5JTYA

Glutamate- and dcka-bound glun1/glun2a agonist binding domains with mpx-007
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
283
structure length
262
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQEKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Negative Allosteric Modulation of GluN2A-Containing NMDA Receptors.
pubmed doi rcsb
molecule keywords Glutamate receptor ionotropic, NMDA 1,Glutamate receptor ion
molecule tags Transport protein, receptor
source organism Rattus norvegicus
total genus 66
structure length 262
sequence length 283
ec nomenclature
pdb deposition date 2016-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5jtyA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5jtyA02
5B7DA 1JW4A 1EZPA 3OMBA 1F9BA 3QUFA 4BDNA 1Q1KA 1DPEA 2A5SA 3V8XB 5ISUA 5I56B 3G3JA 3S9MC 4QFOA 1UTBB 4NWCA 4DCXA 1SBPA 1PBPA 3SEXA 3BFTA 3P7IA 4KR5A 3MVYA 1LCFA 3S9EA 3FD3A 3RT8A 1CB6A 3C35A 1M5EA 5I57A 5CMBA 5JTYB 3D4CA 1P1UA 3HHGA 1LLSA 2ONKE 3SEWA 1I6AA 1ELJA 2A5TB 4OERA 4U21A 3FZVA 3K1NA 1JQFA 1S7YA 3WAFA 2O7UA 2QS2A 1VSOA 3OO6A 2UYEA 5I56A 4ZZAA 3PPQA 4XIGQ 1BIYA 5DEXA 1UTBA 4OMBA 3TCFA 3QUJA 3KN7A 4G4PA 3CSBA 4YZZA 4XKQA 4OENA 1XS5A 1B3EA 3BKIB 2DE3A 1Y1ZA 2RC7A 4ISUA 3LSXA 2OWTA 4ZEIA 2P1SA 3VVDA 3TKDA 1NNFA 2NXOA 2A5TA 3TCHA 1ZKBA 4ZS9A 5DTBA 3TPAA 3E9XA 1MH3A 1LSTA 1SQYA 4FEDA 3DELB 3TQLA 3RGYA 2H98A 5EHSA 1I6QA 1NNPA 4G8HA 3MVXA 3H6VA 4RY1A 2FYIA 4NF6B 2V3QA 2QMWA 1PB8A 5L9SA 4ZECA 1B3LA 1P1OA 2R71A 1B3FA 3TUSA 4UA8A 3CSGA 3IL1B 2DWAA 5KDTA 4I8CA 4OFLA 2O69A 2OWSA 1ZLQA 4GVOA 2REJA 2ESNA 4YB7A 1R6ZA 4LONB 4X9TA 4ZEKA 2HZKA 1AL3A 1FTMA 1M5BA 4ZEBA 1ZMGA 3MVZA 4NWDA 3SKPA 1PC3A 3AXFA 4LA9A 3LR1A 4YB5A 4NF6A 3RPWA 4MF3A 3ZS6A 4IO7A 4YKKA 4FJPA 1QULA 4F1YA 5FHOA 1MXZA 4LUBA 2DWJA 5ICTA 1SW4A 4C1UA 1OMPA 3KFMA 2AYSA 5HM4B 4NEDA 2I4CA 3C32A 1OLCA 3K6UA 3PD9A 3DM0A 4GLIA 3R6UA 2B65A 1FQAA 3KG2A 5L8DA 3H6UA 4ZEFA 4EXKA 2Q88A 1T0KA 2RC8A 2Q9TA 3R7XA 3BFUA 3OO8A 4F31B 2D3IA 4YKIA 3U1OA 3C31A 4F22A 4HCWA 1XT8A 3FGSA 1MDP1 5ITOA 2VOZA 5AA2A 1FQCA 3UN6A 3LUYA 3TAJA 2I49A 3O66A 3CIJA 2Z8EA 1Y3NA 1LFGA 3FJ7A 5ELVA 3WAEA 4I62A 3F11A 4R74A 1H3DA 1MS7A 2ANJA 1ZBMA 2RKMA 2F8DA 2LAOA 5AA2D 1WDNA 4LZ7A 4N13A 3IX1A 2O68A 4H8JA 3MZ9A 1MM7A 4GIZA 1OQGA 1QKBA 1MY4A 3M3LA 1B05A 3G3GA 4RK9A 1QW0A 1IXHA 3CVGA 1PDAA 3U94A 3RQTA 3VE1B 3H4ZA 3VXCA 5I84A 1B5JA 3RUMA 4NF8B 4KQPA 5I2KB 4YAHX 1BLFA 2X7QA 1LAHE 3LSFB 1A8FA 2Y7WA 3M3KA 4ESXA 2FA7A 5K2YA 2THIA 1XVXA 4M4GA 5FHMA 4DDDA 4JSOA 1MXWA 1DOTA 3A3CA 2XXXA 3TTNA 4C1TA 1MPDA 2DYXA 4JWXA 4AQ4A 2AIXA 4Z7EA 1MY2A 1R9QA 5I59B 1SYIA 2RF1A 1SW5A 4L17A 4NE4A 4HTGA 4RNSA 3ZSFA 4JXIA 2KLFA 3IK6B 3T9HB 3K02A 4NF8A 4QFKA 4JWYA 4PETA 4KPTA 4IGRA 3S9NC 3DP4A 3TTLA 4F1UA 1M5DA 2B3FA 2PVUA 5I2KA 3TEPA 3PPOA 1B0HA 5AA1A 4F19A 1Y3QA 4G68C 4ECFA 3K6XA 4PFUA 4ELRA 2O6AA 1VFEA 2QS3A 3UORA 2QL3A 2FNCA 4ONYA 3Q25A 1USYH 5I59A 2UYFA 2Q2AA 3T96B 3M3FA 2OLBA 4LZ5A 3KEIA 5M2VA 4ELQA 4QSCA 2CZLA 3SEYA 2QPQA 1FTJA 3I5OA 4KCCA 4R6KA 4EXLA 1Y20A 2F7CA 4ZDMA 2ZMBA 4IO5A 4MH5A 1FQFA 3OEKA 2DXYA 2I3WA 2PX1A 4ELOA 4NF5B 1IIWA 4C0RA 3MZBA 2UXAA 4G77A 2GHAA 1B52A 3RT6B 1DMBA 3C34A 4GWOA 4XTCQ 1LBBA 2R6GE 4DIGA 1QVSA 4F39A 4QSEA 5CMKA 5IKBA 4R2BA 2E1SA 5I58A 4R9FA 1IQ7A 3T93B 1FQBA 3N26A 3IR1A 3FV1A 2ZNTA 2DSFA 1A8EA 1XOCA 4ZZEA 1FW0A 2PMSA 5DEXB 3T9UA 5IAIA 3GLBA 3CI8A 1NH7A 3ZKLA 2DQVA 1WODA 3PPNA 4NF5A 1VR5A 2V25A 3KN3A 4TOZA 1POY1 4FECA 3A09A 2VD3A 4OFJA 4OXVA 3CR9A 3IOTA 4TQUQ 4F3SA 5H8HB 1R9LA 1FTOA 4E0WA 4EQ9A 3QSLA 3O9PA 4U22A 1IXGA 1A55A 4JWOA 3TTKA 4U1OA 2P0SA 4R2FA 4U23A 4M1VA 5F7VA 3D4GA 3RTWB 1JEVA 2ONSA 1NNKA 4BDLA 2F35A 3GBBA 3G3KA 4JBZA 3QAXA 3SERA 1HSJA 3ZKKA 3CG1A 3PMXA 2I4BA 5DT6A 5KDTB 1B7UA 3UA8A 3U93A 4Z0IA 5BWJA 1NKXA 2AL4A 3V83A 2XD2A 3PUXE 4QFPA 5H8HA 4MLVA 1UTHB 1Z7ME 1QKAA 2P2AA 4U1ZA 3B6WA 2OJTA 4F18A 3EQ1A 3PPRA 1P1QA 2O1MA 3T9XB 1BKAA 2HCAA 1N3XA 3OO7A 1JETA 2I48A 3O28A 3UIFA 4U2RA 3GXAA 4EUOA 3FVNA 3T66A 5KZTA 1GVCA 3W9VA 1LFHA 1FCKA 3H03A 2G29A 1UIUA 1URSA 2F78A 4H1XA 4FEBA 2AL5A 2XXTA 3H06B 4H5FA 3FVKA 4GL0A 1ANFA 1N3WA 1ZJLA 1B6HA 3VVFA 2XHDA 4THIA 2RCBA 1POTA 4OFOA 3U8QA 1TWYA 1UTHA 1QUJA 1JVYA 3LSWA 1B0LA 3L6HA 4XXUA 3UP9A 1II5A 3EN3A 1A7LA 4BDMA 1RYOA 1O64A 5CM6A 2RCAA 1B1XA 2DE4A 3MPKA 2Q89A 1XC1A 4MLQA 4K3FA 4H6DA 1B9JA 4IO6A 2PYYA 1TFAA 2Z22A 5AA2B 4FATA 4KHZE 1N7WA 3MBPA 3CFXA 4KCDA 1EU8A 4PFWA 3EF7A 5AE4A 2NUVA 3MPLA 4IO2A 3PMWA 2DWHA 2XXRA 3QXMA 1N04A 4R72A 1Y4TA 2ZYOA 3PD8A 5ICQA 2F7BA 4BDQA 4PFTA 3W15C 3HPIA 1Y4CA 2XXQA 2GHBA 4WXJA 3LSLA 3MC2A 1QUIA 4R6HA 5J1DA 3THIA 1SD3A 3ILTB 3JYRA 4OQOA 2D21A 2HXWA 3MP1A 1MY3A 3KSJA 5DVFA 3OELA 5BUUA 2PT2A 4H67A 2DS9A 1KWHA 5TPAB 2NOOA 2V93A 2Q8JA 2H9BA 3PGFA 2XXUA 3K4UA 4IO3A 4IY5A 1USYE 4IB2A 1B32A 3S4UA 3C36A 1UIVA 4IO4A 2YLNA 1ZIUA 1YCJA 1S9TA 5B70A 3T9VA 1OVTA 1JNFA 1R1NA 4TLMB 4G8MA 4F29A 4YMAA 4LATA 5ITPA 1N0TA 4ESWA 5CBRA 3K0VA 5AA4B 3MAMA 3U72A 3FVOA 5TPAA 1EZ9A 3PUWE 4HW8A 1P99A 2QMXA 1URDA 3VVEA 2O84X 1SW1A 2XXPA 4DLDA 3O97A 2G93A 1MM6A 4DXBA 1EH3A 2QSXA 2I3VA 1B2HA 3N6TA 1O63A 3C9HA 4R9GA 2IA4A 2O51A 1IXIA 5KCJB 3IJXB 3KJ7A 1PB7A 3H6TA 3UK4A 2PBWA 4UACA 4YICA 1A40A 1NNTA 4PFYA 1MQDA 5AA4A 1MXVA 3FATA 3CFLA 1DTGA 2UVIA 2F6PA 1XVYA 1N84A 2WKYA 5AA3A 2NVUB 3K00A 3OXNA 3IB2A 3TCGA 4H0WA 4X48A 1AIVA 3MUQA 4EQBA 2XX8A 2I6EA 4N6PA 5DYHA 3EHUA 3QK6A 5CC2A 1MXYA 4P0GA 1YPNA 4F2QA 2DXRA 3GZGA 4LP2B 2DVZA 5FTIA 3DP8A 3MJNA 4QF9A 4AB6A 5CMCA 3VDFA 2F36A 5KCJA 1SI1A 3OEMA 3MVWA 3SETA 5L9MA 1I6BA 3IAZA 1MY1A 3PU5A 1HSEA 3V5AA 2DWIA 1Q35A 4FE8A 4WEPA 3KOTA 5HBCA 3G3FA 1QUKA 1D4NA 3TQWA 2F6GA 1AH5A 2HAVA 1FTLA 3UGWA 2F5XA 1YAEA 2XXIA 5I58B 3MQ9A 3I6VA 1LAXA 5FHNA 2DP8A 3LC8A 4JSDA 4Q5TA 4RJZA 3B6QA 3CFZA 3CRBA 3N6UA 3EPEA 2HFBA 5A5XB 1MXUA 3SESA 5H8QB 4DCYA 4F2OA 4KYDA 3RY3A 1Y3PA 4OHNA 5CMMA 1B7ZA 4JDFA 4OVJA 2X7PA 4LQ5A 3TZAA 3I3VA 4PE5B 1IITA 4N07A 3IOVA 4OTEA 4RK2A 3TTRA 3A3UA 3L6GA 1SI0A 3VXBA 3K1MA 3K01A 2I0CA 3TMGA 4RXLA 1LGBC 4KYEA 1MQJA 2Y7KA 1MY0A 5I2NA 4R6YA 3E13X 1ZU0A 3W9WA 1DSNA 2NWJA 1QJMA 1MQHA 5A5XA 2H25A 1SVXB 5H8QA 4JB7A 1PB9A 4POWA 1Y9UA 3Q29A 3ONMA 4I1DA 1MXXA 4QSDA 2XXVA 4GFRA 1NMUA 3OOAA 1MRPA 1US4A 4IY6A 3IB0A 3IOUA 2HAUA 2VHAA 2O1LA 1IEJA 3C33A 3N5LA 1A99A 5EYFA 2OCUA 4DZ1A 2HZLA 3H6WA 3O29A 3FIRA 4FORA 1JW5A 4MBPA 1LAGE 1EZOA 1OVBA 4OETA 4HS7A 2ZNUA 5CBSA 2Q2CA 3O6HA 1IUDA 3KBRA 5CRYA 1N76A 1Y1MA 4PQJA 2QJEA 3G3HA 4P11A 1Z7NE 3FXRA 3G7WA 4RA1A 3VFJA 2DE2A 1S50A 2M8CA 2Z8FA 3TFLA 2DOJA 4Q8RA 1OLAA 2OBGA 3OENA 4OWDA 4OEUA 4NMYA 4GF8A 1LBCA 3TODA 3E4RA 3HV1A 4KD5A 5JTYA 5DVIA 1D9YA 3HHFA 1TXFA 3KSXA 4BDRA 4X1DA 2RINA 2H5YA 1OQHA 2QS4A 1LB8A 4LQ2A 2ZYKA 3JV9A 3MZ1A 4DXUA 3PUYE 5DVJA 5EHMA 4GQOA 4KFQA 1MG1A 1H76A 1B1HA 1MPBA 3N94A 4QHQA 1D3KA 2O7IA 4FAJA 3PUZE 1M5CA 3MWBA 5FTHA 1RYXA 4GXAA 4DXCA 4F3BA 3Q28A 4YKPA 1US5A 1LB9A 5LOMA 1NH8A 1H44A 2H4IA 3HO7A 4WKMA 3TTMA 5HPQA 3KN8A 3ECRA 1GGGA 1AOVA 2E0SA 3K6WA 4TLLB 3U92A 4OEVA 4RPOA 2GRVA 3KJTA 1IZ1A 5H8FB 2REGA 3FVGA 3ILUB 3Q26A 3VLWA 2XX9A 1B51A 2XXHA 4GXSB 3PMVA 3RTFB 4DE8A 2HEUA 4H5GA 2QS1A 2OZZA 4ZE8A 4EF2A 3FV2A 4KYSA 1PEBA 3OO9A 3TYHA 4WEDA 4HCYA 2XD3A 4E0XA 4YMBA 1M5FA 1SYHA 1MQGA 2ZYNA 3G3IA 1B4ZA 4NTLA 3VLUA 4RPNA 2V3TA 1TFDA 3IOWA 2HQ0A 4F3PA 2Z8DA 2PT1A 5H8FA 2VP1A 5H8NB 1ZTYA 1YTVA 4F1VA 3HCQA 3MP8A 4G68B 3FJMA 1FQEA 4XKPA 4OYVA 3H3GA 3O6IA 2Z23A 2ZXTA 4NF4B 1H43A 5H8SA 4QFNA 4U4SA 4H8IA 1XHYA 1TT1A 2OK2A 2Y7RA 2W7YA 2UVJA 1H45A 1MQIA 1J1NA 2F97A 2YPNA 2CMOA 1GV8A 4XKNA 4G8NA 4G2ZA 3M8UA 5JEIA 4O3AA 1P1WA 1I69A 1AMFA 1JVXA 1B5IA 2XXWA 1JEUA 5H8NA 4YB6A 3CG3A 3RN8A 3HN0A 1B3GA 3S9LC 1BP5A 1O7TA 4G68A 3HSTA 1FTKA 4EQ7A 5L9OA 2ABHA 4QFLA 1HSLA 4O3BA 1SDXA 1OIBA 4GL8A 1BTJA 1MH4A 3K1PA 4NF4A 3H7MA 4RYAA 2XXYA 3IORA 4F3GA 2F7AA 4Q0CA 4R75A 2ZNSA 1MDQA 4YU0A 3IO4A 3EHSA 1NFTA 1LFIA 3DP6A 3S2VA 3VV5A 5F1QA 2V3UA 3QYTA 2UVGA 3C4MA 4PP0A 4BDOA 1D9VA 2Y7IA 3SDFA 3OSQA 3OD7A 2XX7A 2ZYMA 2RC9A 3JZJA 4U4XA 3EHTA 4LZ8A 2R9JA 3IB1A 4P0IA 4I9DA 3K6VA 1B7HA 4BLAA 4O3CA 2I58A 2VD2A 3PUVE 1NL5A 3VLVA 3BBRA 5TP9B 4OZ9A 4POXA 4FIMA 1FQDA 4GOTA 1DPPA 3KGCA 3KZGA 1LAFE 3RLFE 4YKJA 4IGTA 1N7XA 3Q27A 4EF1A 1ATGA 3FUZA 4MFIA 2B3BA 3B6TA 2GFEA 1MPCA 3RNNA 2DVCA 1L5TA 4XKRA 1GTKA 2Y84A 3ODBA 1B4HA 4KI0E 3TELA 1DTZA 2D5WA 3FJGA 3DLNA 3B7DA 1P1NA 1SW2A 3OSRA 3GBAA 3O2AA 3KOSA 5TP9A 1UQWA 2UVHA 3IO6A 4GD5A 3FASA 2BJJX 3K2DA 3E3KA 2ONRA 1B3HA 4OESA 3PPPA 1B46A 3MP6A 4R73A 5CI5A 1GR2A 2X26A 1B58A 2IEEA 5I2NB 4ZEDA 4LVQA 2Y7PA 4Q30B 4X1BA 3T22A 1URGA 4ZE9A 2F34A 3PV0E 4EDPA 3R26A 2H99A 5JK4A 1RKMA 4AB5A 2ALUA 1B5HA 2V84A 1B40A 4H65A 3FXUA 1LCTA 3QIMA 1VE4A 1VFDA 1PBQA 2I0BA 4ND9A 1WVJA 3MW0A 2VGQA 4GRKA 4QRZA 3O6GA 3FXQA 3SEUA 2GH9A 3IJOB 1IXCA 5I57B 3LBSA 3TDJA 3SEVA 4ELPA 5K2XA 1JW1A 2QRYA 5TU0A 3USDA 1A54A 2YJPA 3V89B 1CE2A
