5JTYA

Glutamate- and dcka-bound glun1/glun2a agonist binding domains with mpx-007
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
283
structure length
262
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQEKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor ionotropic, NMDA 1,Glutamate receptor ion
publication title Structural Basis for Negative Allosteric Modulation of GluN2A-Containing NMDA Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein, receptor
total genus 66
structure length 262
sequence length 283
ec nomenclature
pdb deposition date 2016-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5jtyA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5jtyA02
4LA9A 4M4GA 1I69A 5I58B 4NEDA 3R26A 4ELOA 1OMPA 3RNNA 3VE1B 5H8QB 4I8CA 3KSJA 4F18A 3PMWA 1YTVA 4DE8A 1R1NA 5ICQA 3QIMA 3D4GA 1NNFA 1URGA 4WEDA 2VD2A 4K3FA 3ZKKA 2H25A 3C9HA 3P7IA 3EQ1A 4NF6B 2UYFA 3G3KA 2YLNA 5L8DA 5DEXA 2ONKE 4FATA 4G77A 4OEUA 1H43A 1MRPA 3S4UA 1QUKA 1B1XA 2Z8FA 1SYHA 2UVGA 3M3FA 3Q28A 3E3KA 2YPNA 1ZU0A 4YU0A 3W15C 3RTWB 2NVUB 3IJXB 4OEVA 4OQOA 4YB5A 2OZZA 1M5EA 4EXLA 4QFPA 4OETA 4PE5B 2I58A 3MAMA 3B6QA 3EHUA 2V93A 1KWHA 3VVEA 3DM0A 5AA2A 4XKRA 2OLBA 1M5BA 3RUMA 3B7DA 3U92A 5KCJB 3QK6A 4R9GA 1URSA 3FD3A 4U22A 2ZYMA 1PEBA 4U4SA 4DCXA 5CRYA 4KCDA 1H44A 1LBBA 4HS7A 4KQPA 1SDXA 3C35A 3S9LC 4DZ1A 3LSFB 2QS3A 3TUSA 3N6UA 3PMVA 2RINA 2Q88A 4H0WA 1GTKA 4MBPA 4KD5A 1B7UA 1AOVA 4PETA 1US5A 1OVTA 3MVXA 4IO5A 3OO6A 1N84A 4OFLA 4O3BA 1JNFA 3K6XA 1GV8A 2RC7A 3MVWA 1CE2A 3DP6A 2B3FA 4R2FA 4LVQA 4DIGA 4XKPA 4F3GA 2Q2AA 1MQHA 4LQ5A 1P1NA 1H76A 4YKIA 1MM6A 4R75A 2THIA 1LGBC 2O7UA 1XC1A 3ODBA 1ANFA 2QS2A 5CM6A 3PUVE 1DSNA 1LBCA 1LAHE 2UYEA 4GL0A 4EXKA 4MLVA 4MLQA 3OO9A 5TPAB 2F78A 1FQFA 5AE4A 3K6UA 1Q35A 5H8HA 4TQUQ 1QVSA 2DQVA 4F19A 5HPQA 1LFHA 4R73A 2I49A 5I2NA 2YJPA 3PV0E 1FQAA 4BDNA 2Q8JA 2DXYA 1MPDA 1VSOA 3CVGA 4RPOA 3OXNA 4IGRA 2HZLA 2Y7RA 4FORA 4O3AA 4GLIA 1NL5A 4EQ7A 4H5GA 1FCKA 3BKIB 2AL5A 1MXUA 2QMXA 1N7XA 1J1NA 2V3TA 3K1NA 5CI5A 5DVJA 3MZ1A 3RQTA 3TDJA 1B7ZA 4NMYA 3MPKA 4U2RA 2CMOA 1OLAA 4X1BA 4NWCA 3FZVA 1XT8A 3FGSA 4ZEKA 1B4ZA 5I57A 5CMBA 3LSWA 1TT1A 2DWJA 4BDRA 3KJ7A 1NNPA 2Z8DA 3OMBA 3GBAA 4KR5A 2D5WA 2DVZA 2NXOA 1ZMGA 3IB0A 1B0LA 4EQBA 3MC2A 4IGTA 5LOMA 1Y9UA 2I48A 5I59B 3LC8A 5H8FA 1MDQA 1AMFA 4YMAA 1BLFA 2H9BA 5AA3A 1P1WA 3C33A 3LR1A 2F34A 2HZKA 2IA4A 3CSGA 1I6AA 1JW5A 3C4MA 4KYSA 1IITA 2DE2A 3MJNA 4N6PA 3SETA 3KGCA 3Q29A 1LB9A 3F11A 5F7VA 1EH3A 3IX1A 2QS1A 4GQOA 3TQWA 4C0RA 3O6GA 2O51A 3MVZA 2XXPA 4IO3A 1I6QA 3T96B 2XHDA 3H6WA 3LUYA 4F3BA 4ELRA 2PT1A 2RCAA 1Y3QA 1A8FA 1VFEA 3VVFA 1RYOA 5ITOA 5A5XA 2AL4A 3FVKA 1MY3A 4O3CA 1UIVA 1JETA 3G3IA 3KN7A 3FASA 3SESA 3Q26A 4LUBA 3K1MA 1N04A 4MF3A 2O68A 4QFLA 2F35A 4BDOA 2XX9A 5HBCA 5EYFA 1PB9A 2XXRA 3O97A 5I58A 1SW4A 2Q89A 1ATGA 5CBSA 3B6WA 5K2YA 2DYXA 1URDA 3O9PA 4Z0IA 3OENA 5J1DA 2I3WA 2DP8A 3S2VA 5H8QA 4R72A 1M5DA 3UIFA 3A3UA 4ZZEA 2RC8A 1EZOA 2DVCA 1FTLA 1RKMA 2XXTA 2QSXA 3K01A 1H45A 4H8JA 1ZJLA 2F5XA 1POTA 1PBQA 4XXUA 1QUIA 2ZMBA 1IXCA 3QUJA 5H8NB 2V3QA 3E4RA 3FVNA 4PFTA 2KLFA 5FHNA 4NF4B 1OIBA 1GGGA 4BDMA 3JZJA 3N6TA 3CFLA 3I6VA 3OO7A 3TEPA 1B1HA 1TFDA 3UA8A 2DWAA 5JEIA 3PD9A 4HCYA 4Q5TA 1B9JA 5JK4A 4H8IA 2DSFA 3HO7A 1LAXA 4AB6A 1LB8A 2F97A 3I3VA 3IL1B 4MH5A 2XX8A 3MWBA 4POWA 4DDDA 3RT6B 2OWTA 4RK9A 1NMUA 1MY2A 1Z7ME 4HW8A 1GVCA 3U72A 5AA4B 1PB7A 4HTGA 3KOTA 3MW0A 3HN0A 3TQLA 1FTMA 4RA1A 3HHFA 3CR9A 1MXVA 2HQ0A 3FV1A 5FTIA 1Y3NA 1N76A 2ALUA 4F3PA 2OJTA 1LCFA 4GXAA 3ONMA 2OK2A 3CFZA 4OWDA 3PPQA 2DXRA 5L9SA 4GIZA 3ILUB 3QAXA 5I2KB 3MQ9A 5DYHA 1ZKBA 3N94A 3QSLA 3DELB 1OLCA 3PUYE 5CMKA 4OFOA 1XVYA 3G3HA 3TCGA 2XXIA 3MZBA 1QUJA 2RKMA 4ECFA 1UTBB 3KN8A 3H4ZA 1GR2A 1NNTA 3OSQA 4N13A 2I4CA 4BLAA 1Y4CA 4I62A 2XX7A 4ND9A 4QRZA 1BIYA 4KPTA 2R71A 3UK4A 3Q27A 1SW1A 4QSEA 1H3DA 2QPQA 3RT8A 4PFUA 1EU8A 4G4PA 2DE4A 4MFIA 3IJOB 3K0VA 3G7WA 2GH9A 2ANJA 1NNKA 1QW0A 4Z7EA 4U23A 2W7YA 1B7HA 3K4UA 4PFWA 1P1OA 4F3SA 3PUXE 4OERA 1MPCA 4EUOA 3RPWA 5TPAA 3DP4A 1B4HA 4ELPA 1YCJA 4OYVA 1Y20A 4Q8RA 2OCUA 1A55A 4OESA 5ELVA 3AXFA 2ABHA 2X7PA 3IOUA 4ZEIA 4JXIA 4F31B 3TELA 3ZKLA 1M5FA 1UTHB 3SDFA 1WODA 2XXQA 4PP0A 3O28A 3IB2A 4WKMA 1MXWA 2XXUA 3CSBA 2G29A 4ZEDA 2QMWA 4FEBA 2HAVA 1IXIA 1UQWA 1P99A 2DWIA 2F6PA 3G3FA 3BBRA 5DVIA 4GOTA 4TLMB 2O7IA 2ZXTA 3N26A 1A8EA 3HV1A 2BJJX 4LP2B 4H65A 1A7LA 4EF2A 2O6AA 4U1OA 3FVOA 3KG2A 1VFDA 1TXFA 1R6ZA 2ZNSA 2XXHA 3USDA 1SD3A 4FEDA 2Y7IA 3KBRA 4NF5B 4IO7A 3VXCA 3TTMA 4JWXA 4R9FA 1MXXA 3IB1A 4E0XA 4G68C 1IXGA 2HXWA 1S9TA 3ZS6A 4THIA 2PT2A 1YPNA 4TLLB 3DLNA 1L5TA 5DVFA 3VLUA 3K2DA 1N0TA 2AYSA 1AL3A 3V5AA 3B6TA 3H6VA 1MXYA 2PYYA 3A3CA 5AA1A 4QSDA 3EF7A 1B2HA 1JEUA 3FUZA 3OSRA 2P2AA 3CFXA 4AQ4A 3ECRA 2I6EA 2HFBA 1POY1 1TWYA 1DPEA 4P0IA 3T93B 2D3IA 2H4IA 3O6IA 1IIWA 5B7DA 1LFIA 3C32A 1B0HA 1DOTA 2VGQA 3LSXA 1WVJA 4OHNA 3SERA 1OQHA 4QF9A 4ZE9A 3SEVA 4F2OA 2Z8EA 2O1LA 1MY1A 1JW4A 2B65A 4UACA 2X7QA 2VD3A 4U1ZA 2H5YA 3GBBA 3PUWE 3O2AA 3PD8A 3R6UA 3TAJA 1I6BA 4JWOA 5M2VA 4NF8B 3T9UA 2HEUA 1US4A 3FJGA 4Q0CA 2QS4A 3M3LA 2I0BA 1NKXA 2I3VA 3K6WA 1LFGA 4IY6A 4YAHX 2F7AA 3HCQA 3TTLA 1JVYA 3V8XB 2XXVA 3U1OA 3SKPA 4X9TA 1VR5A 1Y1MA 3RLFE 1SVXB 3U94A 2O69A 1IUDA 4FJPA 4NTLA 1EZ9A 5H8NA 4F29A 3TCFA 2O1MA 4NF4A 3FV2A 4FE8A 4RPNA 4YKKA 3SEYA 3PMXA 2HAUA 2Y7KA 3U93A 1R9QA 2V25A 4IB2A 2A5TA 2NWJA 4POXA 5TU0A 2FYIA 3PUZE 4R6HA 2F36A 2M8CA 4I9DA 3MP8A 1LCTA 1II5A 1MQDA 4ZZAA 3H6TA 3C31A 1MH3A 2REJA 3O29A 3PPRA 2G93A 1HSLA 3W9WA 3H7MA 3TFLA 3LSLA 5ISUA 3HHGA 5AA4A 1USYH 4G68A 4IO4A 4LZ8A 1ZLQA 3IORA 1B46A 2GHAA 3WAEA 1SW2A 3H03A 5JTYA 4LATA 1JVXA 3FATA 3IO6A 2HCAA 3VLWA 2REGA 1IXHA 5H8SA 1DMBA 4RK2A 3W9VA 3DP8A 4H6DA 5IAIA 5I2KA 4YB6A 3PPOA 1S50A 3SEUA 3T22A 1O7TA 1FQDA 3IOWA 2RC9A 3UORA 4F1YA 4NF6A 3VVDA 5CC2A 1UTBA 1JEVA 5I56B 5H8FB 2DE3A 5ICTA 1Y1ZA 2F8DA 1MPBA 3IOVA 3QUFA 2QRYA 2F7BA 4U4XA 1EZPA 4C1TA 1D3KA 4ELQA 5TP9B 2B3BA 1MQGA 3H6UA 1NH7A 4PFYA 2I0CA 3CG1A 3PU5A 3FXRA 4ZDMA 2QL3A 2DS9A 1FQCA 3IR1A 3HPIA 3L6HA 4ISUA 1QULA 3FXQA 4P11A 3T9HB 1FTOA 3RN8A 4EDPA 1SBPA 1PDAA 2DWHA 1WDNA 1TFAA 5KCJA 1P1UA 1F9BA 5A5XB 4FAJA 2D21A 5F1QA 1JW1A 4ONYA 4IY5A 3C36A 3FVGA 3E13X 4GL8A 3Q25A 4DCYA 2GFEA 1LLSA 4F39A 1B58A 1UTHA 4KYDA 5L9MA 1R9LA 4NWDA 2ONRA 1SI1A 1MG1A 1DTGA 2FA7A 1IEJA 2UXAA 4IO2A 5KDTB 2PBWA 4QFNA 3FJ7A 1BTJA 1IQ7A 4JSOA 1SYIA 1B5JA 2ZNTA 3K1PA 2E1SA 2UVHA 2Y7WA 2XXYA 3TKDA 4QSCA 1NH8A 4YB7A 3KEIA 1ELJA 4G8MA 1O63A 4ZEBA 4GVOA 1QKAA 5ITPA 3TTRA 4FIMA 1UIUA 5CBRA 3OELA 4NF5A 3MVYA 2RCBA 1XHYA 5KZTA 4KFQA 4H1XA 1PB8A 2ZYNA 4GXSB 1IZ1A 1N3XA 2DOJA 3EPEA 3UN6A 4LONB 4YKJA 4EQ9A 2H98A 3V89B 4G8HA 1NFTA 4LZ7A 3S9MC 1BP5A 3OOAA 4E0WA 4ESWA 3MUQA 1T0KA 4R74A 1PC3A 3K00A 4XKQA 1SI0A 4XKNA 3VXBA 1A54A 2V84A 2PMSA 3T9VA 2Y7PA 2R9JA 4R6KA 3M8UA 3A09A 1FW0A 4ESXA 2FNCA 4R2BA 4GWOA 1B3EA 1SQYA 1A40A 2F7CA 3THIA 1LSTA 4M1VA 3OO8A 4OTEA 2AIXA 2E0SA 4OFJA 3TMGA 3K6VA 1Q1KA 4QHQA 2ZYOA 3E9XA 5CMCA 2OWSA 3T66A 2ZYKA 3SEXA 2Z22A 5DEXB 4KI0E 1AH5A 4NF8A 4OXVA 3VV5A 2UVIA 3QYTA 3PPNA 4DLDA 2RF1A 3S9EA 3WAFA 3RTFB 3I5OA 3KN3A 3RY3A 1A99A 4AB5A 2Q2CA 3KOSA 3MBPA 1HSEA 3VLVA 5I59A 4BDLA 1N3WA 4Q30B 3H06B 4KYEA 1B3HA 3EN3A 4UA8A 3KSXA 5AA2B 1OVBA 3RGYA 2ONSA 3GLBA 4JDFA 5FHOA 3C34A 3M3KA 4RNSA 3D4CA 1D9VA 3OD7A 4NE4A 4ZECA 3JYRA 2CZLA 3G3GA 4XTCQ 4RY1A 3CRBA 4WXJA 3GZGA 2NOOA 4DXUA 4ZE8A 2XD2A 3N5LA 1MS7A 4GFRA 2V3UA 3H3GA 1B32A 2XD3A 1PBPA 4R6YA 3UGWA 1ZIUA 2PVUA 4N07A 4IO6A 4OENA 2PX1A 4FECA 3SEWA 3G3JA 1QKBA 4U21A 1MDP1 1DTZA 5BUUA 4RYAA 3FJMA 4YZZA 2ZNUA 4LZ5A 3R7XA 3KFMA 4F1VA 4BDQA 2XXWA 1MY4A 4ZEFA 3IO4A 4GF8A 1FQBA 2P0SA 4KHZE 4H5FA 1AIVA 2WKYA 2R6GE 5HM4B 2Y84A 5DTBA 4LQ2A 1ZTYA 4X48A 2VHAA 1USYE 2NUVA 4C1UA 2P1SA 4F1UA 3OEKA 4QFOA 5I56A 1MQJA 4KCCA 3GXAA 1D4NA 4F2QA 5AA2D 3K02A 4OVJA 5H8HB 1QJMA 2XXXA 4PQJA 3FXUA 5L9OA 1S7YA 3L6GA 3MZ9A 1Y4TA 1B5HA 5EHMA 5TP9A 2VOZA 5I2NB 2VP1A 3CI8A 3TTKA 4YMBA 3PPPA 5I84A 4G8NA 3TODA 1D9YA 2I4BA 3CIJA 3JV9A 3TPAA 1Y3PA 3O66A 4WEPA 3TZAA 5EHSA 2LAOA 3V83A 1MH4A 3MPLA 2IEEA 4EF1A 1B3LA 4HCWA 4JSDA 3IK6B 3MP1A 5FTHA 1XS5A 3T9XB 3VFJA 4X1DA 3KJTA 4GD5A 3ZSFA 5IKBA 2Z23A 3IAZA 4TOZA 2X26A 3TCHA 4GRKA 5K2XA 3HSTA 1FQEA 4DXBA 3EHSA 1SW5A 5I57B 3FIRA 1JQFA 2UVJA 1B3GA 3TYHA 1B52A 2H99A 1B3FA 3CG3A 1B6HA 3VDFA 1RYXA 1M5CA 4XIGQ 4YKPA 4RJZA 1ZBMA 5CMMA 3ILTB 4QFKA 3EHTA 3O6HA 1B05A 1BKAA 1XVXA 3KZGA 1CB6A 4DXCA 2QJEA 3U8QA 5KDTA 1FTJA 1O64A 1MQIA 2GHBA 1FTKA 4JB7A 5BWJA 3QXMA 1LAFE 2Q9TA 4JWYA 1XOCA 4JBZA 3BFTA 5DT6A 2OBGA 1MXZA 5B70A 4F22A 1HSJA 2GRVA 2F6GA 4H67A 4YICA 1B51A 3LBSA 2A5TB 4P0GA 4G2ZA 1LAGE 1Z7NE 3BFUA 3TTNA 4OMBA 2A5SA 3UP9A 3IOTA 5FHMA 1P1QA 2ESNA 2O84X 4RXLA 1OQGA 1B5IA 4OZ9A 3PGFA 1VE4A 3OEMA 1N7WA 4G68B 4L17A 1DPPA 1MY0A 1YAEA 1B40A 1MM7A 4ZS9A 3S9NC 5JTYB 4I1DA 3MP6A
