5JUEL

Crystal structure of uic2 fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
220
structure length
220
Chain Sequence
QVVMTQSPLSLPVSLGDQASISCRSSQSLLHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHIPPWTFGGGTKLDIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the antigen-binding fragment of a monoclonal antibody specific for the multidrug-resistance-linked ABC transporter human P-glycoprotein.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords light chain of UIC2 Fab
total genus 48
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2016-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jueL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jueL01
5BO1L 5J9PB 1I1RA 4QRSB 3HMXL 2EYRA 3STBA 2IWGA 5DXWA 3Q1SL 1ZAGA 5H37G 1NAKL 2HAZA 3S36X 4HUUB 4UQ3B 5HVFB 3P0YL 1TVHA 3OKEA 1CFSB 2Y7QA 3MUJA 5JW3L 4JFEA 4CW1A 4QOKB 4OCXH 1EDQA 3DRQA 1ORSB 4OCSH 3P0VH 4ENEC 2F54E 2Z91B 3L3DB 3ZT7A 3BMWA 1IE5A 2Q3ZA 4OF7A 3W11C 1HH6B 3WSQH 3O6ML 2K7PA 1N0LA 3CK0L 5BZWB 2MCPH 5AZEL 3P9WB 4PJHA 2BJML 4AZ8A 2AS5M 3CFIC 4HK3J 1A7NL 1MAKA 3VGFA 2QJDA 3ISWA 3NFSH 5JO5B 5GS0H 1I7UB 3GBMH 3S36L 5DI8B 3QI9A 3U0WH 5AYQA 4C56A 1SYSB 1DE4B 2M2DA 2OXGA 1CG9B 4YHIB 1XGQB 4JRXB 1X5AA 2WWMD 5DRWB 1Q9OB 3KXFD 4X4ZA 3VXOA 4E41A 1B9ZA 1Y18B 5KSBA 2A73B 3QUXA 4QRRD 3GGWA 1Z5LB 4J4PD 4Y19B 1RULL 4NZTL 2EKSA 3ZDYF 4ISVB 4KK6D 3NN8A 1S78D 3SE8H 5EUKB 4PJDF 3D87B 3GMOA 1S7TA 1LNUA 4EI5D 1Y0LB 3SDAC 4NO5A 1RY7B 1XH3B 2WMPA 2H9GB 3OSKA 4UUJA 3HUJF 2UY7A 4G5ZH 2YZ1A 1A9EA 4HK0A 5KZCB 5KSUA 5EZJB 4BH8B 3DUSA 4KXZI 3ZTNH 4YDKH 2KL6A 4QHNB 5T5NF 4NQCD 4ZS7H 1M6OA 3BKYL 3BHBA 4KRPD 4R96A 1A5FH 4FN0A 5F89A 4K3DH 4F2MB 3EO9L 4XNMB 3TNMB 3DLQR 4ACPA 4LCIH 1RVFL 2XKNA 1NKOA 4K3GA 5SX4H 5IB3B 2FEDD 5IHZA 1WFNA 1NJ9A 2CLZB 1NH6A 4GLRI 3V8OA 1BM3H 2EECA 4FNLL 3X13B 1EUUA 4UU9B 4OZIB 4I77H 2Y36H 2HVKA 5D2LA 2FX9L 3OKMB 2NX5E 2NY2D 3VFNA 2AW2A 5HHPA 2XTJB 3WDJA 3HE7A 3SCMA 4U1NB 3MLZL 3VE0A 4PGEA 3HZKA 2FZ3A 1MH5B 4XAKE 3N1MC 4YBLB 4ODSL 5A2JH 3VFVA 5CJXA 5D96C 1CLCA 4MD5A 5DC9B 4S0SD 1D9KB 2B1AH 2YD5A 3A6CL 3P4NB 5I1CL 4Z7VB 5IVXF 3QDAA 2DKSA 3UTTD 4LPTA 1YNLH 3MLZH 1JN6A 1BZ7A 1JMXA 4A6YA 4ZNEE 1XGUA 5D7JD 4QY8A 4JM2A 3MJGX 4DKFH 4PJFF 2D4FA 2E7HA 3WLWD 1JYXA 1WBYA 4LGRB 2H32H 2YPVH 2EDHA 4P2CG 4YZFE 1TTGA 1TPXB 1SBBA 2NW2B 3H6JA 4OCMC 3RWGB 3WFEH 2W38A 4I1NB 1TZHA 5IBUB 2FD6H 4LGPB 4XNYH 1SHMA 1I8MA 1WAAF 2I9LB 4ZG1A 1HKFA 3S3PA 3DTXA 3KLDA 2UZIH 3QHFL 1UG9A 2PETA 2MKWA 5BRZB 1CFQB 1KBGL 4XCEB 5E5UB 2IAMA 4FFWD 1U8HA 4MJIB 2P8PB 3T8XB 2VQ1A 2ZUUA 5GS1B 2PO6B 2VZOA 4PLJD 5BV7L 1MRDH 5I66B 3EFFB 3G6JB 4YC2C 3EBAA 3JV4A 2CH8A 3C5ZC 3CLFH 4JRYB 2ADFL 3P0YH 4Y4FD 5BS0A 1XCQB 1IC7L 4PJ9B 1DP0A 1NAMH 1R24B 4U1GB 1INQA 1CU4H 4Q9QL 2VZUA 3UTPD 1PSKH 2LU7A 4CRPA 2DIJA 2UUDH 5GGUA 4QHLA 3UPAA 1MQKH 3R8BB 2VXUH 1UT9A 4Z5RB 4IMLB 1HXYA 4HC1L 3HFMH 1HEZB 2NXZD 4MQTB 5EIQA 1BOGA 1UWGL 1U8LB 4OBRA 3FO0H 5H37H 4IRSC 1NANI 1ACZA 2HLAA 3KWWA 2CKBH 4APQC 5D1QD 4LBEB 4ENED 1FYTA 1JZ7A 1BVLB 1LQSR 3TPUA 1FHGA 4PJBB 3GSNH 2NY3D 4HUWB 4NRXB 3F7YA 3DMMA 5DUPL 5GRUH 3Q0HA 2GSGA 2EEAA 4MQ7A 3QIUB 4UINL 4P5TD 4BK5A 1AD0A 5FDYA 2X70A 1CLZL 3MRFB 4GKOA 1I8IA 2R1XA 1CD8A 3VFPB 3GKWH 4ZTPH 2VN4A 4QHUA 1YEIH 1IC5H 3RVTC 1JNNH 1LO5A 3TCXA 1RZKC 3RPIB 2DB8A 5FHAH 5FAAA 4WI5A 4KMQA 3OKOB 2FWOA 3LRSA 3PDDA 2G5RA 3SDAA 3KNBB 3M1BB 2DTML 1X5YA 2VXQL 4XP9H 5JW4M 3FB6B 3FQXB 1MWAB 4KKLD 4NNYB 3ZTNL 5JNYB 2ADIA 4HZLB 4HX1B 3VD3A 5FOBA 1EMTH 3QIUC 2RFXB 3TYGH 1QLEL 1DQTA 2FJFB 4FMKA 2G2RA 2C3WA 2IANE 4RDQF 3FO1A 4NRZB 