chains in the Genus database with same CATH superfamily
5B7DA 1JW4A 1EZPA 3OMBA 1F9BA 4PF8A 3QUFA 4JVDA 4BDNA 1Q1KA 1DPEA 2A5SA 4G61A 3V8XB 5ISUA 5I56B 3G3JA 3S9MC 4GWWA 4QFOA 1UTBB 4NWCA 4DCXA 1SBPA 1PBPA 3SEXA 3BFTA 3P7IA 4KR5A 3MVYA 1LCFA 4GX3A 3S9EA 3FD3A 3RT8A 1CB6A 3C35A 1M5EA 5I57A 5CMBA 5JTYB 4P1LA 3D4CA 1P1UA 3HHGA 1LLSA 2ONKE 3SEWA 1I6AA 1ELJA 2A5TB 2WX9A 3ROJA 2FIXA 4OERA 4U21A 3FZVA 1CNQA 3K1NA 1JQFA 1S7YA 3WAFA 5IGAA 2O7UA 2QS2A 1VSOA 3KBZA 4GBWA 3OO6A 4PBHA 2XA5A 2UYEA 5I56A 4ZZAA 3PPQA 4XIGQ 1BIYA 5DEXA 1UTBA 4OMBA 3TCFA 3QUJA 3KN7A 4G4PA 3CSBA 4YZZA 4MMPA 4XKQA 4OENA 1B3EA 1XS5A 3BKIB 2WYPA 2CEYA 2DE3A 1Y1ZA 4MNPA 2RC7A 4ISUA 3LSXA 2BJIA 2OWTA 4P8BA 4ZEIA 2P1SA 3T0JA 3VVDA 3TKDA 1NNFA 2NXOA 2A5TA 4PFBA 3TCHA 4O7IA 1ZKBA 4ZS9A 5DTBA 3TPAA 1FBPA 3E9XA 1MH3A 1LSTA 4O8MA 1SQYA 4FEDA 4MHFA 3DELB 3TQLA 3RGYA 2H98A 2WYKA 5EHSA 1I6QA 1NNPA 4G8HA 3MVXA 3H6VA 4N4UA 4O7MA 4RY1A 2FYIA 3D1RA 4NF6B 2V3QA 2QMWA 1PB8A 5L9SA 1NV6A 4ZECA 1B3LA 1P1OA 2R71A 1B3FA 3TUSA 4UA8A 3CSGA 3GYYA 3IL1B 2DWAA 5KDTA 4I8CA 4OFLA 4P47A 2O69A 2OWSA 1ZLQA 4GVOA 2REJA 2ESNA 4YB7A 1R6ZA 4LONB 4N8GA 4X9TA 4ZEKA 2HZKA 1AL3A 4GWXA 1FTMA 1M5BA 4ZEBA 1ZMGA 2XWOA 3MVZA 4NWDA 3SKPA 1PC3A 3AXFA 4LA9A 3LR1A 4YB5A 4NF6A 3RPWA 4MF3A 3ZS6A 4IO7A 4YKKA 4FJPA 4OA4A 1QULA 4F1YA 5LTCA 5FHOA 1XI6A 1MXZA 4LUBA 2DWJA 5ICTA 1SW4A 4LN5A 1OMPA 3KFMA 1BK4A 4C1UA 2AYSA 5HM4B 4NEDA 2I4CA 4NHBA 3C32A 1OLCA 3K6UA 1NV0A 3CHGA 3PD9A 2DDKA 3DM0A 4GLIA 3R6UA 2B65A 1FQAA 3KG2A 5L8DA 3H6UA 4ZEFA 4EXKA 2Q88A 1T0KA 2RC8A 2Q9TA 1IMAA 3R7XA 3BFUA 3OO8A 4F31B 2D3IA 4YKIA 3U1OA 5ET5A 3C31A 4F22A 4HCWA 1XT8A 3FGSA 1MDP1 5ITOA 2VOZA 5AA2A 1FQCA 3UN6A 3LUYA 3TAJA 2I49A 1FPKA 3O66A 4I40A 3CIJA 2Z8EA 1Y3NA 1YZ0A 1LFGA 3FJ7A 5ELVA 3WAEA 4I62A 3F11A 4R74A 1FTAA 1IMBA 1H3DA 1MS7A 2ANJA 1ZBMA 2RKMA 1DBZA 2F8DA 2LAOA 5AA2D 1G0HA 1WDNA 4LZ7A 4N13A 3IX1A 2O68A 4H8JA 3MZ9A 1MM7A 4GIZA 4OVQA 1OQGA 1QKBA 4PCDA 1MY4A 3M3LA 1B05A 1INPA 3G3GA 4RK9A 1QW0A 3CVGA 1IXHA 4NGUA 1PDAA 5ESYA 3U94A 1SPIA 3RQTA 3VE1B 3H4ZA 3VXCA 3E79A 5I84A 1B5JA 3RUMA 4NF8B 4KQPA 4I3EA 2FVZA 2P3NA 5EQ8A 5I2KB 4YAHX 1BLFA 2X7QA 1LAHE 3LSFB 1A8FA 2Y7WA 3M3KA 4ESXA 2FA7A 5K2YA 2THIA 1XVXA 4M4GA 5FHMA 4DDDA 4JSOA 1MXWA 1DOTA 3A3CA 2XXXA 3TTNA 4C1TA 1MPDA 2DYXA 2L5VA 4JWXA 4AQ4A 4MNIA 2AIXA 4Z7EA 1MY2A 5T3JA 1R9QA 5I59B 1SYIA 2RF1A 1SW5A 4L17A 4NE4A 4HTGA 4RNSA 4HE0A 3ZSFA 4JXIA 2KLFA 3IK6B 3T9HB 3K02A 4NF8A 4QFKA 4JWYA 4PETA 4KPTA 4IGRA 3S9NC 3DP4A 3TTLA 4F1UA 1M5DA 2B3FA 2PVUA 5I2KA 3TEPA 3PPOA 1B0HA 1NUWA 5AA1A 3RPLB 4F19A 1Y3QA 4G68C 4ECFA 3K6XA 4PFUA 1FPLA 4ELRA 2O6AA 1VFEA 2QS3A 3UORA 2QL3A 2FNCA 4ONYA 3Q25A 1USYH 1NV7A 2Q8MA 5I59A 5IM2A 2UYFA 4NF0A 3FBPA 2Q2AA 3T96B 3M3FA 2B4MA 2OLBA 4FBPA 4LZ5A 1LEVA 1FPBA 4GWSA 4NN3A 3KEIA 5M2VA 4ELQA 4QSCA 2CZLA 3SEYA 2QPQA 1FTJA 3RPLA 3I5OA 4KCCA 4R6KA 4OVTA 4EXLA 1Y20A 1DCUA 2F7CA 4ZDMA 5ET7A 2ZMBA 4IO5A 4MH5A 1FQFA 3OEKA 4PGNA 2DXYA 2I3WA 2PX1A 4ELOA 4NF5B 1IIWA 4C0RA 4OVPA 3MZBA 2UXAA 4G77A 2GHAA 1B52A 3RT6B 1DMBA 1FJ9A 3C34A 4MAGA 4GWOA 2Y5KA 4XTCQ 4GWYA 1LBBA 2R6GE 4DIGA 1IMFA 1QVSA 4F39A 4QSEA 5CMKA 5IKBA 4R2BA 2E1SA 5I58A 4R9FA 1IQ7A 3T93B 1FQBA 3N26A 4DI3D 3IR1A 3FV1A 2ZNTA 2DSFA 4DI4B 1A8EA 1XOCA 4ZZEA 1FW0A 2PMSA 5DEXB 3T9UA 5IAIA 3GLBA 3CI8A 1NH7A 2HPGA 3ZKLA 2DQVA 4PTKA 1WODA 3PPNA 4NF5A 1VR5A 2P3VA 3E78A 2V25A 1FPIA 3KN3A 1Q9DA 4TOZA 1POY1 4FECA 3A09A 2VD3A 4OFJA 4OXVA 3IFCA 3CR9A 1FBDA 3IOTA 4HE1A 1G0IA 1FPGA 4PC9A 4TQUQ 4F3SA 5H8HB 1R9LA 1FTOA 4E0WA 4EQ9A 3QSLA 3O9PA 4U22A 1IXGA 1A55A 4JWOA 3TTKA 4U1OA 2P0SA 4R2FA 4MX6A 2XWVA 4U23A 4M1VA 5F7VA 3D4GA 3RTWB 1JEVA 2QVUA 2ONSA 1NNKA 4BDLA 2F35A 5A5LA 3GBBA 3G3KA 4JBZA 3HFUA 3QAXA 4PAFA 4KXPA 3SERA 1HSJA 3ZKKA 3CG1A 3PMXA 2OX3A 2I4BA 5DT6A 4N91A 5KDTB 1B7UA 3UA8A 3U93A 4Z0IA 4JVCA 5BWJA 1NUXA 1NKXA 4PF6A 2AL4A 3V83A 2XD2A 3PUXE 4QFPA 5H8HA 4MLVA 1UTHB 1Z7ME 1QKAA 1FBEA 2P2AA 4U1ZA 3B6WA 2OJTA 5LDZA 4F18A 3EQ1A 3KC0A 3PPRA 1P1QA 2O1MA 3T9XB 1BKAA 2HCAA 1N3XA 3OO7A 1JETA 2I48A 3O28A 3UIFA 4U2RA 3GXAA 4XEQA 4EUOA 3FVNA 3T66A 3BIHA 5KZTA 1GVCA 3W9VA 1NV2A 1LFHA 1FCKA 3H03A 4P56A 2G29A 1UIUA 1URSA 2F78A 4H1XA 2ZZXA 4FEBA 2AL5A 2XXTA 3H06B 4H5FA 3FVKA 4GL0A 1ANFA 1N3WA 1ZJLA 2V4CA 1B6HA 3VVFA 2XHDA 4THIA 2RCBA 1POTA 2WEFA 4OFOA 3U8QA 1TWYA 1UTHA 1QUJA 1JVYA 3LSWA 1FSAA 1B0LA 3LV0A 3L6HA 4XXUA 3UP9A 1II5A 3EN3A 1K9ZA 1A7LA 4BDMA 1RYOA 1O64A 1EYIA 4MCOA 5CM6A 2RCAA 1B1XA 2DE4A 3MPKA 3KC1A 2Q89A 1XC1A 4MLQA 4K3FA 1FPFA 4H6DA 3FXBA 1AWBA 1B9JA 3MSTA 4IO6A 2PYYA 1TFAA 2Z22A 5AA2B 4FATA 4KHZE 1N7WA 3MBPA 3CFXA 4KCDA 1EU8A 4PFWA 3EF7A 5AE4A 2NUVA 3MPLA 5I3SA 4IO2A 3PMWA 2DWHA 2XXRA 3QXMA 1N04A 4R72A 1Y4TA 2ZYOA 3PD8A 5ICQA 2F7BA 4NQ8A 4BDQA 4PFTA 3W15C 4OANA 3HPIA 4OVRA 1Y4CA 4PFRA 2GHBA 2XXQA 4WXJA 2PFYA 3LSLA 3MC2A 1QUIA 4R6HA 4GWUA 5J1DA 3THIA 1SD3A 3ILTB 3JYRA 4OQOA 1QGXA 2D21A 2HXWA 3MP1A 1MY3A 3KSJA 2XWKA 4O94A 5DVFA 3OELA 5BUUA 5IZZA 2PT2A 4X04A 4H67A 2DS9A 1KWHA 5TPAB 2NOOA 2V93A 2Q8JA 2H9BA 3PGFA 2XXUA 3K4UA 4IO3A 4IY5A 1USYE 1KA0A 4IB2A 5DW8A 1B32A 1FJ6A 3S4UA 2FHYA 3C36A 4PAIA 3ISPA 1UIVA 4IO4A 1JP4A 2YLNA 1ZIUA 1YCJA 5ET8A 1S9TA 2CZHA 5B70A 3T9VA 1OVTA 1JNFA 1R1NA 1EYJA 4TLMB 4G8MA 3B8BA 4F29A 5EQAA 4YMAA 4LATA 5ITPA 1N0TA 4ESWA 5CBRA 3K0VA 5AA4B 3MAMA 3U72A 3FVOA 5TPAA 1NV1A 1FBFA 4PFIA 1EZ9A 3PUWE 4HW8A 1P99A 2QMXA 4H45A 1URDA 3VVEA 2O84X 1SW1A 2XXPA 1IMDA 4DLDA 3O97A 4PBQA 2G93A 1MM6A 5I5PA 4DXBA 1EH3A 2QSXA 4QXDA 2I3VA 4PGPA 3QMFA 2QVRA 1B2HA 3N6TA 1O63A 3C9HA 4R9GA 4JVIA 2IA4A 2O51A 1IXIA 1K9YA 5KCJB 4GX4A 3IJXB 3KJ7A 1PB7A 3H6TA 4GX6A 3UK4A 2PBWA 4UACA 4YICA 1A40A 1NNTA 4PFYA 1MQDA 5F24A 5AA4A 1MXVA 3FATA 3CFLA 1DTGA 2UVIA 1NI9A 2F6PA 2OWZA 1XVYA 1N84A 2WKYA 5AA3A 2NVUB 3K00A 1FPDA 3OXNA 4HE2A 3IB2A 3TCGA 4H0WA 4X48A 1AIVA 3MUQA 4EQBA 2XX8A 2I6EA 4N6PA 5DYHA 3EHUA 3QK6A 5CC2A 1MXYA 3T1BA 4P0GA 1YPNA 4F2QA 2DXRA 3GZGA 4LP2B 2DVZA 5FTIA 3DP8A 3MJNA 4QF9A 1LBVA 4AB6A 1FBGA 5CMCA 4GBVA 3VDFA 1FPJA 2F3DA 2F36A 5KCJA 1SI1A 3OEMA 3MVWA 3SETA 5L9MA 1I6BA 4PE3A 3SZPA 3IAZA 4N6KA 1MY1A 3PU5A 1HSEA 3V5AA 2DWIA 1Q35A 4FE8A 2CZKA 4WEPA 3KOTA 2XWIA 2JJKA 2CEXA 5HBCA 4NG7A 3G3FA 1QUKA 1D4NA 3TQWA 2F6GA 1AH5A 2ZZVA 2HAVA 1FTLA 3UGWA 2F5XA 1YAEA 2XXIA 5I58B 3MQ9A 3I6VA 1LAXA 5FHNA 2DP8A 3LC8A 4JSDA 1KA1A 4H46A 4Q5TA 4RJZA 3B6QA 3CFZA 4XF5A 3CRBA 3N6UA 3EPEA 2HFBA 1KZ8A 5A5XB 1MXUA 2WBBA 3SESA 5H8QB 4DCYA 4F2OA 3EKIA 4KYDA 3RY3A 1Y3PA 4N81A 4OHNA 5CMMA 1B7ZA 4JDFA 4OVJA 2X7PA 4LQ5A 1NUYA 3TZAA 3I3VA 4PE5B 1IITA 4MIJA 4N07A 3IOVA 4OTEA 4RK2A 4NAPA 3TTRA 3A3UA 3L6GA 1SI0A 3VXBA 3K1MA 3K01A 2I0CA 5EYGA 3TMGA 4RXLA 1LGBC 4KYEA 1MQJA 2Y7KA 1MY0A 2PCRA 5I2NA 4R6YA 3E13X 1ZU0A 3W9WA 1DSNA 2NWJA 1QJMA 1MQHA 5A5XA 2H25A 1SVXB 5H8QA 1FPEA 4JB7A 4MNCA 1PB9A 1FRPA 4POWA 5EQ9A 1EYKA 1Y9UA 1LBZA 3LUZA 3Q29A 3ONMA 4I1DA 4XFEA 1MXXA 4QSDA 2XXVA 4GFRA 1NMUA 3OOAA 1MRPA 1US4A 4IY6A 3IB0A 3IOUA 2HAUA 2VT5A 1NUZA 1LBYA 2VHAA 2O1LA 1IEJA 3C33A 3N5LA 4HXVA 1A99A 3PTYA 5EYFA 2OCUA 4DZ1A 2HZLA 4IR8A 3H6WA 3O29A 3FIRA 4FORA 1JW5A 4MBPA 1LAGE 1EZOA 1OVBA 4OETA 4HS7A 2ZNUA 5CBSA 1YXIA 2Q2CA 3O6HA 1IUDA 1LBXA 4X8RA 3KBRA 5CRYA 1N76A 1Y1MA 4PQJA 2MKZA 4MJOA 2QJEA 3G3HA 3A29A 4N8YA 4P11A 1Z7NE 3FXRA 3G7WA 4RA1A 3VFJA 2DE2A 3B50A 1S50A 2M8CA 2Z8FA 2DOJA 3TFLA 1RDYA 1VDWA 4Q8RA 1OLAA 2OBGA 3OENA 4OWDA 4OEUA 4NMYA 4GF8A 1LBCA 4UABA 3TODA 3E4RA 3HV1A 4KD5A 5JTYA 5DVIA 1D9YA 3HHFA 1TXFA 5J16A 3KSXA 4BDRA 4X1DA 2RINA 2H5YA 1IMEA 1D9QA 1OQHA 2QS4A 1LB8A 4LQ2A 2ZYKA 3JV9A 3MZ1A 4DXUA 3PUYE 5I7IA 5DVJA 5EHMA 4GQOA 4KFQA 1MG1A 1H76A 1B1HA 1MPBA 4AS4A 3N94A 4QHQA 4P9KA 1D3KA 2O7IA 4FAJA 3PUZE 1M5CA 3MWBA 5FTHA 2KR0A 1RYXA 4GXAA 4DXCA 4F3BA 3Q28A 4YKPA 1US5A 1LB9A 5LOMA 1NH8A 1H44A 2H4IA 2FIEA 3HO7A 3BIGA 4WKMA 3TTMA 