5JT4A

L16a mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans
molecule tags Electron transport
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jt4A00
1QQ3A 2YL3A 5JRAA 5B3IA 4IB4A 4WGYA 3C62A 4U9EA 5JT4A 1S05A 4IARA 5AGFA 3ZTZA 4CDYA 1CPQA 1APCA 1RCPA 4CIPA 4WGZA 3IQ6A 3VRCA 2XLHA 3TOMA 2XLVA 2YLDA 3DE9A 3ZTMA 3ZWIA 3M4BA 1BBHA 3TOLA 4CDAA 1LM3B 3FOPA 2XL6A 2YL1A 5JVEA 3QW1A 5JLIA 3NMKA 4D4XA 1MQVA 1A7VA 4EIYA 256BA 1YZAA 3HNIA 2XLDA 2XLMA 3QVZA 4NC3A 4CX9A 3QVYA 2BC5A 4ER9A 1GQAA 1CPRA 1CGOA 5JP7A 4CJGA 4JKVA 1YYXA 3ZQYA 1E83A 1CGNA 4U9DA 3NMIA 1YZCA 1M6TA 5JS5A 1EKYA 3ZQVA 5JSLA 4JEAA 3M15A 3IQ5A 2YLGA 2XLEA 4N6HA 3M79A 4CJOA 3M4CA 4JE9A 4D4NA 5JUAA 1JAFA 2XLOA 3C63A 4L6RA 2XL8A 2YLIA 4ULVA 1YYJA 2YKZA 3QW0A 2J9BA 1QPUA 2XLWA 3NMJA 2YL0A 3L1MA 1E86A 4N4WA 3FOOA 3HNJA 4JEBA 3HNKA 1NBBA 3HNLA 1E84A 4CDVA 4IAQA 2YL7A 2QLAA 2XM0A 2XM4A 2J8WA 1E85A 3DE8A 3U8PA 2CCYA
chains in the Genus database with same CATH superfamily
1HMOA 1EQ1A 4H54A 3VM6A 4J32B 4C7OB 2J9UA 2YL3A 2VH3A 4DRHB 2TMVP 1FR0A 3OWTA 4RDAA 4YJWA 3FMSA 4O79A 4XEFA 2B0HA 4FAPB 4YL1A 1VTMP 1C17M 3C62A 4CIHA 3EHNA 1D0XA 4JTAB 5BQHA 1PV3A 3U9MA 1S7ZA 2OEXA 2WL8A 3CZ6A 2R7UA 3DD7A 5BQGA 1SYQA 3ZTZA 4NY3A 4CDYA 2EPKX 5A6AA 2A1DD 2EIKC 1CPQA 1APCA 4C3EA 3MYIA 1YDIA 3B0PA 1G4WR 1ORSC 1ZYRF 4CIPA 1NG1A 1VOMA 3ASOC 4PJMA 1TKNA 4HE8D 3TOMA 3EH2A 4IAOA 1QSPA 3ABKC 3LJBA 3DM5A 1T9KA 4N06A 5F28E 5DQTA 3CEXA 3DI5A 1LI5A 1VK5A 2KGOA 2KYHA 3DE9A 3O39A 1EI7A 3C7JA 4WJ0A 1G8XA 3AG4C 3ITFA 4U5HA 3EGXB 2YQYA 5DQZA 2KNHA 3TOLA 4RBNA 2P1AA 3C8GB 1LM3B 4JTDB 1LVKA 1ZU4A 3BRJA 3GM3A 2LFDA 3NG1A 2YL1A 3ZIBA 4ULWA 1JOGA 1U0BB 5JLIA 4AL1A 3NMKA 3DKAA 4I44A 3MYFA 4EKWA 5KYNA 3RH3A 3EH1A 256BA 3GEHA 4BJ1A 4EIYA 4BJ6C 1Q0FA 2P61A 1VLTA 2OU6A 3QVZA 2MWQA 4CX9A 5KYYB 2YRFA 3FAJA 5AC4A 2Y3GA 4ER9A 1A41A 1GQAA 1B68A 4JJGA 4M63A 4MQ9F 1A0BA 3IHUA 5KYXB 3LS1A 1M56C 2D5RB 4Z9IA 3LNRA 4JIOA 3TJ5A 3SXKA 2G3KA 3L34A 2ASRA 1YYXA 2IXOA 3WG7C 4BJTA 1VMAA 1CGNA 4U9DA 2NSGA 3NMIA 3DAGA 3NRHA 3S9OA 1HW1A 1W2WA 1A7EA 3S90A 1JMWA 4K0DA 4BJ6A 2F22A 4J7TA 1EKYA 3ZQVA 2UUHA 2LQGA 2HJMA 4YL3A 3IPMO 3SNHA 1FNTc 1UFBA 5KYUA 4QI0A 4YT4A 1D0ZA 4E7SA 1LS1A 3HJCA 3C18A 4OD4A 5B1AC 1YA7O 1WASA 3H2VA 1KTMA 4KNWA 2ZXRA 4AX2A 4AK9A 2A69F 2G3VA 5JUAA 1U89A 4U5DE 1HY5A 4IJJA 5L0DA 3EHMA 1QZXA 3DJUB 2HMQA 2IM8A 2YLIA 3T6GB 2R7TA 4DVZA 1YYJA 1LPEA 3GM2A 2CNWD 3TJ6A 3T4RA 2ZXOA 2YEVA 4G7OF 2GA0A 3SP1A 2PBEA 3T6JA 1OW8A 1E86A 1GS9A 2VB6A 1MNDA 2KJGA 2OQMA 1T6IA 3JZ0A 3HNLA 2R7VA 1OQCA 3KH2A 2Q00A 4YT5A 1D0YA 4MTGA 3TK0A 2BL2A 2W4BA 5L0FA 2O9XA 1RJ9A 1WOLA 2Y3HA 4YL0A 1ZU5A 2EIJC 4MVMA 4K1OA 4G0HA 4GQHA 2Y39A 5E3CA 3H2UA 1H7IA 2J8WA 5EGYA 1BZ4A 2I8BA 2NG1A 2XS1A 1GGQA 1XWJA 2XS8A 3ABLC 2JD3A 3U5SA 4CSAC 3FAPB 