1D6EA 3U36A 4F57L 1NBYA 4IBLT 4I5BA 5C0IA 1JGUL 1FIGL 1MOEA 2ICCA 1DBMH 3U7YL 5K9KB 1GL4B 3CFEA 5KANG 1KTDA 1FPTL 5A3ID 3RDTC 5FYLE 4K9EL 1DVFC 1M05A 1H8NA 3KPTA 4XCCH 1P4BH 3WXVH 5I1GL 1G7IB 2F53B 4EOWL 4UILH 1ORSA 4JRYE 5DVOA 4AEIL 4ELMB 4RDQG 1RK1A 2ICWI 4JRXA 3G6JE 5F8RC 5IJVB 3QDGD 4R26H 4OAWA 1KXQE 2BSSB 1MI5A 3T08A 3BH9A 2MWCA 4MA7L 1I85A 1G6RA 4G7VL 4WV1B 1QFOA 4HAGA 4NT6A 3GDBA 3HG1A 1KGCD 2WZPD 5ESQB 2B20A 3QISA 5L2KD 1K9TA 1QVOB 4NUJB 3DVGB 3GRWH 3QDJE 3CFDB 4JY4A 4X6DE 4WU7B 1ZLSL 3ARDB 4KFZC 3BYTA 1VADB 2YA1A 2J6EH 3CFKB 1Y6KR 4XTRC 2W9LA 2HFGH 3QUKA 2FGWH 3QRGL 3TVMD 3QCTH 4OZ4B 1EJOL 3QEHA 4AEHL 2IFGA 3DX8B 3B3IA 1IGIH 2GT9B 1FAIH 1P7QA 1ADQH 1TVBA 4GMSH 3G6DL 5DJCA 3ZYOA 3K1KC 4L8BB 5DQJA 4IMLA 1IGIL 3QEUA 1GPOL 2R23A 4XNMA 1ADQL 5D1XA 4DK6A 5IMMB 2NX5B 3DUUA 1XF1A 1I4FA 4AIOA 3FMGH 5SWSA 4WHTB 5GPRA 5EN2A 2DM4A 3EFFA 5DMJB 1MFAL 5C0RH 3QB7C 5HPOA 3FFDB 3L5WA 5FO7B 3EO1A 5C0DB 4P23B 4NM8L 3WNKA 5IFHL 2I9LA 4JFDD 3VFVB 3FQRA 2GK2A 4S1DC 1KIUA 6FABH 1AR2A 2DICA 5C6TL 5DEFB 1A3LL 1TZHB 1IGFL 3O2VH 4ODTH 3UTQA 1MFAH 5DF0A 5SWZE 5IGXH 1T03H 4UNTA 4ZTPL 4XMPH 1YNTA 4PJDA 1RIVH 5FM5M 3IJYB 2FSEA 1CR9H 3ROOB 5F7LB 1KG0B 3BGMB 4CNIB 1XGPA 3KYMB 2YD4A 4JFZH 5FGBA 1S9YB 2ARJQ 4GAFB 1LP9E 3KPPB 2G60H 3UPRA 3DX9B 3L3KB 5ICYA 5IGXL 2W92A 4FQ1H 3VGHA 1PKQB 4MHHG 5F6IB 3KPRA 5GRZA 1U8KA 4FFYH 1BWMA 5CP3H 2YA2A 3RIFK 2E27L 4NKOB 1KTRL 4G9DB 1X5LA 3FB7B 1NKRA 3STZB 4DZBB 2Q8BH 4CMHC 4L9DA 3VG9B 4LASH 1RUPL 3LOWA 3PF2A 2AEPH 3UBXI 1F4XH 2F9BT 3K3QA 1DVFA 3O45B 4QCIB 1EHLL 5CMAB 5DO2D 3VWKA 4TQEH 2IG2L 4LLWB 3S37H 3VXPB 4QOKE 3PIQA 5L2KE 2Z91A 1CFNA 3C5SB 4R97B 4NN6C 1CXHA 2ID5A 2ZSVB 2HLFD 4Y5XC 3ME0A 3NZ8B 3JUYA 4PJBF 4PJ9D 4QRPD 1OWRM 4C55A 5D4QA 2XWBA 4EZMA 2CLRB 5IQ7H 1NEZA 3QEUB 4MSWA 5HD8D 4MDJB 5DI8A 5AZ2H 4JHZA 3BIKA 2BVTA 2EDKA 3KXFB 3PJSA 4Y8AA 5B3NA 5DWUH 5J9PA 4J3WA 1B88A 5JPMA 1QSVA 3FT3A 1R3HB 2EH8H 1U8MA 3EJZD 3MJ9A 3V4UL 2YD3A 3OKDA 4LLYB 5DJ0A 3QZWG 3RGVA 1F3JB 4MA8L 2LTQC 3GMQB 3QUYC 3CVHL 5CSZA 3UZQA 2JIXD 5HGGS 4FQ2H 1INDL 4ONFH 5HDQL 1CGWA 2QBWA 3SKJH 2X6MA 5ANMB 1F4WH 1VKXA 1KNOA 1W0VB 4MXVE 1OAZH 2P24A 1PLGL 3INUH 4OF0A 5I30H 3P73A 1TQBC 1PEWA 3EDEA 3BH9B 3QG6B 1BQHB 1HE7A 1W0WA 3WCYA 1G9EA 2F74A 2VXUL 3L7EA 5EBMA 3QULA 5HGDB 4LHQB 3RWHA 4BA8A 3VXQB 1OD7A 1KEGL 1DQDH 5F7EH 1ZS8B 2VQTA 1OQOA 5IB1B 4XNXL 3D1MC 1YMME 5JOPD 1S9YA 1T80A 4XXDA 3L3KA 3RIAF 4WY7L 4PRHA 5J6HA 1RK1B 1UB5B 2Z8SA 1T0NA 4L4JA 1P4IL 3VXRA 5LQBL 5C0IB 3P11H 1OT1A 4XNXH 1IM9B 1NEZB 5DLMH 1CLYL 1A6ZA 1HQ4B 2V6HA 1O5DT 2X1QA 1G9MH 4OLZH 2DQCH 5C0DA 2E7MA 3TT1H 4WY7H 2O5XH 3EYQC 5DEZA 4YDLB 1XGRB 4RGNC 4HT1L 1A5FL 5JA9A 3TBVA 3GJFH 5K93A 4Z77B 2ZCHH 5JPNB 4PP2B 3O6LL 3STLB 1XIWA 4PGDA 3GSWB 3KYOB 5F7MC 4DTGH 2OBGA 3NIFE 4ALAL 1TCMA 4KROC 5K9QI 2ZSVA 4CADB 3QUKB 3VFMA 3U48A 1HIML 2YKLL 3NFNB 4M9PA 1AD9B 3A6BL 3D0LA 4HUXA 1YEGL 2IBZY 3O2DL 2A9NH 1OB1B 3MR9B 3PGCB 1QP1A 2VLRE 4ZUVB 5HHOB 2WBJB 4L8BA 3FQUA 3LKSA 4JFOA 4QLRA 4X99A 4PTUA 5E5MA 3KVQA 3FQTA 2FO4A 4X6CE 4R3SA 1ULVA 2VH5H 1JWSA 4JDTH 4KTEL 5CEZL 3LIZL 5GSRB 4PGJA 1CD1B 3QFDA 2A9NL 1IGMH 3U0PB 1B6UA 3OR7A 4P2QD 3BKML 3DJ9A 2ICWB 5J12B 2R39A 1A02N 5A1AA 3FZUD 1IRAY 3LQZA 3BAEL 3E2HC 4PTTB 4D0BB 3WFEL 4OFVA 4YHLL 1SVZA 3X12B 1RJYB 5C0JB 2XWTB 2DQFB 5LWYL 3NH7H 3A67L 2P43B 1UEYA 3Q5YA 1S9WA 3MRHB 4YPGB 4R2GC 4LLVB 4HKXB 4P5KA 3RWFA 3CSPA 1AHWC 2P7TB 2NCMA 5DD1H 4XPGL 5GISH 2XZAH 2EE9A 5ITBL 4P4KD 1PZ5B 3EOAB 2F8VA 1QSEA 4A6YH 3WJLC 5IMMA 4I13B 1HHJB 4XNUH 5C9JB 3VMPA 2OS7A 2R1WB 3KPSD 3IU3A 2EH8L 1IC7H 3DARA 2X4QB 1WIPA 