5HPQA 4N17A 2PFZA 1NV4A 3KN8A 2XXKA 3ECRA 1RDXA 1GGGA 2Y5LA 1AOVA 2E0SA 3K6WA 4TLLB 3U92A 4OEVA 4RPOA 2GRVA 3KJTA 1IZ1A 5H8FB 2REGA 3FVGA 2ZZWA 3ILUB 3Q26A 1NV5A 3VLWA 2XX9A 1B51A 2XXHA 4GXSB 3PMVA 3RTFB 4DE8A 2HEUA 4H5GA 2QS1A 2GQ1A 2OZZA 4ZE8A 4EF2A 3FV2A 4KYSA 1PEBA 2B4LA 3OO9A 3TYHA 4WEDA 4HCYA 2XD3A 4E0XA 4YMBA 1M5FA 1IMCA 1SYHA 1MQGA 2ZYNA 3G3IA 1B4ZA 4NTLA 3VLUA 4RPNA 2V3TA 1TFDA 3IOWA 2WBDA 2HQ0A 2Q74A 4F3PA 2Z8DA 2PT1A 5H8FA 2VP1A 5ET6A 5H8NB 1ZTYA 1YTVA 4F1VA 3HCQA 3MP8A 4G68B 3FJMA 1FQEA 4XKPA 4OYVA 3H3GA 3O6IA 2Z23A 2ZXTA 4NF4B 1H43A 4N15A 5H8SA 4QFNA 4U4SA 4QBAA 4H8IA 1XHYA 1TT1A 4P3LA 3U65A 2HXRA 2OK2A 5EQ7A 2Y7RA 2W7YA 2UVJA 4GWZA 1H45A 1MQIA 1J1NA 2F97A 2YPNA 2CMOA 1GV8A 4XKNA 3NOHA 5IZ3B 4G8NA 4G2ZA 3M8UA 5JEIA 4O3AA 1P1WA 1I69A 2QFLA 1AMFA 1JVXA 1B5IA 2XXWA 1JEUA 5H8NA 4YB6A 3CG3A 3RN8A 3HN0A 1B3GA 3S9LC 1BP5A 1O7TA 4G68A 3HSTA 4AS5A 1FTKA 4EQ7A 4PAKA 5L9OA 2ABHA 4QFLA 1HSLA 2HHMA 4O3BA 1SDXA 1OIBA 4GL8A 1BTJA 1MH4A 3K1PA 4NF4A 3H7MA 4RYAA 2XXYA 3IORA 4F3GA 2F7AA 4P1EA 4Q0CA 4R75A 2ZNSA 1MDQA 4YU0A 3IO4A 3EHSA 1NFTA 1LFIA 3IFAA 5IZ3A 3DP6A 3S2VA 3VV5A 5F1QA 2V3UA 3QYTA 2UVGA 4I3YA 3C4MA 4PP0A 1D9VA 2Y7IA 4BDOA 3SDFA 3OSQA 3OD7A 2XX7A 2ZYMA 2RC9A 1RDZA 3JZJA 4U4XA 5EYHA 3EHTA 4LZ8A 2R9JA 3IB1A 4P0IA 4I9DA 1FBHA 3K6VA 2R8TA 1B7HA 4BLAA 4O3CA 2I58A 2VD2A 3PUVE 1NL5A 3VLVA 3BBRA 5TP9B 4OZ9A 4POXA 4FIMA 1FQDA 4GOTA 1DPPA 3KGCA 2VPNA 3KZGA 4NX1A 1LAFE 3RLFE 4OVSA 4YKJA 4IGTA 1N7XA 3Q27A 4EF1A 1ATGA 3FUZA 4MFIA 2B3BA 3B6TA 2GFEA 1MPCA 2FBPA 3RNNA 2DVCA 1L5TA 4MEVA 4XKRA 2VPOA 1GTKA 2Y84A 3ODBA 1B4HA 4KI0E 3TELA 1DTZA 2D5WA 3FJGA 3DLNA 2QVVA 3B7DA 1P1NA 1SW2A 5FBPA 3OSRA 3GBAA 3O2AA 3KOSA 5TP9A 1UQWA 2UVHA 3IO6A 4GD5A 3FASA 2BJJX 3K2DA 3E3KA 2ONRA 1B3HA 4OESA 2CZIA 3PPPA 1B46A 3MP6A 1YYZA 1LBWA 4R73A 5CI5A 1GR2A 2X26A 1B58A 4PDDA 2IEEA 5I2NB 4ZEDA 4LVQA 2Y7PA 4Q30B 4X1BA 3T22A 1URGA 4ZE9A 2F34A 1DK4A 3PV0E 4EDPA 3R26A 2H99A 1NV3A 5JK4A 1RKMA 4AB5A 2ALUA 3MYUA 1B5HA 2V84A 1B40A 4H65A 3FXUA 1LCTA 4N6DA 3QIMA 1VE4A 1VFDA 1PBQA 2I0BA 4ND9A 1WVJA 5IZ1A 3MW0A 2F3BA 2VGQA 4GRKA 4QRZA 3O6GA 1FBCA 3FXQA 3SEUA 2GH9A 3IJOB 1IXCA 5I57B 3LBSA 3TDJA 3RYDA 2KQZA 3SEVA 4ELPA 5K2XA 1JW1A 2QRYA 5TU0A 3USDA 4PDHA 1A54A 2YJPA 3V89B 1CE2A
chains in the Genus database with same CATH topology
5B7DA 1JW4A 1EZPA 3OMBA 1F9BA 3QUFA 4BDNA 1Q1KA 1DPEA 2A5SA 3V8XB 5ISUA 5I56B 3G3JA 3S9MC 4QFOA 1UTBB 4NWCA 4DCXA 1SBPA 1PBPA 3SEXA 3BFTA 3P7IA 4KR5A 3MVYA 1LCFA 3S9EA 3FD3A 3RT8A 1CB6A 3C35A 1M5EA 5I57A 5CMBA 5JTYB 3D4CA 1P1UA 3HHGA 1LLSA 2ONKE 3SEWA 1I6AA 1ELJA 2A5TB 4OERA 4U21A 3FZVA 3K1NA 1JQFA 1S7YA 3WAFA 2O7UA 2QS2A 1VSOA 3OO6A 2UYEA 5I56A 4ZZAA 3PPQA 4XIGQ 1BIYA 5DEXA 1UTBA 4OMBA 3TCFA 3QUJA 3KN7A 4G4PA 3CSBA 4YZZA 4XKQA 4OENA 1XS5A 1B3EA 3BKIB 2DE3A 1Y1ZA 2RC7A 4ISUA 3LSXA 2OWTA 4ZEIA 2P1SA 3VVDA 3TKDA 1NNFA 2NXOA 2A5TA 3TCHA 1ZKBA 4ZS9A 5DTBA 3TPAA 3E9XA 1MH3A 1LSTA 1SQYA 4FEDA 3DELB 3TQLA 3RGYA 2H98A 5EHSA 1I6QA 1NNPA 4G8HA 3MVXA 3H6VA 4RY1A 2FYIA 4NF6B 2V3QA 2QMWA 1PB8A 5L9SA 4ZECA 1B3LA 1P1OA 2R71A 1B3FA 3TUSA 4UA8A 3CSGA 3IL1B 2DWAA 5KDTA 4I8CA 4OFLA 2O69A 2OWSA 1ZLQA 4GVOA 2REJA 2ESNA 4YB7A 1R6ZA 4LONB 4X9TA 4ZEKA 2HZKA 1AL3A 1FTMA 1M5BA 4ZEBA 1ZMGA 3MVZA 4NWDA 3SKPA 1PC3A 3AXFA 4LA9A 3LR1A 4YB5A 4NF6A 3RPWA 4MF3A 3ZS6A 4IO7A 4YKKA 4FJPA 1QULA 4F1YA 5FHOA 1MXZA 4LUBA 2DWJA 5ICTA 1SW4A 4C1UA 1OMPA 3KFMA 2AYSA 5HM4B 4NEDA 2I4CA 3C32A 1OLCA 3K6UA 3PD9A 3DM0A 4GLIA 3R6UA 2B65A 1FQAA 3KG2A 5L8DA 3H6UA 4ZEFA 4EXKA 2Q88A 1T0KA 2RC8A 2Q9TA 3R7XA 3BFUA 3OO8A 4F31B 2D3IA 4YKIA 3U1OA 3C31A 4F22A 4HCWA 1XT8A 3FGSA 1MDP1 5ITOA 2VOZA 5AA2A 1FQCA 3UN6A 3LUYA 3TAJA 2I49A 3O66A 3CIJA 2Z8EA 1Y3NA 1LFGA 3FJ7A 5ELVA 3WAEA 4I62A 3F11A 4R74A 1H3DA 1MS7A 2ANJA 1ZBMA 2RKMA 2F8DA 2LAOA 5AA2D 1WDNA 4LZ7A 4N13A 3IX1A 2O68A 4H8JA 3MZ9A 1MM7A 4GIZA 1OQGA 1QKBA 1MY4A 3M3LA 1B05A 3G3GA 4RK9A 1QW0A 1IXHA 3CVGA 1PDAA 3U94A 3RQTA 3VE1B 3H4ZA 3VXCA 5I84A 1B5JA 3RUMA 4NF8B 4KQPA 5I2KB 4YAHX 1BLFA 2X7QA 1LAHE 3LSFB 1A8FA 2Y7WA 3M3KA 4ESXA 2FA7A 5K2YA 2THIA 1XVXA 4M4GA 5FHMA 4DDDA 4JSOA 1MXWA 1DOTA 3A3CA 2XXXA 3TTNA 4C1TA 1MPDA 2DYXA 4JWXA 4AQ4A 2AIXA 4Z7EA 1MY2A 1R9QA 5I59B 1SYIA 2RF1A 1SW5A 4L17A 4NE4A 4HTGA 4RNSA 3ZSFA 4JXIA 2KLFA 3IK6B 3T9HB 3K02A 4NF8A 4QFKA 4JWYA 4PETA 4KPTA 4IGRA 3S9NC 3DP4A 3TTLA 4F1UA 1M5DA 2B3FA 2PVUA 5I2KA 3TEPA 3PPOA 1B0HA 5AA1A 4F19A 1Y3QA 4G68C 4ECFA 3K6XA 4PFUA 4ELRA 2O6AA 1VFEA 2QS3A 3UORA 2QL3A 2FNCA 4ONYA 3Q25A 1USYH 5I59A 2UYFA 2Q2AA 3T96B 3M3FA 2OLBA 4LZ5A 3KEIA 5M2VA 4ELQA 4QSCA 2CZLA 3SEYA 2QPQA 1FTJA 3I5OA 4KCCA 4R6KA 4EXLA 1Y20A 2F7CA 4ZDMA 2ZMBA 4IO5A 4MH5A 1FQFA 3OEKA 2DXYA 2I3WA 2PX1A 4ELOA 4NF5B 1IIWA 4C0RA 3MZBA 2UXAA 4G77A 2GHAA 1B52A 3RT6B 1DMBA 3C34A 4GWOA 4XTCQ 1LBBA 2R6GE 4DIGA 1QVSA 4F39A 4QSEA 5CMKA 5IKBA 4R2BA 2E1SA 5I58A 4R9FA 1IQ7A 3T93B 1FQBA 3N26A 3IR1A 3FV1A 2ZNTA 2DSFA 1A8EA 1XOCA 4ZZEA 1FW0A 2PMSA 5DEXB 3T9UA 5IAIA 3GLBA 3CI8A 1NH7A 3ZKLA 2DQVA 1WODA 3PPNA 4NF5A 1VR5A 2V25A 3KN3A 4TOZA 1POY1 4FECA 3A09A 2VD3A 4OFJA 4OXVA 3CR9A 3IOTA 4TQUQ 4F3SA 5H8HB 1R9LA 1FTOA 4E0WA 4EQ9A 3QSLA 3O9PA 4U22A 1IXGA 1A55A 4JWOA 3TTKA 4U1OA 2P0SA 4R2FA 4U23A 4M1VA 5F7VA 3D4GA 3RTWB 1JEVA 2ONSA 1NNKA 4BDLA 2F35A 3GBBA 3G3KA 4JBZA 3QAXA 3SERA 1HSJA 3ZKKA 3CG1A 3PMXA 2I4BA 5DT6A 5KDTB 1B7UA 3UA8A 3U93A 4Z0IA 5BWJA 1NKXA 2AL4A 3V83A 2XD2A 3PUXE 4QFPA 5H8HA 4MLVA 1UTHB 1Z7ME 1QKAA 2P2AA 4U1ZA 3B6WA 2OJTA 4F18A 3EQ1A 3PPRA 1P1QA 2O1MA 3T9XB 1BKAA 2HCAA 1N3XA 3OO7A 1JETA 2I48A 3O28A 3UIFA 4U2RA 3GXAA 4EUOA 3FVNA 3T66A 5KZTA 1GVCA 3W9VA 1LFHA 1FCKA 3H03A 2G29A 1UIUA 1URSA 2F78A 4H1XA 4FEBA 2AL5A 2XXTA 3H06B 4H5FA 3FVKA 4GL0A 1ANFA 1N3WA 1ZJLA 1B6HA 3VVFA 2XHDA 4THIA 2RCBA 1POTA 4OFOA 3U8QA 1TWYA 1UTHA 1QUJA 1JVYA 3LSWA 1B0LA 3L6HA 4XXUA 3UP9A 1II5A 3EN3A 1A7LA 4BDMA 1RYOA 1O64A 5CM6A 2RCAA 1B1XA 2DE4A 3MPKA 2Q89A 1XC1A 4MLQA 4K3FA 4H6DA 1B9JA 4IO6A 2PYYA 1TFAA 2Z22A 5AA2B 4FATA 4KHZE 1N7WA 3MBPA 3CFXA 4KCDA 1EU8A 4PFWA 3EF7A 5AE4A 2NUVA 3MPLA 4IO2A 3PMWA 2DWHA 2XXRA 3QXMA 1N04A 4R72A 1Y4TA 2ZYOA 3PD8A 5ICQA 2F7BA 4BDQA 4PFTA 3W15C 3HPIA 1Y4CA 2XXQA 2GHBA 4WXJA 3LSLA 3MC2A 1QUIA 4R6HA 5J1DA 3THIA 1SD3A 3ILTB 3JYRA 4OQOA 2D21A 2HXWA 3MP1A 1MY3A 3KSJA 5DVFA 3OELA 5BUUA 2PT2A 4H67A 2DS9A 1KWHA 5TPAB 2NOOA 2V93A 2Q8JA 2H9BA 3PGFA 2XXUA 3K4UA 4IO3A 4IY5A 1USYE 4IB2A 1B32A 3S4UA 3C36A 1UIVA 4IO4A 2YLNA 1ZIUA 1YCJA 1S9TA 5B70A 3T9VA 1OVTA 1JNFA 1R1NA 4TLMB 4G8MA 4F29A 4YMAA 4LATA 5ITPA 1N0TA 4ESWA 5CBRA 3K0VA 5AA4B 3MAMA 3U72A 3FVOA 5TPAA 1EZ9A 3PUWE 4HW8A 1P99A 2QMXA 1URDA 3VVEA 2O84X 1SW1A 2XXPA 4DLDA 3O97A 2G93A 1MM6A 4DXBA 1EH3A 2QSXA 2I3VA 1B2HA 3N6TA 1O63A 3C9HA 4R9GA 2IA4A 2O51A 1IXIA 5KCJB 3IJXB 3KJ7A 1PB7A 3H6TA 3UK4A 2PBWA 4UACA 4YICA 1A40A 1NNTA 4PFYA 1MQDA 5AA4A 1MXVA 3FATA 3CFLA 1DTGA 2UVIA 2F6PA 1XVYA 1N84A 2WKYA 5AA3A 2NVUB 3K00A 3OXNA 3IB2A 3TCGA 4H0WA 4X48A 1AIVA 3MUQA 4EQBA 2XX8A 2I6EA 4N6PA 5DYHA 3EHUA 3QK6A 5CC2A 1MXYA 4P0GA 1YPNA 4F2QA 2DXRA 3GZGA 4LP2B 2DVZA 5FTIA 3DP8A 3MJNA 4QF9A 4AB6A 5CMCA 3VDFA 2F36A 5KCJA 1SI1A 3OEMA 3MVWA 3SETA 5L9MA 1I6BA 3IAZA 1MY1A 3PU5A 1HSEA 3V5AA 2DWIA 1Q35A 4FE8A 4WEPA 3KOTA 5HBCA 3G3FA 1QUKA 1D4NA 3TQWA 2F6GA 1AH5A 2HAVA 1FTLA 3UGWA 2F5XA 1YAEA 2XXIA 5I58B 3MQ9A 3I6VA 1LAXA 5FHNA 2DP8A 3LC8A 4JSDA 4Q5TA 4RJZA 3B6QA 3CFZA 3CRBA 3N6UA 3EPEA 2HFBA 5A5XB 1MXUA 3SESA 5H8QB 4DCYA 4F2OA 4KYDA 3RY3A 1Y3PA 4OHNA 5CMMA 1B7ZA 4JDFA 4OVJA 2X7PA 4LQ5A 3TZAA 3I3VA 4PE5B 1IITA 4N07A 3IOVA 4OTEA 4RK2A 3TTRA 3A3UA 3L6GA 1SI0A 3VXBA 3K1MA 3K01A 2I0CA 3TMGA 4RXLA 1LGBC 4KYEA 1MQJA 2Y7KA 1MY0A 5I2NA 4R6YA 3E13X 1ZU0A 3W9WA 1DSNA 2NWJA 1QJMA 1MQHA 5A5XA 2H25A 1SVXB 5H8QA 4JB7A 1PB9A 4POWA 1Y9UA 3Q29A 3ONMA 4I1DA 1MXXA 4QSDA 2XXVA 4GFRA 1NMUA 3OOAA 1MRPA 1US4A 4IY6A 3IB0A 3IOUA 2HAUA 2VHAA 2O1LA 1IEJA 3C33A 3N5LA 1A99A 5EYFA 2OCUA 4DZ1A 2HZLA 3H6WA 3O29A 3FIRA 4FORA 1JW5A 4MBPA 1LAGE 1EZOA 1OVBA 4OETA 4HS7A 2ZNUA 5CBSA 2Q2CA 3O6HA 1IUDA 3KBRA 5CRYA 1N76A 1Y1MA 4PQJA 2QJEA 3G3HA 4P11A 1Z7NE 3FXRA 3G7WA 4RA1A 3VFJA 2DE2A 1S50A 2M8CA 2Z8FA 3TFLA 2DOJA 4Q8RA 1OLAA 2OBGA 3OENA 4OWDA 4OEUA 4NMYA 4GF8A 1LBCA 3TODA 3E4RA 3HV1A 4KD5A 5JTYA 5DVIA 1D9YA 3HHFA 1TXFA 3KSXA 4BDRA 4X1DA 2RINA 2H5YA 1OQHA 2QS4A 1LB8A 4LQ2A 2ZYKA 3JV9A 3MZ1A 4DXUA 3PUYE 5DVJA 5EHMA 4GQOA 