YL0A 4U9DA 3NMJA 1OXBA 3FVYA 1WWPA 3E9VA 1JOGA 5F28E 2ASRA 1MNDA 3EGDB 1VOMA 5F5HA 3U9MA 1E86A 1K40A 1I4YA 4YT5A 5JSLA 3QW0A 4JW1A 2YL7A 4L6RA 4P6IC 4QI2A 4XTKA 3I5QA 5L0GA 1ZZPA 3B0UX 2EINC 1WATA 3L8IA 3GM3A 4YT4A 1VMAA 3R7CA 2JX0A 3K33A 1Q0FA 2GAQA 1Q0KA 4X0RA 3F47A 1YJGA 3NKEA 3SNHA 4MTOA 3KL4A 4DRJB 2IBFA 3M15A 1K05A 3KYIA 4U5FE 5COFA 4KBLA 3SXMA 2OJED 2EPKX 2KC3A 1UFBA 2MYSA 3NMKA 3FDQA 1YA9A 4H54A 1OCOC 1NBBA 1YA7O 1Z6AA 4PR9A 4PFPA 3L0IA 4JEAA 2YKZA 2G3VA 2L81A 2RSEB 2L6GA 3M1CB 4G78A 1S7ZA 1SYQA 4JCZA 4WGZA 1JR8A 1LI7A 1Y4CA 3C8GA 4Z9JA 5B3SC 3SXYA 4NTFA 5JLIA 4Q7CA 2YEVA 1HMOA 3CSKA 1BR1A 2X0CA 4U5GA 3TULA 1CGME 4EBKA 2OG2A 3EZIA 4WGYA 1B68A 5FCLA 1V55C 4LDKA 4Q5SF 3GEHA 5IY5C 4OD4A 3DZAA 1OCCC 4AE4B 1YZAA 1YYXA 1PV3A 2QY9A 3RYLA 3RH3A 5BUOA 2J9VA 1YDIA 2XLWA 4M63A 4D4XA 3EQLF 2LIGA 2PNOA 3MFNA 3AGTA 3MX3A 3LEOA 2ZD9A 1R4TA 2R7OA 3DAGA 3NYMA 1SZIA 2ETSA 3AQBA 4N4WA 1DOVA 4BJ6C 2H7OA 2PF4E 1YLMA 4PJMA 2EIKC 1QKRA 2WZFA 4IGGA 3RW0A 4AE4A 1RXQA 2G62A 5DQZA 2OEVA 2TMVP 3C8ZA 5L3VA 2OQMA 3LNRA 1T9KA 4R32A 5B1AC 4DVYP 1M56C 3LNMB 1Q0MA 4CS9C 4DOZA 1G4WR 3ASNC 2QNLA 4HEAJ 4H4KC 4ONSA 2CDQA 4J30B 1ZHXA 2Y3GA 4XLNF 3OEOA 4YK5A 4AX2A 2W45A 4EUKB 5KYWB 2YLDA 3EHNA 1TKNA 4LACB 3MYFA 3ZTZA 2OOCA 3PMRA 5KYUB 4JZAA 1KNYA 3GORA 4LDRA 4AK9A 1TWCA 1D0XA 2DYRC 2MHRA 1EA8A 1EI7A 1KU2A 4XEKA 1MQVA 2WVNA 2XLEA 3KPHA 2CYDA 4U5BE 4CBEA 4DJ9A 3DI5A 3AG2C 3DJUB 3DAFA 5KYNA 2MWQA 2IXNA 3TK0A 1J8MF 5L0IA 3W2VA 3E70C 5F5FA 1T5OA 1T6UA 1AEPA 2XL4A 1T6QA 1MMDA 3EG9B 2Y69C 4CIPA 3VRCA 4JRZA 2LFFA 1QPUA 2Y3BA 2W9YA 4KC9A 1FMWA 1C17M 1JAFA 1QLEC 1TWHA 2XLDA 3W4YA 3PDMP 4MVMA 5JS5A 3SEOA 3B9QA 3UNGC 4YN0B 2L6FA 2R7WA 4JVSA 3JSEO 5BQGA 2Q9AA 3EGXA 1EQ1A 3U8PA 3KMIA 3AGUA 5CI9A 3U9JA 3FHDA 3WHNA 1FFTC 5A6KA 1CPRA 1C03A 1LM3B 2XM0A 1WOLA 3AJMA 4NQFA 2DGJA 3FAPB 1ST6A 1ORYA 2XLMA 3US6A 5AC5A 1RJ9B 2XL8A 1U0BB 2ZXPA 5T1DB 2NUTA 2NG1A 2WL8A 4CSAC 3PCVA 4LERA 4NTAA 3VM6A 2XLHA 2LQGA 3RQFA 5COGA 1ZW2A 4U5HA 1O5HA 1TFOB 3C18A 2Y39A 1E84A 3ZG1A 1TR2A 2IXOA 5D91A 1BBHA 2IXMA 2KW3C 2WB7A 4G7HF 2FAPB 2YVKA 1ZHYA 4MNDA 3ABMC 4BJ5C 2ZXOA 2BC5A 4RD9A 4MVOA 4PJJA 1T01A 2B0HA 4E7SA 3QVZA 2YHSA 5B3IA 2J46A 3NDBB 1OCRC 2P1AA 3NMIA 1LKXA 2DYSC 2ICWG 3T9OA 1OKKA 3EZHA 2NUTB 