chains in the Genus database with same CATH superfamily
4OVSA 4LA9A 4M4GA 1I69A 5I58B 4NEDA 3R26A 4ELOA 4GWUA 3ROJA 1OMPA 3RNNA 3VE1B 5H8QB 4I8CA 3KSJA 4F18A 3PMWA 1YTVA 4DE8A 1R1NA 5ICQA 3QIMA 3D4GA 1NNFA 2ZZXA 1URGA 4KXPA 4WEDA 2VD2A 4K3FA 1XI6A 3ZKKA 2H25A 3C9HA 3P7IA 3EQ1A 4NF6B 2UYFA 3G3KA 2YLNA 5L8DA 5DEXA 2ONKE 4FATA 4G77A 4OEUA 2Y5KA 1H43A 1MRPA 4OVPA 3S4UA 1QUKA 1FBFA 1B1XA 2Z8FA 1SYHA 2UVGA 3M3FA 3Q28A 3E3KA 2FHYA 1LBWA 2YPNA 5IM2A 1ZU0A 4DI3D 4YU0A 3W15C 3RTWB 2NVUB 3IJXB 4OEVA 4OQOA 4YB5A 2OZZA 1M5EA 4EXLA 4NQ8A 4QFPA 4OETA 4PE5B 2I58A 3MAMA 3B6QA 2Q74A 4HE2A 3EHUA 2V93A 1KWHA 3VVEA 3DM0A 5AA2A 4XKRA 2OLBA 1M5BA 3RUMA 3B7DA 3U92A 5KCJB 3QK6A 4R9GA 1URSA 3D1RA 3FD3A 4U22A 3IFAA 2ZYMA 1PEBA 4U4SA 4DCXA 1LEVA 5CRYA 1FTAA 3ISPA 4I3EA 4KCDA 1H44A 1LBBA 4HS7A 4KQPA 1SDXA 3C35A 3S9LC 4DZ1A 3LSFB 2QS3A 4NG7A 3TUSA 3N6UA 2CZHA 3PMVA 2RINA 2Q88A 4H0WA 1NV4A 1GTKA 4MBPA 4KD5A 1B7UA 1AOVA 4PETA 1US5A 1AWBA 1OVTA 3MVXA 4IO5A 3MSTA 3OO6A 1N84A 4OFLA 4O3BA 1JNFA 3K6XA 4X8RA 1GV8A 2RC7A 3MVWA 1CE2A 3DP6A 2P3NA 2B3FA 4R2FA 4LVQA 4DIGA 4XKPA 4H45A 4H46A 4F3GA 2Q2AA 1MQHA 5IZ3A 4LQ5A 1P1NA 1H76A 2OX3A 2DDKA 4YKIA 1RDZA 3SZPA 1MM6A 4R75A 2THIA 1LGBC 2O7UA 1FPEA 1XC1A 3ODBA 1ANFA 2QS2A 5CM6A 3PUVE 1DSNA 1LBCA 1LAHE 2UYEA 3E79A 4GL0A 4EXKA 4MLVA 4MLQA 4OVRA 3OO9A 5I5PA 5TPAB 2F78A 3RYDA 1FQFA 5AE4A 3K6UA 1Q35A 5H8HA 4TQUQ 1QVSA 2DQVA 4F19A 5HPQA 5IZ1A 1LFHA 4R73A 2I49A 5I2NA 2YJPA 3PV0E 1FQAA 4BDNA 2Q8JA 2DXYA 3LV0A 1MPDA 1VSOA 3CVGA 4PGPA 4RPOA 3OXNA 4LN5A 4IGRA 2HZLA 2Y7RA 4FORA 4O3AA 4GLIA 1NV1A 1NL5A 2PFYA 4EQ7A 4H5GA 1FCKA 3BKIB 2AL5A 1MXUA 4PBQA 2QMXA 2XA5A 1N7XA 1J1NA 2V3TA 3K1NA 5CI5A 5DVJA 3IFCA 3MZ1A 5EQ7A 3RQTA 1NV3A 3TDJA 1B7ZA 4NMYA 3MPKA 4U2RA 2CMOA 1OLAA 4X1BA 4NWCA 3FZVA 1XT8A 3FGSA 4ZEKA 1B4ZA 4PGNA 2WX9A 5I57A 5CMBA 3LSWA 1TT1A 1INPA 1FSAA 2FVZA 2DWJA 4AS5A 4BDRA 3KJ7A 1NNPA 2Z8DA 3OMBA 3GBAA 4KR5A 2D5WA 2DVZA 2NXOA 1ZMGA 3IB0A 1JP4A 1B0LA 4EQBA 3MC2A 1IMBA 4IGTA 5LOMA 1Y9UA 2I48A 5I59B 3LC8A 5H8FA 1MDQA 1AMFA 4YMAA 1BLFA 2H9BA 1Q9DA 2Y5LA 1BK4A 4PFRA 5AA3A 3PTYA 1LBXA 1P1WA 1NV6A 3C33A 2VPNA 5ET8A 3LR1A 2F34A 4HE1A 1FBGA 2HZKA 2IA4A 3CSGA 1I6AA 4UABA 2KQZA 4JVCA 1JW5A 3C4MA 4KYSA 1IITA 2DE2A 2QVVA 3MJNA 4N6PA 3SETA 3KGCA 3Q29A 1LB9A 2VPOA 3F11A 5F7VA 1EH3A 3IX1A 1FPLA 2QS1A 2BJIA 4GQOA 3TQWA 4GWXA 4C0RA 4N8YA 3O6GA 2O51A 3MVZA 2XXPA 4IO3A 1I6QA 3T96B 2XHDA 3H6WA 3LUYA 4F3BA 4ELRA 2PT1A 2RCAA 5EQ8A 1Y3QA 1FJ9A 4GX3A 1A8FA 1VFEA 3CHGA 3VVFA 3KC1A 1RYOA 5ITOA 5A5XA 2AL4A 3FVKA 4GX6A 1MY3A 4O3CA 1UIVA 1JETA 3G3IA 5ESYA 2F3BA 3KN7A 3FASA 3SESA 3Q26A 4LUBA 3K1MA 1N04A 4MF3A 2O68A 3T1BA 4QFLA 1IMEA 2WEFA 2F35A 4BDOA 2XX9A 5HBCA 5EYFA 1PB9A 2XXRA 3O97A 5I58A 1SW4A 2Q89A 1ATGA 5CBSA 4GWYA 3B6WA 5K2YA 2DYXA 1URDA 3O9PA 4Z0IA 3OENA 5J1DA 2I3WA 2DP8A 3S2VA 1IMAA 2HPGA 5H8QA 4R72A 1M5DA 3UIFA 3A3UA 4ZZEA 2RC8A 1EZOA 2DVCA 1FTLA 1RKMA 2XXTA 2QSXA 3K01A 1H45A 4H8JA 1ZJLA 2F5XA 1POTA 1PBQA 4XXUA 1QUIA 2ZMBA 1IXCA 3QUJA 5H8NB 2V3QA 3E4RA 3FVNA 4PFTA 2KLFA 3BIHA 5FHNA 4NF4B 2GQ1A 1OIBA 1GGGA 4BDMA 3JZJA 3N6TA 3CFLA 3I6VA 3OO7A 3TEPA 3RPLA 1B1HA 1TFDA 2OWZA 3UA8A 2DWAA 5JEIA 3PD9A 4HCYA 4Q5TA 3B50A 4XEQA 1B9JA 5JK4A 4H8IA 2DSFA 3HO7A 1LAXA 3NOHA 4AB6A 1LB8A 2F97A 3I3VA 3IL1B 4MH5A 2XX8A 3MWBA 4POWA 4DDDA 3RT6B 2OWTA 4RK9A 1NMUA 1MY2A 1Z7ME 4OANA 2QVRA 4PC9A 4HW8A 1GVCA 3U72A 5AA4B 1PB7A 4HTGA 3KOTA 3MW0A 3HN0A 3TQLA 1FTMA 4RA1A 3HHFA 3CR9A 1MXVA 2HQ0A 1EYIA 3FV1A 5FTIA 1Y3NA 5ET7A 1N76A 4XF5A 2ALUA 4F3PA 2OJTA 1LCFA 4GXAA 3ONMA 2OK2A 3CFZA 4OWDA 3PPQA 4NX1A 2DXRA 5L9SA 4GIZA 1IMCA 4MNPA 3QMFA 3ILUB 3QAXA 5I2KB 3MQ9A 5DYHA 1ZKBA 3N94A 3QSLA 3DELB 1OLCA 3PUYE 5CMKA 4N81A 4JVDA 4OFOA 1XVYA 3G3HA 3TCGA 2XXIA 3MZBA 1QUJA 2RKMA 4MX6A 4PDHA 4ECFA 1UTBB 3KN8A 3H4ZA 1K9YA 1GR2A 1NNTA 4NHBA 3OSQA 4N13A 4PBHA 2I4CA 4BLAA 1Y4CA 4I62A 2XX7A 4ND9A 4GWSA 4QRZA 3GYYA 3MYUA 1BIYA 4KPTA 2FIEA 2R71A 3UK4A 3Q27A 1SW1A 4QSEA 1H3DA 2QPQA 1FPIA 3RT8A 4PFUA 1EU8A 2MKZA 4G4PA 2DE4A 4MFIA 3IJOB 3K0VA 3G7WA 2GH9A 2ANJA 1NNKA 1QW0A 4Z7EA 4U23A 2W7YA 1B7HA 3K4UA 4PFWA 1P1OA 2QVUA 4F3SA 4GX4A 3PUXE 4OERA 1YXIA 3FXBA 4PTKA 1MPCA 4EUOA 3RPWA 5TPAA 2R8TA 3DP4A 1B4HA 4ELPA 1YCJA 4OYVA 1Y20A 4Q8RA 2OCUA 1A55A 4OESA 5ELVA 3AXFA 2ABHA 4N6KA 2X7PA 3IOUA 4ZEIA 4JXIA 4F31B 3TELA 3ZKLA 1M5FA 1UTHB 3SDFA 1WODA 2XXQA 4GWWA 4PP0A 3O28A 3IB2A 4WKMA 1MXWA 2XXUA 3CSBA 2G29A 4ZEDA 4DI4B 2QMWA 4FEBA 5EQAA 2HAVA 2FIXA 1IXIA 1UQWA 1FBCA 1P99A 2DWIA 2F6PA 3G3FA 3BBRA 3LUZA 5DVIA 4GOTA 4TLMB 3E78A 2O7IA 2ZXTA 3N26A 1A8EA 3HV1A 2BJJX 1NV7A 4LP2B 4H65A 1A7LA 2WBDA 4EF2A 2O6AA 4U1OA 2VT5A 3FVOA 4HXVA 3KG2A 1VFDA 4OVQA 1TXFA 1R6ZA 2ZNSA 2XXHA 3USDA 1SD3A 4FEDA 4NF5B 2Y7IA 1KZ8A 3KBRA 4MCOA 4IO7A 3VXCA 4N6DA 3TTMA 4JWXA 4R9FA 1MXXA 3IB1A 4E0XA 4G68C 1IXGA 2HXWA 1S9TA 3ZS6A 4THIA 2PT2A 1NUXA 1YPNA 4TLLB 3DLNA 1L5TA 1FPKA 5DVFA 3VLUA 2CZKA 3K2DA 1N0TA 2AYSA 1AL3A 3V5AA 3B6TA 3H6VA 1MXYA 2PYYA 3A3CA 5AA1A 4QSDA 3EF7A 1B2HA 1JEUA 3FUZA 3OSRA 2P2AA 3CFXA 4AQ4A 3ECRA 2I6EA 2HFBA 1POY1 2HXRA 1TWYA 1DPEA 4PE3A 4P47A 4P0IA 3T93B 2D3IA 2H4IA 3O6IA 1IIWA 5B7DA 1LFIA 3C32A 1B0HA 1DOTA 1KA0A 2VGQA 3LSXA 1WVJA 4OHNA 3SERA 1OQHA 4QF9A 4ZE9A 3SEVA 4F2OA 2Z8EA 1EYJA 2O1LA 1CNQA 1MY1A 2F3DA 1JW4A 2B65A 4UACA 2X7QA 1NUZA 2VD3A 4U1ZA 2H5YA 4PDDA 3GBBA 3PUWE 3O2AA 3PD8A 3R6UA 3TAJA 1I6BA 4JWOA 5FBPA 5M2VA 4NF8B 3T9UA 2HEUA 1NUWA 1US4A 3FJGA 4Q0CA 2QS4A 3M3LA 2I0BA 1NKXA 2I3VA 3K6WA 2P3VA 1LFGA 5IZ3B 1RDYA 4IY6A 4YAHX 2F7AA 3HCQA 3TTLA 1JVYA 3V8XB 2XXVA 3U1OA 3SKPA 4X9TA 3BIGA 1VR5A 1Y1MA 3RLFE 1SVXB 3U94A 2O69A 1IUDA 4FJPA 4NTLA 1EZ9A 5H8NA 4F29A 3TCFA 2O1MA 4NF4A 3FV2A 4FE8A 4RPNA 4YKKA 3SEYA 4OVTA 3PMXA 2HAUA 2Y7KA 4HE0A 3U93A 4O7IA 1R9QA 2V25A 4IB2A 2A5TA 2NWJA 4POXA 5J16A 5TU0A 2FYIA 3PUZE 4R6HA 2F36A 4MJOA 2M8CA 4I9DA 3MP8A 1LCTA 1II5A 1MQDA 4NN3A 4ZZAA 3H6TA 3C31A 1YZ0A 1MH3A 2REJA 3O29A 3PPRA 2G93A 1HSLA 5LTCA 3W9WA 3H7MA 3TFLA 1FPFA 1DK4A 3LSLA 5ISUA 4PFBA 3HHGA 1EYKA 5AA4A 1USYH 4MMPA 4G68A 4IO4A 4LZ8A 1ZLQA 3IORA 1B46A 2GHAA 3WAEA 1SW2A 3H03A 5JTYA 4LATA 1JVXA 3FATA 3IO6A 4FBPA 2HCAA 3VLWA 2REGA 1IXHA 5H8SA 1DMBA 4MNIA 4RK2A 3W9VA 3DP8A 4OA4A 4P1LA 2XWKA 2JJKA 4H6DA 3A29A 5IAIA 5I2KA 4YB6A 3PPOA 4N8GA 1S50A 3SEUA 3T22A 1O7TA 1FQDA 3IOWA 1D9QA 2Q8MA 2RC9A 3UORA 4GBVA 4F1YA 4NF6A 3VVDA 5CC2A 1UTBA 2XWOA 1JEVA 5I56B 5H8FB 2DE3A 2PCRA 5ICTA 1Y1ZA 2F8DA 1MPBA 3IOVA 3QUFA 2QRYA 2F7BA 4U4XA 1FPDA 1EZPA 4C1TA 1D3KA 4ELQA 5TP9B 2B3BA 1MQGA 3HFUA 4MNCA 3H6UA 1NH7A 4PFYA 4PAIA 2I0CA 4PF8A 3CG1A 4NAPA 1FBEA 1NV5A 3T0JA 3PU5A 1IMFA 4AS4A 3FXRA 4ZDMA 2QL3A 4NGUA 2DS9A 1FQCA 3IR1A 1DBZA 3HPIA 4ISUA 3L6HA 1QULA 3FXQA 4P11A 3T9HB 5EYHA 1FTOA 3RN8A 4EDPA 1SBPA 1PDAA 2DWHA 1WDNA 1TFAA 5KCJA 1P1UA 1F9BA 5A5XB 4FAJA 2D21A 5F1QA 1JW1A 4ONYA 4IY5A 3C36A 3FVGA 3E13X 4GL8A 3Q25A 4DCYA 2GFEA 1LLSA 2XWVA 4F39A 1B58A 1UTHA 3FBPA 4KYDA 5L9MA 1R9LA 4NWDA 2ONRA 1SI1A 1MG1A 1DTGA 2FA7A 1IEJA 2UXAA 4IO2A 5KDTB 2PBWA 4QFNA 3FJ7A 1BTJA 1IQ7A 4JSOA 1SYIA 1B5JA 1FBPA 2ZNTA 4PF6A 3K1PA 2E1SA 2UVHA 2Y7WA 4O8MA 2XXYA 3TKDA 4QSCA 1NH8A 4YB7A 3KEIA 2B4MA 2QFLA 1ELJA 1KA1A 4G8MA 1O63A 4ZEBA 1DCUA 1QKAA 4GVOA 5ITPA 3TTRA 4FIMA 1UIUA 3RPLB 5CBRA 1LBZA 3OELA 4NF0A 4NF5A 5EQ9A 3MVYA 2RCBA 1XHYA 5KZTA 4KFQA 4H1XA 1PB8A 2CEXA 2ZYNA 4GXSB 1IZ1A 4G61A 1N3XA 2DOJA 3U65A 3EPEA 3UN6A 4LONB 2KR0A 4YKJA 4EQ9A 2H98A 3EKIA 3V89B 4G8HA 1NFTA 4LZ7A 5IZZA 3S9MC 4I3YA 1BP5A 4P1EA 3OOAA 4E0WA 4ESWA 3MUQA 1T0KA 4R74A 1PC3A 3K00A 4XKQA 1SI0A 4XKNA 3VXBA 1A54A 2V84A 2PMSA 3T9VA 2Y7PA 2R9JA 4R6KA 3M8UA 3A09A 1FW0A 4ESXA 2FNCA 4R2BA 4GWOA 1B3EA 2HHMA 1SQYA 1A40A 2F7CA 3THIA 1LSTA 3B8BA 5I7IA 4M1VA 3OO8A 4OTEA 2AIXA 2E0SA 4OFJA 3TMGA 3K6VA 1Q1KA 1VDWA 5T3JA 4QHQA 2ZYOA 3E9XA 5CMCA 4JVIA 2OWSA 3T66A 2ZYKA 4QBAA 2CEYA 3SEXA 2Z22A 