4KFQA 1MG1A 1H76A 1B1HA 1MPBA 3N94A 4QHQA 1D3KA 2O7IA 4FAJA 3PUZE 1M5CA 3MWBA 5FTHA 1RYXA 4GXAA 4DXCA 4F3BA 3Q28A 4YKPA 1US5A 1LB9A 5LOMA 1NH8A 1H44A 2H4IA 3HO7A 4WKMA 3TTMA 5HPQA 3KN8A 3ECRA 1GGGA 1AOVA 2E0SA 3K6WA 4TLLB 3U92A 4OEVA 4RPOA 2GRVA 3KJTA 1IZ1A 5H8FB 2REGA 3FVGA 3ILUB 3Q26A 3VLWA 2XX9A 1B51A 2XXHA 4GXSB 3PMVA 3RTFB 4DE8A 2HEUA 4H5GA 2QS1A 2OZZA 4ZE8A 4EF2A 3FV2A 4KYSA 1PEBA 3OO9A 3TYHA 4WEDA 4HCYA 2XD3A 4E0XA 4YMBA 1M5FA 1SYHA 1MQGA 2ZYNA 3G3IA 1B4ZA 4NTLA 3VLUA 4RPNA 2V3TA 1TFDA 3IOWA 2HQ0A 4F3PA 2Z8DA 2PT1A 5H8FA 2VP1A 5H8NB 1ZTYA 1YTVA 4F1VA 3HCQA 3MP8A 4G68B 3FJMA 1FQEA 4XKPA 4OYVA 3H3GA 3O6IA 2Z23A 2ZXTA 4NF4B 1H43A 5H8SA 4QFNA 4U4SA 4H8IA 1XHYA 1TT1A 2OK2A 2Y7RA 2W7YA 2UVJA 1H45A 1MQIA 1J1NA 2F97A 2YPNA 2CMOA 1GV8A 4XKNA 4G8NA 4G2ZA 3M8UA 5JEIA 4O3AA 1P1WA 1I69A 1AMFA 1JVXA 1B5IA 2XXWA 1JEUA 5H8NA 4YB6A 3CG3A 3RN8A 3HN0A 1B3GA 3S9LC 1BP5A 1O7TA 4G68A 3HSTA 1FTKA 4EQ7A 5L9OA 2ABHA 4QFLA 1HSLA 4O3BA 1SDXA 1OIBA 4GL8A 1BTJA 1MH4A 3K1PA 4NF4A 3H7MA 4RYAA 2XXYA 3IORA 4F3GA 2F7AA 4Q0CA 4R75A 2ZNSA 1MDQA 4YU0A 3IO4A 3EHSA 1NFTA 1LFIA 3DP6A 3S2VA 3VV5A 5F1QA 2V3UA 3QYTA 2UVGA 3C4MA 4PP0A 4BDOA 1D9VA 2Y7IA 3SDFA 3OSQA 3OD7A 2XX7A 2ZYMA 2RC9A 3JZJA 4U4XA 3EHTA 4LZ8A 2R9JA 3IB1A 4P0IA 4I9DA 3K6VA 1B7HA 4BLAA 4O3CA 2I58A 2VD2A 3PUVE 1NL5A 3VLVA 3BBRA 5TP9B 4OZ9A 4POXA 4FIMA 1FQDA 4GOTA 1DPPA 3KGCA 3KZGA 1LAFE 3RLFE 4YKJA 4IGTA 1N7XA 3Q27A 4EF1A 1ATGA 3FUZA 4MFIA 2B3BA 3B6TA 2GFEA 1MPCA 3RNNA 2DVCA 1L5TA 4XKRA 1GTKA 2Y84A 3ODBA 1B4HA 4KI0E 3TELA 1DTZA 2D5WA 3FJGA 3DLNA 3B7DA 1P1NA 1SW2A 3OSRA 3GBAA 3O2AA 3KOSA 5TP9A 1UQWA 2UVHA 3IO6A 4GD5A 3FASA 2BJJX 3K2DA 3E3KA 2ONRA 1B3HA 4OESA 3PPPA 1B46A 3MP6A 4R73A 5CI5A 1GR2A 2X26A 1B58A 2IEEA 5I2NB 4ZEDA 4LVQA 2Y7PA 4Q30B 4X1BA 3T22A 1URGA 4ZE9A 2F34A 3PV0E 4EDPA 3R26A 2H99A 5JK4A 1RKMA 4AB5A 2ALUA 1B5HA 2V84A 1B40A 4H65A 3FXUA 1LCTA 3QIMA 1VE4A 1VFDA 1PBQA 2I0BA 4ND9A 1WVJA 3MW0A 2VGQA 4GRKA 4QRZA 3O6GA 3FXQA 3SEUA 2GH9A 3IJOB 1IXCA 5I57B 3LBSA 3TDJA 3SEVA 4ELPA 5K2XA 1JW1A 2QRYA 5TU0A 3USDA 1A54A 2YJPA 3V89B 1CE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B7D A;  1JW4 A;  1EZP A;  3OMB A;  1F9B A;  3QUF A;  4BDN A;  1Q1K A;  1DPE A;  2A5S A;  3V8X B;  5ISU A;  5I56 B;  3G3J A;  3S9M C;  4QFO A;  1UTB B;  4NWC A;  4DCX A;  1SBP A;  1PBP A;  3SEX A;  3BFT A;  3P7I A;  4KR5 A;  3MVY A;  1LCF A;  3S9E A;  3FD3 A;  3RT8 A;  1CB6 A;  3C35 A;  1M5E A;  5I57 A;  5CMB A;  5JTY B;  3D4C A;  1P1U A;  3HHG A;  1LLS A;  2ONK E;  3SEW A;  1I6A A;  1ELJ A;  2A5T B;  4OER A;  4U21 A;  3FZV A;  3K1N A;  1JQF A;  1S7Y A;  3WAF A;  2O7U A;  2QS2 A;  1VSO A;  3OO6 A;  2UYE A;  5I56 A;  4ZZA A;  3PPQ A;  4XIG Q;  1BIY A;  5DEX A;  1UTB A;  4OMB A;  3TCF A;  3QUJ A;  3KN7 A;  4G4P A;  3CSB A;  4YZZ A;  4XKQ A;  4OEN A;  1XS5 A;  1B3E A;  3BKI B;  2DE3 A;  1Y1Z A;  2RC7 A;  4ISU A;  3LSX A;  2OWT A;  4ZEI A;  2P1S A;  3VVD A;  3TKD A;  1NNF A;  2NXO A;  2A5T A;  3TCH A;  1ZKB A;  4ZS9 A;  5DTB A;  3TPA A;  3E9X A;  1MH3 A;  1LST A;  1SQY A;  4FED A;  3DEL B;  3TQL A;  3RGY A;  2H98 A;  5EHS A;  1I6Q A;  1NNP A;  4G8H A;  3MVX A;  3H6V A;  4RY1 A;  2FYI A;  4NF6 B;  2V3Q A;  2QMW A;  1PB8 A;  5L9S A;  4ZEC A;  1B3L A;  1P1O A;  2R71 A;  1B3F A;  3TUS A;  4UA8 A;  3CSG A;  3IL1 B;  2DWA A;  5KDT A;  4I8C A;  4OFL A;  2O69 A;  2OWS A;  1ZLQ A;  4GVO A;  2REJ A;  2ESN A;  4YB7 A;  1R6Z A;  4LON B;  4X9T A;  4ZEK A;  2HZK A;  1AL3 A;  1FTM A;  1M5B A;  4ZEB A;  1ZMG A;  3MVZ A;  4NWD A;  3SKP A;  1PC3 A;  3AXF A;  4LA9 A;  3LR1 A;  4YB5 A;  4NF6 A;  3RPW A;  4MF3 A;  3ZS6 A;  4IO7 A;  4YKK A;  4FJP A;  1QUL A;  4F1Y A;  5FHO A;  1MXZ A;  4LUB A;  2DWJ A;  5ICT A;  1SW4 A;  4C1U A;  1OMP A;  3KFM A;  2AYS A;  5HM4 B;  4NED A;  2I4C A;  3C32 A;  1OLC A;  3K6U A;  3PD9 A;  3DM0 A;  4GLI A;  3R6U A;  2B65 A;  1FQA A;  3KG2 A;  5L8D A;  3H6U A;  4ZEF A;  4EXK A;  2Q88 A;  1T0K A;  2RC8 A;  2Q9T A;  3R7X A;  3BFU A;  3OO8 A;  4F31 B;  2D3I A;  4YKI A;  3U1O A;  3C31 A;  4F22 A;  4HCW A;  1XT8 A;  3FGS A;  1MDP 1;  5ITO A;  2VOZ A;  5AA2 A;  1FQC A;  3UN6 A;  3LUY A;  3TAJ A;  2I49 A;  3O66 A;  3CIJ A;  2Z8E A;  1Y3N A;  1LFG A;  3FJ7 A;  5ELV A;  3WAE A;  4I62 A;  3F11 A;  4R74 A;  1H3D A;  1MS7 A;  2ANJ A;  1ZBM A;  2RKM A;  2F8D A;  2LAO A;  5AA2 D;  1WDN A;  4LZ7 A;  4N13 A;  3IX1 A;  2O68 A;  4H8J A;  3MZ9 A;  1MM7 A;  4GIZ A;  1OQG A;  1QKB A;  1MY4 A;  3M3L A;  1B05 A;  3G3G A;  4RK9 A;  1QW0 A;  1IXH A;  3CVG A;  1PDA A;  3U94 A;  3RQT A;  3VE1 B;  3H4Z A;  3VXC A;  5I84 A;  1B5J A;  3RUM A;  4NF8 B;  4KQP A;  5I2K B;  4YAH X;  1BLF A;  2X7Q A;  1LAH E;  3LSF B;  1A8F A;  2Y7W A;  3M3K A;  4ESX A;  2FA7 A;  5K2Y A;  2THI A;  1XVX A;  4M4G A;  5FHM A;  4DDD A;  4JSO A;  1MXW A;  1DOT A;  3A3C A;  2XXX A;  3TTN A;  4C1T A;  1MPD A;  2DYX A;  4JWX A;  4AQ4 A;  2AIX A;  4Z7E A;  1MY2 A;  1R9Q A;  5I59 B;  1SYI A;  2RF1 A;  1SW5 A;  4L17 A;  4NE4 A;  4HTG A;  4RNS A;  3ZSF A;  4JXI A;  2KLF A;  3IK6 B;  3T9H B;  3K02 A;  4NF8 A;  4QFK A;  4JWY A;  4PET A;  4KPT A;  4IGR A;  3S9N C;  3DP4 A;  3TTL A;  4F1U A;  1M5D A;  2B3F A;  2PVU A;  5I2K A;  3TEP A;  3PPO A;  1B0H A;  5AA1 A;  4F19 A;  1Y3Q A;  4G68 C;  4ECF A;  3K6X A;  4PFU A;  4ELR A;  2O6A A;  1VFE A;  2QS3 A;  3UOR A;  2QL3 A;  2FNC A;  4ONY A;  3Q25 A;  1USY H;  5I59 A;  2UYF A;  2Q2A A;  3T96 B;  3M3F A;  2OLB A;  4LZ5 A;  3KEI A;  5M2V A;  4ELQ A;  4QSC A;  2CZL A;  3SEY A;  2QPQ A;  1FTJ A;  3I5O A;  4KCC A;  4R6K A;  4EXL A;  1Y20 A;  2F7C A;  4ZDM A;  2ZMB A;  4IO5 A;  4MH5 A;  1FQF A;  3OEK A;  2DXY A;  2I3W A;  2PX1 A;  4ELO A;  4NF5 B;  1IIW A;  4C0R A;  3MZB A;  2UXA A;  4G77 A;  2GHA A;  1B52 A;  3RT6 B;  1DMB A;  3C34 A;  4GWO A;  4XTC Q;  1LBB A;  2R6G E;  4DIG A;  1QVS A;  4F39 A;  4QSE A;  5CMK A;  5IKB A;  4R2B A;  2E1S A;  5I58 A;  4R9F A;  1IQ7 A;  3T93 B;  1FQB A;  3N26 A;  3IR1 A;  3FV1 A;  2ZNT A;  2DSF A;  1A8E A;  1XOC A;  4ZZE A;  1FW0 A;  2PMS A;  5DEX B;  3T9U A;  5IAI A;  3GLB A;  3CI8 A;  1NH7 A;  3ZKL A;  2DQV A;  1WOD A;  3PPN A;  4NF5 A;  1VR5 A;  2V25 A;  3KN3 A;  4TOZ A;  1POY 1;  4FEC A;  3A09 A;  2VD3 A;  4OFJ A;  4OXV A;  3CR9 A;  3IOT A;  4TQU Q;  4F3S A;  5H8H B;  1R9L A;  1FTO A;  4E0W A;  4EQ9 A;  3QSL A;  3O9P A;  4U22 A;  1IXG A;  1A55 A;  4JWO A;  3TTK A;  4U1O A;  2P0S A;  4R2F A;  4U23 A;  4M1V A;  5F7V A;  3D4G A;  3RTW B;  1JEV A;  2ONS A;  1NNK A;  4BDL A;  2F35 A;  3GBB A;  3G3K A;  4JBZ A;  3QAX A;  3SER A;  1HSJ A;  3ZKK A;  3CG1 A;  3PMX A;  2I4B A;  5DT6 A;  5KDT B;  1B7U A;  3UA8 A;  3U93 A;  4Z0I A;  5BWJ A;  1NKX A;  2AL4 A;  3V83 A;  2XD2 A;  3PUX E;  4QFP A;  5H8H A;  4MLV A;  1UTH B;  1Z7M E;  1QKA A;  2P2A A;  4U1Z A;  3B6W A;  2OJT A;  4F18 A;  3EQ1 A;  3PPR A;  1P1Q A;  2O1M A;  3T9X B;  1BKA A;  2HCA A;  1N3X A;  3OO7 A;  1JET A;  2I48 A;  3O28 A;  3UIF A;  4U2R A;  3GXA A;  4EUO A;  3FVN A;  3T66 A;  5KZT A;  1GVC A;  3W9V A;  1LFH A;  1FCK A;  3H03 A;  2G29 A;  1UIU A;  1URS A;  2F78 A;  4H1X A;  4FEB A;  2AL5 A;  2XXT A;  3H06 B;  4H5F A;  3FVK A;  4GL0 A;  1ANF A;  1N3W A;  1ZJL A;  1B6H A;  3VVF A;  2XHD A;  4THI A;  2RCB A;  1POT A;  4OFO A;  3U8Q A;  1TWY A;  1UTH A;  1QUJ A;  1JVY A;  3LSW A;  1B0L A;  3L6H A;  4XXU A;  3UP9 A;  1II5 A;  3EN3 A;  1A7L A;  4BDM A;  1RYO A;  1O64 A;  5CM6 A;  2RCA A;  1B1X A;  2DE4 A;  3MPK A;  2Q89 A;  1XC1 A;  4MLQ A;  4K3F A;  4H6D A;  1B9J A;  4IO6 A;  2PYY A;  1TFA A;  2Z22 A;  5AA2 B;  4FAT A;  4KHZ E;  1N7W A;  3MBP A;  3CFX A;  4KCD A;  1EU8 A;  4PFW A;  3EF7 A;  5AE4 A;  2NUV A;  3MPL A;  4IO2 A;  3PMW A;  2DWH A;  2XXR A;  3QXM A;  1N04 A;  4R72 A;  1Y4T A;  2ZYO A;  3PD8 A;  5ICQ A;  2F7B A;  4BDQ A;  4PFT A;  3W15 C;  3HPI A;  1Y4C A;  2XXQ A;  2GHB A;  4WXJ A;  3LSL A;  3MC2 A;  1QUI A;  4R6H A;  5J1D A;  3THI A;  1SD3 A;  3ILT B;  3JYR A;  4OQO A;  2D21 A;  2HXW A;  3MP1 A;  1MY3 A;  3KSJ A;  5DVF A;  3OEL A;  5BUU A;  2PT2 A;  4H67 A;  2DS9 A;  1KWH A;  5TPA B;  2NOO A;  2V93 A;  2Q8J A;  2H9B A;  3PGF A;  2XXU A;  3K4U A;  4IO3 A;  4IY5 A;  1USY E;  4IB2 A;  1B32 A;  3S4U A;  3C36 A;  1UIV A;  4IO4 A;  2YLN A;  1ZIU A;  1YCJ A;  1S9T A;  5B70 A;  3T9V A;  