2YBRA 5MEQA 1I1AB 1XR8B 5FKAB 1NCBL 4X9FA 3V6BR 2Z31C 4Q74A 1YJDL 1F8TH 5D2NA 1H9VA 3OKOA 4Y88A 3BSZH 5EC2A 2Y4SA 1H3TA 1FRGL 1VFUA 4MDJA 5LCVL 3BPLB 3PXJA 2LQRA 3SKMB 1DR9A 4M1CD 5LVEA 1IC4L 3QUZA 3LEVH 2GTZB 3K8KA 4HUWA 1MWAH 4NRXA 2HT3D 3C5ZD 4JZOA 3C8DA 5IEHB 1B4JL 1H0DA 2C4FT 5DVMA 2Q87A 1U8JB 3EJYD 4X9HA 4O4YH 4LL9A 1ERNA 3LDBB 4XI5D 5DJXB 3UJTH 5CJ5A 5I19L 5HYSB 1HDMA 3OKLB 1OGAD 4KJPD 4DKAA 2VMFA 3C09C 4M7LT 4NM8H 3WHE0 4YO0A 3ARZA 4Q9CA 5KVGL 5F96L 3IGAB 3LSOB 4IRZH 3Q6FA 2F19L 5E8NB 1ODAA 1HHKA 2ZJSL 3HAEB 3MA7A 3D39E 1NSNH 3O9WC 2ICWA 4UT7H 1OAKH 2ZOKB 3L3HA 3U9UA 3ULVH 4AJ0A 4BM7A 4QRUA 2DBJA 2XA8H 1U8OA 4CMMB 3EFDH 2OSLA 3NPSC 3C87A 1D7FA 4HDIA 1I1YA 3O6LH 4XC3H 3F8UB 2Q86B 3TVMC 4LSQL 4KWUA 1JGUH 3LKOB 4HJJH 1QFUL 4YDIH 3U7YH 1A6UL 5F7UA 1IM9A 1W72L 2WUBL 1AP2A 1NC4D 3VG0H 4NJAL 3V0VA 4QHNA 2V7HB 1DQJB 2E9WA 4FABH 1MCBA 4C59B 1R5WB 5CWSA 1I7TB 1K2DA 1FNFA 5DJDA 1WC7A 3RL1A 4PJEA 4WJ5A 1IJ9A 1IKNA 2CKNA 5IB1A 1X7QB 4YNYA 3QUXD 4M03A 4QRRA 3UTTE 3WKML 2JIXB 2OI9C 4J4PA 3ZHDA 1QSEE 2YPKA 2PN5A 4Z7WE 3QUMA 1MFNA 3LY6A 3RNKB 1NUGA 2IANA 3BPLC 5ENWB 1BZ9A 1VFAB 1KCVL 2CKBB 3O4LE 4U6VL 3U30B 4I3GA 3NFNA 3HE7B 3SCMB 2OTPA 5IQ7L 5DJZA 1Q72L 5KSAC 1J8HA 2UWEE 1KNOB 5FXCH 1FFOA 4XCNB 4Q0XL 4QNPE 5C08A 3W81A 1JL8A 4HK3N 2NW2A 5CJ8A 2Z31A 1WTGT 4RWYH 2VKXA 3GNML 3BW9B 3PP3K 2R2EB 4LPCA 3TYFB 4JG0L 4EI5A 4RFNC 2B39A 2A9ML 1ZOXA 1L0QA 4BFBD 5A2IH 5KJRL 3VDBA 4XPAL 4EI6A 4ONHB 4X5LA 4Y2DB 4ODXB 2DLGA 3SDCB 2ADJB 1KIPB 2XZZA 1BECA 5GZND 4R4FH 1XR9A 5T1LB 3VXMD 5LGJB 1S9XA 2MCG1 4E5XB 3OZ9H 5JXAL 5KJRH 3RI5F 3CH1A 1S7TB 1KOAA 4YLQT 2CRMA 5D2NB 3OPZH 1YEDA 2ENSA 3O8XB 1OAUH 5FA3A 3G04A 3IETB 4KVCL 4PRDB 5D71L 1AJ7L 1EXUB 5E0QA 1A9EB 4U2YA 2ZNWA 3RIFF 4OM0L 4I48A 3SE9H 3FAXA 5MHSE 1UADC 4RMQA 4X7TA 3QUZB 3SDYL 2IPTL 5I8CA 6CGTA 2APVA 4Z77A 1SVCP 5HYJB 5D71H 3L5XL 5FEBA 4A2MA 3O4OC 3LZFL 3SY0B 5BW7A 2G5BB 1QBML 1UYWH 2PW2A 4OM1L 4NHUB 2V7HA 3CVIL 4DUXA 3O3AB 3SDYH 3ALXA 3BXNA 3D5OF 2IGFL 2EYSA 3NA9L 1MCSA 1ROWA 3RNQA 5CZVH 1MFEL 2HFFB 1NFDA 3T04D 1SY6A 1Z2KA 4LMQI 2NY3B 2E3VA 4OKVA 3MV11 3MUY1 2WSKA 4KKCD 5IHLB 4U1SB 4IM8A 2UWEB 4XCFL 5SV3A 2BNRE 4GXUN 3TN0A 2AEIT 1HHHB 3MXVL 3T3PF 5DHVA 4P2QE 1JZ2A 3AROA 4OZGF 4O9HL 1ZTXL 3V5KB 4FOMA 3QO1A 1ZT7B 5ESVB 4RA0C 5F7NC 4Z7WB 4JM2B 5MENA 2BK8A 2A74B 2ADIB 3BH8B 2V5SA 4XP1H 3QH3B 3RX7A 4DFIA 3IF1A 2X5PA 4LLDB 2HT2D 3BISA 5JW4Q 4KQ4H 1RJYA 1N5AA 1Z3GL 1OLLA 4I18A 1YY8A 3N1FC 4LFHG 4YHML 4PJAE 4O2FB 1A6UH 3QJFA 4OLUL 4JZJC 1FNSL 3GSUB 3TNMA 1FYTD 4KRNA 3UC0H 3S37L 4OLYH 2X9XA 4AT6A 5GRXG 1BFVH 4RISH 4YHMH 5LGJA 3QPQC 2APWA 4OLUH 4LKCA 4PJFA 2XG5A 4NSKA 4HFUL 2ATKB 4Y4KB 5CBEA 3WD5L 3PDOB 2NZ9C 5IMOB 2YC1B 3EUUA 5GJSH 1CE6B 2WBWB 3K4ZA 4ODWA 2DBLH 2VZTA 2NY1D 3N85H 1I1AA 1CT8B 3GHEH 2JB5H 1AQKH 2DJUA 3BJLA 5EIVA 1NFDE 1T1WA 1WEJH 1S7RA 2JTDA 3RGHA 1B3JA 1MCHA 2PCPB 1UWXH 1R3IL 2XKUA 4XXDB 4BKLA 1M7IA 4LVNC 1TQCC 3CH8A 1HNGA 2DQEH 4JY4B 3BZEB 1KJ3L 2ESVA 2XRAL 3DECA 4NBZB 1FAKT 3GMPB 1ZEAH 5I30L 3NIFF 1VPOH 5F71A 3QZWB 2R69H 4B50A 3REWB 4TSCH 5F3HA 3U0TA 1AGFA 5EOQL 4WW2C 4GKNA 4KMLB 3BN9D 5EOTA 5IBLD 1JHLH 2YMXH 3RZCD 2D9CA 4JHWH 3TJEL 5I8KL 2V2WB 3JWNC 3OZ9L 2BC4A 4ODSH 3DPBA 3S88H 2J3SA 4PD4J 4FXKB 2QSVA 4J12A 1AJ7H 1MCWM 3EYOA 2AJZA 3LB6C 3V6ZB 2P5EA 3BUYB 1ES0A 3HPLB 5F1OB 3IVKB 4DEPB 4K3JH 5I19H 4DKFL 1EFQA 5EBLB 3FFDA 4U0RC 5BVPH 3FQWB 3TFKD 4XP4L 2HP4A 4M6NL 1KJ2B 1BP3B 4JFED 4EEEA 3MGOA 4V1DD 4HD9A 1T89C 3HZVB 4RMTA 3ZL4H 1AHWB 2ITCB 1BJ1J 5D5MB 2YS4A 5F6HI 5CD5C 3GSVA 2OMBA 1HN1A 3HCVB 4MCYA 4UT6L 3V52H 1MJUL 