5DEXB 4KI0E 1AH5A 4NF8A 4OXVA 3VV5A 2UVIA 3QYTA 3PPNA 4DLDA 2RF1A 3S9EA 1FPJA 3WAFA 3RTFB 3I5OA 3KN3A 3RY3A 1A99A 2WYKA 4AB5A 2Q2CA 4P9KA 3KOSA 2PFZA 3MBPA 2WYPA 1HSEA 3VLVA 5I59A 1FRPA 4BDLA 1N3WA 4Q30B 4XFEA 3H06B 4KYEA 1B3HA 4MHFA 1K9ZA 3EN3A 4UA8A 3KSXA 1NUYA 5AA2B 1OVBA 3RGYA 2XXKA 2ONSA 3GLBA 4JDFA 5FHOA 3C34A 4P3LA 3M3KA 4RNSA 5ET6A 3D4CA 1D9VA 3OD7A 4NE4A 4ZECA 3JYRA 4MAGA 2CZLA 3G3GA 4XTCQ 1FBDA 2WBBA 4RY1A 3CRBA 4WXJA 3GZGA 2NOOA 2ZZWA 4DXUA 1LBYA 4ZE8A 5I3SA 2XD2A 3N5LA 1MS7A 4GFRA 2V3UA 3H3GA 1NI9A 1B32A 2XD3A 1PBPA 4R6YA 3UGWA 1ZIUA 2PVUA 4N07A 4IO6A 1FBHA 4OENA 2PX1A 4FECA 2XWIA 3SEWA 3G3JA 1QKBA 4U21A 1MDP1 1QGXA 1DTZA 5BUUA 4RYAA 3FJMA 5LDZA 4YZZA 2ZNUA 4LZ5A 3R7XA 3KFMA 4F1VA 4BDQA 2XXWA 1MY4A 1FJ6A 4ZEFA 3IO4A 4GF8A 1FQBA 2P0SA 4KHZE 4H5FA 1AIVA 2WKYA 2R6GE 5HM4B 5ET5A 2Y84A 5DTBA 3KBZA 4LQ2A 1ZTYA 4X48A 2VHAA 1USYE 4MIJA 2NUVA 4C1UA 1LBVA 2P1SA 4F1UA 3OEKA 4QFOA 5I56A 1MQJA 4KCCA 3GXAA 1D4NA 4F2QA 2CZIA 4O7MA 5AA2D 3K02A 4OVJA 5H8HB 1QJMA 2XXXA 4PQJA 3FXUA 5L9OA 1S7YA 5A5LA 3L6GA 5EYGA 3MZ9A 1FPBA 1Y4TA 1B5HA 5EHMA 5TP9A 2VOZA 5I2NB 2VP1A 3CI8A 4PAKA 3TTKA 4YMBA 3PPPA 5I84A 4G8NA 5F24A 3TODA 1D9YA 2I4BA 3CIJA 3JV9A 3TPAA 1Y3PA 3O66A 4WEPA 1G0IA 3TZAA 5EHSA 2LAOA 3V83A 2L5VA 1MH4A 3MPLA 4I40A 4N91A 2IEEA 4EF1A 1G0HA 1B3LA 4HCWA 4JSDA 3IK6B 3MP1A 5FTHA 1XS5A 3T9XB 4O94A 1NV0A 3VFJA 4X1DA 3KJTA 4GD5A 3ZSFA 5IKBA 2Z23A 3IAZA 4GBWA 4TOZA 2X26A 3TCHA 4GRKA 5K2XA 1NV2A 3HSTA 1FQEA 4DXBA 3EHSA 1SW5A 5I57B 5IGAA 3FIRA 1JQFA 2UVJA 1B3GA 3TYHA 1IMDA 1YYZA 1B52A 2H99A 2V4CA 1B3FA 3CG3A 3KC0A 1B6HA 4MEVA 2FBPA 3VDFA 1RYXA 1M5CA 4XIGQ 4YKPA 4RJZA 1ZBMA 5CMMA 3ILTB 4PAFA 4QFKA 3EHTA 1FPGA 3O6HA 1B05A 1BKAA 1XVXA 3KZGA 1CB6A 4DXCA 2QJEA 3U8QA 5KDTA 1FTJA 1O64A 1MQIA 2GHBA 1FTKA 4N4UA 4JB7A 5BWJA 3QXMA 1LAFE 4PCDA 2Q9TA 4JWYA 1XOCA 4JBZA 3BFTA 5DT6A 2ZZVA 2OBGA 1MXZA 5B70A 4F22A 1HSJA 2GRVA 2F6GA 4H67A 4YICA 1RDXA 1B51A 4N15A 3LBSA 2A5TB 4P0GA 4G2ZA 1LAGE 1Z7NE 3BFUA 3TTNA 4OMBA 4X04A 4IR8A 4N17A 1SPIA 2A5SA 3UP9A 3IOTA 5FHMA 1P1QA 2ESNA 2O84X 4RXLA 1OQGA 1B5IA 4OZ9A 4P8BA 3PGFA 1VE4A 2B4LA 3OEMA 1N7WA 4G68B 4QXDA 4GWZA 1DPPA 1MY0A 4L17A 1YAEA 4P56A 1B40A 1MM7A 4ZS9A 4PFIA 5DW8A 3S9NC 5JTYB 4I1DA 3MP6A
chains in the Genus database with same CATH topology
4LA9A 4M4GA 1I69A 5I58B 4NEDA 3R26A 4ELOA 1OMPA 3RNNA 3VE1B 5H8QB 4I8CA 3KSJA 4F18A 3PMWA 1YTVA 4DE8A 1R1NA 5ICQA 3QIMA 3D4GA 1NNFA 1URGA 4WEDA 2VD2A 4K3FA 3ZKKA 2H25A 3C9HA 3P7IA 3EQ1A 4NF6B 2UYFA 3G3KA 2YLNA 5L8DA 5DEXA 2ONKE 4FATA 4G77A 4OEUA 1H43A 1MRPA 3S4UA 1QUKA 1B1XA 2Z8FA 1SYHA 2UVGA 3M3FA 3Q28A 3E3KA 2YPNA 1ZU0A 4YU0A 3W15C 3RTWB 2NVUB 3IJXB 4OEVA 4OQOA 4YB5A 2OZZA 1M5EA 4EXLA 4QFPA 4OETA 4PE5B 2I58A 3MAMA 3B6QA 3EHUA 2V93A 1KWHA 3VVEA 3DM0A 5AA2A 4XKRA 2OLBA 1M5BA 3RUMA 3B7DA 3U92A 5KCJB 3QK6A 4R9GA 1URSA 3FD3A 4U22A 2ZYMA 1PEBA 4U4SA 4DCXA 5CRYA 4KCDA 1H44A 1LBBA 4HS7A 4KQPA 1SDXA 3C35A 3S9LC 4DZ1A 3LSFB 2QS3A 3TUSA 3N6UA 3PMVA 2RINA 2Q88A 4H0WA 1GTKA 4MBPA 4KD5A 1B7UA 1AOVA 4PETA 1US5A 1OVTA 3MVXA 4IO5A 3OO6A 1N84A 4OFLA 4O3BA 1JNFA 3K6XA 1GV8A 2RC7A 3MVWA 1CE2A 3DP6A 2B3FA 4R2FA 4LVQA 4DIGA 4XKPA 4F3GA 2Q2AA 1MQHA 4LQ5A 1P1NA 1H76A 4YKIA 1MM6A 4R75A 2THIA 1LGBC 2O7UA 1XC1A 3ODBA 1ANFA 2QS2A 5CM6A 3PUVE 1DSNA 1LBCA 1LAHE 2UYEA 4GL0A 4EXKA 4MLVA 4MLQA 3OO9A 5TPAB 2F78A 1FQFA 5AE4A 3K6UA 1Q35A 5H8HA 4TQUQ 1QVSA 2DQVA 4F19A 5HPQA 1LFHA 4R73A 2I49A 5I2NA 2YJPA 3PV0E 1FQAA 4BDNA 2Q8JA 2DXYA 1MPDA 1VSOA 3CVGA 4RPOA 3OXNA 4IGRA 2HZLA 2Y7RA 4FORA 4O3AA 4GLIA 1NL5A 4EQ7A 4H5GA 1FCKA 3BKIB 2AL5A 1MXUA 2QMXA 1N7XA 1J1NA 2V3TA 3K1NA 5CI5A 5DVJA 3MZ1A 3RQTA 3TDJA 1B7ZA 4NMYA 3MPKA 4U2RA 2CMOA 1OLAA 4X1BA 4NWCA 3FZVA 1XT8A 3FGSA 4ZEKA 1B4ZA 5I57A 5CMBA 3LSWA 1TT1A 2DWJA 4BDRA 3KJ7A 1NNPA 2Z8DA 3OMBA 3GBAA 4KR5A 2D5WA 2DVZA 2NXOA 1ZMGA 3IB0A 1B0LA 4EQBA 3MC2A 4IGTA 5LOMA 1Y9UA 2I48A 5I59B 3LC8A 5H8FA 1MDQA 1AMFA 4YMAA 1BLFA 2H9BA 5AA3A 1P1WA 3C33A 3LR1A 2F34A 2HZKA 2IA4A 3CSGA 1I6AA 1JW5A 3C4MA 4KYSA 1IITA 2DE2A 3MJNA 4N6PA 3SETA 3KGCA 3Q29A 1LB9A 3F11A 5F7VA 1EH3A 3IX1A 2QS1A 4GQOA 3TQWA 4C0RA 3O6GA 2O51A 3MVZA 2XXPA 4IO3A 1I6QA 3T96B 2XHDA 3H6WA 3LUYA 4F3BA 4ELRA 2PT1A 2RCAA 1Y3QA 1A8FA 1VFEA 3VVFA 1RYOA 5ITOA 5A5XA 2AL4A 3FVKA 1MY3A 4O3CA 1UIVA 1JETA 3G3IA 3KN7A 3FASA 3SESA 3Q26A 4LUBA 3K1MA 1N04A 4MF3A 2O68A 4QFLA 2F35A 4BDOA 2XX9A 5HBCA 5EYFA 1PB9A 2XXRA 3O97A 5I58A 1SW4A 2Q89A 1ATGA 5CBSA 3B6WA 5K2YA 2DYXA 1URDA 3O9PA 4Z0IA 3OENA 5J1DA 2I3WA 2DP8A 3S2VA 5H8QA 4R72A 1M5DA 3UIFA 3A3UA 4ZZEA 2RC8A 1EZOA 2DVCA 1FTLA 1RKMA 2XXTA 2QSXA 3K01A 1H45A 4H8JA 1ZJLA 2F5XA 1POTA 1PBQA 4XXUA 1QUIA 2ZMBA 1IXCA 3QUJA 5H8NB 2V3QA 3E4RA 3FVNA 4PFTA 2KLFA 5FHNA 4NF4B 1OIBA 1GGGA 4BDMA 3JZJA 3N6TA 3CFLA 3I6VA 3OO7A 3TEPA 1B1HA 1TFDA 3UA8A 2DWAA 5JEIA 3PD9A 4HCYA 4Q5TA 1B9JA 5JK4A 4H8IA 2DSFA 3HO7A 1LAXA 4AB6A 1LB8A 2F97A 3I3VA 3IL1B 4MH5A 2XX8A 3MWBA 4POWA 4DDDA 3RT6B 2OWTA 4RK9A 1NMUA 1MY2A 1Z7ME 4HW8A 1GVCA 3U72A 5AA4B 1PB7A 4HTGA 3KOTA 3MW0A 3HN0A 3TQLA 1FTMA 4RA1A 3HHFA 3CR9A 1MXVA 2HQ0A 3FV1A 5FTIA 1Y3NA 1N76A 2ALUA 4F3PA 2OJTA 1LCFA 4GXAA 3ONMA 2OK2A 3CFZA 4OWDA 3PPQA 2DXRA 5L9SA 4GIZA 3ILUB 3QAXA 5I2KB 3MQ9A 5DYHA 1ZKBA 3N94A 3QSLA 3DELB 1OLCA 3PUYE 5CMKA 4OFOA 1XVYA 3G3HA 3TCGA 2XXIA 3MZBA 1QUJA 2RKMA 4ECFA 1UTBB 3KN8A 3H4ZA 1GR2A 1NNTA 3OSQA 4N13A 2I4CA 4BLAA 1Y4CA 4I62A 2XX7A 4ND9A 4QRZA 1BIYA 4KPTA 2R71A 3UK4A 3Q27A 1SW1A 4QSEA 1H3DA 2QPQA 3RT8A 4PFUA 1EU8A 4G4PA 2DE4A 4MFIA 3IJOB 3K0VA 3G7WA 2GH9A 2ANJA 1NNKA 1QW0A 4Z7EA 4U23A 2W7YA 1B7HA 3K4UA 4PFWA 1P1OA 4F3SA 3PUXE 4OERA 1MPCA 4EUOA 3RPWA 5TPAA 3DP4A 1B4HA 4ELPA 1YCJA 4OYVA 1Y20A 4Q8RA 2OCUA 1A55A 4OESA 5ELVA 3AXFA 2ABHA 2X7PA 3IOUA 4ZEIA 4JXIA 4F31B 3TELA 3ZKLA 1M5FA 1UTHB 3SDFA 1WODA 2XXQA 4PP0A 3O28A 3IB2A 4WKMA 1MXWA 2XXUA 3CSBA 2G29A 4ZEDA 2QMWA 4FEBA 2HAVA 1IXIA 1UQWA 1P99A 2DWIA 2F6PA 3G3FA 3BBRA 5DVIA 4GOTA 4TLMB 2O7IA 2ZXTA 3N26A 1A8EA 3HV1A 2BJJX 4LP2B 4H65A 1A7LA 4EF2A 2O6AA 4U1OA 3FVOA 3KG2A 1VFDA 1TXFA 1R6ZA 2ZNSA 2XXHA 3USDA 1SD3A 4FEDA 2Y7IA 3KBRA 4NF5B 4IO7A 3VXCA 3TTMA 4JWXA 4R9FA 1MXXA 3IB1A 4E0XA 4G68C 1IXGA 2HXWA 1S9TA 3ZS6A 4THIA 2PT2A 1YPNA 4TLLB 3DLNA 1L5TA 5DVFA 3VLUA 3K2DA 1N0TA 2AYSA 1AL3A 3V5AA 3B6TA 3H6VA 1MXYA 2PYYA 3A3CA 5AA1A 4QSDA 3EF7A 1B2HA 1JEUA 3FUZA 3OSRA 2P2AA 3CFXA 4AQ4A 3ECRA 2I6EA 2HFBA 1POY1 1TWYA 1DPEA 4P0IA 3T93B 2D3IA 2H4IA 3O6IA 1IIWA 5B7DA 1LFIA 3C32A 1B0HA 1DOTA 2VGQA 3LSXA 1WVJA 4OHNA 3SERA 1OQHA 4QF9A 4ZE9A 3SEVA 4F2OA 2Z8EA 2O1LA 1MY1A 1JW4A 2B65A 4UACA 2X7QA 2VD3A 4U1ZA 2H5YA 3GBBA 3PUWE 3O2AA 3PD8A 3R6UA 3TAJA 1I6BA 4JWOA 5M2VA 4NF8B 3T9UA 2HEUA 1US4A 3FJGA 4Q0CA 2QS4A 3M3LA 2I0BA 1NKXA 2I3VA 3K6WA 1LFGA 4IY6A 4YAHX 2F7AA 3HCQA 3TTLA 1JVYA 3V8XB 2XXVA 3U1OA 3SKPA 4X9TA 1VR5A 1Y1MA 3RLFE 1SVXB 3U94A 2O69A 1IUDA 4FJPA 4NTLA 1EZ9A 5H8NA 4F29A 3TCFA 2O1MA 4NF4A 3FV2A 4FE8A 4RPNA 4YKKA 3SEYA 3PMXA 2HAUA 2Y7KA 3U93A 1R9QA 2V25A 4IB2A 2A5TA 2NWJA 4POXA 5TU0A 2FYIA 3PUZE 4R6HA 2F36A 2M8CA 4I9DA 3MP8A 1LCTA 1II5A 1MQDA 4ZZAA 3H6TA 3C31A 1MH3A 2REJA 3O29A 3PPRA 2G93A 1HSLA 3W9WA 3H7MA 3TFLA 3LSLA 5ISUA 3HHGA 5AA4A 1USYH 4G68A 4IO4A 4LZ8A 1ZLQA 3IORA 1B46A 2GHAA 3WAEA 1SW2A 3H03A 5JTYA 4LATA 1JVXA 3FATA 3IO6A 2HCAA 3VLWA 2REGA 1IXHA 5H8SA 1DMBA 4RK2A 3W9VA 3DP8A 4H6DA 5IAIA 5I2KA 4YB6A 3PPOA 1S50A 3SEUA 3T22A 1O7TA 1FQDA 3IOWA 2RC9A 3UORA 4F1YA 4NF6A 3VVDA 5CC2A 1UTBA 1JEVA 5I56B 5H8FB 2DE3A 5ICTA 1Y1ZA 2F8DA 1MPBA 3IOVA 3QUFA 2QRYA 2F7BA 4U4XA 1EZPA 4C1TA 1D3KA 4ELQA 5TP9B 2B3BA 1MQGA 3H6UA 1NH7A 4PFYA 2I0CA 3CG1A 3PU5A 3FXRA 4ZDMA 2QL3A 2DS9A 1FQCA 3IR1A 3HPIA 3L6HA 4ISUA 1QULA 3FXQA 4P11A 3T9HB 1FTOA 3RN8A 4EDPA 1SBPA 1PDAA 2DWHA 1WDNA 1TFAA 5KCJA 1P1UA 1F9BA 5A5XB 4FAJA 2D21A 5F1QA 1JW1A 4ONYA 4IY5A 3C36A 3FVGA 3E13X 4GL8A 3Q25A 4DCYA 2GFEA 1LLSA 4F39A 1B58A 1UTHA 4KYDA 5L9MA 1R9LA 4NWDA 2ONRA 1SI1A 1MG1A 1DTGA 2FA7A 1IEJA 2UXAA 4IO2A 5KDTB 2PBWA 4QFNA 3FJ7A 1BTJA 1IQ7A 4JSOA 1SYIA 1B5JA 2ZNTA 3K1PA 2E1SA 2UVHA 2Y7WA 2XXYA 3TKDA 4QSCA 1NH8A 4YB7A 3KEIA 1ELJA 4G8MA 1O63A 4ZEBA 4GVOA 1QKAA 5ITPA 3TTRA 4FIMA 1UIUA 5CBRA 3OELA 4NF5A 3MVYA 2RCBA 1XHYA 5KZTA 4KFQA 4H1XA 1PB8A 2ZYNA 4GXSB 1IZ1A 1N3XA 2DOJA 3EPEA 3UN6A 4LONB 4YKJA 4EQ9A 2H98A 3V89B 4G8HA 1NFTA 4LZ7A 3S9MC 1BP5A 3OOAA 4E0WA 4ESWA 3MUQA 1T0KA 4R74A 1PC3A 