1OVT A;  1JNF A;  1R1N A;  4TLM B;  4G8M A;  4F29 A;  4YMA A;  4LAT A;  5ITP A;  1N0T A;  4ESW A;  5CBR A;  3K0V A;  5AA4 B;  3MAM A;  3U72 A;  3FVO A;  5TPA A;  1EZ9 A;  3PUW E;  4HW8 A;  1P99 A;  2QMX A;  1URD A;  3VVE A;  2O84 X;  1SW1 A;  2XXP A;  4DLD A;  3O97 A;  2G93 A;  1MM6 A;  4DXB A;  1EH3 A;  2QSX A;  2I3V A;  1B2H A;  3N6T A;  1O63 A;  3C9H A;  4R9G A;  2IA4 A;  2O51 A;  1IXI A;  5KCJ B;  3IJX B;  3KJ7 A;  1PB7 A;  3H6T A;  3UK4 A;  2PBW A;  4UAC A;  4YIC A;  1A40 A;  1NNT A;  4PFY A;  1MQD A;  5AA4 A;  1MXV A;  3FAT A;  3CFL A;  1DTG A;  2UVI A;  2F6P A;  1XVY A;  1N84 A;  2WKY A;  5AA3 A;  2NVU B;  3K00 A;  3OXN A;  3IB2 A;  3TCG A;  4H0W A;  4X48 A;  1AIV A;  3MUQ A;  4EQB A;  2XX8 A;  2I6E A;  4N6P A;  5DYH A;  3EHU A;  3QK6 A;  5CC2 A;  1MXY A;  4P0G A;  1YPN A;  4F2Q A;  2DXR A;  3GZG A;  4LP2 B;  2DVZ A;  5FTI A;  3DP8 A;  3MJN A;  4QF9 A;  4AB6 A;  5CMC A;  3VDF A;  2F36 A;  5KCJ A;  1SI1 A;  3OEM A;  3MVW A;  3SET A;  5L9M A;  1I6B A;  3IAZ A;  1MY1 A;  3PU5 A;  1HSE A;  3V5A A;  2DWI A;  1Q35 A;  4FE8 A;  4WEP A;  3KOT A;  5HBC A;  3G3F A;  1QUK A;  1D4N A;  3TQW A;  2F6G A;  1AH5 A;  2HAV A;  1FTL A;  3UGW A;  2F5X A;  1YAE A;  2XXI A;  5I58 B;  3MQ9 A;  3I6V A;  1LAX A;  5FHN A;  2DP8 A;  3LC8 A;  4JSD A;  4Q5T A;  4RJZ A;  3B6Q A;  3CFZ A;  3CRB A;  3N6U A;  3EPE A;  2HFB A;  5A5X B;  1MXU A;  3SES A;  5H8Q B;  4DCY A;  4F2O A;  4KYD A;  3RY3 A;  1Y3P A;  4OHN A;  5CMM A;  1B7Z A;  4JDF A;  4OVJ A;  2X7P A;  4LQ5 A;  3TZA A;  3I3V A;  4PE5 B;  1IIT A;  4N07 A;  3IOV A;  4OTE A;  4RK2 A;  3TTR A;  3A3U A;  3L6G A;  1SI0 A;  3VXB A;  3K1M A;  3K01 A;  2I0C A;  3TMG A;  4RXL A;  1LGB C;  4KYE A;  1MQJ A;  2Y7K A;  1MY0 A;  5I2N A;  4R6Y A;  3E13 X;  1ZU0 A;  3W9W A;  1DSN A;  2NWJ A;  1QJM A;  1MQH A;  5A5X A;  2H25 A;  1SVX B;  5H8Q A;  4JB7 A;  1PB9 A;  4POW A;  1Y9U A;  3Q29 A;  3ONM A;  4I1D A;  1MXX A;  4QSD A;  2XXV A;  4GFR A;  1NMU A;  3OOA A;  1MRP A;  1US4 A;  4IY6 A;  3IB0 A;  3IOU A;  2HAU A;  2VHA A;  2O1L A;  1IEJ A;  3C33 A;  3N5L A;  1A99 A;  5EYF A;  2OCU A;  4DZ1 A;  2HZL A;  3H6W A;  3O29 A;  3FIR A;  4FOR A;  1JW5 A;  4MBP A;  1LAG E;  1EZO A;  1OVB A;  4OET A;  4HS7 A;  2ZNU A;  5CBS A;  2Q2C A;  3O6H A;  1IUD A;  3KBR A;  5CRY A;  1N76 A;  1Y1M A;  4PQJ A;  2QJE A;  3G3H A;  4P11 A;  1Z7N E;  3FXR A;  3G7W A;  4RA1 A;  3VFJ A;  2DE2 A;  1S50 A;  2M8C A;  2Z8F A;  3TFL A;  2DOJ A;  4Q8R A;  1OLA A;  2OBG A;  3OEN A;  4OWD A;  4OEU A;  4NMY A;  4GF8 A;  1LBC A;  3TOD A;  3E4R A;  3HV1 A;  4KD5 A;  5JTY A;  5DVI A;  1D9Y A;  3HHF A;  1TXF A;  3KSX A;  4BDR A;  4X1D A;  2RIN A;  2H5Y A;  1OQH A;  2QS4 A;  1LB8 A;  4LQ2 A;  2ZYK A;  3JV9 A;  3MZ1 A;  4DXU A;  3PUY E;  5DVJ A;  5EHM A;  4GQO A;  4KFQ A;  1MG1 A;  1H76 A;  1B1H A;  1MPB A;  3N94 A;  4QHQ A;  1D3K A;  2O7I A;  4FAJ A;  3PUZ E;  1M5C A;  3MWB A;  5FTH A;  1RYX A;  4GXA A;  4DXC A;  4F3B A;  3Q28 A;  4YKP A;  1US5 A;  1LB9 A;  5LOM A;  1NH8 A;  1H44 A;  2H4I A;  3HO7 A;  4WKM A;  3TTM A;  5HPQ A;  3KN8 A;  3ECR A;  1GGG A;  1AOV A;  2E0S A;  3K6W A;  4TLL B;  3U92 A;  4OEV A;  4RPO A;  2GRV A;  3KJT A;  1IZ1 A;  5H8F B;  2REG A;  3FVG A;  3ILU B;  3Q26 A;  3VLW A;  2XX9 A;  1B51 A;  2XXH A;  4GXS B;  3PMV A;  3RTF B;  4DE8 A;  2HEU A;  4H5G A;  2QS1 A;  2OZZ A;  4ZE8 A;  4EF2 A;  3FV2 A;  4KYS A;  1PEB A;  3OO9 A;  3TYH A;  4WED A;  4HCY A;  2XD3 A;  4E0X A;  4YMB A;  1M5F A;  1SYH A;  1MQG A;  2ZYN A;  3G3I A;  1B4Z A;  4NTL A;  3VLU A;  4RPN A;  2V3T A;  1TFD A;  3IOW A;  2HQ0 A;  4F3P A;  2Z8D A;  2PT1 A;  5H8F A;  2VP1 A;  5H8N B;  1ZTY A;  1YTV A;  4F1V A;  3HCQ A;  3MP8 A;  4G68 B;  3FJM A;  1FQE A;  4XKP A;  4OYV A;  3H3G A;  3O6I A;  2Z23 A;  2ZXT A;  4NF4 B;  1H43 A;  5H8S A;  4QFN A;  4U4S A;  4H8I A;  1XHY A;  1TT1 A;  2OK2 A;  2Y7R A;  2W7Y A;  2UVJ A;  1H45 A;  1MQI A;  1J1N A;  2F97 A;  2YPN A;  2CMO A;  1GV8 A;  4XKN A;  4G8N A;  4G2Z A;  3M8U A;  5JEI A;  4O3A A;  1P1W A;  1I69 A;  1AMF A;  1JVX A;  1B5I A;  2XXW A;  1JEU A;  5H8N A;  4YB6 A;  3CG3 A;  3RN8 A;  3HN0 A;  1B3G A;  3S9L C;  1BP5 A;  1O7T A;  4G68 A;  3HST A;  1FTK A;  4EQ7 A;  5L9O A;  2ABH A;  4QFL A;  1HSL A;  4O3B A;  1SDX A;  1OIB A;  4GL8 A;  1BTJ A;  1MH4 A;  3K1P A;  4NF4 A;  3H7M A;  4RYA A;  2XXY A;  3IOR A;  4F3G A;  2F7A A;  4Q0C A;  4R75 A;  2ZNS A;  1MDQ A;  4YU0 A;  3IO4 A;  3EHS A;  1NFT A;  1LFI A;  3DP6 A;  3S2V A;  3VV5 A;  5F1Q A;  2V3U A;  3QYT A;  2UVG A;  3C4M A;  4PP0 A;  4BDO A;  1D9V A;  2Y7I A;  3SDF A;  3OSQ A;  3OD7 A;  2XX7 A;  2ZYM A;  2RC9 A;  3JZJ A;  4U4X A;  3EHT A;  4LZ8 A;  2R9J A;  3IB1 A;  4P0I A;  4I9D A;  3K6V A;  1B7H A;  4BLA A;  4O3C A;  2I58 A;  2VD2 A;  3PUV E;  1NL5 A;  3VLV A;  3BBR A;  5TP9 B;  4OZ9 A;  4POX A;  4FIM A;  1FQD A;  4GOT A;  1DPP A;  3KGC A;  3KZG A;  1LAF E;  3RLF E;  4YKJ A;  4IGT A;  1N7X A;  3Q27 A;  4EF1 A;  1ATG A;  3FUZ A;  4MFI A;  2B3B A;  3B6T A;  2GFE A;  1MPC A;  3RNN A;  2DVC A;  1L5T A;  4XKR A;  1GTK A;  2Y84 A;  3ODB A;  1B4H A;  4KI0 E;  3TEL A;  1DTZ A;  2D5W A;  3FJG A;  3DLN A;  3B7D A;  1P1N A;  1SW2 A;  3OSR A;  3GBA A;  3O2A A;  3KOS A;  5TP9 A;  1UQW A;  2UVH A;  3IO6 A;  4GD5 A;  3FAS A;  2BJJ X;  3K2D A;  3E3K A;  2ONR A;  1B3H A;  4OES A;  3PPP A;  1B46 A;  3MP6 A;  4R73 A;  5CI5 A;  1GR2 A;  2X26 A;  1B58 A;  2IEE A;  5I2N B;  4ZED A;  4LVQ A;  2Y7P A;  4Q30 B;  4X1B A;  3T22 A;  1URG A;  4ZE9 A;  2F34 A;  3PV0 E;  4EDP A;  3R26 A;  2H99 A;  5JK4 A;  1RKM A;  4AB5 A;  2ALU A;  1B5H A;  2V84 A;  1B40 A;  4H65 A;  3FXU A;  1LCT A;  3QIM A;  1VE4 A;  1VFD A;  1PBQ A;  2I0B A;  4ND9 A;  1WVJ A;  3MW0 A;  2VGQ A;  4GRK A;  4QRZ A;  3O6G A;  3FXQ A;  3SEU A;  2GH9 A;  3IJO B;  1IXC A;  5I57 B;  3LBS A;  3TDJ A;  3SEV A;  4ELP A;  5K2X A;  1JW1 A;  2QRY A;  5TU0 A;  3USD A;  1A54 A;  2YJP A;  3V89 B;  1CE2 A; 
#chains in the Genus database with same CATH topology
 5B7D A;  1JW4 A;  1EZP A;  3OMB A;  1F9B A;  4PF8 A;  3QUF A;  4JVD A;  4BDN A;  1Q1K A;  1DPE A;  2A5S A;  4G61 A;  3V8X B;  5ISU A;  5I56 B;  3G3J A;  3S9M C;  4GWW A;  4QFO A;  1UTB B;  4NWC A;  4DCX A;  1SBP A;  1PBP A;  3SEX A;  3BFT A;  3P7I A;  4KR5 A;  3MVY A;  1LCF A;  4GX3 A;  3S9E A;  3FD3 A;  3RT8 A;  1CB6 A;  3C35 A;  1M5E A;  5I57 A;  5CMB A;  5JTY B;  4P1L A;  3D4C A;  1P1U A;  3HHG A;  1LLS A;  2ONK E;  3SEW A;  1I6A A;  1ELJ A;  2A5T B;  2WX9 A;  3ROJ A;  2FIX A;  4OER A;  4U21 A;  3FZV A;  1CNQ A;  3K1N A;  1JQF A;  1S7Y A;  3WAF A;  5IGA A;  2O7U A;  2QS2 A;  1VSO A;  3KBZ A;  4GBW A;  3OO6 A;  4PBH A;  2XA5 A;  2UYE A;  5I56 A;  4ZZA A;  3PPQ A;  4XIG Q;  1BIY A;  5DEX A;  1UTB A;  4OMB A;  3TCF A;  3QUJ A;  3KN7 A;  4G4P A;  3CSB A;  4YZZ A;  4MMP A;  4XKQ A;  4OEN A;  1B3E A;  1XS5 A;  3BKI B;  2WYP A;  2CEY A;  2DE3 A;  1Y1Z A;  4MNP A;  2RC7 A;  4ISU A;  3LSX A;  2BJI A;  2OWT A;  4P8B A;  4ZEI A;  2P1S A;  3T0J A;  3VVD A;  3TKD A;  1NNF A;  2NXO A;  2A5T A;  4PFB A;  3TCH A;  4O7I A;  1ZKB A;  4ZS9 A;  5DTB A;  3TPA A;  1FBP A;  3E9X A;  1MH3 A;  1LST A;  4O8M A;  1SQY A;  4FED A;  4MHF A;  3DEL B;  3TQL A;  3RGY A;  2H98 A;  2WYK A;  5EHS A;  1I6Q A;  1NNP A;  4G8H A;  3MVX A;  3H6V A;  4N4U A;  4O7M A;  4RY1 A;  2FYI A;  3D1R A;  4NF6 B;  2V3Q A;  2QMW A;  1PB8 A;  5L9S A;  1NV6 A;  4ZEC A;  1B3L A;  1P1O A;  2R71 A;  1B3F A;  3TUS A;  4UA8 A;  3CSG A;  3GYY A;  3IL1 B;  2DWA A;  5KDT A;  4I8C A;  4OFL A;  4P47 A;  2O69 A;  2OWS A;  1ZLQ A;  4GVO A;  2REJ A;  2ESN A;  4YB7 A;  1R6Z A;  4LON B;  4N8G A;  4X9T A;  4ZEK A;  2HZK A;  1AL3 A;  4GWX A;  1FTM A;  1M5B A;  4ZEB A;  1ZMG A;  2XWO A;  3MVZ A;  4NWD A;  3SKP A;  1PC3 A;  3AXF A;  4LA9 A;  3LR1 A;  4YB5 A;  4NF6 A;  3RPW A;  4MF3 A;  3ZS6 A;  4IO7 A;  4YKK A;  4FJP A;  4OA4 A;  1QUL A;  4F1Y A;  5LTC A;  5FHO A;  1XI6 A;  1MXZ A;  4LUB A;  2DWJ A;  5ICT A;  1SW4 A;  4LN5 A;  1OMP A;  3KFM A;  1BK4 A;  4C1U A;  2AYS A;  5HM4 B;  4NED A;  2I4C A;  4NHB A;  3C32 A;  1OLC A;  3K6U A;  1NV0 A;  3CHG A;  3PD9 A;  2DDK A;  3DM0 A;  4GLI A;  3R6U A;  2B65 A;  1FQA A;  3KG2 A;  5L8D A;  3H6U A;  4ZEF A;  4EXK A;  2Q88 A;  1T0K A;  2RC8 A;  2Q9T A;  1IMA A;  3R7X A;  