3U8PA 3S29A 3QMKA 1VB5A 2XL4A 4XPYA 2CCYA 1RJ9B 2Z15A 1WN0A 3E9VA 4JVSA 4DRIB 2XRHA 4EBKA 1A7DA 2OJED 1NFOA 3UMIA 3C8GD 2I15A 5L3QA 3N0TA 5FZTA 3W8HA 1YVIA 5B3IA 4Z9JA 4Z9HA 3RVYA 1N1CA 4WGYA 3SXZA 2LIGA 2VCBA 2AU5A 3CQZA 3O10A 4E18A 1FFTC 2LSEA 2Q9BA 4CS7A 1AUEA 3ZDLA 1SMYF 1OXBA 3UGOA 2ZXWC 5BUOA 4I1MA 5AGFA 4JTCB 1ZW2A 5A6JA 2OEVA 4CSAA 3RVZA 5BQIA 4O6NA 1IW7F 4WGZA 4B6IA 2LCHA 1QKRA 5KYWA 2AWYA 2FGYA 1PD1A 2EIMC 2XLVA 4YT8A 3SXYA 2H7BA 4GEHA 3J06A 2YLDA 3LS0A 1ZZPA 1NU7D 1TWHA 2DGJA 3RF3A 4QI2A 1NZEA 3JSEO 3A9CA 5COMA 4E17A 3M1CB 3K33A 1GM5A 4MVQA 1TWAA 3RQFA 3F47A 1IZMA 2J7PA 1LE2A 3FOPA 4F4BA 3U8VA 4PFOA 3N2ZB 2BE5F 2B0JA 3ASNC 1TR2A 3CSKA 1RMVA 2PP4A 4DXWA 4DRJB 1T5OA 2WVNA 2NUTA 1MQVA 4D4XA 1A7VA 4PJLA 1D1CA 3G50A 1O3UA 1ZVZA 2HFIA 1L3PA 3HNIA 2NSFA 1ORJA 2ZPAA 2XLMA 3LNMB 4OIQF 5DVWA 3OEOA 1OCCC 1TWGA 2BC5A 3I4UA 4K7BA 3EQLF 4X0RA 1G4US 2R9RB 3KPHA 1CPRA 1RKCA 1V4AA 1J8YF 3KYIA 4O6YA 3B0UX 3HLZA 4G7ZF 4XWJA 3ZQYA 2HMZA 1OW6A 1AVOB 1T01A 3LESA 3RYLA 1Q0DA 2FAPB 1M6TA 1Y6DA 2PX0A 1MMDA 2WB7A 3N24A 1WTYA 2DYRC 1KU2A 3NYJA 2CDQA 5JSLA 3L0IA 2M64A 1MNEA 3EGDA 3ATPA 2KC3A 3LLIA 2PF4E 3FDQA 3AG1C 2L6FA 2XLEA 4G78A 2OG2A 4XLNF 2X51A 3RIPA 1Y4CA 5E3AA 1R5ID 2A68F 2MHRA 3M4CA 4P9TA 3NKEA 3WAQA 4A4AA 4D4NA 4YWQA 3UMKA 1BR1A 1LI7A 1M2OA 2ICWG 1QVXA 3RFYA 3CAXA 2OKUA 3KL4A 3X1OA 3PCVA 4FESA 1OCRC 5AC5A 4U5GA 4U5BE 4DBQA 5T3WA 2OOCA 3LUTB 1AEPA 3AGUA 3DXJF 1YJGA 2QY9A 4H4KC 4HEAJ 1F1MA 1JRAA 1QPUA 2XLWA 3JTLO 3MLGA 4O6MA 3L1MA 4YT2A 3PDMP 1XZPA 4JEBA 2DYSC 1Z6AA 3HNKA 4R32A 1FFHA 2HV6A 1HE9A 3SZRA 4BG0A 3LLKA 2J46A 4MVUA 1ZW3A 4U5FE 5A6BD 1TFKB 4CDVA 1MMGA 4ZLCA 1ZHXA 2CYDA 2YVKA 3MFNA 1PCXA 3W8IA 2XM0A 1ORYA 3BEHA 4FX5A 2Q3TA 4A2NB 4AL0A 4WABA 3IEEA 4BJ5C 2RD9A 3MX3A 2IXPA 1LKXA 5DS5A 2HSBA 2VCCA 2CW0F 2ZXPA 1I4ZA 4LDKA 5KYUB 1SF8A 3U2MA 3JCUQ 5L0HA 3L8JA 2EPLX 4U5CE 3GEIA 3UMHA 1M57C 1L7CA 3W2WA 2R02A 1ZHWA 4OINF 4Q4ZF 2HKVA 4XEVA 5COFA 3ZSUA 2AWCA 3JT1A 2H7OA 2EPMX 1Z3IX 4MVZA 4C3BA 1JPJA 1YARO 1JR8A 1OKKA 1LS4A 3DZAA 5JT4A 1D1BA 1S05A 2LFFA 4BJ5A 1T6UA 3NYLA 3HTKC 2EINC 4GYTA 1PD0A 4BEMJ 3V5ZA 3ZVRA 3B29A 4UDVA 2IXNA 5CI9A 2HS5A 2XLHA 3AGTA 2EPOA 4W8PA 1YAUO 2WVOA 3U2LA 4W8KA 1FMVA 3UGPA 3QZCA 4C3DA 3Q7LA 4EWCA 1D1AA 2A0UA 3B0VC 3ZWIA 2R7WA 4AE4A 3M4BA 3TD7A 1BBHA 4IRUA 1BDJB 2PX3A 4EBBA 1YLMA 3G4XA 4JURI 4G7HF 3GANA 2CGEA 2DI3A 4CDAA 3O55A 3T9OA 1R4TA 3K1HA 2WZLA 3GORA 3LAYA 4DVYP 1EA8A 3MBGA 4ONSA 4PFPA 3S27A 5A69A 5JVEA 1J8MF 3EJNA 1NFNA 4P6IC 2KQ9A 1OXKA 5EK0A 5F5FA 2PNOA 2NUPA 3A11A 3W2VA 1H9GA 5CIVA 4LDQA 2YHSA 4MVOA 4XPXA 3S0XA 4PK4A 1CGOA 2QE9A 3OA1A 2HUJA 1ZHZA 3NDBB 2NUPB 3US6A 2XXAA 1QLEC 4HFFB 3V5XA 4Q7CA 3VYWA 2P7VA 4JKVA 1V74B 5L0CA 2ZD9A 3DJNB 2W9YA 4DJ9A 2X0CA 2JX0A 3RKOF 5D92A 3SYNA 2HSQA 4RD9A 