1YZCA 1LI5A 1NFNA 2H7BA 2WZLA 1OW8A 3B29A 3ZC4A 3FXHA 4OINF 3S9OA 3S0XA 1XWJA 3GWNA 1OXKA 1YAUO 3N2ZB 4XEVA 3QZCA 3UMKA 3W8HA 3SXKA 2QUPA 4GEHA 4MW3A 4P9FA 1HE1A 3DXJF 1OCZC 4W8PA 5EK0A 4CS8C 5EHHA 4XWJA 1XZQA 1H9TA 2NUPA 1NLXA 1A41A 2PBEA 3CQZA 4JE9A 4XQ1A 2EPMX 4ANJA 1JPNA 1Z5ZA 1G5ZA 4HE8D 3IEEA 3RVYA 4JC7A 2BL2A 4FX5A 2J8WA 3EG9A 4P9TA 5TJ5E 1AVOB 2V3CC 2Q9BA 5JP7A 2YWAA 5JVEA 1PCXA 3JT1A 5T3WA 5KYXA 4IAOA 3EH1A 4HFFB 1QVXA 2J9BA 5E33A 1GM5A 4YL1A 2GDCA 2J9WA 3IQ5A 3ZQYA 5DS4A 1ORJA 3RVZA 3DKAA 3C62A 1TQGA 1KTMA 3G4XA 4DRHB 3IQCA 4LDQA 3MLGA 3S90A 1H9GA 3ITFA 5L0CA 3KH2A 1DOWA 1Y6DA 1WTYA 2P61A 2P6VA 3TOLA 4CJGA 4DVZA 3GWLA 5HSWA 5KYWA 4DXWA 1MMGA 4DRIB 2HV7A 4BJ1A 4Q4ZF 5D92A 2XS1A 2HS5A 2R7SA 1TWAA 4OD5A 4F4BA 1E85A 2J7PD 2VCCA 1LIHA 3U5SA 3W2WA 4OIQF 1V54C 2J9UA 1VYKA 1CGOA 2CGEA 2R7RA 3ZQVA 1VB5A 3DJNB 3LS0A 5E3CA 1UG7A 5AGFA 4C3DA 3DD7A 1S05A 2P0NA 5DLJA 3ZIBA 4FAPB 1OW7A 4MVUA 3SXZA 2YZSA 2HSQA 2A6HF 3KKBA 2XRHA 4J32B 4LLCA 1VLTA 2VCAA 3S29A 2Q4FA 1PD0A 4ZLCA 3AOUA 4DBQA 2KSFA 3VYWA 3O55A 1U89A 1NSGB 2XLOA 3SZRA 3T6JA 2LFDA 2PX3A 2R25A 3Q6MA 2NSGA 5T3TA 1G4US 3EHMA 4OIRF 3EGXB 3H2VA 1C02A 2G3KA 3IQ6A 4J7YA 3K1IA 4CSAA 1M57C 3S28A 1Z7Qc 3S84A 2AU5A 1OR3A 2PX0A 3C8GD 3DMDA 3FOOA 4N6CA 1JMWA 3VF0A 1HW2A 3DE8A 3JSZA 4QDLA 4ULVA 5E2QA 1N1CA 2KJGA 1RJ9A 2YLIA 3O10A 3GM1A 1T6IA 3DE9A 4B6IA 4OIPF 1FTSA 3K1HA 4U5EE 2HSBA 2KGOA 3G4ZA 3K1IC 4O6YA 1G8XA 2HJMA 3HTKC 1A7DA 3DWWA 3N0TA 1D1BA 3HNJA 3JZ0A 2A1DD 2B0JA 5KYXB 3HJCA 4E18A 3L34A 1HE9A 1Z63A 1YVIA 2R7UA 3I4UA 2H8AA 3JYYA 1LS4A 3A11A 3U0CA 4E17A 4WABA 2A0UA 2GA0A 3G50A 2BE5F 3V5XA 3FMSA 3LLIA 3QVYA 5K0IA 2L9JA 4EBJA 3B0PA 3JYHA 4QI0A 3O6XA 3UMIA 4JJFA 5BQIA 3GEEA 3HKKA 3LUTB 4RBNA 2A0BA 2HMZA 4IB4A 4I1OB 2L7AA 3QMKA 3LS1A 2FGYA 1YARO
chains in the Genus database with same CATH topology
4WGYA 1YZAA 1YYXA 3HNIA 2QLAA 2XLWA 4D4XA 4JE9A 2CCYA 4IARA 4N4WA 1A7VA 2J8WA 5JP7A 5JVEA 2YL3A 4JEBA 2J9BA 4D4NA 2XLVA 3IQ5A 4CJOA 3ZQYA 3M79A 4ER9A 1GQAA 3C62A 4N6HA 3FOPA 3TOLA 3ZWIA 2YLDA 4CJGA 1EKYA 3ZTZA 1E85A 3C63A 4JKVA 4CDAA 4EIYA 1QQ3A 1MQVA 2XLEA 3L1MA 1CGOA 3ZQVA 5JRAA 3M4BA 4CDYA 5AGFA 4IAQA 3ZTMA 1CGNA 1S05A 256BA 2YLGA 4CIPA 3VRCA 3TOMA 1QPUA 2XLDA 1JAFA 4U9EA 5JS5A 2XLOA 1RCPA 3HNLA 