3BFU A;  3OO8 A;  4F31 B;  2D3I A;  4YKI A;  3U1O A;  5ET5 A;  3C31 A;  4F22 A;  4HCW A;  1XT8 A;  3FGS A;  1MDP 1;  5ITO A;  2VOZ A;  5AA2 A;  1FQC A;  3UN6 A;  3LUY A;  3TAJ A;  2I49 A;  1FPK A;  3O66 A;  4I40 A;  3CIJ A;  2Z8E A;  1Y3N A;  1YZ0 A;  1LFG A;  3FJ7 A;  5ELV A;  3WAE A;  4I62 A;  3F11 A;  4R74 A;  1FTA A;  1IMB A;  1H3D A;  1MS7 A;  2ANJ A;  1ZBM A;  2RKM A;  1DBZ A;  2F8D A;  2LAO A;  5AA2 D;  1G0H A;  1WDN A;  4LZ7 A;  4N13 A;  3IX1 A;  2O68 A;  4H8J A;  3MZ9 A;  1MM7 A;  4GIZ A;  4OVQ A;  1OQG A;  1QKB A;  4PCD A;  1MY4 A;  3M3L A;  1B05 A;  1INP A;  3G3G A;  4RK9 A;  1QW0 A;  3CVG A;  1IXH A;  4NGU A;  1PDA A;  5ESY A;  3U94 A;  1SPI A;  3RQT A;  3VE1 B;  3H4Z A;  3VXC A;  3E79 A;  5I84 A;  1B5J A;  3RUM A;  4NF8 B;  4KQP A;  4I3E A;  2FVZ A;  2P3N A;  5EQ8 A;  5I2K B;  4YAH X;  1BLF A;  2X7Q A;  1LAH E;  3LSF B;  1A8F A;  2Y7W A;  3M3K A;  4ESX A;  2FA7 A;  5K2Y A;  2THI A;  1XVX A;  4M4G A;  5FHM A;  4DDD A;  4JSO A;  1MXW A;  1DOT A;  3A3C A;  2XXX A;  3TTN A;  4C1T A;  1MPD A;  2DYX A;  2L5V A;  4JWX A;  4AQ4 A;  4MNI A;  2AIX A;  4Z7E A;  1MY2 A;  5T3J A;  1R9Q A;  5I59 B;  1SYI A;  2RF1 A;  1SW5 A;  4L17 A;  4NE4 A;  4HTG A;  4RNS A;  4HE0 A;  3ZSF A;  4JXI A;  2KLF A;  3IK6 B;  3T9H B;  3K02 A;  4NF8 A;  4QFK A;  4JWY A;  4PET A;  4KPT A;  4IGR A;  3S9N C;  3DP4 A;  3TTL A;  4F1U A;  1M5D A;  2B3F A;  2PVU A;  5I2K A;  3TEP A;  3PPO A;  1B0H A;  1NUW A;  5AA1 A;  3RPL B;  4F19 A;  1Y3Q A;  4G68 C;  4ECF A;  3K6X A;  4PFU A;  1FPL A;  4ELR A;  2O6A A;  1VFE A;  2QS3 A;  3UOR A;  2QL3 A;  2FNC A;  4ONY A;  3Q25 A;  1USY H;  1NV7 A;  2Q8M A;  5I59 A;  5IM2 A;  2UYF A;  4NF0 A;  3FBP A;  2Q2A A;  3T96 B;  3M3F A;  2B4M A;  2OLB A;  4FBP A;  4LZ5 A;  1LEV A;  1FPB A;  4GWS A;  4NN3 A;  3KEI A;  5M2V A;  4ELQ A;  4QSC A;  2CZL A;  3SEY A;  2QPQ A;  1FTJ A;  3RPL A;  3I5O A;  4KCC A;  4R6K A;  4OVT A;  4EXL A;  1Y20 A;  1DCU A;  2F7C A;  4ZDM A;  5ET7 A;  2ZMB A;  4IO5 A;  4MH5 A;  1FQF A;  3OEK A;  4PGN A;  2DXY A;  2I3W A;  2PX1 A;  4ELO A;  4NF5 B;  1IIW A;  4C0R A;  4OVP A;  3MZB A;  2UXA A;  4G77 A;  2GHA A;  1B52 A;  3RT6 B;  1DMB A;  1FJ9 A;  3C34 A;  4MAG A;  4GWO A;  2Y5K A;  4XTC Q;  4GWY A;  1LBB A;  2R6G E;  4DIG A;  1IMF A;  1QVS A;  4F39 A;  4QSE A;  5CMK A;  5IKB A;  4R2B A;  2E1S A;  5I58 A;  4R9F A;  1IQ7 A;  3T93 B;  1FQB A;  3N26 A;  4DI3 D;  3IR1 A;  3FV1 A;  2ZNT A;  2DSF A;  4DI4 B;  1A8E A;  1XOC A;  4ZZE A;  1FW0 A;  2PMS A;  5DEX B;  3T9U A;  5IAI A;  3GLB A;  3CI8 A;  1NH7 A;  2HPG A;  3ZKL A;  2DQV A;  4PTK A;  1WOD A;  3PPN A;  4NF5 A;  1VR5 A;  2P3V A;  3E78 A;  2V25 A;  1FPI A;  3KN3 A;  1Q9D A;  4TOZ A;  1POY 1;  4FEC A;  3A09 A;  2VD3 A;  4OFJ A;  4OXV A;  3IFC A;  3CR9 A;  1FBD A;  3IOT A;  4HE1 A;  1G0I A;  1FPG A;  4PC9 A;  4TQU Q;  4F3S A;  5H8H B;  1R9L A;  1FTO A;  4E0W A;  4EQ9 A;  3QSL A;  3O9P A;  4U22 A;  1IXG A;  1A55 A;  4JWO A;  3TTK A;  4U1O A;  2P0S A;  4R2F A;  4MX6 A;  2XWV A;  4U23 A;  4M1V A;  5F7V A;  3D4G A;  3RTW B;  1JEV A;  2QVU A;  2ONS A;  1NNK A;  4BDL A;  2F35 A;  5A5L A;  3GBB A;  3G3K A;  4JBZ A;  3HFU A;  3QAX A;  4PAF A;  4KXP A;  3SER A;  1HSJ A;  3ZKK A;  3CG1 A;  3PMX A;  2OX3 A;  2I4B A;  5DT6 A;  4N91 A;  5KDT B;  1B7U A;  3UA8 A;  3U93 A;  4Z0I A;  4JVC A;  5BWJ A;  1NUX A;  1NKX A;  4PF6 A;  2AL4 A;  3V83 A;  2XD2 A;  3PUX E;  4QFP A;  5H8H A;  4MLV A;  1UTH B;  1Z7M E;  1QKA A;  1FBE A;  2P2A A;  4U1Z A;  3B6W A;  2OJT A;  5LDZ A;  4F18 A;  3EQ1 A;  3KC0 A;  3PPR A;  1P1Q A;  2O1M A;  3T9X B;  1BKA A;  2HCA A;  1N3X A;  3OO7 A;  1JET A;  2I48 A;  3O28 A;  3UIF A;  4U2R A;  3GXA A;  4XEQ A;  4EUO A;  3FVN A;  3T66 A;  3BIH A;  5KZT A;  1GVC A;  3W9V A;  1NV2 A;  1LFH A;  1FCK A;  3H03 A;  4P56 A;  2G29 A;  1UIU A;  1URS A;  2F78 A;  4H1X A;  2ZZX A;  4FEB A;  2AL5 A;  2XXT A;  3H06 B;  4H5F A;  3FVK A;  4GL0 A;  1ANF A;  1N3W A;  1ZJL A;  2V4C A;  1B6H A;  3VVF A;  2XHD A;  4THI A;  2RCB A;  1POT A;  2WEF A;  4OFO A;  3U8Q A;  1TWY A;  1UTH A;  1QUJ A;  1JVY A;  3LSW A;  1FSA A;  1B0L A;  3LV0 A;  3L6H A;  4XXU A;  3UP9 A;  1II5 A;  3EN3 A;  1K9Z A;  1A7L A;  4BDM A;  1RYO A;  1O64 A;  1EYI A;  4MCO A;  5CM6 A;  2RCA A;  1B1X A;  2DE4 A;  3MPK A;  3KC1 A;  2Q89 A;  1XC1 A;  4MLQ A;  4K3F A;  1FPF A;  4H6D A;  3FXB A;  1AWB A;  1B9J A;  3MST A;  4IO6 A;  2PYY A;  1TFA A;  2Z22 A;  5AA2 B;  4FAT A;  4KHZ E;  1N7W A;  3MBP A;  3CFX A;  4KCD A;  1EU8 A;  4PFW A;  3EF7 A;  5AE4 A;  2NUV A;  3MPL A;  5I3S A;  4IO2 A;  3PMW A;  2DWH A;  2XXR A;  3QXM A;  1N04 A;  4R72 A;  1Y4T A;  2ZYO A;  3PD8 A;  5ICQ A;  2F7B A;  4NQ8 A;  4BDQ A;  4PFT A;  3W15 C;  4OAN A;  3HPI A;  4OVR A;  1Y4C A;  4PFR A;  2GHB A;  2XXQ A;  4WXJ A;  2PFY A;  3LSL A;  3MC2 A;  1QUI A;  4R6H A;  4GWU A;  5J1D A;  3THI A;  1SD3 A;  3ILT B;  3JYR A;  4OQO A;  1QGX A;  2D21 A;  2HXW A;  3MP1 A;  1MY3 A;  3KSJ A;  2XWK A;  4O94 A;  5DVF A;  3OEL A;  5BUU A;  5IZZ A;  2PT2 A;  4X04 A;  4H67 A;  2DS9 A;  1KWH A;  5TPA B;  2NOO A;  2V93 A;  2Q8J A;  2H9B A;  3PGF A;  2XXU A;  3K4U A;  4IO3 A;  4IY5 A;  1USY E;  1KA0 A;  4IB2 A;  5DW8 A;  1B32 A;  1FJ6 A;  3S4U A;  2FHY A;  3C36 A;  4PAI A;  3ISP A;  1UIV A;  4IO4 A;  1JP4 A;  2YLN A;  1ZIU A;  1YCJ A;  5ET8 A;  1S9T A;  2CZH A;  5B70 A;  3T9V A;  1OVT A;  1JNF A;  1R1N A;  1EYJ A;  4TLM B;  4G8M A;  3B8B A;  4F29 A;  5EQA A;  4YMA A;  4LAT A;  5ITP A;  1N0T A;  4ESW A;  5CBR A;  3K0V A;  5AA4 B;  3MAM A;  3U72 A;  3FVO A;  5TPA A;  1NV1 A;  1FBF A;  4PFI A;  1EZ9 A;  3PUW E;  4HW8 A;  1P99 A;  2QMX A;  4H45 A;  1URD A;  3VVE A;  2O84 X;  1SW1 A;  2XXP A;  1IMD A;  4DLD A;  3O97 A;  4PBQ A;  2G93 A;  1MM6 A;  5I5P A;  4DXB A;  1EH3 A;  2QSX A;  4QXD A;  2I3V A;  4PGP A;  3QMF A;  2QVR A;  1B2H A;  3N6T A;  1O63 A;  3C9H A;  4R9G A;  4JVI A;  2IA4 A;  2O51 A;  1IXI A;  1K9Y A;  5KCJ B;  4GX4 A;  3IJX B;  3KJ7 A;  1PB7 A;  3H6T A;  4GX6 A;  3UK4 A;  2PBW A;  4UAC A;  4YIC A;  1A40 A;  1NNT A;  4PFY A;  1MQD A;  5F24 A;  5AA4 A;  1MXV A;  3FAT A;  3CFL A;  1DTG A;  2UVI A;  1NI9 A;  2F6P A;  2OWZ A;  1XVY A;  1N84 A;  2WKY A;  5AA3 A;  2NVU B;  3K00 A;  1FPD A;  3OXN A;  4HE2 A;  3IB2 A;  3TCG A;  4H0W A;  4X48 A;  1AIV A;  3MUQ A;  4EQB A;  2XX8 A;  2I6E A;  4N6P A;  5DYH A;  3EHU A;  3QK6 A;  5CC2 A;  1MXY A;  3T1B A;  4P0G A;  1YPN A;  4F2Q A;  2DXR A;  3GZG A;  4LP2 B;  2DVZ A;  5FTI A;  3DP8 A;  3MJN A;  4QF9 A;  1LBV A;  4AB6 A;  1FBG A;  5CMC A;  4GBV A;  3VDF A;  1FPJ A;  2F3D A;  2F36 A;  5KCJ A;  1SI1 A;  3OEM A;  3MVW A;  3SET A;  5L9M A;  1I6B A;  4PE3 A;  3SZP A;  3IAZ A;  4N6K A;  1MY1 A;  3PU5 A;  1HSE A;  3V5A A;  2DWI A;  1Q35 A;  4FE8 A;  2CZK A;  4WEP A;  3KOT A;  2XWI A;  2JJK A;  2CEX A;  5HBC A;  4NG7 A;  3G3F A;  1QUK A;  1D4N A;  3TQW A;  2F6G A;  1AH5 A;  2ZZV A;  2HAV A;  1FTL A;  3UGW A;  2F5X A;  1YAE A;  2XXI A;  5I58 B;  3MQ9 A;  3I6V A;  1LAX A;  5FHN A;  2DP8 A;  3LC8 A;  4JSD A;  1KA1 A;  4H46 A;  4Q5T A;  4RJZ A;  3B6Q A;  3CFZ A;  4XF5 A;  3CRB A;  3N6U A;  3EPE A;  2HFB A;  1KZ8 A;  5A5X B;  1MXU A;  2WBB A;  3SES A;  5H8Q B;  4DCY A;  4F2O A;  3EKI A;  4KYD A;  3RY3 A;  1Y3P A;  4N81 A;  4OHN A;  5CMM A;  1B7Z A;  4JDF A;  4OVJ A;  2X7P A;  4LQ5 A;  1NUY A;  3TZA A;  3I3V A;  4PE5 B;  1IIT A;  4MIJ A;  4N07 A;  3IOV A;  4OTE A;  4RK2 A;  4NAP A;  3TTR A;  3A3U A;  3L6G A;  1SI0 A;  3VXB A;  3K1M A;  3K01 A;  2I0C A;  5EYG A;  3TMG A;  4RXL A;  1LGB C;  4KYE A;  1MQJ A;  2Y7K A;  1MY0 A;  2PCR A;  5I2N A;  4R6Y A;  3E13 X;  1ZU0 A;  3W9W A;  1DSN A;  2NWJ A;  1QJM A;  1MQH A;  5A5X A;  2H25 A;  1SVX B;  5H8Q A;  1FPE A;  4JB7 A;  4MNC A;  1PB9 A;  1FRP A;  4POW A;  5EQ9 A;  1EYK A;  1Y9U A;  1LBZ A;  3LUZ A;  3Q29 A;  3ONM A;  4I1D A;  4XFE A;  1MXX A;  4QSD A;  2XXV A;  4GFR A;  1NMU A;  3OOA A;  1MRP A;  1US4 A;  4IY6 A;  3IB0 A;  3IOU A;  2HAU A;  2VT5 A;  1NUZ A;  1LBY A;  2VHA A;  2O1L A;  1IEJ A;  3C33 A;  3N5L A;  4HXV A;  1A99 A;  3PTY A;  5EYF A;  2OCU A;  4DZ1 A;  2HZL A;  4IR8 A;  3H6W A;  3O29 A;  3FIR A;  4FOR A;  1JW5 A;  4MBP A;  1LAG E;  1EZO A;  1OVB A;  4OET A;  4HS7 A;  2ZNU A;  5CBS A;  1YXI A;  2Q2C A;  3O6H A;  