1RKEA 3Q6NA 3DMDA 3R2PA 2XXAB 3IQCA 4JEAA 3M15A 1I4YA 3ZG1A 3IQ5A 1HW2A 5DS6A 2YLGA 3K1IC 2FFHA 2HZ8A 1G5ZA 2PFDA 3FXHA 4CS9C 2R05A 5EHHA 3ECSA 2G62A 4JE9A 2CNWA 4XQ1A 2OCCC 5GPGB 2XLOA 3PMRA 1RKEB 3C63A 4KNVA 4L6RA 4PJNA 1H6GA 1Q0GA 1Z63A 2NPUA 2XL8A 3DWWA 1K05A 5IY5C 5A6KA 2NUTB 3VAYA 4XPWA 4MTOA 3U9JA 3EG9A 3AOUA 3QW0A 2R7QA 2J9BA 1OW7A 2A6HF 4NQFA 2R7OA 5DS4A 5D91A 5L0GA 1T6QA 3K1IA 2ETSA 3K6BA 4MS2A 2YL0A 1KNYA 4E0IA 4E7ZA 3POVA 2D4UA 3FOOA 3HNJA 4CS9A 1ZHYA 1CGME 2M4EA 1SZIA 1NBBA 1ST6A 2HV7A 2Y3DA 2V3CC 3JSZA 1FAPB 1NSGB 3LEVA 3EG9B 1LE4A 4LERA 1Z23A 3Q6MA 4JJFA 2C04A 1E84A 4IAQA 2R7SA 2YL7A 4LLCA 3EZHA 5CI8A 5B1BC 2L9JA 1Z5ZA 2QTVA 1OKKD 3EGXA 3K66A 3C8GA 2L6GA 2JPUA 3T6BA 1E85A 3DE8A 3UR3C 4JC7A 1DOVA 1O5HA 2J0XA 5L0IA 3EGDB 3W4YA 3JRMO 1BR4A 3EFOA 4N6CA 3LEOA 1LIHA 4KC9A 5T3TA 3UNGC 5L0JA 1QQ3A 5TJ5E 2KK1A 1E2XA 1WGWA 2L6HA 2Q9AA 5JRAA 2KSFA 4ZLDA 1NU9C 4LACB 4IB4A 5KYYA 4XTKA 1OR3A 3TULA 4U9EA 2GWWA 2V26A 3ZC4A 3EFOB 3B9QA 4NTBA 4IARA 5KYXA 4BEJA 1C03A 3PHF2 1M2VA 5E2QA 3TQOA 3F46A 3GEEA 3FVYA 2J9WA 1RCPA 2MYSA 1H9TA 5E33A 4CS8C 4IWBA 2Q7RA 3IQ6A 5L3VA 3VRCA 3S84A 4BPMA 1TQGA 2H8AA 4MTFA 5T1DB 2R7RA 2QUPA 1WATA 5DLJA 3KKBA 2LK4A 3DM9B 1M2VB 4JCHA 4PR9A 2VCAA 2J45A 5HSWA 3ZTMA 4LLEA 3GM1A 4NTFA 3JYHA 3H65A 1TFOB 1C02A 3KYJA 2J0WA 4JZAA 1DOWA 1SR2A 2H7VC 3AJMA 3V7OA 2KW3C 2XSEA 3GWLA 3AG2C 3O6XA 2HJ3A 3KMIA 3AQBA 4J30B 4YK5A 4JCZA 2WZFA 4CS8A 2XL6A 2L7AA 2YZSA 3QW1A 4NCQA 4XEKA 2A6EF 2EPNA 2VC9A 4DOZA 1K04A 3FHDA 2J7PD 5FCLA 1YZAA 3HKKA 2XLDA 2J9VA 4NC3A 3QTHA 1VYKA 4OIRF 3G4ZA 3QVYA 2GFHA 3B71A 3EPVA 4QDLA 4MW8A 3K7DA 5HV9A 5JP7A 4KI2A 1VYIA 1TWCA 1VLSA 4CJGA 1U6HA 4YN0B 1V54C 2Y69C 3RQEA 1ZHTA 1Z7Qc 1E83A 3U3BA 3RW0A 1NLXA 4U5EE 3NYMA 1YZCA 4MVRA 4Q5SF 2Y3BA 3I5QA 2AP3A 1I5NA 3Q7GA 4J7YA 3U0CA 2WVQA 3ABMC 4JRZA 3SXMA 2C03A 4IGGA 4PJJA 2GDCA 5JS5A 3EZIA 2AVKA 4PACA 2R7XA 2P6VA 1K40A 4E0HA 4MVSA 4P9FA 2QNLA 3AG3C 3R7CA 4AE4B 3U3FA 2IYLD 1XZQA 2DB4A 2GAQA 2P0NA 2Q4FA 3IQTA 2Q9CA 3DAFA 4N6HA 1BR2A 3JYYA 4NTAA 3V5YA 1UG7A 3M79A 4I1OB 4LDRA 5COGA 4CJOA 2W4MA 4XLPF 3GWNA 2VASA 1JAFA 2R25A 2IOQA 1RXQA 1WWPA 4ANJA 2A0BA 4MNDA 2YWAA 2EILC 5KYWB 4DBRA 1OCOC 3AQCA 3S28A 4ULVA 3JRTA 4EBJA 4OIOF 2YKZA 4OIPF 2OJQA 3C8ZA 1YA9A 1MMAA 3RQGA 5A6BA 2WZGA 1Q0MA 4HFKB 2LD6A 5F5HA 3NMJA 2RSEB 1FTSA 1HMDA 1MMNA 5K0IA 4N4WA 1HE1A 2E87A 4MW3A 1OCZC 2UUIA 4O7GA 1V55C 3X2QC 2IBFA 3VF0A 3L8IA 4OD5A 3SEOA 5B3SC 3NKDA 3WHNA 1Q0KA 4CBEA 2IXMA 2QLAA 4C7OA 1OR2A 2XM4A 3GODA 1FMWA 2W45A 3I5PA 4I3MA 1JPNA 4EUKB 4JW1A 4KBLA 2R03A 1O87A 2LP4A 3E70C 4EHPA 2L81A 3WODF 4FWVA
chains in the Genus database with same CATH topology