1M6TA 3U8PA 3IQ6A 1CPQA 4CDVA 1CPRA 1LM3B 2XM0A 2YL0A 4U9DA 3FOOA 3NMJA 2XLMA 1YYJA 3DE8A 2XL8A 4ULVA 1E86A 2YLIA 5JSLA 3DE9A 2YL1A 3QW0A 2YL7A 4L6RA 2XLHA 3M4CA 1E83A 4CX9A 3HNJA 1E84A 1BBHA 2XM4A 4NC3A 3M15A 3HNKA 3NMKA 2BC5A 1NBBA 3QVYA 4JEAA 2YKZA 4WGZA 3QVZA 5B3IA 5JUAA 3QW1A 5JT4A 3NMIA 5JLIA 4IB4A 1YZCA 1APCA 2XL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WGY A;  1YZA A;  1YYX A;  3HNI A;  2QLA A;  2XLW A;  4D4X A;  4JE9 A;  2CCY A;  4IAR A;  4N4W A;  1A7V A;  2J8W A;  5JP7 A;  5JVE A;  2YL3 A;  4JEB A;  2J9B A;  4D4N A;  2XLV A;  3IQ5 A;  4CJO A;  3ZQY A;  3M79 A;  4ER9 A;  1GQA A;  3C62 A;  4N6H A;  3FOP A;  3TOL A;  3ZWI A;  2YLD A;  4CJG A;  1EKY A;  3ZTZ A;  1E85 A;  3C63 A;  4JKV A;  4CDA A;  4EIY A;  1QQ3 A;  1MQV A;  2XLE A;  3L1M A;  1CGO A;  3ZQV A;  5JRA A;  3M4B A;  4CDY A;  5AGF A;  4IAQ A;  3ZTM A;  1CGN A;  1S05 A;  256B A;  2YLG A;  4CIP A;  3VRC A;  3TOM A;  1QPU A;  2XLD A;  1JAF A;  4U9E A;  5JS5 A;  2XLO A;  1RCP A;  3HNL A;  1M6T A;  3U8P A;  3IQ6 A;  1CPQ A;  4CDV A;  1CPR A;  1LM3 B;  2XM0 A;  2YL0 A;  4U9D A;  3FOO A;  3NMJ A;  2XLM A;  1YYJ A;  3DE8 A;  2XL8 A;  4ULV A;  1E86 A;  2YLI A;  5JSL A;  3DE9 A;  2YL1 A;  3QW0 A;  2YL7 A;  4L6R A;  2XLH A;  3M4C A;  1E83 A;  4CX9 A;  3HNJ A;  1E84 A;  1BBH A;  2XM4 A;  4NC3 A;  3M15 A;  3HNK A;  3NMK A;  2BC5 A;  1NBB A;  3QVY A;  4JEA A;  2YKZ A;  4WGZ A;  3QVZ A;  5B3I A;  5JUA A;  3QW1 A;  5JT4 A;  3NMI A;  5JLI A;  4IB4 A;  1YZC A;  1APC A;  2XL6 A; 
#chains in the Genus database with same CATH topology
 2A69 F;  2CNW A;  3T6B A;  2D5R B;  3A9C A;  4JTD B;  2ZPA A;  2XS8 A;  2NSF A;  2FFH A;  4O6N A;  2QLA A;  4YL0 A;  4K0D A;  4O6M A;  4FES A;  1VTM P;  1ZU5 A;  3S27 A;  3SP1 A;  2EPO A;  2WZG A;  2NUP B;  5CIV A;  4PJN A;  1MNE A;  2M64 A;  4MVZ A;  4CS9 A;  2CCY A;  4IAR A;  3L8J A;  4UDV A;  1Q0G A;  1A7V A;  4KNV A;  3GOD A;  4BJ5 A;  4BEJ A;  1JPJ A;  1V74 B;  3ATP A;  2LD6 A;  4G7Z F;  1L7C A;  2Q00 A;  4W8K A;  2LCH A;  1VK5 A;  4MVQ A;  3TJ5 A;  2V26 A;  1TWG A;  3U3B A;  3UGP A;  4NY3 A;  4A4A A;  4MTF A;  4YJW A;  4D4N A;  2XLV A;  3AG3 C;  3IHU A;  4C3B A;  2XXA B;  3ZSU A;  1SR2 A;  1HW1 A;  2R9R B;  1LPE A;  2CW0 F;  2KQ9 A;  2R02 