1IUD A;  1LBX A;  4X8R A;  3KBR A;  5CRY A;  1N76 A;  1Y1M A;  4PQJ A;  2MKZ A;  4MJO A;  2QJE A;  3G3H A;  3A29 A;  4N8Y A;  4P11 A;  1Z7N E;  3FXR A;  3G7W A;  4RA1 A;  3VFJ A;  2DE2 A;  3B50 A;  1S50 A;  2M8C A;  2Z8F A;  2DOJ A;  3TFL A;  1RDY A;  1VDW A;  4Q8R A;  1OLA A;  2OBG A;  3OEN A;  4OWD A;  4OEU A;  4NMY A;  4GF8 A;  1LBC A;  4UAB A;  3TOD A;  3E4R A;  3HV1 A;  4KD5 A;  5JTY A;  5DVI A;  1D9Y A;  3HHF A;  1TXF A;  5J16 A;  3KSX A;  4BDR A;  4X1D A;  2RIN A;  2H5Y A;  1IME A;  1D9Q A;  1OQH A;  2QS4 A;  1LB8 A;  4LQ2 A;  2ZYK A;  3JV9 A;  3MZ1 A;  4DXU A;  3PUY E;  5I7I A;  5DVJ A;  5EHM A;  4GQO A;  4KFQ A;  1MG1 A;  1H76 A;  1B1H A;  1MPB A;  4AS4 A;  3N94 A;  4QHQ A;  4P9K A;  1D3K A;  2O7I A;  4FAJ A;  3PUZ E;  1M5C A;  3MWB A;  5FTH A;  2KR0 A;  1RYX A;  4GXA A;  4DXC A;  4F3B A;  3Q28 A;  4YKP A;  1US5 A;  1LB9 A;  5LOM A;  1NH8 A;  1H44 A;  2H4I A;  2FIE A;  3HO7 A;  3BIG A;  4WKM A;  3TTM A;  5HPQ A;  4N17 A;  2PFZ A;  1NV4 A;  3KN8 A;  2XXK A;  3ECR A;  1RDX A;  1GGG A;  2Y5L A;  1AOV A;  2E0S A;  3K6W A;  4TLL B;  3U92 A;  4OEV A;  4RPO A;  2GRV A;  3KJT A;  1IZ1 A;  5H8F B;  2REG A;  3FVG A;  2ZZW A;  3ILU B;  3Q26 A;  1NV5 A;  3VLW A;  2XX9 A;  1B51 A;  2XXH A;  4GXS B;  3PMV A;  3RTF B;  4DE8 A;  2HEU A;  4H5G A;  2QS1 A;  2GQ1 A;  2OZZ A;  4ZE8 A;  4EF2 A;  3FV2 A;  4KYS A;  1PEB A;  2B4L A;  3OO9 A;  3TYH A;  4WED A;  4HCY A;  2XD3 A;  4E0X A;  4YMB A;  1M5F A;  1IMC A;  1SYH A;  1MQG A;  2ZYN A;  3G3I A;  1B4Z A;  4NTL A;  3VLU A;  4RPN A;  2V3T A;  1TFD A;  3IOW A;  2WBD A;  2HQ0 A;  2Q74 A;  4F3P A;  2Z8D A;  2PT1 A;  5H8F A;  2VP1 A;  5ET6 A;  5H8N B;  1ZTY A;  1YTV A;  4F1V A;  3HCQ A;  3MP8 A;  4G68 B;  3FJM A;  1FQE A;  4XKP A;  4OYV A;  3H3G A;  3O6I A;  2Z23 A;  2ZXT A;  4NF4 B;  1H43 A;  4N15 A;  5H8S A;  4QFN A;  4U4S A;  4QBA A;  4H8I A;  1XHY A;  1TT1 A;  4P3L A;  3U65 A;  2HXR A;  2OK2 A;  5EQ7 A;  2Y7R A;  2W7Y A;  2UVJ A;  4GWZ A;  1H45 A;  1MQI A;  1J1N A;  2F97 A;  2YPN A;  2CMO A;  1GV8 A;  4XKN A;  3NOH A;  5IZ3 B;  4G8N A;  4G2Z A;  3M8U A;  5JEI A;  4O3A A;  1P1W A;  1I69 A;  2QFL A;  1AMF A;  1JVX A;  1B5I A;  2XXW A;  1JEU A;  5H8N A;  4YB6 A;  3CG3 A;  3RN8 A;  3HN0 A;  1B3G A;  3S9L C;  1BP5 A;  1O7T A;  4G68 A;  3HST A;  4AS5 A;  1FTK A;  4EQ7 A;  4PAK A;  5L9O A;  2ABH A;  4QFL A;  1HSL A;  2HHM A;  4O3B A;  1SDX A;  1OIB A;  4GL8 A;  1BTJ A;  1MH4 A;  3K1P A;  4NF4 A;  3H7M A;  4RYA A;  2XXY A;  3IOR A;  4F3G A;  2F7A A;  4P1E A;  4Q0C A;  4R75 A;  2ZNS A;  1MDQ A;  4YU0 A;  3IO4 A;  3EHS A;  1NFT A;  1LFI A;  3IFA A;  5IZ3 A;  3DP6 A;  3S2V A;  3VV5 A;  5F1Q A;  2V3U A;  3QYT A;  2UVG A;  4I3Y A;  3C4M A;  4PP0 A;  1D9V A;  2Y7I A;  4BDO A;  3SDF A;  3OSQ A;  3OD7 A;  2XX7 A;  2ZYM A;  2RC9 A;  1RDZ A;  3JZJ A;  4U4X A;  5EYH A;  3EHT A;  4LZ8 A;  2R9J A;  3IB1 A;  4P0I A;  4I9D A;  1FBH A;  3K6V A;  2R8T A;  1B7H A;  4BLA A;  4O3C A;  2I58 A;  2VD2 A;  3PUV E;  1NL5 A;  3VLV A;  3BBR A;  5TP9 B;  4OZ9 A;  4POX A;  4FIM A;  1FQD A;  4GOT A;  1DPP A;  3KGC A;  2VPN A;  3KZG A;  4NX1 A;  1LAF E;  3RLF E;  4OVS A;  4YKJ A;  4IGT A;  1N7X A;  3Q27 A;  4EF1 A;  1ATG A;  3FUZ A;  4MFI A;  2B3B A;  3B6T A;  2GFE A;  1MPC A;  2FBP A;  3RNN A;  2DVC A;  1L5T A;  4MEV A;  4XKR A;  2VPO A;  1GTK A;  2Y84 A;  3ODB A;  1B4H A;  4KI0 E;  3TEL A;  1DTZ A;  2D5W A;  3FJG A;  3DLN A;  2QVV A;  3B7D A;  1P1N A;  1SW2 A;  5FBP A;  3OSR A;  3GBA A;  3O2A A;  3KOS A;  5TP9 A;  1UQW A;  2UVH A;  3IO6 A;  4GD5 A;  3FAS A;  2BJJ X;  3K2D A;  3E3K A;  2ONR A;  1B3H A;  4OES A;  2CZI A;  3PPP A;  1B46 A;  3MP6 A;  1YYZ A;  1LBW A;  4R73 A;  5CI5 A;  1GR2 A;  2X26 A;  1B58 A;  4PDD A;  2IEE A;  5I2N B;  4ZED A;  4LVQ A;  2Y7P A;  4Q30 B;  4X1B A;  3T22 A;  1URG A;  4ZE9 A;  2F34 A;  1DK4 A;  3PV0 E;  4EDP A;  3R26 A;  2H99 A;  1NV3 A;  5JK4 A;  1RKM A;  4AB5 A;  2ALU A;  3MYU A;  1B5H A;  2V84 A;  1B40 A;  4H65 A;  3FXU A;  1LCT A;  4N6D A;  3QIM A;  1VE4 A;  1VFD A;  1PBQ A;  2I0B A;  4ND9 A;  1WVJ A;  5IZ1 A;  3MW0 A;  2F3B A;  2VGQ A;  4GRK A;  4QRZ A;  3O6G A;  1FBC A;  3FXQ A;  3SEU A;  2GH9 A;  3IJO B;  1IXC A;  5I57 B;  3LBS A;  3TDJ A;  3RYD A;  2KQZ A;  3SEV A;  4ELP A;  5K2X A;  1JW1 A;  2QRY A;  5TU0 A;  3USD A;  4PDH A;  1A54 A;  2YJP A;  3V89 B;  1CE2 A; 
#chains in the Genus database with same CATH homology
 5B7D A;  1JW4 A;  1EZP A;  3OMB A;  1F9B A;  3QUF A;  4BDN A;  1Q1K A;  1DPE A;  2A5S A;  3V8X B;  5ISU A;  5I56 B;  3G3J A;  3S9M C;  4QFO A;  1UTB B;  4NWC A;  4DCX A;  1SBP A;  1PBP A;  3SEX A;  3BFT A;  3P7I A;  4KR5 A;  3MVY A;  1LCF A;  3S9E A;  3FD3 A;  3RT8 A;  1CB6 A;  3C35 A;  1M5E A;  5I57 A;  5CMB A;  5JTY B;  3D4C A;  1P1U A;  3HHG A;  1LLS A;  2ONK E;  3SEW A;  1I6A A;  1ELJ A;  2A5T B;  4OER A;  4U21 A;  3FZV A;  3K1N A;  1JQF A;  1S7Y A;  3WAF A;  2O7U A;  2QS2 A;  1VSO A;  3OO6 A;  2UYE A;  5I56 A;  4ZZA A;  3PPQ A;  4XIG Q;  1BIY A;  5DEX A;  1UTB A;  4OMB A;  3TCF A;  3QUJ A;  3KN7 A;  4G4P A;  3CSB A;  4YZZ A;  4XKQ A;  4OEN A;  1XS5 A;  1B3E A;  3BKI B;  2DE3 A;  1Y1Z A;  2RC7 A;  4ISU A;  3LSX A;  2OWT A;  4ZEI A;  2P1S A;  3VVD A;  3TKD A;  1NNF A;  2NXO A;  2A5T A;  3TCH A;  1ZKB A;  4ZS9 A;  5DTB A;  3TPA A;  3E9X A;  1MH3 A;  1LST A;  1SQY A;  4FED A;  3DEL B;  3TQL A;  3RGY A;  2H98 A;  5EHS A;  1I6Q A;  1NNP A;  4G8H A;  3MVX A;  3H6V A;  4RY1 A;  2FYI A;  4NF6 B;  2V3Q A;  2QMW A;  1PB8 A;  5L9S A;  4ZEC A;  1B3L A;  1P1O A;  2R71 A;  1B3F A;  3TUS A;  4UA8 A;  3CSG A;  3IL1 B;  2DWA A;  5KDT A;  4I8C A;  4OFL A;  2O69 A;  2OWS A;  1ZLQ A;  4GVO A;  2REJ A;  2ESN A;  4YB7 A;  1R6Z A;  4LON B;  4X9T A;  4ZEK A;  2HZK A;  1AL3 A;  1FTM A;  1M5B A;  4ZEB A;  1ZMG A;  3MVZ A;  4NWD A;  3SKP A;  1PC3 A;  3AXF A;  4LA9 A;  3LR1 A;  4YB5 A;  4NF6 A;  3RPW A;  4MF3 A;  3ZS6 A;  4IO7 A;  4YKK A;  4FJP A;  1QUL A;  4F1Y A;  5FHO A;  1MXZ A;  4LUB A;  2DWJ A;  5ICT A;  1SW4 A;  4C1U A;  1OMP A;  3KFM A;  2AYS A;  5HM4 B;  4NED A;  2I4C A;  3C32 A;  1OLC A;  3K6U A;  3PD9 A;  3DM0 A;  4GLI A;  3R6U A;  2B65 A;  1FQA A;  3KG2 A;  5L8D A;  3H6U A;  4ZEF A;  4EXK A;  2Q88 A;  1T0K A;  2RC8 A;  2Q9T A;  3R7X A;  3BFU A;  3OO8 A;  4F31 B;  2D3I A;  4YKI A;  3U1O A;  3C31 A;  4F22 A;  4HCW A;  1XT8 A;  3FGS A;  1MDP 1;  5ITO A;  2VOZ A;  5AA2 A;  1FQC A;  3UN6 A;  3LUY A;  3TAJ A;  2I49 A;  3O66 A;  3CIJ A;  2Z8E A;  1Y3N A;  1LFG A;  3FJ7 A;  5ELV A;  3WAE A;  4I62 A;  3F11 A;  4R74 A;  1H3D A;  1MS7 A;  2ANJ A;  1ZBM A;  2RKM A;  2F8D A;  2LAO A;  5AA2 D;  1WDN A;  4LZ7 A;  4N13 A;  3IX1 A;  2O68 A;  4H8J A;  3MZ9 A;  1MM7 A;  4GIZ A;  1OQG A;  1QKB A;  1MY4 A;  3M3L A;  1B05 A;  3G3G A;  4RK9 A;  1QW0 A;  1IXH A;  3CVG A;  1PDA A;  3U94 A;  3RQT A;  3VE1 B;  3H4Z A;  3VXC A;  5I84 A;  1B5J A;  3RUM A;  4NF8 B;  4KQP A;  5I2K B;  4YAH X;  1BLF A;  2X7Q A;  1LAH E;  3LSF B;  1A8F A;  2Y7W A;  3M3K A;  4ESX A;  2FA7 A;  5K2Y A;  2THI A;  1XVX A;  4M4G A;  5FHM A;  4DDD A;  4JSO A;  1MXW A;  1DOT A;  3A3C A;  2XXX A;  3TTN A;  4C1T A;  1MPD A;  2DYX A;  4JWX A;  4AQ4 A;  2AIX A;  4Z7E A;  1MY2 A;  1R9Q A;  5I59 B;  1SYI A;  2RF1 A;  1SW5 A;  4L17 A;  4NE4 A;  4HTG A;  4RNS A;  3ZSF A;  4JXI A;  2KLF A;  3IK6 B;  3T9H B;  3K02 A;  4NF8 A;  4QFK A;  4JWY A;  4PET A;  4KPT A;  4IGR A;  3S9N C;  3DP4 A;  3TTL A;  4F1U A;  1M5D A;  2B3F A;  2PVU A;  5I2K A;  3TEP A;  3PPO A;  1B0H A;  5AA1 A;  4F19 A;  1Y3Q A;  4G68 C;  4ECF A;  3K6X A;  4PFU A;  4ELR A;  2O6A A;  1VFE A;  2QS3 A;  3UOR A;  2QL3 A;  2FNC A;  4ONY A;  3Q25 A;  1USY H;  5I59 A;  2UYF A;  2Q2A A;  3T96 B;  3M3F A;  2OLB A;  4LZ5 A;  3KEI A;  5M2V A;  4ELQ A;  4QSC A;  2CZL A;  3SEY A;  2QPQ A;  1FTJ A;  3I5O A;  4KCC A;  4R6K A;  4EXL A;  1Y20 A;  2F7C A;  4ZDM A;  2ZMB A;  4IO5 A;  4MH5 A;  1FQF A;  3OEK A;  2DXY A;  2I3W A;  2PX1 A;  4ELO A;  4NF5 B;  1IIW A;  4C0R A;  3MZB A;  2UXA A;  4G77 A;  2GHA A;  1B52 A;  3RT6 B;  1DMB A;  3C34 A;  4GWO A;  4XTC Q;  1LBB A;  2R6G E;  4DIG A;  1QVS A;  4F39 A;  4QSE A;  5CMK A;  5IKB A;  4R2B A;  2E1S A;  5I58 A;  4R9F A;  1IQ7 A;  3T93 B;  1FQB A;  3N26 A;  3IR1 A;  3FV1 A;  2ZNT A;  2DSF A;  1A8E