3K00A 4XKQA 1SI0A 4XKNA 3VXBA 1A54A 2V84A 2PMSA 3T9VA 2Y7PA 2R9JA 4R6KA 3M8UA 3A09A 1FW0A 4ESXA 2FNCA 4R2BA 4GWOA 1B3EA 1SQYA 1A40A 2F7CA 3THIA 1LSTA 4M1VA 3OO8A 4OTEA 2AIXA 2E0SA 4OFJA 3TMGA 3K6VA 1Q1KA 4QHQA 2ZYOA 3E9XA 5CMCA 2OWSA 3T66A 2ZYKA 3SEXA 2Z22A 5DEXB 4KI0E 1AH5A 4NF8A 4OXVA 3VV5A 2UVIA 3QYTA 3PPNA 4DLDA 2RF1A 3S9EA 3WAFA 3RTFB 3I5OA 3KN3A 3RY3A 1A99A 4AB5A 2Q2CA 3KOSA 3MBPA 1HSEA 3VLVA 5I59A 4BDLA 1N3WA 4Q30B 3H06B 4KYEA 1B3HA 3EN3A 4UA8A 3KSXA 5AA2B 1OVBA 3RGYA 2ONSA 3GLBA 4JDFA 5FHOA 3C34A 3M3KA 4RNSA 3D4CA 1D9VA 3OD7A 4NE4A 4ZECA 3JYRA 2CZLA 3G3GA 4XTCQ 4RY1A 3CRBA 4WXJA 3GZGA 2NOOA 4DXUA 4ZE8A 2XD2A 3N5LA 1MS7A 4GFRA 2V3UA 3H3GA 1B32A 2XD3A 1PBPA 4R6YA 3UGWA 1ZIUA 2PVUA 4N07A 4IO6A 4OENA 2PX1A 4FECA 3SEWA 3G3JA 1QKBA 4U21A 1MDP1 1DTZA 5BUUA 4RYAA 3FJMA 4YZZA 2ZNUA 4LZ5A 3R7XA 3KFMA 4F1VA 4BDQA 2XXWA 1MY4A 4ZEFA 3IO4A 4GF8A 1FQBA 2P0SA 4KHZE 4H5FA 1AIVA 2WKYA 2R6GE 5HM4B 2Y84A 5DTBA 4LQ2A 1ZTYA 4X48A 2VHAA 1USYE 2NUVA 4C1UA 2P1SA 4F1UA 3OEKA 4QFOA 5I56A 1MQJA 4KCCA 3GXAA 1D4NA 4F2QA 5AA2D 3K02A 4OVJA 5H8HB 1QJMA 2XXXA 4PQJA 3FXUA 5L9OA 1S7YA 3L6GA 3MZ9A 1Y4TA 1B5HA 5EHMA 5TP9A 2VOZA 5I2NB 2VP1A 3CI8A 3TTKA 4YMBA 3PPPA 5I84A 4G8NA 3TODA 1D9YA 2I4BA 3CIJA 3JV9A 3TPAA 1Y3PA 3O66A 4WEPA 3TZAA 5EHSA 2LAOA 3V83A 1MH4A 3MPLA 2IEEA 4EF1A 1B3LA 4HCWA 4JSDA 3IK6B 3MP1A 5FTHA 1XS5A 3T9XB 3VFJA 4X1DA 3KJTA 4GD5A 3ZSFA 5IKBA 2Z23A 3IAZA 4TOZA 2X26A 3TCHA 4GRKA 5K2XA 3HSTA 1FQEA 4DXBA 3EHSA 1SW5A 5I57B 3FIRA 1JQFA 2UVJA 1B3GA 3TYHA 1B52A 2H99A 1B3FA 3CG3A 1B6HA 3VDFA 1RYXA 1M5CA 4XIGQ 4YKPA 4RJZA 1ZBMA 5CMMA 3ILTB 4QFKA 3EHTA 3O6HA 1B05A 1BKAA 1XVXA 3KZGA 1CB6A 4DXCA 2QJEA 3U8QA 5KDTA 1FTJA 1O64A 1MQIA 2GHBA 1FTKA 4JB7A 5BWJA 3QXMA 1LAFE 2Q9TA 4JWYA 1XOCA 4JBZA 3BFTA 5DT6A 2OBGA 1MXZA 5B70A 4F22A 1HSJA 2GRVA 2F6GA 4H67A 4YICA 1B51A 3LBSA 2A5TB 4P0GA 4G2ZA 1LAGE 1Z7NE 3BFUA 3TTNA 4OMBA 2A5SA 3UP9A 3IOTA 5FHMA 1P1QA 2ESNA 2O84X 4RXLA 1OQGA 1B5IA 4OZ9A 3PGFA 1VE4A 3OEMA 1N7WA 4G68B 4L17A 1DPPA 1MY0A 1YAEA 1B40A 1MM7A 4ZS9A 3S9NC 5JTYB 4I1DA 3MP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LA9 A;  4M4G A;  1I69 A;  5I58 B;  4NED A;  3R26 A;  4ELO A;  1OMP A;  3RNN A;  3VE1 B;  5H8Q B;  4I8C A;  3KSJ A;  4F18 A;  3PMW A;  1YTV A;  4DE8 A;  1R1N A;  5ICQ A;  3QIM A;  3D4G A;  1NNF A;  1URG A;  4WED A;  2VD2 A;  4K3F A;  3ZKK A;  2H25 A;  3C9H A;  3P7I A;  3EQ1 A;  4NF6 B;  2UYF A;  3G3K A;  2YLN A;  5L8D A;  5DEX A;  2ONK E;  4FAT A;  4G77 A;  4OEU A;  1H43 A;  1MRP A;  3S4U A;  1QUK A;  1B1X A;  2Z8F A;  1SYH A;  2UVG A;  3M3F A;  3Q28 A;  3E3K A;  2YPN A;  1ZU0 A;  4YU0 A;  3W15 C;  3RTW B;  2NVU B;  3IJX B;  4OEV A;  4OQO A;  4YB5 A;  2OZZ A;  1M5E A;  4EXL A;  4QFP A;  4OET A;  4PE5 B;  2I58 A;  3MAM A;  3B6Q A;  3EHU A;  2V93 A;  1KWH A;  3VVE A;  3DM0 A;  5AA2 A;  4XKR A;  2OLB A;  1M5B A;  3RUM A;  3B7D A;  3U92 A;  5KCJ B;  3QK6 A;  4R9G A;  1URS A;  3FD3 A;  4U22 A;  2ZYM A;  1PEB A;  4U4S A;  4DCX A;  5CRY A;  4KCD A;  1H44 A;  1LBB A;  4HS7 A;  4KQP A;  1SDX A;  3C35 A;  3S9L C;  4DZ1 A;  3LSF B;  2QS3 A;  3TUS A;  3N6U A;  3PMV A;  2RIN A;  2Q88 A;  4H0W A;  1GTK A;  4MBP A;  4KD5 A;  1B7U A;  1AOV A;  4PET A;  1US5 A;  1OVT A;  3MVX A;  4IO5 A;  3OO6 A;  1N84 A;  4OFL A;  4O3B A;  1JNF A;  3K6X A;  1GV8 A;  2RC7 A;  3MVW A;  1CE2 A;  3DP6 A;  2B3F A;  4R2F A;  4LVQ A;  4DIG A;  4XKP A;  4F3G A;  2Q2A A;  1MQH A;  4LQ5 A;  1P1N A;  1H76 A;  4YKI A;  1MM6 A;  4R75 A;  2THI A;  1LGB C;  2O7U A;  1XC1 A;  3ODB A;  1ANF A;  2QS2 A;  5CM6 A;  3PUV E;  1DSN A;  1LBC A;  1LAH E;  2UYE A;  4GL0 A;  4EXK A;  4MLV A;  4MLQ A;  3OO9 A;  5TPA B;  2F78 A;  1FQF A;  5AE4 A;  3K6U A;  1Q35 A;  5H8H A;  4TQU Q;  1QVS A;  2DQV A;  4F19 A;  5HPQ A;  1LFH A;  4R73 A;  2I49 A;  5I2N A;  2YJP A;  3PV0 E;  1FQA A;  4BDN A;  2Q8J A;  2DXY A;  1MPD A;  1VSO A;  3CVG A;  4RPO A;  3OXN A;  4IGR A;  2HZL A;  2Y7R A;  4FOR A;  4O3A A;  4GLI A;  1NL5 A;  4EQ7 A;  4H5G A;  1FCK A;  3BKI B;  2AL5 A;  1MXU A;  2QMX A;  1N7X A;  1J1N A;  2V3T A;  3K1N A;  5CI5 A;  5DVJ A;  3MZ1 A;  3RQT A;  3TDJ A;  1B7Z A;  4NMY A;  3MPK A;  4U2R A;  2CMO A;  1OLA A;  4X1B A;  4NWC A;  3FZV A;  1XT8 A;  3FGS A;  4ZEK A;  1B4Z A;  5I57 A;  5CMB A;  3LSW A;  1TT1 A;  2DWJ A;  4BDR A;  3KJ7 A;  1NNP A;  2Z8D A;  3OMB A;  3GBA A;  4KR5 A;  2D5W A;  2DVZ A;  2NXO A;  1ZMG A;  3IB0 A;  1B0L A;  4EQB A;  3MC2 A;  4IGT A;  5LOM A;  1Y9U A;  2I48 A;  5I59 B;  3LC8 A;  5H8F A;  1MDQ A;  1AMF A;  4YMA A;  1BLF A;  2H9B A;  5AA3 A;  1P1W A;  3C33 A;  3LR1 A;  2F34 A;  2HZK A;  2IA4 A;  3CSG A;  1I6A A;  1JW5 A;  3C4M A;  4KYS A;  1IIT A;  2DE2 A;  3MJN A;  4N6P A;  3SET A;  3KGC A;  3Q29 A;  1LB9 A;  3F11 A;  5F7V A;  1EH3 A;  3IX1 A;  2QS1 A;  4GQO A;  3TQW A;  4C0R A;  3O6G A;  2O51 A;  3MVZ A;  2XXP A;  4IO3 A;  1I6Q A;  3T96 B;  2XHD A;  3H6W A;  3LUY A;  4F3B A;  4ELR A;  2PT1 A;  2RCA A;  1Y3Q A;  1A8F A;  1VFE A;  3VVF A;  1RYO A;  5ITO A;  5A5X A;  2AL4 A;  3FVK A;  1MY3 A;  4O3C A;  1UIV A;  1JET A;  3G3I A;  3KN7 A;  3FAS A;  3SES A;  3Q26 A;  4LUB A;  3K1M A;  1N04 A;  4MF3 A;  2O68 A;  4QFL A;  2F35 A;  4BDO A;  2XX9 A;  5HBC A;  5EYF A;  1PB9 A;  2XXR A;  3O97 A;  5I58 A;  1SW4 A;  2Q89 A;  1ATG A;  5CBS A;  3B6W A;  5K2Y A;  2DYX A;  1URD A;  3O9P A;  4Z0I A;  3OEN A;  5J1D A;  2I3W A;  2DP8 A;  3S2V A;  5H8Q A;  4R72 A;  1M5D A;  3UIF A;  3A3U A;  4ZZE A;  2RC8 A;  1EZO A;  2DVC A;  1FTL A;  1RKM A;  2XXT A;  2QSX A;  3K01 A;  1H45 A;  4H8J A;  1ZJL A;  2F5X A;  1POT A;  1PBQ A;  4XXU A;  1QUI A;  2ZMB A;  1IXC A;  3QUJ A;  5H8N B;  2V3Q A;  3E4R A;  3FVN A;  4PFT A;  2KLF A;  5FHN A;  4NF4 B;  1OIB A;  1GGG A;  4BDM A;  3JZJ A;  3N6T A;  3CFL A;  3I6V A;  3OO7 A;  3TEP A;  1B1H A;  1TFD A;  3UA8 A;  2DWA A;  5JEI A;  3PD9 A;  4HCY A;  4Q5T A;  1B9J A;  5JK4 A;  4H8I A;  2DSF A;  3HO7 A;  1LAX A;  4AB6 A;  1LB8 A;  2F97 A;  3I3V A;  3IL1 B;  4MH5 A;  2XX8 A;  3MWB A;  4POW A;  4DDD A;  3RT6 B;  2OWT A;  4RK9 A;  1NMU A;  1MY2 A;  1Z7M E;  4HW8 A;  1GVC A;  3U72 A;  5AA4 B;  1PB7 A;  4HTG A;  3KOT A;  3MW0 A;  3HN0 A;  3TQL A;  1FTM A;  4RA1 A;  3HHF A;  3CR9 A;  1MXV A;  2HQ0 A;  3FV1 A;  5FTI A;  1Y3N A;  1N76 A;  2ALU A;  4F3P A;  2OJT A;  1LCF A;  4GXA A;  3ONM A;  2OK2 A;  3CFZ A;  4OWD A;  3PPQ A;  2DXR A;  5L9S A;  4GIZ A;  3ILU B;  3QAX A;  5I2K B;  3MQ9 A;  5DYH A;  1ZKB A;  3N94 A;  3QSL A;  3DEL B;  1OLC A;  3PUY E;  5CMK A;  4OFO A;  1XVY A;  3G3H A;  3TCG A;  2XXI A;  3MZB A;  1QUJ A;  2RKM A;  4ECF A;  1UTB B;  3KN8 A;  3H4Z A;  1GR2 A;  1NNT A;  3OSQ A;  4N13 A;  2I4C A;  4BLA A;  1Y4C A;  4I62 A;  2XX7 A;  4ND9 A;  4QRZ A;  1BIY A;  4KPT A;  2R71 A;  3UK4 A;  3Q27 A;  1SW1 A;  4QSE A;  1H3D A;  2QPQ A;  3RT8 A;  4PFU A;  1EU8 A;  4G4P A;  2DE4 A;  4MFI A;  3IJO B;  3K0V A;  3G7W A;  2GH9 A;  2ANJ A;  1NNK A;  1QW0 A;  4Z7E A;  4U23 A;  2W7Y A;  1B7H A;  3K4U A;  4PFW A;  1P1O A;  4F3S A;  3PUX E;  4OER A;  1MPC A;  4EUO A;  3RPW A;  5TPA A;  3DP4 A;  1B4H A;  4ELP A;  1YCJ A;  4OYV A;  1Y20 A;  4Q8R A;  2OCU A;  1A55 A;  4OES A;  5ELV A;  3AXF A;  2ABH A;  2X7P A;  3IOU A;  4ZEI A;  4JXI A;  4F31 B;  3TEL A;  3ZKL A;  1M5F A;  1UTH B;  3SDF A;  1WOD A;  2XXQ A;  4PP0 A;  3O28 A;  3IB2 A;  4WKM A;  1MXW A;  2XXU A;  3CSB A;  2G29 A;  4ZED A;  2QMW A;  4FEB A;  2HAV A;  1IXI A;  1UQW A;  1P99 A;  2DWI A;  2F6P A;  3G3F A;  3BBR A;  5DVI A;  4GOT A;  4TLM B;  2O7I A;  2ZXT A;  3N26 A;  1A8E A;  3HV1 A;  2BJJ X;  4LP2 B;  4H65 A;  1A7L A;  4EF2 A;  2O6A A;  4U1O A;  3FVO A;  3KG2 A;  1VFD A;  1TXF A;  1R6Z A;  2ZNS A;  2XXH A;  3USD A;  1SD3 A;  4FED A;  2Y7I A;  3KBR A;  4NF5 B;  4IO7 A;  3VXC A;  3TTM A;  4JWX A;  4R9F A;  1MXX A;  3IB1 A;  4E0X A;  4G68 C;  1IXG A;  2HXW A;  1S9T A;  3ZS6 A;  4THI A;  2PT2 A;  1YPN A;  4TLL B;  3DLN A;  1L5T A;  5DVF A;  3VLU A;  3K2D A;  1N0T A;  2AYS A;  1AL3 A;  3V5A A;  3B6T A;  3H6V A;  1MXY A;  2PYY A;  3A3C A;  5AA1 A;  4QSD A;  3EF7 A;  1B2H A;  1JEU A;  3FUZ A;  3OSR A;  2P2A A;  3CFX A;  4AQ4 A;  3ECR A;  2I6E A;  2HFB A;  1POY 1;  1TWY A;  1DPE A;  4P0I A;  3T93 B;  2D3I A;  2H4I A;  3O6I A;  1IIW A;  5B7D A;  1LFI A;  3C32 A;  