1QQ3A 2YL3A 5JRAA 5B3IA 4IB4A 4WGYA 3C62A 4U9EA 5JT4A 1S05A 4IARA 5AGFA 3ZTZA 4CDYA 1CPQA 1APCA 1RCPA 4CIPA 4WGZA 3IQ6A 3VRCA 2XLHA 3TOMA 2XLVA 2YLDA 3DE9A 3ZTMA 3ZWIA 3M4BA 1BBHA 3TOLA 4CDAA 1LM3B 3FOPA 2XL6A 2YL1A 5JVEA 3QW1A 5JLIA 3NMKA 4D4XA 1MQVA 1A7VA 4EIYA 256BA 1YZAA 3HNIA 2XLDA 2XLMA 3QVZA 4NC3A 4CX9A 3QVYA 2BC5A 4ER9A 1GQAA 1CPRA 1CGOA 5JP7A 4CJGA 4JKVA 1YYXA 3ZQYA 1E83A 1CGNA 4U9DA 3NMIA 1YZCA 1M6TA 5JS5A 1EKYA 3ZQVA 5JSLA 4JEAA 3M15A 3IQ5A 2YLGA 2XLEA 4N6HA 3M79A 4CJOA 3M4CA 4JE9A 4D4NA 5JUAA 1JAFA 2XLOA 3C63A 4L6RA 2XL8A 2YLIA 4ULVA 1YYJA 2YKZA 3QW0A 2J9BA 1QPUA 2XLWA 3NMJA 2YL0A 3L1MA 1E86A 4N4WA 3FOOA 3HNJA 4JEBA 3HNKA 1NBBA 3HNLA 1E84A 4CDVA 4IAQA 2YL7A 2QLAA 2XM0A 2XM4A 2J8WA 1E85A 3DE8A 3U8PA 2CCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQ3 A;  2YL3 A;  5JRA A;  5B3I A;  4IB4 A;  4WGY A;  3C62 A;  4U9E A;  5JT4 A;  1S05 A;  4IAR A;  5AGF A;  3ZTZ A;  4CDY A;  1CPQ A;  1APC A;  1RCP A;  4CIP A;  4WGZ A;  3IQ6 A;  3VRC A;  2XLH A;  3TOM A;  2XLV A;  2YLD A;  3DE9 A;  3ZTM A;  3ZWI A;  3M4B A;  1BBH A;  3TOL A;  4CDA A;  1LM3 B;  3FOP A;  2XL6 A;  2YL1 A;  5JVE A;  3QW1 A;  5JLI A;  3NMK A;  4D4X A;  1MQV A;  1A7V A;  4EIY A;  256B A;  1YZA A;  3HNI A;  2XLD A;  2XLM A;  3QVZ A;  4NC3 A;  4CX9 A;  3QVY A;  2BC5 A;  4ER9 A;  1GQA A;  1CPR A;  1CGO A;  5JP7 A;  4CJG A;  4JKV A;  1YYX A;  3ZQY A;  1E83 A;  1CGN A;  4U9D A;  3NMI A;  1YZC A;  1M6T A;  5JS5 A;  1EKY A;  3ZQV A;  5JSL A;  4JEA A;  3M15 A;  3IQ5 A;  2YLG A;  2XLE A;  4N6H A;  3M79 A;  4CJO A;  3M4C A;  4JE9 A;  4D4N A;  5JUA A;  1JAF A;  2XLO A;  3C63 A;  4L6R A;  2XL8 A;  2YLI A;  4ULV A;  1YYJ A;  2YKZ A;  3QW0 A;  2J9B A;  1QPU A;  2XLW A;  3NMJ A;  2YL0 A;  3L1M A;  1E86 A;  4N4W A;  3FOO A;  3HNJ A;  4JEB A;  3HNK A;  1NBB A;  3HNL A;  1E84 A;  4CDV A;  4IAQ A;  2YL7 A;  2QLA A;  2XM0 A;  2XM4 A;  2J8W A;  1E85 A;  3DE8 A;  3U8P A;  2CCY A; 
#chains in the Genus database with same CATH topology
 1HMO A;  1EQ1 A;  4H54 A;  3VM6 A;  4J32 B;  4C7O B;  2J9U A;  2YL3 A;  2VH3 A;  4DRH B;  2TMV P;  1FR0 A;  3OWT A;  4RDA A;  4YJW A;  3FMS A;  4O79 A;  4XEF A;  2B0H A;  4FAP B;  4YL1 A;  1VTM P;  1C17 M;  3C62 A;  4CIH A;  3EHN A;  1D0X A;  4JTA B;  5BQH A;  1PV3 A;  3U9M A;  1S7Z A;  2OEX A;  2WL8 A;  3CZ6 A;  2R7U A;  3DD7 A;  5BQG A;  1SYQ A;  3ZTZ A;  4NY3 A;  4CDY A;  2EPK X;  5A6A A;  2A1D D;  2EIK C;  1CPQ A;  1APC A;  4C3E A;  3MYI A;  1YDI A;  3B0P A;  1G4W R;  1ORS C;  1ZYR F;  4CIP A;  1NG1 A;  1VOM A;  3ASO C;  4PJM A;  1TKN A;  4HE8 D;  3TOM A;  3EH2 A;  4IAO A;  1QSP A;  3ABK C;  3LJB A;  3DM5 A;  1T9K A;  4N06 A;  5F28 E;  5DQT A;  3CEX A;  3DI5 A;  1LI5 A;  1VK5 A;  2KGO A;  2KYH A;  3DE9 A;  3O39 A;  1EI7 A;  3C7J A;  4WJ0 A;  1G8X A;  3AG4 C;  3ITF A;  4U5H A;  3EGX B;  2YQY A;  5DQZ A;  2KNH A;  3TOL A;  4RBN A;  2P1A A;  