2B2XH 4X4MA 5I8CB 5EUOB 4MJ6B 4NO3B 4R4ND 4JKPL 4JDZB 3MRPB 2YC1A 3V6FB 3OL2A 3TZVC 3SGDI 1MVFA 3MLYL 1ZA6A 1VA9A 5F97E 1E4KC 5K9JL 3TVMA 3F7VB 1AH1A 2JF1A 4JGUA 1P5VA 5C0FB 3RI5K 4X6CB 1RZJH 2H8PA 4OB5H 1F4YH 4CN1A 2E8ZA 4HC1H 4HW6A 4LCUA 4NC2B 1IARB 1PX4A 2MSPA 4LOUC 1RHHB 4OFPA 4QCIA 3BWUC 4U1JA 2DWEB 4BSJA 4AL8H 4MQSB 3WKMH 3BAEH 4P2YA 4BELD 3CVHA 5C86A 4DZBA 3ULVD 3BZ4A 4PREA 4XP6H 5FYJD 1S7QB 3RL2B 2YBRB 5GRYA 1JHTA 2VLLA 3CH1B 3RX8A 1RQ5A 3AMKA 4WFGD 1JGVL 5T1DH 3I02A 3MYJB 1P4LB 2SEBB 1NGYB 3DGGB 1XCQA 4U0RB 5GRWA 1G7MB 2B8OT 3MRCB 1F4HA 5CSBA 2E5EA 5EA0L 1FLRL 3LAFA 4TSBH 1G0YR 3QUZD 2PTTA 3MX0A 4GBXB 3RGVB 4XWOD 5HHNB 3S6CA 5MHSD 2VAAB 4X9IA 4DGIL 3LS5H 5IEKA 3WIFA 3MV7A 2LAAA 3MROA 5TE6L 3BRDA 4YE4H 2PW2B 4ZPTA 3CCHA 5J11B 3BXNB 8FABB 3IXTA 1FLRH 1DBAH 2BOBA 3CXDL 1OGAA 4TSBL 2JLLA 3QA3B 1KF9B 1T4KB 3PWPA 3EOTH 4LSTH 2D9QB 4OSUL 3OF6A 3F7YB 3L1OH 1JVKA 5E24E 4AM0B 4K7FB 1T1ZA 3B4NA 4HIJA 2VWEC 1Z9OA 3DI3B 5CD3B 2R69L 4L1DA 4AEFA 1ZLUH 5GSVB 1RURL 3HNTL 3CFCH 3RKPA 2R1YB 2RCSH 3NACL 4IOFC 2M26A 5IK3B 4PB9H 2D3VA 3VGBA 3TPKA 2FECL 2HMID 4BZ1L 5A16A 4GO6B 3CXHJ 4YIQB 3QWOA 3TBSA 1LWRA 2WINA 2VLMD 3QIWD 4HEPG 3EDKA 2VUOA 3P4MB 2GJZA 1A7OH 3C6LA 4KDVA 1OQXA 1CE6A 2CR3A 3VWKD 2A0LD 4GRMB 4Y5VA 3M45A 2PKDA 3QFJA 4AIZA 2LU4A 1CL7H 1LEKA 5JMOC 3E6FA 4Y4FA 3GI9H 2GJ6B 4XXCC 4HBCH 2WV3A 3BN3B 4KZDL 2R4RH 4HJGB 1Q1JL 2GKIA 3RTQC 3Q2CA 4XGZB 2R2BA 4OKDA 3DUHA 4YWGH 1ZTXH 4LFHD 4PJBA 2GY5A 5IBTH 3PWUB 1S3KL 3K2UL 1I8LC 2IPUG 3IFPA 1IFHH 4GKZA 5JIHA 3GBML 3S36H 5KG9A 3C8HA 1IAMA 2J5LB 5I1KH 3LKQB 4JKLA 4EDXB 1VEPA 1J86A 4RBPH 4JFDE 4NBXB 3PWLB 3TH3T 3BYYA 1NANH 4RAUA 4CUCA 4MNGA 1KLGA 1DBJH 3SJVA 1EO8L 2A77L 5FYKU 4P46C 4EUPA 2VITA 4TPRL 2BSRB 4LNRB 4OD1H 1LO4L 4NZTH 3MBXH 2AEQL 2FATH 5TQ2H 4L3ED 3DX7A 5JHLH 4OLYL 5GGTA 1FL5B 3BZDA 4PY7B 3RUGB 5MI0C 1BBJA 1E28B 1PKQE 5EO0A 4HX1A 5I15L 3IXTB 5C09D 2F58H 2P8LA 3Q3GB 1XMWA 5BMFH 4O51A 1YEJL 3JTTA 3QAZC 4JCLA 2XFXA 1PQZB 3CX2A 4NKQB 3DSFL 4P46A 2VZ3A 4RQQA 3WLBB 5I15H 3V79C 1LEKB 1WT5A 4RWYL 4PRHD 2Y9RT 4FTVE 1OGTA 1WWAX 1JPST 2BVYA 1KIRA 3D2UB 3N0PB 1L7TH 1EEZB 3PNWA 4IJ3B 1KYOJ 1EIBA 2I26N 3LEXA 1KT2B 1QQDA 3QUXC 3ZE0F 4M8QB 5A2LH 5KVDL 1SJEB 5FGSA 1KFAL 4G3YL 3HR5A 3TBSB 2BERA 3MXWH 4PRPE 5JOFB 1VFBB 4BSVB 4TNVK 3LQAL 3PV7A 3GM8A 5EFIB 2G60L 4NZUL 3RL2A 4LLAA 4WVRA 2NLJB 1CBVL 4NQUA 1AY1H 1FP5A 1JZ8A 4G3YH 4UAOC 2XQBL 2V7NA 1DFBL 5EIIA 3IAQA 4KJWC 4FG6C 3D69A 5HYIA 5EO1A 4DN3L 1CICC 1P6FA 1MI5D 3V9FA 1CBVH 4HUUA 4UQ3A 2VLME 2AXFA 2IADB 2Q8AH 4Y2DC 4LARH 5DMGD 1ORQB 4X6FA 3I50H 3L5XH 1NGQL 4Z95L 5DRXA 3G08A 5I0DA 3GJEA 1F3DH 1DQML 1MLBA 3HNVL 3D0VB 4NGHL 4NNXA 4DN3H 3ULSB 5DS8B 2BSTB 1XR8A 2HFEA 5FKAA 2IGFH 4X7EC 2P5WE 3NA9H 4NO3A 2NY6D 5H35B 1MQ8A 4PRPA 1LD9A 4ZOBA 1FVEA 1IGTB 5ALCL 3DYPA 3TGXA 1JPFA 5DJ6B 4L29A 1P7QD 4ZDHA 2FEEI 1H15A 1D5MB 3P0GB 1OLZA 1DUZA 1Q9OA 1A0QL 5MP6H 2O26U 5EOCH 4H25A 2YK1H 3CNKA 4K3HA 3KS0J 2OTWA 3B43A 5JXEA 4CGTA 4E0RA 1X7QA 4H0IA 4ZXBB 2MQCA 3VXSB 4DZ8B 1EUTA 4GW5B 5DRNA 3B2UD 5H2BA 5KZCD 5DFVD 3QH3A 2JJSA 3VFSA 2A0LC 3SDXE 4P4KA 4MNQA 3HFML 3KPLA 5E1AA 4KH2A 3CUPB 5E8OB 3MRQA 4GG8B 4IRJB 3L95A 2XG4A 1F58H 4H1LA 5A3IC 3GFUA 1RZFH 3TNNA 3MA9H 4OGYL 3QAZB 4M43H 4TULH 5CGTA 5IF0B 5C09E 4PRAB 3SPVA 2D2OA 4TVPL 5E99H 2XQYG 1NFKA 1KJMB 4UOW1 3RDTB 5JPNA 5HHMB 2EDJA 3TA3C 1SEBA 4M7LL 1CLZH 5D70H 4JFDA 5F6HJ 3RA7L 2VIRA 4G6MH 5BV7C 5ISZB 2WM0A 1TQBB 3DIFB 3KLHC 5C0EA 1G7LA 1VSCA 1R3LB 3K8MA 2NY5L 4JM4H 5ECJE 4JVUA 5IM7A 1C5BL 2DTMH 1Y0LA 3NZ8A 5ANMA 3AS3A 5I1JL 1LO0L 1JFQL 2XTLA 3MRDA 