A;  4BJ6 A;  4ER9 A;  4YT2 A;  2IYL D;  2WVO A;  3LJB A;  1ZW3 A;  5COM A;  3JCU Q;  4BJT A;  4O79 A;  4EKW A;  1MMN A;  4CS8 A;  3R2P A;  3NRH A;  2LSE A;  3TJ6 A;  3JRM O;  3ZWI A;  2DI3 A;  2OJQ A;  2R7X A;  4XLP F;  1L3P A;  2UUH A;  3I5P A;  3UMH A;  4I3M A;  2NPU A;  2KYH A;  4I44 A;  3T6G B;  2Q7R A;  5DQT A;  2KK1 A;  4E0I A;  3AG4 C;  1R5I D;  3C63 A;  4XPX A;  3KYJ A;  3RIP A;  1WGW A;  1FAP B;  3L1M A;  4AL0 A;  4A2N B;  4JJG A;  3HLZ A;  3T4R A;  1LE2 A;  3ABK C;  3ECS A;  2VC9 A;  2ZXW C;  5JRA A;  3LLK A;  3M4B A;  3CEX A;  3FAJ A;  4JIO A;  1V4A A;  4MVS A;  1BR4 A;  1CGN A;  3ZTM A;  2XXA A;  2F22 A;  2YLG A;  2EIJ C;  4IJJ A;  5L0D A;  1OQC A;  2P7V A;  3ASO C;  4MTG A;  4JTA B;  1QSP A;  1BZ4 A;  2GFH A;  3TD7 A;  4PK4 A;  4XPW A;  2VAS A;  3TOM A;  4Z9H A;  1I4Z A;  1FMV A;  2Q3T A;  1LE4 A;  1NU9 C;  1ORS C;  3GEI A;  4U9E A;  2OU6 A;  1Z3I X;  2I15 A;  2OCC C;  2OKU A;  3X2Q C;  3ZDL A;  2Y3H A;  1RCP A;  3ABL C;  2PFD A;  3HNL A;  1GS9 A;  3RQE A;  1M6T A;  3TQO A;  5KYY B;  4BG0 A;  4EWC A;  2H7V C;  5DS5 A;  4LLE A;  2QTV A;  4IRU A;  4JCH A;  4E7Z A;  1CPQ A;  4CDV A;  3F46 A;  1NG1 A;  1VLS A;  4BEM J;  2EPN A;  5A6J A;  1IZM A;  3EGD A;  3U3F A;  4AL1 A;  1NZE A;  2ZXR A;  4GQH A;  1NU7 D;  1YYJ A;  5GPG B;  3PHF 2;  2W4B A;  3NYJ A;  1OKK D;  2HFI A;  2YL1 A;  3QTH A;  1A0B A;  2W4M A;  4CIH A;  4YL3 A;  2UUI A;  3LEV A;  4PFO A;  2HJ3 A;  3M4C A;  3W8I A;  4J7T A;  1E83 A;  2HZ8 A;  4GYT A;  1M2O A;  4CX9 A;  4U5C E;  3CAX A;  3EH2 A;  3J06 A;  5AC4 A;  3LAY A;  2XM4 A;  3RFY A;  1SF8 A;  3H65 A;  4NC3 A;  4MW8 A;  1VYI A;  1WN0 A;  3X1O A;  1Z23 A;  3B0V C;  3K7D A;  3OA1 A;  3HNK A;  2R7T A;  1AUE A;  2Q9C A;  4DBR A;  2CNW D;  5DS6 A;  1FNT c;  1ZHZ A;  3AG1 C;  3C8G B;  3K6B A;  4N06 A;  3VAY A;  5JUA A;  2EIL C;  3EFO B;  3QW1 A;  5JT4 A;  4MVR A;  4Z9I A;  1ZVZ A;  4KI2 A;  4PAC A;  4JTC B;  2VB6 A;  4G0H A;  4KNW A;  4JUR I;  1W2W A;  3BEH A;  4U5D E;  3WAQ A;  1APC A;  2LK4 A;  3Q7L A;  2O9X A;  2AVK A;  2C04 A;  2XL6 A;  3OWT A;  3NG1 A;  4HFK B;  4RDA A;  2X51 A;  1XZP A;  1PD1 A;  2IXP A;  2OEX A;  2WVQ A;  3NYL A;  3RQG A;  3NKD A;  4EBB A;  1BR2 A;  5A6B D;  5L0H A;  4G7O F;  5EGY A;  