1B0H A;  1DOT A;  2VGQ A;  3LSX A;  1WVJ A;  4OHN A;  3SER A;  1OQH A;  4QF9 A;  4ZE9 A;  3SEV A;  4F2O A;  2Z8E A;  2O1L A;  1MY1 A;  1JW4 A;  2B65 A;  4UAC A;  2X7Q A;  2VD3 A;  4U1Z A;  2H5Y A;  3GBB A;  3PUW E;  3O2A A;  3PD8 A;  3R6U A;  3TAJ A;  1I6B A;  4JWO A;  5M2V A;  4NF8 B;  3T9U A;  2HEU A;  1US4 A;  3FJG A;  4Q0C A;  2QS4 A;  3M3L A;  2I0B A;  1NKX A;  2I3V A;  3K6W A;  1LFG A;  4IY6 A;  4YAH X;  2F7A A;  3HCQ A;  3TTL A;  1JVY A;  3V8X B;  2XXV A;  3U1O A;  3SKP A;  4X9T A;  1VR5 A;  1Y1M A;  3RLF E;  1SVX B;  3U94 A;  2O69 A;  1IUD A;  4FJP A;  4NTL A;  1EZ9 A;  5H8N A;  4F29 A;  3TCF A;  2O1M A;  4NF4 A;  3FV2 A;  4FE8 A;  4RPN A;  4YKK A;  3SEY A;  3PMX A;  2HAU A;  2Y7K A;  3U93 A;  1R9Q A;  2V25 A;  4IB2 A;  2A5T A;  2NWJ A;  4POX A;  5TU0 A;  2FYI A;  3PUZ E;  4R6H A;  2F36 A;  2M8C A;  4I9D A;  3MP8 A;  1LCT A;  1II5 A;  1MQD A;  4ZZA A;  3H6T A;  3C31 A;  1MH3 A;  2REJ A;  3O29 A;  3PPR A;  2G93 A;  1HSL A;  3W9W A;  3H7M A;  3TFL A;  3LSL A;  5ISU A;  3HHG A;  5AA4 A;  1USY H;  4G68 A;  4IO4 A;  4LZ8 A;  1ZLQ A;  3IOR A;  1B46 A;  2GHA A;  3WAE A;  1SW2 A;  3H03 A;  5JTY A;  4LAT A;  1JVX A;  3FAT A;  3IO6 A;  2HCA A;  3VLW A;  2REG A;  1IXH A;  5H8S A;  1DMB A;  4RK2 A;  3W9V A;  3DP8 A;  4H6D A;  5IAI A;  5I2K A;  4YB6 A;  3PPO A;  1S50 A;  3SEU A;  3T22 A;  1O7T A;  1FQD A;  3IOW A;  2RC9 A;  3UOR A;  4F1Y A;  4NF6 A;  3VVD A;  5CC2 A;  1UTB A;  1JEV A;  5I56 B;  5H8F B;  2DE3 A;  5ICT A;  1Y1Z A;  2F8D A;  1MPB A;  3IOV A;  3QUF A;  2QRY A;  2F7B A;  4U4X A;  1EZP A;  4C1T A;  1D3K A;  4ELQ A;  5TP9 B;  2B3B A;  1MQG A;  3H6U A;  1NH7 A;  4PFY A;  2I0C A;  3CG1 A;  3PU5 A;  3FXR A;  4ZDM A;  2QL3 A;  2DS9 A;  1FQC A;  3IR1 A;  3HPI A;  3L6H A;  4ISU A;  1QUL A;  3FXQ A;  4P11 A;  3T9H B;  1FTO A;  3RN8 A;  4EDP A;  1SBP A;  1PDA A;  2DWH A;  1WDN A;  1TFA A;  5KCJ A;  1P1U A;  1F9B A;  5A5X B;  4FAJ A;  2D21 A;  5F1Q A;  1JW1 A;  4ONY A;  4IY5 A;  3C36 A;  3FVG A;  3E13 X;  4GL8 A;  3Q25 A;  4DCY A;  2GFE A;  1LLS A;  4F39 A;  1B58 A;  1UTH A;  4KYD A;  5L9M A;  1R9L A;  4NWD A;  2ONR A;  1SI1 A;  1MG1 A;  1DTG A;  2FA7 A;  1IEJ A;  2UXA A;  4IO2 A;  5KDT B;  2PBW A;  4QFN A;  3FJ7 A;  1BTJ A;  1IQ7 A;  4JSO A;  1SYI A;  1B5J A;  2ZNT A;  3K1P A;  2E1S A;  2UVH A;  2Y7W A;  2XXY A;  3TKD A;  4QSC A;  1NH8 A;  4YB7 A;  3KEI A;  1ELJ A;  4G8M A;  1O63 A;  4ZEB A;  4GVO A;  1QKA A;  5ITP A;  3TTR A;  4FIM A;  1UIU A;  5CBR A;  3OEL A;  4NF5 A;  3MVY A;  2RCB A;  1XHY A;  5KZT A;  4KFQ A;  4H1X A;  1PB8 A;  2ZYN A;  4GXS B;  1IZ1 A;  1N3X A;  2DOJ A;  3EPE A;  3UN6 A;  4LON B;  4YKJ A;  4EQ9 A;  2H98 A;  3V89 B;  4G8H A;  1NFT A;  4LZ7 A;  3S9M C;  1BP5 A;  3OOA A;  4E0W A;  4ESW A;  3MUQ A;  1T0K A;  4R74 A;  1PC3 A;  3K00 A;  4XKQ A;  1SI0 A;  4XKN A;  3VXB A;  1A54 A;  2V84 A;  2PMS A;  3T9V A;  2Y7P A;  2R9J A;  4R6K A;  3M8U A;  3A09 A;  1FW0 A;  4ESX A;  2FNC A;  4R2B A;  4GWO A;  1B3E A;  1SQY A;  1A40 A;  2F7C A;  3THI A;  1LST A;  4M1V A;  3OO8 A;  4OTE A;  2AIX A;  2E0S A;  4OFJ A;  3TMG A;  3K6V A;  1Q1K A;  4QHQ A;  2ZYO A;  3E9X A;  5CMC A;  2OWS A;  3T66 A;  2ZYK A;  3SEX A;  2Z22 A;  5DEX B;  4KI0 E;  1AH5 A;  4NF8 A;  4OXV A;  3VV5 A;  2UVI A;  3QYT A;  3PPN A;  4DLD A;  2RF1 A;  3S9E A;  3WAF A;  3RTF B;  3I5O A;  3KN3 A;  3RY3 A;  1A99 A;  4AB5 A;  2Q2C A;  3KOS A;  3MBP A;  1HSE A;  3VLV A;  5I59 A;  4BDL A;  1N3W A;  4Q30 B;  3H06 B;  4KYE A;  1B3H A;  3EN3 A;  4UA8 A;  3KSX A;  5AA2 B;  1OVB A;  3RGY A;  2ONS A;  3GLB A;  4JDF A;  5FHO A;  3C34 A;  3M3K A;  4RNS A;  3D4C A;  1D9V A;  3OD7 A;  4NE4 A;  4ZEC A;  3JYR A;  2CZL A;  3G3G A;  4XTC Q;  4RY1 A;  3CRB A;  4WXJ A;  3GZG A;  2NOO A;  4DXU A;  4ZE8 A;  2XD2 A;  3N5L A;  1MS7 A;  4GFR A;  2V3U A;  3H3G A;  1B32 A;  2XD3 A;  1PBP A;  4R6Y A;  3UGW A;  1ZIU A;  2PVU A;  4N07 A;  4IO6 A;  4OEN A;  2PX1 A;  4FEC A;  3SEW A;  3G3J A;  1QKB A;  4U21 A;  1MDP 1;  1DTZ A;  5BUU A;  4RYA A;  3FJM A;  4YZZ A;  2ZNU A;  4LZ5 A;  3R7X A;  3KFM A;  4F1V A;  4BDQ A;  2XXW A;  1MY4 A;  4ZEF A;  3IO4 A;  4GF8 A;  1FQB A;  2P0S A;  4KHZ E;  4H5F A;  1AIV A;  2WKY A;  2R6G E;  5HM4 B;  2Y84 A;  5DTB A;  4LQ2 A;  1ZTY A;  4X48 A;  2VHA A;  1USY E;  2NUV A;  4C1U A;  2P1S A;  4F1U A;  3OEK A;  4QFO A;  5I56 A;  1MQJ A;  4KCC A;  3GXA A;  1D4N A;  4F2Q A;  5AA2 D;  3K02 A;  4OVJ A;  5H8H B;  1QJM A;  2XXX A;  4PQJ A;  3FXU A;  5L9O A;  1S7Y A;  3L6G A;  3MZ9 A;  1Y4T A;  1B5H A;  5EHM A;  5TP9 A;  2VOZ A;  5I2N B;  2VP1 A;  3CI8 A;  3TTK A;  4YMB A;  3PPP A;  5I84 A;  4G8N A;  3TOD A;  1D9Y A;  2I4B A;  3CIJ A;  3JV9 A;  3TPA A;  1Y3P A;  3O66 A;  4WEP A;  3TZA A;  5EHS A;  2LAO A;  3V83 A;  1MH4 A;  3MPL A;  2IEE A;  4EF1 A;  1B3L A;  4HCW A;  4JSD A;  3IK6 B;  3MP1 A;  5FTH A;  1XS5 A;  3T9X B;  3VFJ A;  4X1D A;  3KJT A;  4GD5 A;  3ZSF A;  5IKB A;  2Z23 A;  3IAZ A;  4TOZ A;  2X26 A;  3TCH A;  4GRK A;  5K2X A;  3HST A;  1FQE A;  4DXB A;  3EHS A;  1SW5 A;  5I57 B;  3FIR A;  1JQF A;  2UVJ A;  1B3G A;  3TYH A;  1B52 A;  2H99 A;  1B3F A;  3CG3 A;  1B6H A;  3VDF A;  1RYX A;  1M5C A;  4XIG Q;  4YKP A;  4RJZ A;  1ZBM A;  5CMM A;  3ILT B;  4QFK A;  3EHT A;  3O6H A;  1B05 A;  1BKA A;  1XVX A;  3KZG A;  1CB6 A;  4DXC A;  2QJE A;  3U8Q A;  5KDT A;  1FTJ A;  1O64 A;  1MQI A;  2GHB A;  1FTK A;  4JB7 A;  5BWJ A;  3QXM A;  1LAF E;  2Q9T A;  4JWY A;  1XOC A;  4JBZ A;  3BFT A;  5DT6 A;  2OBG A;  1MXZ A;  5B70 A;  4F22 A;  1HSJ A;  2GRV A;  2F6G A;  4H67 A;  4YIC A;  1B51 A;  3LBS A;  2A5T B;  4P0G A;  4G2Z A;  1LAG E;  1Z7N E;  3BFU A;  3TTN A;  4OMB A;  2A5S A;  3UP9 A;  3IOT A;  5FHM A;  1P1Q A;  2ESN A;  2O84 X;  4RXL A;  1OQG A;  1B5I A;  4OZ9 A;  3PGF A;  1VE4 A;  3OEM A;  1N7W A;  4G68 B;  4L17 A;  1DPP A;  1MY0 A;  1YAE A;  1B40 A;  1MM7 A;  4ZS9 A;  3S9N C;  5JTY B;  4I1D A;  3MP6 A; 
#chains in the Genus database with same CATH topology
 4OVS A;  4LA9 A;  4M4G A;  1I69 A;  5I58 B;  4NED A;  3R26 A;  4ELO A;  4GWU A;  3ROJ A;  1OMP A;  3RNN A;  3VE1 B;  5H8Q B;  4I8C A;  3KSJ A;  4F18 A;  3PMW A;  1YTV A;  4DE8 A;  1R1N A;  5ICQ A;  3QIM A;  3D4G A;  1NNF A;  2ZZX A;  1URG A;  4KXP A;  4WED A;  2VD2 A;  4K3F A;  1XI6 A;  3ZKK A;  2H25 A;  3C9H A;  3P7I A;  3EQ1 A;  4NF6 B;  2UYF A;  3G3K A;  2YLN A;  5L8D A;  5DEX A;  2ONK E;  4FAT A;  4G77 A;  4OEU A;  2Y5K A;  1H43 A;  1MRP A;  4OVP A;  3S4U A;  1QUK A;  1FBF A;  1B1X A;  2Z8F A;  1SYH A;  2UVG A;  3M3F A;  3Q28 A;  3E3K A;  2FHY A;  1LBW A;  2YPN A;  5IM2 A;  1ZU0 A;  4DI3 D;  4YU0 A;  3W15 C;  3RTW B;  2NVU B;  3IJX B;  4OEV A;  4OQO A;  4YB5 A;  2OZZ A;  1M5E A;  4EXL A;  4NQ8 A;  4QFP A;  4OET A;  4PE5 B;  2I58 A;  3MAM A;  3B6Q A;  2Q74 A;  4HE2 A;  3EHU A;  2V93 A;  1KWH A;  3VVE A;  3DM0 A;  5AA2 A;  4XKR A;  2OLB A;  1M5B A;  3RUM A;  3B7D A;  3U92 A;  5KCJ B;  3QK6 A;  4R9G A;  1URS A;  3D1R A;  3FD3 A;  4U22 A;  3IFA A;  2ZYM A;  1PEB A;  4U4S A;  4DCX A;  1LEV A;  5CRY A;  1FTA A;  3ISP A;  4I3E A;  4KCD A;  1H44 A;  1LBB A;  4HS7 A;  4KQP A;  1SDX A;  3C35 A;  3S9L C;  4DZ1 A;  3LSF B;  2QS3 A;  4NG7 A;  3TUS A;  3N6U A;  2CZH A;  3PMV A;  2RIN A;  2Q88 A;  4H0W A;  1NV4 A;  1GTK A;  4MBP A;  4KD5 A;  1B7U A;  1AOV A;  4PET A;  1US5 A;  1AWB A;  1OVT A;  3MVX A;  4IO5 A;  3MST A;  3OO6 A;  1N84 A;  4OFL A;  4O3B A;  1JNF A;  3K6X A;  4X8R A;  1GV8 A;  2RC7 A;  3MVW A;  1CE2 A;  3DP6 A;  2P3N A;  2B3F A;  4R2F A;  4LVQ A;  4DIG A;  4XKP A;  4H45 A;  4H46 A;  4F3G A;  2Q2A A;  1MQH A;  5IZ3 A;  4LQ5 A;  1P1N A;  1H76 A;  2OX3 A;  2DDK A;  4YKI A;  1RDZ A;  3SZP A;  1MM6 A;  4R75 A;  2THI A;  1LGB C;  2O7U A;  1FPE A;  1XC1 A;  3ODB A;  1ANF A;  2QS2 A;  5CM6 A;  3PUV E;  1DSN A;  1LBC A;  1LAH E;  2UYE A;  3E79 A;  4GL0 A;  4EXK A;  4MLV A;  4MLQ A;  4OVR A;  3OO9 A;  5I5P A;  5TPA B;  2F78 A;  3RYD A;  1FQF A;  5AE4 A;  3K6U A;  1Q35 A;  5H8H A;  4TQU Q;  1QVS A;  2DQV A;  4F19 A;  5HPQ A;  5IZ1 A;  1LFH A;  4R73 A;  2I49 A;  5I2N A;  2YJP A;  3PV0 E;  1FQA A;  4BDN A;  2Q8J A;  2DXY A;  3LV0 A;  1MPD A;  1VSO A;  3CVG A;  4PGP A;  4RPO A;  3OXN A;  4LN5 A;  4IGR A;  2HZL A;  2Y7R A;  4FOR A;  4O3A A;  4GLI A;  1NV1 A;  1NL5 