4RIRB 1FGNL 3P9MB 1DUYB 1YMMA 5KOVC 3TO4C 2VDKL 4G42A 1U95B 2IPKA 2PCPA 3GSRA 3TYGL 5GXBB 4KQ3L 1ZXQA 1T3FB 3W9DA 1JNHB 4JR9H 1ONQB 1JF5A 1UJTA 3CFDA 1F6FB 4P2RA 3VGDA 5CMAA 2HJLA 5IVXA 1SMAA 4WW2F 1Y18A 4XB8A 3HPLA 2DMCA 4MDIA 2C4XA 5LKNA 1XCTA 3L6FA 4NZDA 5JLZB 3FCTB 5JHDD 3L3JB 5D1ZC 3KPRB 3JWOL 1Q9LA 3VJ6B 2YKLH 4N8VB 3KYKH 3O3EB 7CGTA 3FN0L 1P1ZB 2VOTA 25C8H 4HJ0C 5JIKA 1TJHH 4HWZB 4NPYB 2XI9A 4WO4B 5EU6E 3B9AA 4MWFB 3GKZA 1WFTA 2HA1A 4WFGE 1D6VL 5HGDA 5FCUL 4OCWL 1ZHNA 5DUML 5C7XL 4GQPH 2HRPH 4ONOA 5DGQA 5DRNB 2EC9T 4MA7H 2B1HH 2DWDA 4MS8C 2D7TH 2PXYB 4PJ7E 3MJ7A 4FHBD 5C0BE 3QRFM 3ARDD 3CUPA 5CEZD 1F6LL 9CGTA 3I3EA 5FCUH 3QJHA 1E4XI 2ATPB 1DQMH 4N5ED 4MJIE 4TRPL 2FCBA 1ETZB 2J6EL 1IAIL 1AIFB 1FVEB 2Z9TA 1U95A 1A1MA 4GG6B 4HKJB 4AMKH 3UCRA 3UDWA 3KJ6L 2DQUH 1Y6NR 1FNEA 1K4CB 1YNKH 4N9OB 1R3HA 4XNYL 1I7TA 1GGUA 3V52L 1FG2A 1AXIB 5JR1L 3CMGA 3QHTC 4L8SC 4F2MA 2JJTA 4I4WB 3RVWD 2EO1A 3FCTA 1FFNB 3E6HA 1QRNB 2UZIL 1S5IL 1G7LB 4G8GE 4D8PA 2EO9A 4NHUA 3MRFA 3VJ6A 1G7HB 4K7PX 1IFHL 1FN4A 3RVUD 3IDXL 5F1NA 1ZA6B 3C9NA 3LQAC 5IIEA 1XGTB 5HPMA 5ALBL 4WU5B 4OCXL 2DL9A 4G8IB 5DK2A 3PWNA 1QHOA 1QEWB 5L7XH 3VXRD 1N5YH 5B3JF 4M1GL 4DWHA 5AZEH 5EZLB 2A6IB 2QHRH 2R4SL 2J1KA 1LEGB 3ARBA 4PJCB 2XTJE 5ISZD 2I9TA 3WHXA 5JHLL 2OK0H 4MA3A 5I8EB 4G6AC 3V5HA 2W0KA 1CG9A 3K74B 1NDMB 3W9EB 1BVKB 3D3VA 3HB3D 5I8OL 4HZAA 5T5FL 2JJUA 3TPUB 2PXYD 4ODXA 2EDBA 1IT9H 1IL1A 1YEKH 3WIHA 5FHBH 3HMXA 1PFCA 4OI9A 3VDCA 3QUML 1EH9A 4PUBL 5GGTL 4WNQA 2E8YA 3T4YB 1ZHBA 4HPOL 2OLDA 2QADD 4R2GB 3DMMC 3QG7H 1MHHB 5I1IH 4ZSOB 3VH8B 1E4JA 4XVTH 1HHGA 2YA0A 3G9VA 3H7BB 4RGMB 3TA3D 1MJ8H 1IKFL 3U7WH 1LD9B 5FHBL 4BFIA 2ZJSH 1B0GB 1UXWB 5D7SL 3WIIL 5BS0E 5I1JH 3HRZB 4KAQL 1J05B 5IT2H 1FGNH 5GGRA 1CI5A 3L5HA 2BSTA 4X8JA 5CIPH 5T1LD 3VXMB 3G5VB 5EU7C 3VXSA 4JVWA 4Y19E 1MJ8L 4NN5B 1DQQA 2E27H 3MLRL 4UTAL 5C07A 5F3HB 4P9HC 4YHZL 4H20L 4CU8A 1K3IA 3HG1B 5GRJL 2A6JA 1PZUB 1D6EB 1IAIM 2R1WA 2Q8BL 3E8UL 5JORA 3P73B 3THMH 3RPKA 3WV0A 4Q9RH 4JAMA 3WNOA 2YR3A 3MGTA 3GSNA 4U6XA 2C9AA 4OZFA 3PABA 3C2AH 1BF8A 2RQ8A 3BE1L 4XZUB 1JPFB 5DJ6A 3IGAA 3LSOA 1WTLA 5FF6B 1MCWW 5KAQF 4Y2DA 2B1AL 5AD0B 3P77B 1RUQL 1KENL 2DS4A 4Q7DA 5ID0B 2Z93B 2DRUA 1XGUB 3ABZA 3KLSA 5DWUL 2BHZA 1MSPA 3T0ED 1H0DB 2JELL 2GI7A 3MRMA 4ZFGH 4KZEL 5IVZB 4P9HH 3KGRA 4QHUB 4QRPE 3D85A 1SJXA 4PBXA 4Y5XB 4CVWA 1W72B 1FV1B 4R2GD 4YO0B 3Q1SH 4GSDL 1AKJD 2GW5A 3EDDA 2FJGA 1ZGLP 3QJFB 4PRIB 1XF2A 1OHQA 4JFYA 4L4TE 3ECBB 3L3GB 3QHFH 1PLGH 3INUL 1HXYB 4N8VG 12E8H 3PP4H 2I5YL 4CVXA 2HN7A 2AK4B 4I2XE 3MRPA 2VLRD 1TVDA 3WSQL 1OP3K 1WT5C 3PUCA 2FL5B 4HHAB 5HDBE 1K8IA 1BAFH 5FYJE 3EYSH 2X44D 4ORGB 1K5NA 1ETZA 4R90H 4JG1L 2H2SC 4JLRB 4FXGA 1M71B 1NC2B 2FNBA 1YN6A 3GSNB 4GUPB 4U6XB 2C1PA 4MHHI 3WNMA 1DVFD 1OSZB 1NAML 4LEXH 3LEXB 4NWTH 5IROC 5LQBH 1A6TA 3SE9L 3KYMA 1MCOH 1WC7B 3SOBL 4OI8A 4L8CB 5AD0A 3BP4B 2P8LB 4V1DE 4U7SA 5KSBE 2AJUL 4Q6IB 4ZS6C 2CGRH 4KUCD 4U3CA 1LHZA 1MNUL 1F42A 4DKEH 4XAKD 4F37F 4PTTA 4D0BA 2DYPB 1QFPA 5JA8B 2WIIA 2P5ED 5E2VL 4NHCH 4KUZH 2VDKH 3MRGB 4GRMA 3QIBC 5CJBA 4NQED 5FGRA 3SE3C 3IETA 4PRDA 1JZ5A 2HT4D 1J0KA 1MCNA 3FQNB 5DQ9A 1TJIL 1VFBA 4X8JB 4QT5B 3CU7A 2XPGA 4QXGL 4WHYH 1NBZA 1N6VA 5ID1B 2YUWA 4E5XA 1LE5B 1GZPB 4E41E 1WVZA 1JGEA 2A1WL 5CJQL 1BVZA 4HS3B 1UC6A 5DFVC 1ITCA 2R9HD 1JZ3A 3LPGA 3SO5A 3FO2A 3MRJB 3S5LG 4Y5VB 3QPXH 4AG4H 2KKQA 5E8PA 1RHFA 3VXSD 1WLHA 3TLRA 1QEWA 1JHKH 4G9FB 2VABB 4NC1E 3RP1A 5CD3A 1NGZA 1FORH 2H6PA 5FF6A 1H8SA 3RVVC 5MENE 1GSMA 1ND0A 1VEOA 3HLAA 3CFKA 4MCYB 4OQTA 3OGCB 2BOBB 4J3OC 4PLJC 1BZ9B 1VFAA 2RJMA 