3C8G B;  1LM3 B;  4JTD B;  1LVK A;  1ZU4 A;  3BRJ A;  3GM3 A;  2LFD A;  3NG1 A;  2YL1 A;  3ZIB A;  4ULW A;  1JOG A;  1U0B B;  5JLI A;  4AL1 A;  3NMK A;  3DKA A;  4I44 A;  3MYF A;  4EKW A;  5KYN A;  3RH3 A;  3EH1 A;  256B A;  3GEH A;  4BJ1 A;  4EIY A;  4BJ6 C;  1Q0F A;  2P61 A;  1VLT A;  2OU6 A;  3QVZ A;  2MWQ A;  4CX9 A;  5KYY B;  2YRF A;  3FAJ A;  5AC4 A;  2Y3G A;  4ER9 A;  1A41 A;  1GQA A;  1B68 A;  4JJG A;  4M63 A;  4MQ9 F;  1A0B A;  3IHU A;  5KYX B;  3LS1 A;  1M56 C;  2D5R B;  4Z9I A;  3LNR A;  4JIO A;  3TJ5 A;  3SXK A;  2G3K A;  3L34 A;  2ASR A;  1YYX A;  2IXO A;  3WG7 C;  4BJT A;  1VMA A;  1CGN A;  4U9D A;  2NSG A;  3NMI A;  3DAG A;  3NRH A;  3S9O A;  1HW1 A;  1W2W A;  1A7E A;  3S90 A;  1JMW A;  4K0D A;  4BJ6 A;  2F22 A;  4J7T A;  1EKY A;  3ZQV A;  2UUH A;  2LQG A;  2HJM A;  4YL3 A;  3IPM O;  3SNH A;  1FNT c;  1UFB A;  5KYU A;  4QI0 A;  4YT4 A;  1D0Z A;  4E7S A;  1LS1 A;  3HJC A;  3C18 A;  4OD4 A;  5B1A C;  1YA7 O;  1WAS A;  3H2V A;  1KTM A;  4KNW A;  2ZXR A;  4AX2 A;  4AK9 A;  2A69 F;  2G3V A;  5JUA A;  1U89 A;  4U5D E;  1HY5 A;  4IJJ A;  5L0D A;  3EHM A;  1QZX A;  3DJU B;  2HMQ A;  2IM8 A;  2YLI A;  3T6G B;  2R7T A;  4DVZ A;  1YYJ A;  1LPE A;  3GM2 A;  2CNW D;  3TJ6 A;  3T4R A;  2ZXO A;  2YEV A;  4G7O F;  2GA0 A;  3SP1 A;  2PBE A;  3T6J A;  1OW8 A;  1E86 A;  1GS9 A;  2VB6 A;  1MND A;  2KJG A;  2OQM A;  1T6I A;  3JZ0 A;  3HNL A;  2R7V A;  1OQC A;  3KH2 A;  2Q00 A;  4YT5 A;  1D0Y A;  4MTG A;  3TK0 A;  2BL2 A;  2W4B A;  5L0F A;  2O9X A;  1RJ9 A;  1WOL A;  2Y3H A;  4YL0 A;  1ZU5 A;  2EIJ C;  4MVM A;  4K1O A;  4G0H A;  4GQH A;  2Y39 A;  5E3C A;  3H2U A;  1H7I A;  2J8W A;  5EGY A;  1BZ4 A;  2I8B A;  2NG1 A;  2XS1 A;  1GGQ A;  1XWJ A;  2XS8 A;  3ABL C;  2JD3 A;  3U5S A;  4CSA C;  3FAP B;  3U8P A;  3S29 A;  3QMK A;  1VB5 A;  2XL4 A;  4XPY A;  2CCY A;  1RJ9 B;  2Z15 A;  1WN0 A;  3E9V A;  4JVS A;  4DRI B;  2XRH A;  4EBK A;  1A7D A;  2OJE D;  1NFO A;  3UMI A;  3C8G D;  2I15 A;  5L3Q A;  3N0T A;  5FZT A;  3W8H A;  1YVI A;  5B3I A;  4Z9J A;  4Z9H A;  3RVY A;  1N1C A;  4WGY A;  3SXZ A;  2LIG A;  2VCB A;  2AU5 A;  3CQZ A;  3O10 A;  4E18 A;  1FFT C;  2LSE A;  2Q9B A;  4CS7 A;  1AUE A;  3ZDL A;  1SMY F;  1OXB A;  3UGO A;  2ZXW C;  5BUO A;  4I1M A;  5AGF A;  4JTC B;  1ZW2 A;  5A6J A;  2OEV A;  4CSA A;  3RVZ A;  5BQI A;  4O6N A;  1IW7 F;  4WGZ A;  4B6I A;  2LCH A;  1QKR A;  5KYW A;  2AWY A;  2FGY A;  1PD1 A;  2EIM C;  2XLV A;  4YT8 A;  3SXY A;  2H7B A;  4GEH A;  3J06 A;  2YLD A;  3LS0 A;  1ZZP A;  1NU7 D;  1TWH A;  2DGJ A;  3RF3 A;  4QI2 A;  1NZE A;  3JSE O;  3A9C A;  5COM A;  4E17 A;  3M1C B;  3K33 A;  1GM5 A;  4MVQ A;  1TWA A;  3RQF A;  3F47 A;  1IZM A;  2J7P A;  1LE2 A;  3FOP A;  4F4B A;  3U8V A;  4PFO A;  3N2Z B;  2BE5 