A;  2PFY A;  4EQ7 A;  4H5G A;  1FCK A;  3BKI B;  2AL5 A;  1MXU A;  4PBQ A;  2QMX A;  2XA5 A;  1N7X A;  1J1N A;  2V3T A;  3K1N A;  5CI5 A;  5DVJ A;  3IFC A;  3MZ1 A;  5EQ7 A;  3RQT A;  1NV3 A;  3TDJ A;  1B7Z A;  4NMY A;  3MPK A;  4U2R A;  2CMO A;  1OLA A;  4X1B A;  4NWC A;  3FZV A;  1XT8 A;  3FGS A;  4ZEK A;  1B4Z A;  4PGN A;  2WX9 A;  5I57 A;  5CMB A;  3LSW A;  1TT1 A;  1INP A;  1FSA A;  2FVZ A;  2DWJ A;  4AS5 A;  4BDR A;  3KJ7 A;  1NNP A;  2Z8D A;  3OMB A;  3GBA A;  4KR5 A;  2D5W A;  2DVZ A;  2NXO A;  1ZMG A;  3IB0 A;  1JP4 A;  1B0L A;  4EQB A;  3MC2 A;  1IMB A;  4IGT A;  5LOM A;  1Y9U A;  2I48 A;  5I59 B;  3LC8 A;  5H8F A;  1MDQ A;  1AMF A;  4YMA A;  1BLF A;  2H9B A;  1Q9D A;  2Y5L A;  1BK4 A;  4PFR A;  5AA3 A;  3PTY A;  1LBX A;  1P1W A;  1NV6 A;  3C33 A;  2VPN A;  5ET8 A;  3LR1 A;  2F34 A;  4HE1 A;  1FBG A;  2HZK A;  2IA4 A;  3CSG A;  1I6A A;  4UAB A;  2KQZ A;  4JVC A;  1JW5 A;  3C4M A;  4KYS A;  1IIT A;  2DE2 A;  2QVV A;  3MJN A;  4N6P A;  3SET A;  3KGC A;  3Q29 A;  1LB9 A;  2VPO A;  3F11 A;  5F7V A;  1EH3 A;  3IX1 A;  1FPL A;  2QS1 A;  2BJI A;  4GQO A;  3TQW A;  4GWX A;  4C0R A;  4N8Y A;  3O6G A;  2O51 A;  3MVZ A;  2XXP A;  4IO3 A;  1I6Q A;  3T96 B;  2XHD A;  3H6W A;  3LUY A;  4F3B A;  4ELR A;  2PT1 A;  2RCA A;  5EQ8 A;  1Y3Q A;  1FJ9 A;  4GX3 A;  1A8F A;  1VFE A;  3CHG A;  3VVF A;  3KC1 A;  1RYO A;  5ITO A;  5A5X A;  2AL4 A;  3FVK A;  4GX6 A;  1MY3 A;  4O3C A;  1UIV A;  1JET A;  3G3I A;  5ESY A;  2F3B A;  3KN7 A;  3FAS A;  3SES A;  3Q26 A;  4LUB A;  3K1M A;  1N04 A;  4MF3 A;  2O68 A;  3T1B A;  4QFL A;  1IME A;  2WEF A;  2F35 A;  4BDO A;  2XX9 A;  5HBC A;  5EYF A;  1PB9 A;  2XXR A;  3O97 A;  5I58 A;  1SW4 A;  2Q89 A;  1ATG A;  5CBS A;  4GWY A;  3B6W A;  5K2Y A;  2DYX A;  1URD A;  3O9P A;  4Z0I A;  3OEN A;  5J1D A;  2I3W A;  2DP8 A;  3S2V A;  1IMA A;  2HPG A;  5H8Q A;  4R72 A;  1M5D A;  3UIF A;  3A3U A;  4ZZE A;  2RC8 A;  1EZO A;  2DVC A;  1FTL A;  1RKM A;  2XXT A;  2QSX A;  3K01 A;  1H45 A;  4H8J A;  1ZJL A;  2F5X A;  1POT A;  1PBQ A;  4XXU A;  1QUI A;  2ZMB A;  1IXC A;  3QUJ A;  5H8N B;  2V3Q A;  3E4R A;  3FVN A;  4PFT A;  2KLF A;  3BIH A;  5FHN A;  4NF4 B;  2GQ1 A;  1OIB A;  1GGG A;  4BDM A;  3JZJ A;  3N6T A;  3CFL A;  3I6V A;  3OO7 A;  3TEP A;  3RPL A;  1B1H A;  1TFD A;  2OWZ A;  3UA8 A;  2DWA A;  5JEI A;  3PD9 A;  4HCY A;  4Q5T A;  3B50 A;  4XEQ A;  1B9J A;  5JK4 A;  4H8I A;  2DSF A;  3HO7 A;  1LAX A;  3NOH A;  4AB6 A;  1LB8 A;  2F97 A;  3I3V A;  3IL1 B;  4MH5 A;  2XX8 A;  3MWB A;  4POW A;  4DDD A;  3RT6 B;  2OWT A;  4RK9 A;  1NMU A;  1MY2 A;  1Z7M E;  4OAN A;  2QVR A;  4PC9 A;  4HW8 A;  1GVC A;  3U72 A;  5AA4 B;  1PB7 A;  4HTG A;  3KOT A;  3MW0 A;  3HN0 A;  3TQL A;  1FTM A;  4RA1 A;  3HHF A;  3CR9 A;  1MXV A;  2HQ0 A;  1EYI A;  3FV1 A;  5FTI A;  1Y3N A;  5ET7 A;  1N76 A;  4XF5 A;  2ALU A;  4F3P A;  2OJT A;  1LCF A;  4GXA A;  3ONM A;  2OK2 A;  3CFZ A;  4OWD A;  3PPQ A;  4NX1 A;  2DXR A;  5L9S A;  4GIZ A;  1IMC A;  4MNP A;  3QMF A;  3ILU B;  3QAX A;  5I2K B;  3MQ9 A;  5DYH A;  1ZKB A;  3N94 A;  3QSL A;  3DEL B;  1OLC A;  3PUY E;  5CMK A;  4N81 A;  4JVD A;  4OFO A;  1XVY A;  3G3H A;  3TCG A;  2XXI A;  3MZB A;  1QUJ A;  2RKM A;  4MX6 A;  4PDH A;  4ECF A;  1UTB B;  3KN8 A;  3H4Z A;  1K9Y A;  1GR2 A;  1NNT A;  4NHB A;  3OSQ A;  4N13 A;  4PBH A;  2I4C A;  4BLA A;  1Y4C A;  4I62 A;  2XX7 A;  4ND9 A;  4GWS A;  4QRZ A;  3GYY A;  3MYU A;  1BIY A;  4KPT A;  2FIE A;  2R71 A;  3UK4 A;  3Q27 A;  1SW1 A;  4QSE A;  1H3D A;  2QPQ A;  1FPI A;  3RT8 A;  4PFU A;  1EU8 A;  2MKZ A;  4G4P A;  2DE4 A;  4MFI A;  3IJO B;  3K0V A;  3G7W A;  2GH9 A;  2ANJ A;  1NNK A;  1QW0 A;  4Z7E A;  4U23 A;  2W7Y A;  1B7H A;  3K4U A;  4PFW A;  1P1O A;  2QVU A;  4F3S A;  4GX4 A;  3PUX E;  4OER A;  1YXI A;  3FXB A;  4PTK A;  1MPC A;  4EUO A;  3RPW A;  5TPA A;  2R8T A;  3DP4 A;  1B4H A;  4ELP A;  1YCJ A;  4OYV A;  1Y20 A;  4Q8R A;  2OCU A;  1A55 A;  4OES A;  5ELV A;  3AXF A;  2ABH A;  4N6K A;  2X7P A;  3IOU A;  4ZEI A;  4JXI A;  4F31 B;  3TEL A;  3ZKL A;  1M5F A;  1UTH B;  3SDF A;  1WOD A;  2XXQ A;  4GWW A;  4PP0 A;  3O28 A;  3IB2 A;  4WKM A;  1MXW A;  2XXU A;  3CSB A;  2G29 A;  4ZED A;  4DI4 B;  2QMW A;  4FEB A;  5EQA A;  2HAV A;  2FIX A;  1IXI A;  1UQW A;  1FBC A;  1P99 A;  2DWI A;  2F6P A;  3G3F A;  3BBR A;  3LUZ A;  5DVI A;  4GOT A;  4TLM B;  3E78 A;  2O7I A;  2ZXT A;  3N26 A;  1A8E A;  3HV1 A;  2BJJ X;  1NV7 A;  4LP2 B;  4H65 A;  1A7L A;  2WBD A;  4EF2 A;  2O6A A;  4U1O A;  2VT5 A;  3FVO A;  4HXV A;  3KG2 A;  1VFD A;  4OVQ A;  1TXF A;  1R6Z A;  2ZNS A;  2XXH A;  3USD A;  1SD3 A;  4FED A;  4NF5 B;  2Y7I A;  1KZ8 A;  3KBR A;  4MCO A;  4IO7 A;  3VXC A;  4N6D A;  3TTM A;  4JWX A;  4R9F A;  1MXX A;  3IB1 A;  4E0X A;  4G68 C;  1IXG A;  2HXW A;  1S9T A;  3ZS6 A;  4THI A;  2PT2 A;  1NUX A;  1YPN A;  4TLL B;  3DLN A;  1L5T A;  1FPK A;  5DVF A;  3VLU A;  2CZK A;  3K2D A;  1N0T A;  2AYS A;  1AL3 A;  3V5A A;  3B6T A;  3H6V A;  1MXY A;  2PYY A;  3A3C A;  5AA1 A;  4QSD A;  3EF7 A;  1B2H A;  1JEU A;  3FUZ A;  3OSR A;  2P2A A;  3CFX A;  4AQ4 A;  3ECR A;  2I6E A;  2HFB A;  1POY 1;  2HXR A;  1TWY A;  1DPE A;  4PE3 A;  4P47 A;  4P0I A;  3T93 B;  2D3I A;  2H4I A;  3O6I A;  1IIW A;  5B7D A;  1LFI A;  3C32 A;  1B0H A;  1DOT A;  1KA0 A;  2VGQ A;  3LSX A;  1WVJ A;  4OHN A;  3SER A;  1OQH A;  4QF9 A;  4ZE9 A;  3SEV A;  4F2O A;  2Z8E A;  1EYJ A;  2O1L A;  1CNQ A;  1MY1 A;  2F3D A;  1JW4 A;  2B65 A;  4UAC A;  2X7Q A;  1NUZ A;  2VD3 A;  4U1Z A;  2H5Y A;  4PDD A;  3GBB A;  3PUW E;  3O2A A;  3PD8 A;  3R6U A;  3TAJ A;  1I6B A;  4JWO A;  5FBP A;  5M2V A;  4NF8 B;  3T9U A;  2HEU A;  1NUW A;  1US4 A;  3FJG A;  4Q0C A;  2QS4 A;  3M3L A;  2I0B A;  1NKX A;  2I3V A;  3K6W A;  2P3V A;  1LFG A;  5IZ3 B;  1RDY A;  4IY6 A;  4YAH X;  2F7A A;  3HCQ A;  3TTL A;  1JVY A;  3V8X B;  2XXV A;  3U1O A;  3SKP A;  4X9T A;  3BIG A;  1VR5 A;  1Y1M A;  3RLF E;  1SVX B;  3U94 A;  2O69 A;  1IUD A;  4FJP A;  4NTL A;  1EZ9 A;  5H8N A;  4F29 A;  3TCF A;  2O1M A;  4NF4 A;  3FV2 A;  4FE8 A;  4RPN A;  4YKK A;  3SEY A;  4OVT A;  3PMX A;  2HAU A;  2Y7K A;  4HE0 A;  3U93 A;  4O7I A;  1R9Q A;  2V25 A;  4IB2 A;  2A5T A;  2NWJ A;  4POX A;  5J16 A;  5TU0 A;  2FYI A;  3PUZ E;  4R6H A;  2F36 A;  4MJO A;  2M8C A;  4I9D A;  3MP8 A;  1LCT A;  1II5 A;  1MQD A;  4NN3 A;  4ZZA A;  3H6T A;  3C31 A;  1YZ0 A;  1MH3 A;  2REJ A;  3O29 A;  3PPR A;  2G93 A;  1HSL A;  5LTC A;  3W9W A;  3H7M A;  3TFL A;  1FPF A;  1DK4 A;  3LSL A;  5ISU A;  4PFB A;  3HHG A;  1EYK A;  5AA4 A;  1USY H;  4MMP A;  4G68 A;  4IO4 A;  4LZ8 A;  1ZLQ A;  3IOR A;  1B46 A;  2GHA A;  3WAE A;  1SW2 A;  3H03 A;  5JTY A;  4LAT A;  1JVX A;  3FAT A;  3IO6 A;  4FBP A;  2HCA A;  3VLW A;  2REG A;  1IXH A;  5H8S A;  1DMB A;  4MNI A;  4RK2 A;  3W9V A;  3DP8 A;  4OA4 A;  4P1L A;  2XWK A;  2JJK A;  4H6D A;  3A29 A;  5IAI A;  5I2K A;  4YB6 A;  3PPO A;  4N8G A;  1S50 A;  3SEU A;  3T22 A;  1O7T A;  1FQD A;  3IOW A;  1D9Q A;  2Q8M A;  2RC9 A;  3UOR A;  4GBV A;  4F1Y A;  4NF6 A;  3VVD A;  5CC2 A;  1UTB A;  2XWO A;  1JEV A;  5I56 B;  5H8F B;  2DE3 A;  2PCR A;  5ICT A;  1Y1Z A;  2F8D A;  1MPB A;  3IOV A;  3QUF A;  2QRY A;  2F7B A;  4U4X A;  1FPD A;  1EZP A;  4C1T A;  1D3K A;  4ELQ A;  5TP9 B;  2B3B A;  1MQG A;  3HFU A;  4MNC A;  3H6U A;  1NH7 A;  4PFY A;  4PAI A;  2I0C A;  4PF8 A;  3CG1 A;  4NAP A;  1FBE A;  1NV5 A;  3T0J A;  3PU5 A;  1IMF A;  4AS4 A;  3FXR A;  4ZDM A;  2QL3 A;  4NGU A;  2DS9 A;  1FQC A;  3IR1 A;  1DBZ A;  3HPI A;  4ISU A;  3L6H A;  1QUL A;  3FXQ A;  4P11 A;  3T9H B;  5EYH A;  1FTO A;  3RN8 A;  4EDP A;  1SBP A;  1PDA A;  2DWH A;  1WDN A;  1TFA A;  5KCJ A;  1P1U A;  1F9B A;  5A5X B;  4FAJ A;  2D21 A;  5F1Q A;  1JW1 A;  4ONY A;  4IY5 A;  3C36 A;  3FVG A;  3E13 X;  4GL8 A;  3Q25 A;  4DCY A;  2GFE A;  1LLS A;  2XWV A;  4F39 A;  1B58 A;  1UTH A;  3FBP A;  4KYD A;  5L9M A;  1R9L A;  4NWD A;  2ONR A;  1SI1 A;  1MG1 A;  1DTG A;  2FA7 A;  1IEJ A;  2UXA A;  4IO2 A;  5KDT B;  2PBW A;  4QFN A;  3FJ7 A;  1BTJ A;  1IQ7 A;  4JSO A;  1SYI A;  1B5J A;  1FBP A;  2ZNT A;  4PF6 A;  3K1P A;  2E1S A;  2UVH A;  2Y7W A;  4O8M A;  2XXY A;  3TKD A;  4QSC A;  1NH8 A;  4YB7 A;  3KEI A;  2B4M A;  2QFL A;  1ELJ A;  1KA1 A;  4G8M A;  