5J4MA 5KSAA 4MNQD 4KI1A 2XY2A 1WWCA 1GGBL 4J6RL 4DAGL 5ICZA 4U3XA 3BVNA 3AM8C 2X4QA 4NN7B 5GHWL 1A3RL 4F7EB 2NNAB 5GJSL 1XH3A 2APXA 4RGMC 1JV5A 5DTFB 5FO8A 3PWLA 1GYAA 1QNZL 4MAYA 4Y2DD 3WS3A 3CDYA 4PP1D 5EBGA 1JZ6A 3IDJA 4WUKL 5EORL 1A3RH 4IIQC 3VXQA 1ZT7A 2IH1A 5ESVA 4TVPD 1G7PB 3BEWB 1NMBH 4NO0B 4TUJA 5E2JA 2WUCH 1UXWA 5JXED 2B0SH 3GMQA 4IEFB 5GGVL 3MV8E 2I60H 3D85D 3QP3A 3T4YA 3GIZH 3IT8D 4Z8FL 4NOBA 1Q94A 4Q9QH 3HC3L 4L4TD 1A8JH 1IBGL 4DVRL 5EUKA 4MB5A 3AU1A 4Y4FB 1P2CA 3HC0B 5I75B 1JUFB 3UMTA 5B39B 1KGCE 3V5DB 2I60L 3RWHB 1J1PH 3GMMB 5L8KB 4LGSB 4Z8FH 1KCKA 1JK8B 1CLOH 4HH9A 4YHKL 2XN9B 1F3RB 5F9WB 5IV2B 5L0QC 1NLDH 3AREC 1TIUA 1NLBH 5C0NC 4MXQC 3T0EE 4CU6A 4KRLB 4UTBL 2ZCKH 5I17A 3MZTA 4Z0XA 3VCLB 1C16B 3SY0A 5EWIL 3BZFA 2AI0L 3LRHA 1WWBX 5E2TL 2CLVA 3ARGC 1UQSA 3SOBH 1QTYT 5F88B 5CKAA 3BPOC 4N1HB 1NBQA 4L4VD 3LN4B 4HPOH 1UCBH 3VD5A 1N64H 1U3HC 2OR9H 3QG7L 5DA4A 1J7VR 1B2WL 4DKDC 4I0PA 5C08E 4K3DL 4HIXH 5ICXA 2R0KH 4QXTB 1MFBH 3KYOA 4OZFG 4XP9L 1N4XH 2VDQL 4Y4HB 3C6LD 3F7PC 5IFHH 4H8WL 1ND0B 5J56B 4W4OA 4XRCB 4ELMF 1YPZE 2VDNH 4V2CB 1MELA 5HY9B 2MKLC 1A1OB 3MFGB 5ID0A 2YD9A 1MJUH 4K94C 1ED3B 3NN8B 4Q6IC 4CNIA 4H88H 3V6OE 1N7MH 4JREC 5H94A 4P3WA 4M3JA 3QXTA 5KSBB 2OJZL 1NBVH 2FHBA 3RVUC 5EU4B 4KHTH 4K9EH 4U1GC 4N0UA 3HAEG 3AM8A 1RZ8A 1MIEL 3UZVB 3GM0A 3L7EB 3C60D 4XCCL 1CGSH 2HT4C 4KY1L 3GSOA 3WXVL 4MA1C 4XNQB 4Y1AE 5HYQA 5DUMH 1MCKA 3PQYE 3WN5B 4KI5D 5CEXA 1GGCH 1R0AH 1TXKA 1J9CT 4QEGA 5J0BA 4YPGA 2BNUB 5ETUA 3HZVA 1OSPL 3QEQE 1RZJC 2V2XA 1T20B 2DI7A 3QPXL 4AG4L 2EDQA 4U6YB 2EXWC 5D1ZD 3ULUL 2ERJB 3FQWA 4CBPA 1UM6L 4XAWH 3U1SH 1LEIB 4K7PL 4G6AD 1MI5B 4NOFA 3EYFB 4PJIB 3EHBD 1KJ2L 4I2XB 1P53A 1LMKA 2D0HA 3C2SA 4EXPX 1GC1H 2DLTA 2J8UB 3F7QA 4WWKD 2P5EE 1QACA 4EVNB 1B0WA 2BFVL 1N0XH 3UJIL 2NY1C 3T65A 5FV2A 2WP3O 1CFBA 2EIEA 1GGBH 2G9HB 4Q2ZA 7FABH 1BBDL 4MQXD 3B83A 2W91A 2BC4B 3V0AC 4QRPB 4U6TA 2X09A 1INEH 4LVEA 1FZKB 4WI4A 2FBOJ 4GQ9L 3D3VD 3LPWA 4YXLL 1EBPA 1I1FA 4MD5B 5E94B 3DV4B 2VLKB 5IIEB 4JO2H 5C8JB 1I3RB 5DJ2A 1YJDC 1FBIH 1P7QB 3QCVL 4R0LA 3IYLW 4XT1C 4PJ5E 4IRSB 4MA8H 2EKJA 2UUDK 2VERN 3CXDH 1INDH 5I9QC 4R90L 4TVPE 3VI3F 2JKXA 4F33B 1GCFA 4YXLH 1E4WH 1G0XA 5E8NA 3TA3A 3U46A 1UWXK 3KPLB 3FO0L 4ELKA 2QEJA 2X89A 2ZUVA 3AVEA 3E2HB 3GSNL 4IRJD 5ISZA 4PRAA 5IROA 3SPVB 3VW3L 2P1YA 1GRWA 2GTZA 4PB9L 1EA9C 3PHQB 4J8RB 4W6XB 1WZ1H 4ELMA 3QXUA 1EEYA 1VERA 2NPLX 4RGOL 4X7SH 2VTFA 2OL3H 3RWDA 3RFZC 3QUMH 4F7MA 4PUBH 5GGTH 3U0WL 4QYOA 5D7IF 3ILQD 1EHXA 3TO4A 3VXME 2GSIA 2BHYA 3PV6B 4CAGA 1PYWB 4EQ2A 1LE5A 4P57B 3OHXA 4QRTA 1JPSH 2RR3A 1OGAB 4M7JH 1E6JH 4JB9L 4JM2D 2UY6A 1HHIB 5M95B 4U7MA 3C8KA 3ROLA 5KS9E 3WIFB 4ZSOE 5FO8B 3O2WH 4HUNB 3SE4A 1A7PH 1T2JA 3B5TA 3BEWA 1T66C 1KACB 2BHUA 3FT2A 1EVTC 1MFBL 3ARTA 4MCZB 4UTAH 3EIFA 4YWGL 1TETL 3R06A 1QSZA 4H8WH 2OJEA 4HZLA 5GRJH 4D0CB 4JQIH 5TDOB 5C9JA 3U4EB 2P42B 4ODHL 5CEYA 3E8UH 4ZS7L 3BKYH 1D9KC 4MDIB 1OTUC 2COQA 3TCLB 1JV5B 5DTFA 3RNKA 4IS6B 3FN3A 2AQ3A 5H35A 2C3VB 2FWOB 4HPYH 4NPYA 3S8WA 3SDDD 2MOVA 3DOSA 4FTVA 5C70A 2AXGA 4PJXF 3ZE0E 4KK9C 1DBJL 1NBVL 3QHZH 4MD4B 5EOCJ 3MLSL 3RL1B 3RWCA 2Y36L 1GOHA 4LDLB 1KTDB 2FX9H 5IW1B 2OR8A 2NR6C 4P4RA 2EE3A 2OSLB 3MLWH 4RRPA 35C8H 3MUGB 1G1YA 3MOBL 3PGDB 1FYTE 4Z0BH 1NCTA 3N85L 4R8WL 3G5XA 3ULVC 1M7DB 1DBBH 1NBYB 4YHNB 2GTWA 3ALPA 5BOPA 1YYML 2CXKA 1K8IB 4P9HL 3ZTJH 1J0JA 5LAXA 4X6EB 4FQIH 2RFXA 1FSKC 3QXAB 4QTIH 3MV7D 5EIIB 4B0MM 3TZVB 1YMMD 4G6JH 4FP8L 5JOPE 1EERB 4KI5C 2PW1B 3RVXD 3STZA 3NH7L 4HWBH 1L4IA 5TE4L 5M7QA 4AIZB 4PRIA 4DGYL 4ZXBD 4P3DB 3NMEA 1HNFA 1NMAL 