2R7V A;  2Y3D A;  4WJ0 A;  1GGQ A;  5FZT A;  2A68 F;  3HNI A;  4PJL A;  2AWY A;  3GM2 A;  5L3Q A;  2YRF A;  1RMV A;  4YT8 A;  1D0Y A;  2VH3 A;  3CZ6 A;  5A6A A;  1F1M A;  1FFH A;  1WAS A;  3UGO A;  5A69 A;  3U2M A;  1H6G A;  1D1C A;  2IOQ A;  5E3A A;  1SMY F;  4OIO F;  2HUJ A;  3ZVR A;  1D1A A;  2JPU A;  3V5Z A;  3JRT A;  1OR2 A;  2AP3 A;  2RD9 A;  2VCB A;  1J8Y F;  1LVK A;  4K1O A;  3U8V A;  1LS1 A;  3EPV A;  2GWW A;  2YL3 A;  1OW6 A;  2J45 A;  4JEB A;  2HMQ A;  3MYI A;  1Q0D A;  2XSE A;  5CI8 A;  3Q6N A;  2E87 A;  4CJO A;  3SYN A;  3IQT A;  1M2V B;  2EPL X;  3M79 A;  3BRJ A;  1IW7 F;  2J0X A;  2J0W A;  1I5N A;  2YQY A;  5BQH A;  2R03 A;  1E2X A;  1GQA A;  3V5Y A;  1K04 A;  4EHP A;  4O7G A;  3UR3 C;  1ZYR F;  2J7P A;  4N6H A;  2C03 A;  2A6E F;  3FOP A;  5L0F A;  2HV6 A;  4E0H A;  1NFO A;  1EKY A;  2PP4 A;  1M2V A;  2R7Q A;  2LP4 A;  1U6H A;  3Q7G A;  4XEF A;  5KYU A;  4ZLD A;  2KNH A;  4JKV A;  1ZHT A;  4C7O A;  1RKE A;  4CDA A;  3N24 A;  4EIY A;  2JD3 A;  1QQ3 A;  1D0Z A;  2QE9 A;  3O39 A;  4NCQ A;  2Z15 A;  3V7O A;  5A6B A;  3C7J A;  1ZHW A;  2M4E A;  3H2U A;  4CS7 A;  3WG7 C;  4C3E A;  1BDJ B;  1O3U A;  4MS2 A;  2R05 A;  4I1M A;  4CDY A;  4YWQ A;  4IAQ A;  5L0J A;  5DVW A;  3JTL O;  3RF3 A;  256B A;  4BPM A;  4MQ9 F;  5HV9 A;  1RKE B;  1QZX A;  3AQC A;  3WOD F;  3DM5 A;  3IPM O;  4K7B A;  1MMA A;  3LES A;  4IWB A;  1ZU4 A;  1JRA A;  2D4U A;  1O87 A;  3GAN A;  3RKO F;  1RKC A;  1A7E A;  3K66 A;  3DM9 B;  3EFO A;  3MBG A;  3B71 A;  1HMD A;  1TFK B;  4XPY A;  2HKV A;  3EJN A;  3U2L A;  4ULW A;  2IM8 A;  5KYY A;  3POV A;  2EIM C;  4FWV A;  5B1B C;  1FR0 A;  4NTB A;  2L6H A;  1HY5 A;  2I8B A;  4C7O B;  2AWC A;  1H7I A;  2DB4 A;  2YL0 A;  4U9D A;  3NMJ A;  1OXB A;  3FVY A;  1WWP A;  3E9V A;  1JOG A;  5F28 E;  2ASR A;  1MND A;  3EGD B;  1VOM A;  5F5H A;  3U9M A;  1E86 A;  1K40 A;  1I4Y A;  4YT5 A;  5JSL A;  3QW0 A;  4JW1 A;  2YL7 A;  4L6R A;  4P6I C;  4QI2 A;  4XTK A;  3I5Q A;  5L0G A;  1ZZP A;  3B0U X;  2EIN C;  1WAT A;  3L8I A;  3GM3 A;  4YT4 A;  1VMA A;  3R7C A;  2JX0 A;  3K33 A;  1Q0F A;  2GAQ A;  1Q0K A;  4X0R A;  3F47 A;  1YJG A;  3NKE A;  3SNH A;  4MTO A;  3KL4 A;  4DRJ B;  2IBF A;  3M15 A;  1K05 A;  3KYI A;  4U5F E;  5COF A;  