1O63 A;  4ZEB A;  1DCU A;  1QKA A;  4GVO A;  5ITP A;  3TTR A;  4FIM A;  1UIU A;  3RPL B;  5CBR A;  1LBZ A;  3OEL A;  4NF0 A;  4NF5 A;  5EQ9 A;  3MVY A;  2RCB A;  1XHY A;  5KZT A;  4KFQ A;  4H1X A;  1PB8 A;  2CEX A;  2ZYN A;  4GXS B;  1IZ1 A;  4G61 A;  1N3X A;  2DOJ A;  3U65 A;  3EPE A;  3UN6 A;  4LON B;  2KR0 A;  4YKJ A;  4EQ9 A;  2H98 A;  3EKI A;  3V89 B;  4G8H A;  1NFT A;  4LZ7 A;  5IZZ A;  3S9M C;  4I3Y A;  1BP5 A;  4P1E A;  3OOA A;  4E0W A;  4ESW A;  3MUQ A;  1T0K A;  4R74 A;  1PC3 A;  3K00 A;  4XKQ A;  1SI0 A;  4XKN A;  3VXB A;  1A54 A;  2V84 A;  2PMS A;  3T9V A;  2Y7P A;  2R9J A;  4R6K A;  3M8U A;  3A09 A;  1FW0 A;  4ESX A;  2FNC A;  4R2B A;  4GWO A;  1B3E A;  2HHM A;  1SQY A;  1A40 A;  2F7C A;  3THI A;  1LST A;  3B8B A;  5I7I A;  4M1V A;  3OO8 A;  4OTE A;  2AIX A;  2E0S A;  4OFJ A;  3TMG A;  3K6V A;  1Q1K A;  1VDW A;  5T3J A;  4QHQ A;  2ZYO A;  3E9X A;  5CMC A;  4JVI A;  2OWS A;  3T66 A;  2ZYK A;  4QBA A;  2CEY A;  3SEX A;  2Z22 A;  5DEX B;  4KI0 E;  1AH5 A;  4NF8 A;  4OXV A;  3VV5 A;  2UVI A;  3QYT A;  3PPN A;  4DLD A;  2RF1 A;  3S9E A;  1FPJ A;  3WAF A;  3RTF B;  3I5O A;  3KN3 A;  3RY3 A;  1A99 A;  2WYK A;  4AB5 A;  2Q2C A;  4P9K A;  3KOS A;  2PFZ A;  3MBP A;  2WYP A;  1HSE A;  3VLV A;  5I59 A;  1FRP A;  4BDL A;  1N3W A;  4Q30 B;  4XFE A;  3H06 B;  4KYE A;  1B3H A;  4MHF A;  1K9Z A;  3EN3 A;  4UA8 A;  3KSX A;  1NUY A;  5AA2 B;  1OVB A;  3RGY A;  2XXK A;  2ONS A;  3GLB A;  4JDF A;  5FHO A;  3C34 A;  4P3L A;  3M3K A;  4RNS A;  5ET6 A;  3D4C A;  1D9V A;  3OD7 A;  4NE4 A;  4ZEC A;  3JYR A;  4MAG A;  2CZL A;  3G3G A;  4XTC Q;  1FBD A;  2WBB A;  4RY1 A;  3CRB A;  4WXJ A;  3GZG A;  2NOO A;  2ZZW A;  4DXU A;  1LBY A;  4ZE8 A;  5I3S A;  2XD2 A;  3N5L A;  1MS7 A;  4GFR A;  2V3U A;  3H3G A;  1NI9 A;  1B32 A;  2XD3 A;  1PBP A;  4R6Y A;  3UGW A;  1ZIU A;  2PVU A;  4N07 A;  4IO6 A;  1FBH A;  4OEN A;  2PX1 A;  4FEC A;  2XWI A;  3SEW A;  3G3J A;  1QKB A;  4U21 A;  1MDP 1;  1QGX A;  1DTZ A;  5BUU A;  4RYA A;  3FJM A;  5LDZ A;  4YZZ A;  2ZNU A;  4LZ5 A;  3R7X A;  3KFM A;  4F1V A;  4BDQ A;  2XXW A;  1MY4 A;  1FJ6 A;  4ZEF A;  3IO4 A;  4GF8 A;  1FQB A;  2P0S A;  4KHZ E;  4H5F A;  1AIV A;  2WKY A;  2R6G E;  5HM4 B;  5ET5 A;  2Y84 A;  5DTB A;  3KBZ A;  4LQ2 A;  1ZTY A;  4X48 A;  2VHA A;  1USY E;  4MIJ A;  2NUV A;  4C1U A;  1LBV A;  2P1S A;  4F1U A;  3OEK A;  4QFO A;  5I56 A;  1MQJ A;  4KCC A;  3GXA A;  1D4N A;  4F2Q A;  2CZI A;  4O7M A;  5AA2 D;  3K02 A;  4OVJ A;  5H8H B;  1QJM A;  2XXX A;  4PQJ A;  3FXU A;  5L9O A;  1S7Y A;  5A5L A;  3L6G A;  5EYG A;  3MZ9 A;  1FPB A;  1Y4T A;  1B5H A;  5EHM A;  5TP9 A;  2VOZ A;  5I2N B;  2VP1 A;  3CI8 A;  4PAK A;  3TTK A;  4YMB A;  3PPP A;  5I84 A;  4G8N A;  5F24 A;  3TOD A;  1D9Y A;  2I4B A;  3CIJ A;  3JV9 A;  3TPA A;  1Y3P A;  3O66 A;  4WEP A;  1G0I A;  3TZA A;  5EHS A;  2LAO A;  3V83 A;  2L5V A;  1MH4 A;  3MPL A;  4I40 A;  4N91 A;  2IEE A;  4EF1 A;  1G0H A;  1B3L A;  4HCW A;  4JSD A;  3IK6 B;  3MP1 A;  5FTH A;  1XS5 A;  3T9X B;  4O94 A;  1NV0 A;  3VFJ A;  4X1D A;  3KJT A;  4GD5 A;  3ZSF A;  5IKB A;  2Z23 A;  3IAZ A;  4GBW A;  4TOZ A;  2X26 A;  3TCH A;  4GRK A;  5K2X A;  1NV2 A;  3HST A;  1FQE A;  4DXB A;  3EHS A;  1SW5 A;  5I57 B;  5IGA A;  3FIR A;  1JQF A;  2UVJ A;  1B3G A;  3TYH A;  1IMD A;  1YYZ A;  1B52 A;  2H99 A;  2V4C A;  1B3F A;  3CG3 A;  3KC0 A;  1B6H A;  4MEV A;  2FBP A;  3VDF A;  1RYX A;  1M5C A;  4XIG Q;  4YKP A;  4RJZ A;  1ZBM A;  5CMM A;  3ILT B;  4PAF A;  4QFK A;  3EHT A;  1FPG A;  3O6H A;  1B05 A;  1BKA A;  1XVX A;  3KZG A;  1CB6 A;  4DXC A;  2QJE A;  3U8Q A;  5KDT A;  1FTJ A;  1O64 A;  1MQI A;  2GHB A;  1FTK A;  4N4U A;  4JB7 A;  5BWJ A;  3QXM A;  1LAF E;  4PCD A;  2Q9T A;  4JWY A;  1XOC A;  4JBZ A;  3BFT A;  5DT6 A;  2ZZV A;  2OBG A;  1MXZ A;  5B70 A;  4F22 A;  1HSJ A;  2GRV A;  2F6G A;  4H67 A;  4YIC A;  1RDX A;  1B51 A;  4N15 A;  3LBS A;  2A5T B;  4P0G A;  4G2Z A;  1LAG E;  1Z7N E;  3BFU A;  3TTN A;  4OMB A;  4X04 A;  4IR8 A;  4N17 A;  1SPI A;  2A5S A;  3UP9 A;  3IOT A;  5FHM A;  1P1Q A;  2ESN A;  2O84 X;  4RXL A;  1OQG A;  1B5I A;  4OZ9 A;  4P8B A;  3PGF A;  1VE4 A;  2B4L A;  3OEM A;  1N7W A;  4G68 B;  4QXD A;  4GWZ A;  1DPP A;  1MY0 A;  4L17 A;  1YAE A;  4P56 A;  1B40 A;  1MM7 A;  4ZS9 A;  4PFI A;  5DW8 A;  3S9N C;  5JTY B;  4I1D A;  3MP6 A; 
#chains in the Genus database with same CATH homology
 4LA9 A;  4M4G A;  1I69 A;  5I58 B;  4NED A;  3R26 A;  4ELO A;  1OMP A;  3RNN A;  3VE1 B;  5H8Q B;  4I8C A;  3KSJ A;  4F18 A;  3PMW A;  1YTV A;  4DE8 A;  1R1N A;  5ICQ A;  3QIM A;  3D4G A;  1NNF A;  1URG A;  4WED A;  2VD2 A;  4K3F A;  3ZKK A;  2H25 A;  3C9H A;  3P7I A;  3EQ1 A;  4NF6 B;  2UYF A;  3G3K A;  2YLN A;  5L8D A;  5DEX A;  2ONK E;  4FAT A;  4G77 A;  4OEU A;  1H43 A;  1MRP A;  3S4U A;  1QUK A;  1B1X A;  2Z8F A;  1SYH A;  2UVG A;  3M3F A;  3Q28 A;  3E3K A;  2YPN A;  1ZU0 A;  4YU0 A;  3W15 C;  3RTW B;  2NVU B;  3IJX B;  4OEV A;  4OQO A;  4YB5 A;  2OZZ A;  1M5E A;  4EXL A;  4QFP A;  4OET A;  4PE5 B;  2I58 A;  3MAM A;  3B6Q A;  3EHU A;  2V93 A;  1KWH A;  3VVE A;  3DM0 A;  5AA2 A;  4XKR A;  2OLB A;  1M5B A;  3RUM A;  3B7D A;  3U92 A;  5KCJ B;  3QK6 A;  4R9G A;  1URS A;  3FD3 A;  4U22 A;  2ZYM A;  1PEB A;  4U4S A;  4DCX A;  5CRY A;  4KCD A;  1H44 A;  1LBB A;  4HS7 A;  4KQP A;  1SDX A;  3C35 A;  3S9L C;  4DZ1 A;  3LSF B;  2QS3 A;  3TUS A;  3N6U A;  3PMV A;  2RIN A;  2Q88 A;  4H0W A;  1GTK A;  4MBP A;  4KD5 A;  1B7U A;  1AOV A;  4PET A;  1US5 A;  1OVT A;  3MVX A;  4IO5 A;  3OO6 A;  1N84 A;  4OFL A;  4O3B A;  1JNF A;  3K6X A;  1GV8 A;  2RC7 A;  3MVW A;  1CE2 A;  3DP6 A;  2B3F A;  4R2F A;  4LVQ A;  4DIG A;  4XKP A;  4F3G A;  2Q2A A;  1MQH A;  4LQ5 A;  1P1N A;  1H76 A;  4YKI A;  1MM6 A;  4R75 A;  2THI A;  1LGB C;  2O7U A;  1XC1 A;  3ODB A;  1ANF A;  2QS2 A;  5CM6 A;  3PUV E;  1DSN A;  1LBC A;  1LAH E;  2UYE A;  4GL0 A;  4EXK A;  4MLV A;  4MLQ A;  3OO9 A;  5TPA B;  2F78 A;  1FQF A;  5AE4 A;  3K6U A;  1Q35 A;  5H8H A;  4TQU Q;  1QVS A;  2DQV A;  4F19 A;  5HPQ A;  1LFH A;  4R73 A;  2I49 A;  5I2N A;  2YJP A;  3PV0 E;  1FQA A;  4BDN A;  2Q8J A;  2DXY A;  1MPD A;  1VSO A;  3CVG A;  4RPO A;  3OXN A;  4IGR A;  2HZL A;  2Y7R A;  4FOR A;  4O3A A;  4GLI A;  1NL5 A;  4EQ7 A;  4H5G A;  1FCK A;  3BKI B;  2AL5 A;  1MXU A;  2QMX A;  1N7X A;  1J1N A;  2V3T A;  3K1N A;  5CI5 A;  5DVJ A;  3MZ1 A;  3RQT A;  3TDJ A;  1B7Z A;  4NMY A;  3MPK A;  4U2R A;  2CMO A;  1OLA A;  4X1B A;  4NWC A;  3FZV A;  1XT8 A;  3FGS A;  4ZEK A;  1B4Z A;  5I57 A;  5CMB A;  3LSW A;  1TT1 A;  2DWJ A;  4BDR A;  3KJ7 A;  1NNP A;  2Z8D A;  3OMB A;  3GBA A;  4KR5 A;  2D5W A;  2DVZ A;  2NXO A;  1ZMG A;  3IB0 A;  1B0L A;  4EQB A;  3MC2 A;  4IGT A;  5LOM A;  1Y9U A;  2I48 A;  5I59 B;  3LC8 A;  5H8F A;  1MDQ A;  1AMF A;  4YMA A;  1BLF A;  2H9B A;  5AA3 A;  1P1W A;  3C33 A;  3LR1 A;  2F34 A;  2HZK A;  2IA4 A;  3CSG A;  1I6A A;  1JW5 A;  3C4M A;  4KYS A;  1IIT A;  2DE2 A;  3MJN A;  4N6P A;  3SET A;  3KGC A;  3Q29 A;  1LB9 A;  3F11 A;  5F7V A;  1EH3 A;  3IX1 A;  2QS1 A;  4GQO A;  3TQW A;  4C0R A;  3O6G A;  2O51 A;  3MVZ A;  2XXP A;  4IO3 A;  1I6Q A;  3T96 B;  2XHD A;  3H6W A;  3LUY A;  4F3B A;  4ELR A;  2PT1 A;  2RCA A;  1Y3Q A;  1A8F A;  1VFE A;  3VVF A;  1RYO A;  5ITO A;  5A5X A;  2AL4 A;  3FVK A;  1MY3 A;  4O3C A;  1UIV A;  1JET A;  3G3I A;  3KN7 A;  3FAS A;  3SES A;  3Q26 A;  4LUB A;  3K1M A;  1N04 A;  4MF3 A;  2O68 A;  4QFL A;  2F35 A;  4BDO A;  2XX9 A;  5HBC A;  5EYF A;  1PB9 A;  2XXR A;  3O97 A;  5I58 A;  1SW4 A;  2Q89 A;  1ATG A;  5CBS A;  3B6W A;  5K2Y A;  2DYX A;  1URD A;  3O9P A;  4Z0I A;  3OEN A;  5J1D A;  2I3W A;  2DP8 A;  3S2V A;  5H8Q A;  4R72 A;  1M5D A;  3UIF A;  3A3U A;  4ZZE A;  2RC8 A;  1EZO A;  2DVC A;  1FTL A;  1RKM A;  2XXT A;  2QSX A;  3K01 A;  1H45 A;  4H8J A;  1ZJL A;  2F5X A;  1POT A;  1PBQ A;  4XXU A;  1QUI A;  2ZMB A;  1IXC A;  3QUJ A;  5H8N B;  2V3Q A;  3E4R A;  3FVN A;  4PFT A;  2KLF A;  5FHN A;  4NF4 B;  1OIB A;  1GGG A;  4BDM A;  3JZJ A;  3N6T A;  3CFL A;  3I6V A;  3OO7 A;  3TEP A;  1B1H A;  1TFD A;  3UA8 A;  2DWA A;  5JEI A;  3PD9 A;  4HCY A;  4Q5T A;  1B9J A;  5JK4 A;  4H8I A;  2DSF A;  3HO7 A;  1LAX A;  4AB6 A;  1LB8 A;  2F97 A;  3I3V A;  