4HMCA 1VADA 1C16A 3BGFC 5T3XH 1F90H 2HRLA 3PWUA 5JDJA 3TIDA 1JK8A 4HH9B 2CMRL 2VB5A 15C8H 4W70A 1LGVA 3U6RA 3W0WD 2XN9A 5BXFA 2CDGB 3BMVA 3SGJA 3ZDXE 2Q6WA 2FB4L 5ENWA 1QSFE 5D7KD 4UOW0 3ZDZF 3OKKB 2NTFB 3DX9A 5ICYB 1D5XA 1G6RB 1G7JA 1GIGH 5C0BB 3NCFB 4MGXA 5IW6A 3UX9B 5DK2B 5ESAA 4FQXA 4N5UA 4NO2B 3MV01 1BOYA 2FDBP 4JJ5A 1KUMA 3QFJB 5TF0A 1ZSDB 3TWCL 3U7AA 1DL7H 4WO4C 4GRLD 4TYUA 2YWZA 3WO4B 1KIQB 1H15B 4Q9BA 4Q6YA 4K3JL 4PY7A 1G9NL 3FMGL 1CDJA 3NCBB 1HILB 4MZ3A 4LLQB 4FFVD 4K94L 4LNRA 2R2BB 2W9EH 3DROA 1G6RL 5TH2A 5I1HH 1MCLA 3RY6C 5C0RL 4GW5A 1P4IH 2DQTH 3AREA 3KPRE 4ZPVB 4NGHH 1RSFA 3PWVB 4XBEH 4QOKD 2EIZA 4CMMA 3Q5TA 4U6YA 2C3VA 1ZHBB 3V95A 1V3JA 2DI8A 2RBLA 1A3LH 5EULV 1ZLUK 2OR9L 4XXCA 4UOJA 4S0TD 5FA3B 2M8XA 3RTQA 1CE1L 4X83A 1F00I 4QF1A 3K4AA 1CGYA 3LKNB 2P46B 1DJSA 1NGYA 5D2LE 3HRZA 4HMDA 5FYKL 4DTGL 2AJ3B 1F6AA 4YHOL 5KW9H 4CMHB 3IKKA 1A21A 3QEQD 4FQ1L 4WHCA 4Z76B 5CJXC 1S8DB 5L2KA 4JFYB 1U92A 4PLNC 3MREA 4ONHA 5CZKA 1QFWH 5CSZB 3SE4C 5I1DB 4FQXB 5FYKH 2AJXH 2BVPA 4P5TC 5J13C 5ISZE 1I1YB 4ZO8A 4WWKB 3HE6B 2ITDA 2R2HB 3G6AB 4P23C 3VFUA 1YECH 5HHME 3FRPA 5ACZB 2ZG1A 2BY0A 3BWAA 4YGVA 3MA9L 2CDFA 3KPQA 5C09B 5D5MF 3D9AH 4PGEB 3VE0B 1T6VN 5HDLA 2VSCA 5IR1A 3KLAA 1KJVB 1YZZA 4TVPH 1NCDL 5DJYB 1OSPH 3FO9B 3H9ZA 3E0GA 3QWRD 4TTDD 3TT3L 4U1LB 3S4SB 5EB9A 4JY5H 5JOFA 2FBJL 2HN7B 2CSPA 3DETD 1I1FB 1NCDH 5FYJU 5LAXB 2N7BA 2FH8A 3C9NB 4P2RE 2D7QA 4DVBA 5KANI 1FVCA 4LLDA 2CK2A 1JI1A 4XBGB 4LVHC 5SWSD 1K5NB 4UILL 2FO1A 1VFMA 4G9DA 2NXZB 2EC8A 3GMMA 4RFNB 3FTGB 3RQ3A 1SYSA 4WW2A 5SX4I 3E3QC 4PS4H 3DV6B 5F9AC 3O11B 2DBLL 3FRUA 4MD4A 4FZ8L 1VEMA 4GRWF 3EOBB 5KSUB 1TTUA 4N0RA 3ULUD 4X4XB 5I73C 2DQJH 1A4JA 4JFEE 4ODVH 4RA3A 2GEEA 4JG0H 2VO5A 1NUFA 4X6CF 1CIUA 2QQQA 3BESR 3GSQA 3ZHLA 5T3ZE 5ADOL 2R0ZH 3U30C 2NTFA 3GSXA 5DHYB 2CDEB 3JZ7A 4NKMA 3U79A 5DSCB 3VXRB 1NL0H 3RVXC 3RKDD 1M71A 3SGJC 2DM7A 5JXAH 5DD0L 3WFHB 1T7VA 1NLDL 3P4NA 1HHIA 4QNPF 2VL5B 3G6JF 4L3CB 4ZMAT 2LVEA 3QULB 3QNZB 3IJHB 3I6LE 3S9DB 3N9GH 1JBJA 2Y06H 1JNHA 5IEHA 1WZ1L 2OX5A 4LMQE 4X7FC 1MJ7H 5F1NB 1FIEA 4OGAD 1YQVH 3TVMB 4JPIB 3DRQB 1UKSA 4PRPB 5F7HA 5C2BL 2X4RA 4XC1L 5DFWH 1Q9LB 4XNZC 5B8CB 4X6EA 4QGYA 4UT7L 3S7GA 1EZVX 4WWKC 1ZWIA 4XB7A 3AC0A 4XHJD 3BQUA 2ZCLH 1J0ZA 3RHWK 5ILTH 3P9LA 3VH8G 4FTVB 2X9YA 5C2BH 3PGDA 4MQXC 3NTCL 4LSVH 3ILPA 2WWMC 4MJ6A 1ONQA 2H3NA 1UA6H 1NDMA 4JKWA 2I24N 3NFPB 2DI9A 4ZTOH 4LSQH 3FOMB 5DO2C 3EKCA 3TIEA 4LCCC 4HJJL 1QFUH 4YDIL 4GH7B 1KXVC 1IZJA 2Z0BA 5GS1A 1FZJA 2AJSL 3MBXL 1T1YA 4NCDA 3U0TB 2NLJA 4JDTL 5CEZH 4M5ZH 5HGAA 1A47A 2XNAA 4MXVF 2BXZA 5DYOB 2VL5A 4XHQA 4U1MA 5IKCA 3C08L 1RJCA 3WKNA 2P48B 2XV6B 4JFDB 4YNYB 3IXAA 4IMKC 3QO0B 5IFJB 4EN3A 1LO2L 1BZQK 2E9BA 4XPFL 2X7LB 4XAWL 3U1SL 1QLFB 1KCLA 4Z0BL 1W8OA 4FQLH 3NABL 4N0CD 5F44A 1YPZF 2PUQT 2NY4B 4WDIA 4G6FD 1J1OH 4YDJA 1NCWL 1HH6A 2GAZB 4KXZH 2N1KA 4XBPA 1P7KA 4G6JL 1P1ZA 3QUYA 2VC2L 4PRNB 3QZWA 1HWGB 3OB0K 1B0RB 5GGSB 3GNMH 3DGGA 4M61B 5I1IL 1FNGB 3QDMA 1T3FA 3B6SA 3W9DB 3FTGA 5K9KA 2DQDL 5CINH 4NYLA 4XNZB 4K71C 4HIIB 4YC2B 2MTPA 4MVBD 5IOPB 4X5WA 3VFGL 4NZUH 1VB9A 4NO0A 5SWZD 1F11A 1AY1L 2WLZA 3W0WE 5IT2L 3FOMA 1QYGH 5DGRA 5TDPA 2IFFL 1MRDL 3BD3A 5CJOL 4JDZA 1IGJA 3WLWC 1F8TL 4NNYA 2R0WH 4PJ9C 3HMWH 1UKQA 5EO9B 3DURA 4FRWA 4JZJB 2AJVH 1ZWIB 3BP7B 2OP4L 4X5XB 2R0ZL 5D7IA 2XACC 4JJHA 1K4DB 3UBXG 3MCLH 3QI9C 4Y5YA 2AV7A 3KPQB 2A83A 2CDFB 3GB7B 3M17A 1I9JL 4PD4K 5KTEL 4JHAH 2AV1B 5IV2A 5F89B 1UWGH 1EAPB 4JFQB 3P4OB 1J0IA 3S97C 4YGVB 1ZHLB 4RGOH 1ZT4B 2EXYC 4K8RL 3VXPA 4MZ2A 4OZHE 4GMTL 3GMNB 1OW0C 3MC0A 2XWJA 