4KBL A;  3SXM A;  2OJE D;  2EPK X;  2KC3 A;  1UFB A;  2MYS A;  3NMK A;  3FDQ A;  1YA9 A;  4H54 A;  1OCO C;  1NBB A;  1YA7 O;  1Z6A A;  4PR9 A;  4PFP A;  3L0I A;  4JEA A;  2YKZ A;  2G3V A;  2L81 A;  2RSE B;  2L6G A;  3M1C B;  4G78 A;  1S7Z A;  1SYQ A;  4JCZ A;  4WGZ A;  1JR8 A;  1LI7 A;  1Y4C A;  3C8G A;  4Z9J A;  5B3S C;  3SXY A;  4NTF A;  5JLI A;  4Q7C A;  2YEV A;  1HMO A;  3CSK A;  1BR1 A;  2X0C A;  4U5G A;  3TUL A;  1CGM E;  4EBK A;  2OG2 A;  3EZI A;  4WGY A;  1B68 A;  5FCL A;  1V55 C;  4LDK A;  4Q5S F;  3GEH A;  5IY5 C;  4OD4 A;  3DZA A;  1OCC C;  4AE4 B;  1YZA A;  1YYX A;  1PV3 A;  2QY9 A;  3RYL A;  3RH3 A;  5BUO A;  2J9V A;  1YDI A;  2XLW A;  4M63 A;  4D4X A;  3EQL F;  2LIG A;  2PNO A;  3MFN A;  3AGT A;  3MX3 A;  3LEO A;  2ZD9 A;  1R4T A;  2R7O A;  3DAG A;  3NYM A;  1SZI A;  2ETS A;  3AQB A;  4N4W A;  1DOV A;  4BJ6 C;  2H7O A;  2PF4 E;  1YLM A;  4PJM A;  2EIK C;  1QKR A;  2WZF A;  4IGG A;  3RW0 A;  4AE4 A;  1RXQ A;  2G62 A;  5DQZ A;  2OEV A;  2TMV P;  3C8Z A;  5L3V A;  2OQM A;  3LNR A;  1T9K A;  4R32 A;  5B1A C;  4DVY P;  1M56 C;  3LNM B;  1Q0M A;  4CS9 C;  4DOZ A;  1G4W R;  3ASN C;  2QNL A;  4HEA J;  4H4K C;  4ONS A;  2CDQ A;  4J30 B;  1ZHX A;  2Y3G A;  4XLN F;  3OEO A;  4YK5 A;  4AX2 A;  2W45 A;  4EUK B;  5KYW B;  2YLD A;  3EHN A;  1TKN A;  4LAC B;  3MYF A;  3ZTZ A;  2OOC A;  3PMR A;  5KYU B;  4JZA A;  1KNY A;  3GOR A;  4LDR A;  4AK9 A;  1TWC A;  1D0X A;  2DYR C;  2MHR A;  1EA8 A;  1EI7 A;  1KU2 A;  4XEK A;  1MQV A;  2WVN A;  2XLE A;  3KPH A;  2CYD A;  4U5B E;  4CBE A;  4DJ9 A;  3DI5 A;  3AG2 C;  3DJU B;  3DAF A;  5KYN A;  2MWQ A;  2IXN A;  3TK0 A;  1J8M F;  5L0I A;  3W2V A;  3E70 C;  5F5F A;  1T5O A;  1T6U A;  1AEP A;  2XL4 A;  1T6Q A;  1MMD A;  3EG9 B;  2Y69 C;  4CIP A;  3VRC A;  4JRZ A;  2LFF A;  1QPU A;  2Y3B A;  2W9Y A;  4KC9 A;  1FMW A;  1C17 M;  1JAF A;  1QLE C;  1TWH A;  2XLD A;  3W4Y A;  3PDM P;  4MVM A;  5JS5 A;  3SEO A;  3B9Q A;  3UNG C;  4YN0 B;  2L6F A;  2R7W A;  4JVS A;  3JSE O;  5BQG A;  2Q9A A;  3EGX A;  1EQ1 A;  3U8P A;  3KMI A;  3AGU A;  5CI9 A;  3U9J A;  3FHD A;  3WHN A;  1FFT C;  5A6K A;  1CPR A;  1C03 A;  1LM3 B;  2XM0 A;  1WOL A;  3AJM A;  4NQF A;  2DGJ A;  3FAP B;  1ST6 A;  1ORY A;  2XLM A;  3US6 A;  