F;  2B0J A;  3ASN C;  1TR2 A;  3CSK A;  1RMV A;  2PP4 A;  4DXW A;  4DRJ B;  1T5O A;  2WVN A;  2NUT A;  1MQV A;  4D4X A;  1A7V A;  4PJL A;  1D1C A;  3G50 A;  1O3U A;  1ZVZ A;  2HFI A;  1L3P A;  3HNI A;  2NSF A;  1ORJ A;  2ZPA A;  2XLM A;  3LNM B;  4OIQ F;  5DVW A;  3OEO A;  1OCC C;  1TWG A;  2BC5 A;  3I4U A;  4K7B A;  3EQL F;  4X0R A;  1G4U S;  2R9R B;  3KPH A;  1CPR A;  1RKC A;  1V4A A;  1J8Y F;  3KYI A;  4O6Y A;  3B0U X;  3HLZ A;  4G7Z F;  4XWJ A;  3ZQY A;  2HMZ A;  1OW6 A;  1AVO B;  1T01 A;  3LES A;  3RYL A;  1Q0D A;  2FAP B;  1M6T A;  1Y6D A;  2PX0 A;  1MMD A;  2WB7 A;  3N24 A;  1WTY A;  2DYR C;  1KU2 A;  3NYJ A;  2CDQ A;  5JSL A;  3L0I A;  2M64 A;  1MNE A;  3EGD A;  3ATP A;  2KC3 A;  3LLI A;  2PF4 E;  3FDQ A;  3AG1 C;  2L6F A;  2XLE A;  4G78 A;  2OG2 A;  4XLN F;  2X51 A;  3RIP A;  1Y4C A;  5E3A A;  1R5I D;  2A68 F;  2MHR A;  3M4C A;  4P9T A;  3NKE A;  3WAQ A;  4A4A A;  4D4N A;  4YWQ A;  3UMK A;  1BR1 A;  1LI7 A;  1M2O A;  2ICW G;  1QVX A;  3RFY A;  3CAX A;  2OKU A;  3KL4 A;  3X1O A;  3PCV A;  4FES A;  1OCR C;  5AC5 A;  4U5G A;  4U5B E;  4DBQ A;  5T3W A;  2OOC A;  3LUT B;  1AEP A;  3AGU A;  3DXJ F;  1YJG A;  2QY9 A;  4H4K C;  4HEA J;  1F1M A;  1JRA A;  1QPU A;  2XLW A;  3JTL O;  3MLG A;  4O6M A;  3L1M A;  4YT2 A;  3PDM P;  1XZP A;  4JEB A;  2DYS C;  1Z6A A;  3HNK A;  4R32 A;  1FFH A;  2HV6 A;  1HE9 A;  3SZR A;  4BG0 A;  3LLK A;  2J46 A;  4MVU A;  1ZW3 A;  4U5F E;  5A6B D;  1TFK B;  4CDV A;  1MMG A;  4ZLC A;  1ZHX A;  2CYD A;  2YVK A;  3MFN A;  1PCX A;  3W8I A;  2XM0 A;  1ORY A;  3BEH A;  4FX5 A;  2Q3T A;  4A2N B;  4AL0 A;  4WAB A;  3IEE A;  4BJ5 C;  2RD9 A;  3MX3 A;  2IXP A;  1LKX A;  5DS5 A;  2HSB A;  2VCC A;  2CW0 F;  2ZXP A;  1I4Z A;  4LDK A;  5KYU B;  1SF8 A;  3U2M A;  3JCU Q;  5L0H A;  3L8J A;  2EPL X;  4U5C E;  3GEI A;  3UMH A;  1M57 C;  1L7C A;  3W2W A;  2R02 A;  1ZHW A;  4OIN F;  4Q4Z F;  2HKV A;  4XEV A;  5COF A;  3ZSU A;  2AWC A;  3JT1 A;  2H7O A;  2EPM X;  1Z3I X;  4MVZ A;  4C3B A;  1JPJ A;  1YAR O;  1JR8 A;  1OKK A;  1LS4 A;  3DZA A;  5JT4 A;  1D1B A;  1S05 A;  2LFF A;  4BJ5 A;  1T6U A;  3NYL A;  3HTK C;  2EIN C;  4GYT A;  1PD0 A;  4BEM J;  3V5Z A;  3ZVR A;  3B29 A;  4UDV A;  2IXN A;  5CI9 A;  2HS5 A;  2XLH A;  3AGT A;  2EPO A;  4W8P A;  1YAU O;  2WVO A;  3U2L A;  4W8K A;  1FMV A;  3UGP A;  3QZC A;  4C3D A;  3Q7L A;  4EWC A;  1D1A A;  2A0U A;  3B0V C;  3ZWI A;  2R7W A;  4AE4 A;  3M4B A;  3TD7 A;  1BBH A;  4IRU A;  1BDJ B;  2PX3 A;  4EBB A;  1YLM A;  3G4X A;  4JUR I;  4G7H F;  3GAN A;  2CGE A;  2DI3 A;  4CDA A;  3O55 A;  3T9O A;  1R4T A;  3K1H A;  2WZL A;  3GOR A;  3LAY A;  4DVY P;  1EA8 A;  3MBG A;  4ONS A;  4PFP A;  3S27 A;  5A69 A;  5JVE A;  1J8M F;  3EJN A;  1NFN A;  4P6I C;  2KQ9 A;  1OXK A;  