A;  1XOC A;  4ZZE A;  1FW0 A;  2PMS A;  5DEX B;  3T9U A;  5IAI A;  3GLB A;  3CI8 A;  1NH7 A;  3ZKL A;  2DQV A;  1WOD A;  3PPN A;  4NF5 A;  1VR5 A;  2V25 A;  3KN3 A;  4TOZ A;  1POY 1;  4FEC A;  3A09 A;  2VD3 A;  4OFJ A;  4OXV A;  3CR9 A;  3IOT A;  4TQU Q;  4F3S A;  5H8H B;  1R9L A;  1FTO A;  4E0W A;  4EQ9 A;  3QSL A;  3O9P A;  4U22 A;  1IXG A;  1A55 A;  4JWO A;  3TTK A;  4U1O A;  2P0S A;  4R2F A;  4U23 A;  4M1V A;  5F7V A;  3D4G A;  3RTW B;  1JEV A;  2ONS A;  1NNK A;  4BDL A;  2F35 A;  3GBB A;  3G3K A;  4JBZ A;  3QAX A;  3SER A;  1HSJ A;  3ZKK A;  3CG1 A;  3PMX A;  2I4B A;  5DT6 A;  5KDT B;  1B7U A;  3UA8 A;  3U93 A;  4Z0I A;  5BWJ A;  1NKX A;  2AL4 A;  3V83 A;  2XD2 A;  3PUX E;  4QFP A;  5H8H A;  4MLV A;  1UTH B;  1Z7M E;  1QKA A;  2P2A A;  4U1Z A;  3B6W A;  2OJT A;  4F18 A;  3EQ1 A;  3PPR A;  1P1Q A;  2O1M A;  3T9X B;  1BKA A;  2HCA A;  1N3X A;  3OO7 A;  1JET A;  2I48 A;  3O28 A;  3UIF A;  4U2R A;  3GXA A;  4EUO A;  3FVN A;  3T66 A;  5KZT A;  1GVC A;  3W9V A;  1LFH A;  1FCK A;  3H03 A;  2G29 A;  1UIU A;  1URS A;  2F78 A;  4H1X A;  4FEB A;  2AL5 A;  2XXT A;  3H06 B;  4H5F A;  3FVK A;  4GL0 A;  1ANF A;  1N3W A;  1ZJL A;  1B6H A;  3VVF A;  2XHD A;  4THI A;  2RCB A;  1POT A;  4OFO A;  3U8Q A;  1TWY A;  1UTH A;  1QUJ A;  1JVY A;  3LSW A;  1B0L A;  3L6H A;  4XXU A;  3UP9 A;  1II5 A;  3EN3 A;  1A7L A;  4BDM A;  1RYO A;  1O64 A;  5CM6 A;  2RCA A;  1B1X A;  2DE4 A;  3MPK A;  2Q89 A;  1XC1 A;  4MLQ A;  4K3F A;  4H6D A;  1B9J A;  4IO6 A;  2PYY A;  1TFA A;  2Z22 A;  5AA2 B;  4FAT A;  4KHZ E;  1N7W A;  3MBP A;  3CFX A;  4KCD A;  1EU8 A;  4PFW A;  3EF7 A;  5AE4 A;  2NUV A;  3MPL A;  4IO2 A;  3PMW A;  2DWH A;  2XXR A;  3QXM A;  1N04 A;  4R72 A;  1Y4T A;  2ZYO A;  3PD8 A;  5ICQ A;  2F7B A;  4BDQ A;  4PFT A;  3W15 C;  3HPI A;  1Y4C A;  2XXQ A;  2GHB A;  4WXJ A;  3LSL A;  3MC2 A;  1QUI A;  4R6H A;  5J1D A;  3THI A;  1SD3 A;  3ILT B;  3JYR A;  4OQO A;  2D21 A;  2HXW A;  3MP1 A;  1MY3 A;  3KSJ A;  5DVF A;  3OEL A;  5BUU A;  2PT2 A;  4H67 A;  2DS9 A;  1KWH A;  5TPA B;  2NOO A;  2V93 A;  2Q8J A;  2H9B A;  3PGF A;  2XXU A;  3K4U A;  4IO3 A;  4IY5 A;  1USY E;  4IB2 A;  1B32 A;  3S4U A;  3C36 A;  1UIV A;  4IO4 A;  2YLN A;  1ZIU A;  1YCJ A;  1S9T A;  5B70 A;  3T9V A;  1OVT A;  1JNF A;  1R1N A;  4TLM B;  4G8M A;  4F29 A;  4YMA A;  4LAT A;  5ITP A;  1N0T A;  4ESW A;  5CBR A;  3K0V A;  5AA4 B;  3MAM A;  3U72 A;  3FVO A;  5TPA A;  1EZ9 A;  3PUW E;  4HW8 A;  1P99 A;  2QMX A;  1URD A;  3VVE A;  2O84 X;  1SW1 A;  2XXP A;  4DLD A;  3O97 A;  2G93 A;  1MM6 A;  4DXB A;  1EH3 A;  2QSX A;  2I3V A;  1B2H A;  3N6T A;  1O63 A;  3C9H A;  4R9G A;  2IA4 A;  2O51 A;  1IXI A;  5KCJ B;  3IJX B;  3KJ7 A;  1PB7 A;  3H6T A;  3UK4 A;  2PBW A;  4UAC A;  4YIC A;  1A40 A;  1NNT A;  4PFY A;  1MQD A;  5AA4 A;  1MXV A;  3FAT A;  3CFL A;  1DTG A;  2UVI A;  2F6P A;  1XVY A;  1N84 A;  2WKY A;  5AA3 A;  2NVU B;  3K00 A;  3OXN A;  3IB2 A;  3TCG A;  4H0W A;  4X48 A;  1AIV A;  3MUQ A;  4EQB A;  2XX8 A;  2I6E A;  4N6P A;  5DYH A;  3EHU A;  3QK6 A;  5CC2 A;  1MXY A;  4P0G A;  1YPN A;  4F2Q A;  2DXR A;  3GZG A;  4LP2 B;  2DVZ A;  5FTI A;  3DP8 A;  3MJN A;  4QF9 A;  4AB6 A;  5CMC A;  3VDF A;  2F36 A;  5KCJ A;  1SI1 A;  3OEM A;  3MVW A;  3SET A;  5L9M A;  1I6B A;  3IAZ A;  1MY1 A;  3PU5 A;  1HSE A;  3V5A A;  2DWI A;  1Q35 A;  4FE8 A;  4WEP A;  3KOT A;  5HBC A;  3G3F A;  1QUK A;  1D4N A;  3TQW A;  2F6G A;  1AH5 A;  2HAV A;  1FTL A;  3UGW A;  2F5X A;  1YAE A;  2XXI A;  5I58 B;  3MQ9 A;  3I6V A;  1LAX A;  5FHN A;  2DP8 A;  3LC8 A;  4JSD A;  4Q5T A;  4RJZ A;  3B6Q A;  3CFZ A;  3CRB A;  3N6U A;  3EPE A;  2HFB A;  5A5X B;  1MXU A;  3SES A;  5H8Q B;  4DCY A;  4F2O A;  4KYD A;  3RY3 A;  1Y3P A;  4OHN A;  5CMM A;  1B7Z A;  4JDF A;  4OVJ A;  2X7P A;  4LQ5 A;  3TZA A;  3I3V A;  4PE5 B;  1IIT A;  4N07 A;  3IOV A;  4OTE A;  4RK2 A;  3TTR A;  3A3U A;  3L6G A;  1SI0 A;  3VXB A;  3K1M A;  3K01 A;  2I0C A;  3TMG A;  4RXL A;  1LGB C;  4KYE A;  1MQJ A;  2Y7K A;  1MY0 A;  5I2N A;  4R6Y A;  3E13 X;  1ZU0 A;  3W9W A;  1DSN A;  2NWJ A;  1QJM A;  1MQH A;  5A5X A;  2H25 A;  1SVX B;  5H8Q A;  4JB7 A;  1PB9 A;  4POW A;  1Y9U A;  3Q29 A;  3ONM A;  4I1D A;  1MXX A;  4QSD A;  2XXV A;  4GFR A;  1NMU A;  3OOA A;  1MRP A;  1US4 A;  4IY6 A;  3IB0 A;  3IOU A;  2HAU A;  2VHA A;  2O1L A;  1IEJ A;  3C33 A;  3N5L A;  1A99 A;  5EYF A;  2OCU A;  4DZ1 A;  2HZL A;  3H6W A;  3O29 A;  3FIR A;  4FOR A;  1JW5 A;  4MBP A;  1LAG E;  1EZO A;  1OVB A;  4OET A;  4HS7 A;  2ZNU A;  5CBS A;  2Q2C A;  3O6H A;  1IUD A;  3KBR A;  5CRY A;  1N76 A;  1Y1M A;  4PQJ A;  2QJE A;  3G3H A;  4P11 A;  1Z7N E;  3FXR A;  3G7W A;  4RA1 A;  3VFJ A;  2DE2 A;  1S50 A;  2M8C A;  2Z8F A;  3TFL A;  2DOJ A;  4Q8R A;  1OLA A;  2OBG A;  3OEN A;  4OWD A;  4OEU A;  4NMY A;  4GF8 A;  1LBC A;  3TOD A;  3E4R A;  3HV1 A;  4KD5 A;  5JTY A;  5DVI A;  1D9Y A;  3HHF A;  1TXF A;  3KSX A;  4BDR A;  4X1D A;  2RIN A;  2H5Y A;  1OQH A;  2QS4 A;  1LB8 A;  4LQ2 A;  2ZYK A;  3JV9 A;  3MZ1 A;  4DXU A;  3PUY E;  5DVJ A;  5EHM A;  4GQO A;  4KFQ A;  1MG1 A;  1H76 A;  1B1H A;  1MPB A;  3N94 A;  4QHQ A;  1D3K A;  2O7I A;  4FAJ A;  3PUZ E;  1M5C A;  3MWB A;  5FTH A;  1RYX A;  4GXA A;  4DXC A;  4F3B A;  3Q28 A;  4YKP A;  1US5 A;  1LB9 A;  5LOM A;  1NH8 A;  1H44 A;  2H4I A;  3HO7 A;  4WKM A;  3TTM A;  5HPQ A;  3KN8 A;  3ECR A;  1GGG A;  1AOV A;  2E0S A;  3K6W A;  4TLL B;  3U92 A;  4OEV A;  4RPO A;  2GRV A;  3KJT A;  1IZ1 A;  5H8F B;  2REG A;  3FVG A;  3ILU B;  3Q26 A;  3VLW A;  2XX9 A;  1B51 A;  2XXH A;  4GXS B;  3PMV A;  3RTF B;  4DE8 A;  2HEU A;  4H5G A;  2QS1 A;  2OZZ A;  4ZE8 A;  4EF2 A;  3FV2 A;  4KYS A;  1PEB A;  3OO9 A;  3TYH A;  4WED A;  4HCY A;  2XD3 A;  4E0X A;  4YMB A;  1M5F A;  1SYH A;  1MQG A;  2ZYN A;  3G3I A;  1B4Z A;  4NTL A;  3VLU A;  4RPN A;  2V3T A;  1TFD A;  3IOW A;  2HQ0 A;  4F3P A;  2Z8D A;  2PT1 A;  5H8F A;  2VP1 A;  5H8N B;  1ZTY A;  1YTV A;  4F1V A;  3HCQ A;  3MP8 A;  4G68 B;  3FJM A;  1FQE A;  4XKP A;  4OYV A;  3H3G A;  3O6I A;  2Z23 A;  2ZXT A;  4NF4 B;  1H43 A;  5H8S A;  4QFN A;  4U4S A;  4H8I A;  1XHY A;  1TT1 A;  2OK2 A;  2Y7R A;  2W7Y A;  2UVJ A;  1H45 A;  1MQI A;  1J1N A;  2F97 A;  2YPN A;  2CMO A;  1GV8 A;  4XKN A;  4G8N A;  4G2Z A;  3M8U A;  5JEI A;  4O3A A;  1P1W A;  1I69 A;  1AMF A;  1JVX A;  1B5I A;  2XXW A;  1JEU A;  5H8N A;  4YB6 A;  3CG3 A;  3RN8 A;  3HN0 A;  1B3G A;  3S9L C;  1BP5 A;  1O7T A;  4G68 A;  3HST A;  1FTK A;  4EQ7 A;  5L9O A;  2ABH A;  4QFL A;  1HSL A;  4O3B A;  1SDX A;  1OIB A;  4GL8 A;  1BTJ A;  1MH4 A;  3K1P A;  4NF4 A;  3H7M A;  4RYA A;  2XXY A;  3IOR A;  4F3G A;  2F7A A;  4Q0C A;  4R75 A;  2ZNS A;  1MDQ A;  4YU0 A;  3IO4 A;  3EHS A;  1NFT A;  1LFI A;  3DP6 A;  3S2V A;  3VV5 A;  5F1Q A;  2V3U A;  3QYT A;  2UVG A;  3C4M A;  4PP0 A;  4BDO A;  1D9V A;  2Y7I A;  3SDF A;  3OSQ A;  3OD7 A;  2XX7 A;  2ZYM A;  2RC9 A;  3JZJ A;  4U4X A;  3EHT A;  4LZ8 A;  2R9J A;  3IB1 A;  4P0I A;  4I9D A;  3K6V A;  1B7H A;  4BLA A;  4O3C A;  2I58 A;  2VD2 A;  3PUV E;  1NL5 A;  3VLV A;  3BBR A;  5TP9 B;  4OZ9 A;  4POX A;  4FIM A;  1FQD A;  4GOT A;  1DPP A;  3KGC A;  3KZG A;  1LAF E;  3RLF E;  4YKJ A;  4IGT A;  1N7X A;  3Q27 A;  4EF1 A;  1ATG A;  3FUZ A;  4MFI A;  2B3B A;  3B6T A;  2GFE A;  1MPC A;  3RNN A;  2DVC A;  1L5T A;  4XKR A;  1GTK A;  2Y84 A;  3ODB A;  1B4H A;  4KI0 E;  3TEL A;  1DTZ A;  2D5W A;  3FJG A;  3DLN A;  3B7D A;  1P1N A;  1SW2 A;  3OSR A;  3GBA A;  3O2A A;  3KOS A;  5TP9 A;  1UQW A;  2UVH A;  3IO6 A;  4GD5 A;  3FAS A;  2BJJ X;  3K2D A;  3E3K A;  2ONR A;  1B3H A;  4OES A;  3PPP A;  1B46 A;  3MP6 A;  4R73 A;  5CI5 A;  1GR2 A;  2X26 A;  1B58 A;  2IEE A;  5I2N B;  4ZED A;  4LVQ A;  2Y7P A;  4Q30 B;  4X1B A;  3T22 A;  1URG A;  4ZE9 A;  2F34 A;  3PV0 E;  4EDP A;  3R26 A;  2H99 A;  5JK4 A;  1RKM A;  4AB5 A;  2ALU A;  1B5H A;  2V84 A;  1B40 A;  4H65 A;  3FXU A;  1LCT A;  3QIM A;  1VE4 A;  1VFD A;  1PBQ A;  2I0B A;  4ND9 A;  1WVJ A;  3MW0 A;  2VGQ A;  4GRK A;  4QRZ A;  3O6G A;  3FXQ A;  3SEU A;  2GH9 A;  3IJO B;  1IXC A;  5I57 B;  3LBS A;  3TDJ A;  3SEV A;  4ELP A;  5K2X A;  1JW1 A;  2QRY A;  5TU0 A;  3USD A;  1A54 A;  2YJP A;  3V89 B;  1CE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...