5AC5 A;  1RJ9 B;  2XL8 A;  1U0B B;  2ZXP A;  5T1D B;  2NUT A;  2NG1 A;  2WL8 A;  4CSA C;  3PCV A;  4LER A;  4NTA A;  3VM6 A;  2XLH A;  2LQG A;  3RQF A;  5COG A;  1ZW2 A;  4U5H A;  1O5H A;  1TFO B;  3C18 A;  2Y39 A;  1E84 A;  3ZG1 A;  1TR2 A;  2IXO A;  5D91 A;  1BBH A;  2IXM A;  2KW3 C;  2WB7 A;  4G7H F;  2FAP B;  2YVK A;  1ZHY A;  4MND A;  3ABM C;  4BJ5 C;  2ZXO A;  2BC5 A;  4RD9 A;  4MVO A;  4PJJ A;  1T01 A;  2B0H A;  4E7S A;  3QVZ A;  2YHS A;  5B3I A;  2J46 A;  3NDB B;  1OCR C;  2P1A A;  3NMI A;  1LKX A;  2DYS C;  2ICW G;  3T9O A;  1OKK A;  3EZH A;  2NUT B;  1YZC A;  1LI5 A;  1NFN A;  2H7B A;  2WZL A;  1OW8 A;  3B29 A;  3ZC4 A;  3FXH A;  4OIN F;  3S9O A;  3S0X A;  1XWJ A;  3GWN A;  1OXK A;  1YAU O;  3N2Z B;  4XEV A;  3QZC A;  3UMK A;  3W8H A;  3SXK A;  2QUP A;  4GEH A;  4MW3 A;  4P9F A;  1HE1 A;  3DXJ F;  1OCZ C;  4W8P A;  5EK0 A;  4CS8 C;  5EHH A;  4XWJ A;  1XZQ A;  1H9T A;  2NUP A;  1NLX A;  1A41 A;  2PBE A;  3CQZ A;  4JE9 A;  4XQ1 A;  2EPM X;  4ANJ A;  1JPN A;  1Z5Z A;  1G5Z A;  4HE8 D;  3IEE A;  3RVY A;  4JC7 A;  2BL2 A;  4FX5 A;  2J8W A;  3EG9 A;  4P9T A;  5TJ5 E;  1AVO B;  2V3C C;  2Q9B A;  5JP7 A;  2YWA A;  5JVE A;  1PCX A;  3JT1 A;  5T3W A;  5KYX A;  4IAO A;  3EH1 A;  4HFF B;  1QVX A;  2J9B A;  5E33 A;  1GM5 A;  4YL1 A;  2GDC A;  2J9W A;  3IQ5 A;  3ZQY A;  5DS4 A;  1ORJ A;  3RVZ A;  3DKA A;  3C62 A;  1TQG A;  1KTM A;  3G4X A;  4DRH B;  3IQC A;  4LDQ A;  3MLG A;  3S90 A;  1H9G A;  3ITF A;  5L0C A;  3KH2 A;  1DOW A;  1Y6D A;  1WTY A;  2P61 A;  2P6V A;  3TOL A;  4CJG A;  4DVZ A;  3GWL A;  5HSW A;  5KYW A;  4DXW A;  1MMG A;  4DRI B;  2HV7 A;  4BJ1 A;  4Q4Z F;  5D92 A;  2XS1 A;  2HS5 A;  2R7S A;  1TWA A;  4OD5 A;  4F4B A;  1E85 A;  2J7P D;  2VCC A;  1LIH A;  3U5S A;  3W2W A;  4OIQ F;  1V54 C;  2J9U A;  1VYK A;  1CGO A;  2CGE A;  2R7R A;  3ZQV A;  1VB5 A;  3DJN B;  3LS0 A;  5E3C A;  1UG7 A;  5AGF A;  4C3D A;  3DD7 A;  1S05 A;  2P0N A;  5DLJ A;  3ZIB A;  4FAP B;  1OW7 A;  4MVU A;  3SXZ A;  2YZS A;  2HSQ A;  2A6H F;  3KKB A;  2XRH A;  4J32 B;  4LLC A;  1VLT A;  2VCA A;  3S29 A;  2Q4F A;  1PD0 A;  4ZLC A;  3AOU A;  4DBQ A;  2KSF A;  3VYW A;  3O55 A;  1U89 A;  1NSG B;  2XLO A;  3SZR A;  3T6J A;  2LFD A;  2PX3 A;  2R25 A;  3Q6M A;  