5EK0 A;  5F5F A;  2PNO A;  2NUP A;  3A11 A;  3W2V A;  1H9G A;  5CIV A;  4LDQ A;  2YHS A;  4MVO A;  4XPX A;  3S0X A;  4PK4 A;  1CGO A;  2QE9 A;  3OA1 A;  2HUJ A;  1ZHZ A;  3NDB B;  2NUP B;  3US6 A;  2XXA A;  1QLE C;  4HFF B;  3V5X A;  4Q7C A;  3VYW A;  2P7V A;  4JKV A;  1V74 B;  5L0C A;  2ZD9 A;  3DJN B;  2W9Y A;  4DJ9 A;  2X0C A;  2JX0 A;  3RKO F;  5D92 A;  3SYN A;  2HSQ A;  4RD9 A;  1RKE A;  3Q6N A;  3DMD A;  3R2P A;  2XXA B;  3IQC A;  4JEA A;  3M15 A;  1I4Y A;  3ZG1 A;  3IQ5 A;  1HW2 A;  5DS6 A;  2YLG A;  3K1I C;  2FFH A;  2HZ8 A;  1G5Z A;  2PFD A;  3FXH A;  4CS9 C;  2R05 A;  5EHH A;  3ECS A;  2G62 A;  4JE9 A;  2CNW A;  4XQ1 A;  2OCC C;  5GPG B;  2XLO A;  3PMR A;  1RKE B;  3C63 A;  4KNV A;  4L6R A;  4PJN A;  1H6G A;  1Q0G A;  1Z63 A;  2NPU A;  2XL8 A;  3DWW A;  1K05 A;  5IY5 C;  5A6K A;  2NUT B;  3VAY A;  4XPW A;  4MTO A;  3U9J A;  3EG9 A;  3AOU A;  3QW0 A;  2R7Q A;  2J9B A;  1OW7 A;  2A6H F;  4NQF A;  2R7O A;  5DS4 A;  5D91 A;  5L0G A;  1T6Q A;  3K1I A;  2ETS A;  3K6B A;  4MS2 A;  2YL0 A;  1KNY A;  4E0I A;  4E7Z A;  3POV A;  2D4U A;  3FOO A;  3HNJ A;  4CS9 A;  1ZHY A;  1CGM E;  2M4E A;  1SZI A;  1NBB A;  1ST6 A;  2HV7 A;  2Y3D A;  2V3C C;  3JSZ A;  1FAP B;  1NSG B;  3LEV A;  3EG9 B;  1LE4 A;  4LER A;  1Z23 A;  3Q6M A;  4JJF A;  2C04 A;  1E84 A;  4IAQ A;  2R7S A;  2YL7 A;  4LLC A;  3EZH A;  5CI8 A;  5B1B C;  2L9J A;  1Z5Z A;  2QTV A;  1OKK D;  3EGX A;  3K66 A;  3C8G A;  2L6G A;  2JPU A;  3T6B A;  1E85 A;  3DE8 A;  3UR3 C;  4JC7 A;  1DOV A;  1O5H A;  2J0X A;  5L0I A;  3EGD B;  3W4Y A;  3JRM O;  1BR4 A;  3EFO A;  4N6C A;  3LEO A;  1LIH A;  4KC9 A;  5T3T A;  3UNG C;  5L0J A;  1QQ3 A;  5TJ5 E;  2KK1 A;  1E2X A;  1WGW A;  2L6H A;  2Q9A A;  5JRA A;  2KSF A;  4ZLD A;  1NU9 C;  4LAC B;  4IB4 A;  5KYY A;  4XTK A;  1OR3 A;  3TUL A;  4U9E A;  2GWW A;  2V26 A;  3ZC4 A;  3EFO B;  3B9Q A;  4NTB A;  4IAR A;  5KYX A;  4BEJ A;  1C03 A;  3PHF 2;  1M2V A;  5E2Q A;  3TQO A;  3F46 A;  3GEE A;  3FVY A;  2J9W A;  1RCP A;  2MYS A;  1H9T A;  5E33 A;  4CS8 C;  4IWB A;  2Q7R A;  3IQ6 A;  5L3V A;  3VRC A;  3S84 A;  4BPM A;  1TQG A;  2H8A A;  4MTF A;  5T1D B;  2R7R A;  2QUP A;  1WAT A;  5DLJ A;  3KKB A;  2LK4 A;  3DM9 B;  1M2V B;  4JCH A;  4PR9 A;  2VCA A;  2J45 A;  5HSW A;  3ZTM A;  4LLE A;  3GM1 A;  4NTF A;  3JYH A;  3H65 A;  1TFO B;  1C02 A;  3KYJ A;  2J0W A;  4JZA A;  1DOW A;  1SR2 A;  2H7V C;  3AJM A;  3V7O A;  2KW3 C;  2XSE A;  3GWL A;  3AG2 C;  3O6X A;  2HJ3 A;  3KMI A;  3AQB A;  4J30 B;  4YK5 A;  4JCZ A;  2WZF A;  4CS8 A;  2XL6 A;  2L7A A;  2YZS A;  3QW1 A;  4NCQ A;  4XEK A;  2A6E F;  2EPN A;  2VC9 A;  4DOZ A;  1K04 A;  3FHD A;  2J7P D;  5FCL A;  1YZA A;  3HKK A;  2XLD A;  2J9V A;  4NC3 A;  3QTH A;  1VYK A;  4OIR F;  3G4Z A;  