3IL1 B;  4MH5 A;  2XX8 A;  3MWB A;  4POW A;  4DDD A;  3RT6 B;  2OWT A;  4RK9 A;  1NMU A;  1MY2 A;  1Z7M E;  4HW8 A;  1GVC A;  3U72 A;  5AA4 B;  1PB7 A;  4HTG A;  3KOT A;  3MW0 A;  3HN0 A;  3TQL A;  1FTM A;  4RA1 A;  3HHF A;  3CR9 A;  1MXV A;  2HQ0 A;  3FV1 A;  5FTI A;  1Y3N A;  1N76 A;  2ALU A;  4F3P A;  2OJT A;  1LCF A;  4GXA A;  3ONM A;  2OK2 A;  3CFZ A;  4OWD A;  3PPQ A;  2DXR A;  5L9S A;  4GIZ A;  3ILU B;  3QAX A;  5I2K B;  3MQ9 A;  5DYH A;  1ZKB A;  3N94 A;  3QSL A;  3DEL B;  1OLC A;  3PUY E;  5CMK A;  4OFO A;  1XVY A;  3G3H A;  3TCG A;  2XXI A;  3MZB A;  1QUJ A;  2RKM A;  4ECF A;  1UTB B;  3KN8 A;  3H4Z A;  1GR2 A;  1NNT A;  3OSQ A;  4N13 A;  2I4C A;  4BLA A;  1Y4C A;  4I62 A;  2XX7 A;  4ND9 A;  4QRZ A;  1BIY A;  4KPT A;  2R71 A;  3UK4 A;  3Q27 A;  1SW1 A;  4QSE A;  1H3D A;  2QPQ A;  3RT8 A;  4PFU A;  1EU8 A;  4G4P A;  2DE4 A;  4MFI A;  3IJO B;  3K0V A;  3G7W A;  2GH9 A;  2ANJ A;  1NNK A;  1QW0 A;  4Z7E A;  4U23 A;  2W7Y A;  1B7H A;  3K4U A;  4PFW A;  1P1O A;  4F3S A;  3PUX E;  4OER A;  1MPC A;  4EUO A;  3RPW A;  5TPA A;  3DP4 A;  1B4H A;  4ELP A;  1YCJ A;  4OYV A;  1Y20 A;  4Q8R A;  2OCU A;  1A55 A;  4OES A;  5ELV A;  3AXF A;  2ABH A;  2X7P A;  3IOU A;  4ZEI A;  4JXI A;  4F31 B;  3TEL A;  3ZKL A;  1M5F A;  1UTH B;  3SDF A;  1WOD A;  2XXQ A;  4PP0 A;  3O28 A;  3IB2 A;  4WKM A;  1MXW A;  2XXU A;  3CSB A;  2G29 A;  4ZED A;  2QMW A;  4FEB A;  2HAV A;  1IXI A;  1UQW A;  1P99 A;  2DWI A;  2F6P A;  3G3F A;  3BBR A;  5DVI A;  4GOT A;  4TLM B;  2O7I A;  2ZXT A;  3N26 A;  1A8E A;  3HV1 A;  2BJJ X;  4LP2 B;  4H65 A;  1A7L A;  4EF2 A;  2O6A A;  4U1O A;  3FVO A;  3KG2 A;  1VFD A;  1TXF A;  1R6Z A;  2ZNS A;  2XXH A;  3USD A;  1SD3 A;  4FED A;  2Y7I A;  3KBR A;  4NF5 B;  4IO7 A;  3VXC A;  3TTM A;  4JWX A;  4R9F A;  1MXX A;  3IB1 A;  4E0X A;  4G68 C;  1IXG A;  2HXW A;  1S9T A;  3ZS6 A;  4THI A;  2PT2 A;  1YPN A;  4TLL B;  3DLN A;  1L5T A;  5DVF A;  3VLU A;  3K2D A;  1N0T A;  2AYS A;  1AL3 A;  3V5A A;  3B6T A;  3H6V A;  1MXY A;  2PYY A;  3A3C A;  5AA1 A;  4QSD A;  3EF7 A;  1B2H A;  1JEU A;  3FUZ A;  3OSR A;  2P2A A;  3CFX A;  4AQ4 A;  3ECR A;  2I6E A;  2HFB A;  1POY 1;  1TWY A;  1DPE A;  4P0I A;  3T93 B;  2D3I A;  2H4I A;  3O6I A;  1IIW A;  5B7D A;  1LFI A;  3C32 A;  1B0H A;  1DOT A;  2VGQ A;  3LSX A;  1WVJ A;  4OHN A;  3SER A;  1OQH A;  4QF9 A;  4ZE9 A;  3SEV A;  4F2O A;  2Z8E A;  2O1L A;  1MY1 A;  1JW4 A;  2B65 A;  4UAC A;  2X7Q A;  2VD3 A;  4U1Z A;  2H5Y A;  3GBB A;  3PUW E;  3O2A A;  3PD8 A;  3R6U A;  3TAJ A;  1I6B A;  4JWO A;  5M2V A;  4NF8 B;  3T9U A;  2HEU A;  1US4 A;  3FJG A;  4Q0C A;  2QS4 A;  3M3L A;  2I0B A;  1NKX A;  2I3V A;  3K6W A;  1LFG A;  4IY6 A;  4YAH X;  2F7A A;  3HCQ A;  3TTL A;  1JVY A;  3V8X B;  2XXV A;  3U1O A;  3SKP A;  4X9T A;  1VR5 A;  1Y1M A;  3RLF E;  1SVX B;  3U94 A;  2O69 A;  1IUD A;  4FJP A;  4NTL A;  1EZ9 A;  5H8N A;  4F29 A;  3TCF A;  2O1M A;  4NF4 A;  3FV2 A;  4FE8 A;  4RPN A;  4YKK A;  3SEY A;  3PMX A;  2HAU A;  2Y7K A;  3U93 A;  1R9Q A;  2V25 A;  4IB2 A;  2A5T A;  2NWJ A;  4POX A;  5TU0 A;  2FYI A;  3PUZ E;  4R6H A;  2F36 A;  2M8C A;  4I9D A;  3MP8 A;  1LCT A;  1II5 A;  1MQD A;  4ZZA A;  3H6T A;  3C31 A;  1MH3 A;  2REJ A;  3O29 A;  3PPR A;  2G93 A;  1HSL A;  3W9W A;  3H7M A;  3TFL A;  3LSL A;  5ISU A;  3HHG A;  5AA4 A;  1USY H;  4G68 A;  4IO4 A;  4LZ8 A;  1ZLQ A;  3IOR A;  1B46 A;  2GHA A;  3WAE A;  1SW2 A;  3H03 A;  5JTY A;  4LAT A;  1JVX A;  3FAT A;  3IO6 A;  2HCA A;  3VLW A;  2REG A;  1IXH A;  5H8S A;  1DMB A;  4RK2 A;  3W9V A;  3DP8 A;  4H6D A;  5IAI A;  5I2K A;  4YB6 A;  3PPO A;  1S50 A;  3SEU A;  3T22 A;  1O7T A;  1FQD A;  3IOW A;  2RC9 A;  3UOR A;  4F1Y A;  4NF6 A;  3VVD A;  5CC2 A;  1UTB A;  1JEV A;  5I56 B;  5H8F B;  2DE3 A;  5ICT A;  1Y1Z A;  2F8D A;  1MPB A;  3IOV A;  3QUF A;  2QRY A;  2F7B A;  4U4X A;  1EZP A;  4C1T A;  1D3K A;  4ELQ A;  5TP9 B;  2B3B A;  1MQG A;  3H6U A;  1NH7 A;  4PFY A;  2I0C A;  3CG1 A;  3PU5 A;  3FXR A;  4ZDM A;  2QL3 A;  2DS9 A;  1FQC A;  3IR1 A;  3HPI A;  3L6H A;  4ISU A;  1QUL A;  3FXQ A;  4P11 A;  3T9H B;  1FTO A;  3RN8 A;  4EDP A;  1SBP A;  1PDA A;  2DWH A;  1WDN A;  1TFA A;  5KCJ A;  1P1U A;  1F9B A;  5A5X B;  4FAJ A;  2D21 A;  5F1Q A;  1JW1 A;  4ONY A;  4IY5 A;  3C36 A;  3FVG A;  3E13 X;  4GL8 A;  3Q25 A;  4DCY A;  2GFE A;  1LLS A;  4F39 A;  1B58 A;  1UTH A;  4KYD A;  5L9M A;  1R9L A;  4NWD A;  2ONR A;  1SI1 A;  1MG1 A;  1DTG A;  2FA7 A;  1IEJ A;  2UXA A;  4IO2 A;  5KDT B;  2PBW A;  4QFN A;  3FJ7 A;  1BTJ A;  1IQ7 A;  4JSO A;  1SYI A;  1B5J A;  2ZNT A;  3K1P A;  2E1S A;  2UVH A;  2Y7W A;  2XXY A;  3TKD A;  4QSC A;  1NH8 A;  4YB7 A;  3KEI A;  1ELJ A;  4G8M A;  1O63 A;  4ZEB A;  4GVO A;  1QKA A;  5ITP A;  3TTR A;  4FIM A;  1UIU A;  5CBR A;  3OEL A;  4NF5 A;  3MVY A;  2RCB A;  1XHY A;  5KZT A;  4KFQ A;  4H1X A;  1PB8 A;  2ZYN A;  4GXS B;  1IZ1 A;  1N3X A;  2DOJ A;  3EPE A;  3UN6 A;  4LON B;  4YKJ A;  4EQ9 A;  2H98 A;  3V89 B;  4G8H A;  1NFT A;  4LZ7 A;  3S9M C;  1BP5 A;  3OOA A;  4E0W A;  4ESW A;  3MUQ A;  1T0K A;  4R74 A;  1PC3 A;  3K00 A;  4XKQ A;  1SI0 A;  4XKN A;  3VXB A;  1A54 A;  2V84 A;  2PMS A;  3T9V A;  2Y7P A;  2R9J A;  4R6K A;  3M8U A;  3A09 A;  1FW0 A;  4ESX A;  2FNC A;  4R2B A;  4GWO A;  1B3E A;  1SQY A;  1A40 A;  2F7C A;  3THI A;  1LST A;  4M1V A;  3OO8 A;  4OTE A;  2AIX A;  2E0S A;  4OFJ A;  3TMG A;  3K6V A;  1Q1K A;  4QHQ A;  2ZYO A;  3E9X A;  5CMC A;  2OWS A;  3T66 A;  2ZYK A;  3SEX A;  2Z22 A;  5DEX B;  4KI0 E;  1AH5 A;  4NF8 A;  4OXV A;  3VV5 A;  2UVI A;  3QYT A;  3PPN A;  4DLD A;  2RF1 A;  3S9E A;  3WAF A;  3RTF B;  3I5O A;  3KN3 A;  3RY3 A;  1A99 A;  4AB5 A;  2Q2C A;  3KOS A;  3MBP A;  1HSE A;  3VLV A;  5I59 A;  4BDL A;  1N3W A;  4Q30 B;  3H06 B;  4KYE A;  1B3H A;  3EN3 A;  4UA8 A;  3KSX A;  5AA2 B;  1OVB A;  3RGY A;  2ONS A;  3GLB A;  4JDF A;  5FHO A;  3C34 A;  3M3K A;  4RNS A;  3D4C A;  1D9V A;  3OD7 A;  4NE4 A;  4ZEC A;  3JYR A;  2CZL A;  3G3G A;  4XTC Q;  4RY1 A;  3CRB A;  4WXJ A;  3GZG A;  2NOO A;  4DXU A;  4ZE8 A;  2XD2 A;  3N5L A;  1MS7 A;  4GFR A;  2V3U A;  3H3G A;  1B32 A;  2XD3 A;  1PBP A;  4R6Y A;  3UGW A;  1ZIU A;  2PVU A;  4N07 A;  4IO6 A;  4OEN A;  2PX1 A;  4FEC A;  3SEW A;  3G3J A;  1QKB A;  4U21 A;  1MDP 1;  1DTZ A;  5BUU A;  4RYA A;  3FJM A;  4YZZ A;  2ZNU A;  4LZ5 A;  3R7X A;  3KFM A;  4F1V A;  4BDQ A;  2XXW A;  1MY4 A;  4ZEF A;  3IO4 A;  4GF8 A;  1FQB A;  2P0S A;  4KHZ E;  4H5F A;  1AIV A;  2WKY A;  2R6G E;  5HM4 B;  2Y84 A;  5DTB A;  4LQ2 A;  1ZTY A;  4X48 A;  2VHA A;  1USY E;  2NUV A;  4C1U A;  2P1S A;  4F1U A;  3OEK A;  4QFO A;  5I56 A;  1MQJ A;  4KCC A;  3GXA A;  1D4N A;  4F2Q A;  5AA2 D;  3K02 A;  4OVJ A;  5H8H B;  1QJM A;  2XXX A;  4PQJ A;  3FXU A;  5L9O A;  1S7Y A;  3L6G A;  3MZ9 A;  1Y4T A;  1B5H A;  5EHM A;  5TP9 A;  2VOZ A;  5I2N B;  2VP1 A;  3CI8 A;  3TTK A;  4YMB A;  3PPP A;  5I84 A;  4G8N A;  3TOD A;  1D9Y A;  2I4B A;  3CIJ A;  3JV9 A;  3TPA A;  1Y3P A;  3O66 A;  4WEP A;  3TZA A;  5EHS A;  2LAO A;  3V83 A;  1MH4 A;  3MPL A;  2IEE A;  4EF1 A;  1B3L A;  4HCW A;  4JSD A;  3IK6 B;  3MP1 A;  5FTH A;  1XS5 A;  3T9X B;  3VFJ A;  4X1D A;  3KJT A;  4GD5 A;  3ZSF A;  5IKB A;  2Z23 A;  3IAZ A;  4TOZ A;  2X26 A;  3TCH A;  4GRK A;  5K2X A;  3HST A;  1FQE A;  4DXB A;  3EHS A;  1SW5 A;  5I57 B;  3FIR A;  1JQF A;  2UVJ A;  1B3G A;  3TYH A;  1B52 A;  2H99 A;  1B3F A;  3CG3 A;  1B6H A;  3VDF A;  1RYX A;  1M5C A;  4XIG Q;  4YKP A;  4RJZ A;  1ZBM A;  5CMM A;  3ILT B;  4QFK A;  3EHT A;  3O6H A;  1B05 A;  1BKA A;  1XVX A;  3KZG A;  1CB6 A;  4DXC A;  2QJE A;  3U8Q A;  5KDT A;  1FTJ A;  1O64 A;  1MQI A;  2GHB A;  1FTK A;  4JB7 A;  5BWJ A;  3QXM A;  1LAF E;  2Q9T A;  4JWY A;  1XOC A;  4JBZ A;  3BFT A;  5DT6 A;  2OBG A;  1MXZ A;  5B70 A;  4F22 A;  1HSJ A;  2GRV A;  2F6G A;  4H67 A;  4YIC A;  1B51 A;  3LBS A;  2A5T B;  4P0G A;  4G2Z A;  1LAG E;  1Z7N E;  3BFU A;  3TTN A;  4OMB A;  2A5S A;  3UP9 A;  3IOT A;  5FHM A;  1P1Q A;  2ESN A;  2O84 X;  4RXL A;  1OQG A;  1B5I A;  4OZ9 A;  3PGF A;  1VE4 A;  3OEM A;  1N7W A;  4G68 B;  4L17 A;  1DPP A;  1MY0 A;  1YAE A;  1B40 A;  1MM7 A;  4ZS9 A;  3S9N C;  5JTY B;  4I1D A;  3MP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...