2NSG A;  5T3T A;  1G4U S;  3EHM A;  4OIR F;  3EGX B;  3H2V A;  1C02 A;  2G3K A;  3IQ6 A;  4J7Y A;  3K1I A;  4CSA A;  1M57 C;  3S28 A;  1Z7Q c;  3S84 A;  2AU5 A;  1OR3 A;  2PX0 A;  3C8G D;  3DMD A;  3FOO A;  4N6C A;  1JMW A;  3VF0 A;  1HW2 A;  3DE8 A;  3JSZ A;  4QDL A;  4ULV A;  5E2Q A;  1N1C A;  2KJG A;  1RJ9 A;  2YLI A;  3O10 A;  3GM1 A;  1T6I A;  3DE9 A;  4B6I A;  4OIP F;  1FTS A;  3K1H A;  4U5E E;  2HSB A;  2KGO A;  3G4Z A;  3K1I C;  4O6Y A;  1G8X A;  2HJM A;  3HTK C;  1A7D A;  3DWW A;  3N0T A;  1D1B A;  3HNJ A;  3JZ0 A;  2A1D D;  2B0J A;  5KYX B;  3HJC A;  4E18 A;  3L34 A;  1HE9 A;  1Z63 A;  1YVI A;  2R7U A;  3I4U A;  2H8A A;  3JYY A;  1LS4 A;  3A11 A;  3U0C A;  4E17 A;  4WAB A;  2A0U A;  2GA0 A;  3G50 A;  2BE5 F;  3V5X A;  3FMS A;  3LLI A;  3QVY A;  5K0I A;  2L9J A;  4EBJ A;  3B0P A;  3JYH A;  4QI0 A;  3O6X A;  3UMI A;  4JJF A;  5BQI A;  3GEE A;  3HKK A;  3LUT B;  4RBN A;  2A0B A;  2HMZ A;  4IB4 A;  4I1O B;  2L7A A;  3QMK A;  3LS1 A;  2FGY A;  1YAR O; 
#chains in the Genus database with same CATH homology
 4WGY A;  1YZA A;  1YYX A;  3HNI A;  2QLA A;  2XLW A;  4D4X A;  4JE9 A;  2CCY A;  4IAR A;  4N4W A;  1A7V A;  2J8W A;  5JP7 A;  5JVE A;  2YL3 A;  4JEB A;  2J9B A;  4D4N A;  2XLV A;  3IQ5 A;  4CJO A;  3ZQY A;  3M79 A;  4ER9 A;  1GQA A;  3C62 A;  4N6H A;  3FOP A;  3TOL A;  3ZWI A;  2YLD A;  4CJG A;  1EKY A;  3ZTZ A;  1E85 A;  3C63 A;  4JKV A;  4CDA A;  4EIY A;  1QQ3 A;  1MQV A;  2XLE A;  3L1M A;  1CGO A;  3ZQV A;  5JRA A;  3M4B A;  4CDY A;  5AGF A;  4IAQ A;  3ZTM A;  1CGN A;  1S05 A;  256B A;  2YLG A;  4CIP A;  3VRC A;  3TOM A;  1QPU A;  2XLD A;  1JAF A;  4U9E A;  5JS5 A;  2XLO A;  1RCP A;  3HNL A;  1M6T A;  3U8P A;  3IQ6 A;  1CPQ A;  4CDV A;  1CPR A;  1LM3 B;  2XM0 A;  2YL0 A;  4U9D A;  3FOO A;  3NMJ A;  2XLM A;  1YYJ A;  3DE8 A;  2XL8 A;  4ULV A;  1E86 A;  2YLI A;  5JSL A;  3DE9 A;  2YL1 A;  3QW0 A;  2YL7 A;  4L6R A;  2XLH A;  3M4C A;  1E83 A;  4CX9 A;  3HNJ A;  1E84 A;  1BBH A;  2XM4 A;  4NC3 A;  3M15 A;  3HNK A;  3NMK A;  2BC5 A;  1NBB A;  3QVY A;  4JEA A;  2YKZ A;  4WGZ A;  3QVZ A;  5B3I A;  5JUA A;  3QW1 A;  5JT4 A;  3NMI A;  5JLI A;  4IB4 A;  1YZC A;  1APC A;  2XL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...