3QVY A;  2GFH A;  3B71 A;  3EPV A;  4QDL A;  4MW8 A;  3K7D A;  5HV9 A;  5JP7 A;  4KI2 A;  1VYI A;  1TWC A;  1VLS A;  4CJG A;  1U6H A;  4YN0 B;  1V54 C;  2Y69 C;  3RQE A;  1ZHT A;  1Z7Q c;  1E83 A;  3U3B A;  3RW0 A;  1NLX A;  4U5E E;  3NYM A;  1YZC A;  4MVR A;  4Q5S F;  2Y3B A;  3I5Q A;  2AP3 A;  1I5N A;  3Q7G A;  4J7Y A;  3U0C A;  2WVQ A;  3ABM C;  4JRZ A;  3SXM A;  2C03 A;  4IGG A;  4PJJ A;  2GDC A;  5JS5 A;  3EZI A;  2AVK A;  4PAC A;  2R7X A;  2P6V A;  1K40 A;  4E0H A;  4MVS A;  4P9F A;  2QNL A;  3AG3 C;  3R7C A;  4AE4 B;  3U3F A;  2IYL D;  1XZQ A;  2DB4 A;  2GAQ A;  2P0N A;  2Q4F A;  3IQT A;  2Q9C A;  3DAF A;  4N6H A;  1BR2 A;  3JYY A;  4NTA A;  3V5Y A;  1UG7 A;  3M79 A;  4I1O B;  4LDR A;  5COG A;  4CJO A;  2W4M A;  4XLP F;  3GWN A;  2VAS A;  1JAF A;  2R25 A;  2IOQ A;  1RXQ A;  1WWP A;  4ANJ A;  2A0B A;  4MND A;  2YWA A;  2EIL C;  5KYW B;  4DBR A;  1OCO C;  3AQC A;  3S28 A;  4ULV A;  3JRT A;  4EBJ A;  4OIO F;  2YKZ A;  4OIP F;  2OJQ A;  3C8Z A;  1YA9 A;  1MMA A;  3RQG A;  5A6B A;  2WZG A;  1Q0M A;  4HFK B;  2LD6 A;  5F5H A;  3NMJ A;  2RSE B;  1FTS A;  1HMD A;  1MMN A;  5K0I A;  4N4W A;  1HE1 A;  2E87 A;  4MW3 A;  1OCZ C;  2UUI A;  4O7G A;  1V55 C;  3X2Q C;  2IBF A;  3VF0 A;  3L8I A;  4OD5 A;  3SEO A;  5B3S C;  3NKD A;  3WHN A;  1Q0K A;  4CBE A;  2IXM A;  2QLA A;  4C7O A;  1OR2 A;  2XM4 A;  3GOD A;  1FMW A;  2W45 A;  3I5P A;  4I3M A;  1JPN A;  4EUK B;  4JW1 A;  4KBL A;  2R03 A;  1O87 A;  2LP4 A;  3E70 C;  4EHP A;  2L81 A;  3WOD F;  4FWV A; 
#chains in the Genus database with same CATH homology
 1QQ3 A;  2YL3 A;  5JRA A;  5B3I A;  4IB4 A;  4WGY A;  3C62 A;  4U9E A;  5JT4 A;  1S05 A;  4IAR A;  5AGF A;  3ZTZ A;  4CDY A;  1CPQ A;  1APC A;  1RCP A;  4CIP A;  4WGZ A;  3IQ6 A;  3VRC A;  2XLH A;  3TOM A;  2XLV A;  2YLD A;  3DE9 A;  3ZTM A;  3ZWI A;  3M4B A;  1BBH A;  3TOL A;  4CDA A;  1LM3 B;  3FOP A;  2XL6 A;  2YL1 A;  5JVE A;  3QW1 A;  5JLI A;  3NMK A;  4D4X A;  1MQV A;  1A7V A;  4EIY A;  256B A;  1YZA A;  3HNI A;  2XLD A;  2XLM A;  3QVZ A;  4NC3 A;  4CX9 A;  3QVY A;  2BC5 A;  4ER9 A;  1GQA A;  1CPR A;  1CGO A;  5JP7 A;  4CJG A;  4JKV A;  1YYX A;  3ZQY A;  1E83 A;  1CGN A;  4U9D A;  3NMI A;  1YZC A;  1M6T A;  5JS5 A;  1EKY A;  3ZQV A;  5JSL A;  4JEA A;  3M15 A;  3IQ5 A;  2YLG A;  2XLE A;  4N6H A;  3M79 A;  4CJO A;  3M4C A;  4JE9 A;  4D4N A;  5JUA A;  1JAF A;  2XLO A;  3C63 A;  4L6R A;  2XL8 A;  2YLI A;  4ULV A;  1YYJ A;  2YKZ A;  3QW0 A;  2J9B A;  1QPU A;  2XLW A;  3NMJ A;  2YL0 A;  3L1M A;  1E86 A;  4N4W A;  3FOO A;  3HNJ A;  4JEB A;  3HNK A;  1NBB A;  3HNL A;  1E84 A;  4CDV A;  4IAQ A;  2YL7 A;  2QLA A;  2XM0 A;  2XM4 A;  2J8W A;  1E85 A;  3DE8 A;  3U8P A;  2CCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...