3RZCB 1WF5A 1T7WA 3IDMA 5I2IA 2DYPD 4NRYA 3B9KD 3HE6A 3HCVA 1NBZB 3SDDB 5F9JA 4F9PA 2NY7H 5KAQG 1EO7A 5E8DL 1AXSB 3GMRB 3EYQD 3L7FA 3GKWL 3G04B 4RCAA 4K8RH 3TO4D 1F45A 3L95B 1JNNL 4G80B 1KN4H 3VWJC 1KPUB 4NP4H 2ED8A 1YC7A 3EFDL 5D7LA 1MF2H 4XPHH 4G7YH 1X5KA 4Z7NF 1UJ3A 1HHHA 4LHUA 5I17B 3MBEC 4UBDC 3RUGA 4K3EH 5DLML 4X7CC 4DOHE 1J1XH 1G9ML 3V5KA 4X4XA 2V2XB 4P2RB 5FGCB 3VI3E 3VFTB 1H3VA 3IS1X 3ILQC 4QWWD 1QLEH 4H1LH 2CJUL 5BZWA 2XFXB 4F9LA 3EDFA 2KZWA 2WIMA 3WLBA 3EW3B 4UAOB 3KPPA 4JKPH 4HCRL 2W65A 3F58H 2VLJA 3W2DH 4RZCA 3SEPA 1UZ8B 1U6AH 3I6LD 5ABDE 5DJ8B 3MLSH 1JF6A 3KHOA 4P23A 3FONB 3ZKSD 5JMRA 4GAJL 4U1MB 2FR4B 1P9MC 1E28A 5EO0B 2V9QA 3CFBA 4BH7A 3P9LB 3KG5A 5GS0C 3MNWA 1XF4B 1F4YL 3ET9F 5CUSL 3KS0H 1JGLH 4PG2A 4YH6A 5HYJA 4QHKI 4FQXC 5C3LD 1MWAA 4BJLA 2GT9A 4RRPG 3C5JB 1FVDA 2UYLB 4XPFH 4JDVB 2G2RB 5DZNA 3S35L 3IJSB 2HWZL 3AFLA 3GHEL 3JTSA 5T1LA 3ZKNC 5AG9A 1A4KB 1VENA 4M6OL 4F3FA 1RMFH 3O3UN 2E7LC 4EI5C 2QL1A 1QQDB 1WEJL 1NCWH 1NMAH 5D2LB 4APQA 5MERA 4IDJH 5E03A 4K71B 3RVWC 3ESUF 1QG3A 2APBA 4M1CC 2FJHA 2CLZA 2NY6B 1VCAA 3GIVB 4M7ZB 5CINL 3KPMA 3QIBB 4PJ5A 1OF2B 4DEPC 2Z93A 4X6FB 4KKBD 2AJYL 1BX2A 1X3DA 5I16B 3ROOA 1MHCB 1AFVL 3UTSE 4N90E 4XPGH 4EXKA 3V6OA 3OX8A 1FFOB 4U1IB 1XGYL 3FT4A 4QHKJ 5EH1A 4JO3L 3I2CL 1X5IA 3EZ8A 3MNVB 3WXWH 3JWOC 5I71C 5IMKA 3SQOH 3ULUF 1CZ8H 1E27B 5I1EL 4RAVA 4M1DL 1ZMYA 3X17A 3TV3L 4FQJL 1PVHA 4ZYKB 1OPGH 1FC2D 1R3KA 2X10A 1IAIH 4EBQH 3OKNB 2CO6B 4LKXB 4DQOH 1UENA 1MFDH 3LHPH 1YY9C 5B21A 4W4OC 5DA0B 2WANA 1QSFB 1YQVL 4QXUH 5TDOA 4S1RH 5JW4N 1DANT 3WIHL 1ZV5A 1MFEH 4JN2B 4P2OB 5A43C 2D03L 3G6JA 1CE1H 3QEGL 3DI2B 2P24B 4KRPB 1QHPA 1ZVHA 3CC5A 4G80A 1FGVL 3CFEB 3RAJL 4HS6B 3RNQB 3O6FA 5E8DH 3C09B 1U41A 3IDXH 3VFRB 3B9KA 2VZ1A 5FYLL 5DRXB 5BQ7A 1HHJA 5KVMC 2AEWA 4NP4L 3ZO0A 1JN6B 4A6YB 1WWWX 2H6PB 4PBVC 4LU5H 5LBSH 3FL7A 2X4NB 5CSGA 5K59F 3U6RB 3PV6A 3MO1B 4P3CH 3KWWB 3TESA 4KQ4L 4XH2B 2N4IA 1BQUA 4MCZA 1FYTB 2CLRA 4KJPC 4HULB 1MUJB 4U1NA 3K2MC 1JCKA 3B5HA 2AXGB 3NCEB 1CYGA 1FNSH 1XIWD 1AI1L 1KB9J 4O58H 5F9OH 2IBBA 4W68A 4XC3L 2X4TA 1BQHG 1JPTL 2J88H 4YHKH 2ICWJ 3RGVC 3MUGA 2XY1A 3SKOA 1EHLH 1RIHH 3GBLA 3O41B 1WZKA 1H3XA 4GOSA 4IMKA 5E99L 5EU5A 4P4RB 1BIHA 1MCFA 5JQ6L 5E56A 4P23D 1AQKL 1FZOB 4LF3B 4PJCF 1RIHL 4S1QH 3I6KA 1B90A 5C0JA 3DTXB 2IQ9H 4OQTH 3G5YA 5JUEL 4U05A 4JZJA 1MCEA 1GGIH 1NAMA 1B2WH 3SO3C 2X4PA 4ELKB 2R0KL 1HEZA 1C5BH 3QIBD 4NQXA 4TTDC 1I9IH 4PRBA 5D5MA 3PABB 4HUVA 5J1AB 4NZRL 4X6BB 2H26B 4JFFD 4XZUA 4L9LB 4PRHB 5D7LB 4L3EA 5GZNC 1DN0B 5I66A 1NGWA 3KR3H 1PZ5A 1MLCA 2BDNH 1KFAH 4ZFOL 5EOQH 2IF7A 4NO2A 2A2QT 5FYLD 4NKDB 5KBNC 4Y19A 2CRIA 2VISA 3MR9A 4WTZG 3VD7A 4HLJA 4ORGA 3KR3L 2GFBB 3OB8A 1N6QH 2WBJC 1AD9A 4NN7C 1BEYL 2Y72A 4XMKL 2BY3A 5E6IC 1W72A 1K8DB 5D2NE 4JM2F 3O6FC 4G6KH 5MEOA 3QIUD 4U7KA 2FO4B 4MAYD 4OF3A 2FX7H 1FCGA 3HI6H 5HJ3B 2VLKA 4EUPH 1D6VH 4PJ5B 2CIKA 2XKNB 2Y6SC 4M1DH 1A7OL 1CD1A 1T0MA 3DX6B 1EK3A 2VLKE 3VFTA 1BQLL 3WE6B 1KCUL 3AAZB 3HUJE 4LPVA 4Y5VC 1J88A 1U91A 1FN4B 4XVJL 1YDPB 2I07B 5HGAB 4HG4J 1C5DB 4JQXA 3IJSA 5HHPB 1ZT1B 3VWJB 4G42B 4H26B 1OP9A 1S7VA 3QEGH 4I0PB 4KV5E 1CDBA 1EEQA 3V5HB 1L6ZA 1Q0YL 4HBQA 1U3JA 2J8OA 3RAJH 3NPZB 2MHAB 3NFPA 4NFCA 1JZ4A 2VAAA 3ARUA 3MBEA 5MI0B 2XIDA 3FHQA 4OFYA 5F7FA 4Z7UB 5D9SA 1U8IB 3MACL 3WDIA 5HPMB 4G8FB 4PJIE 4M6AA 3CSYB 2OI9B 4NQVB 1F2QA 4KGLA 1A1NA 1A7BA 3H2WA 3BUYA 1YEGH 43CAA 4FQQA 3PWPB 3MGOB 3CDCA 1S5HB 3NCJH 2A6DA 1MCOL 4GRLA 3GO1L 5CP7B 4PJ8A 3QEQB 1A6ZB 1HQ4A 4MJ2A 1LK3L 3QDMD 3KPRD 3NIDF 4MA1B 1J12A 4TPRH 1I8MB 3Q5OA 2W9DL 3PQYB 1CU4L 4AH2B 4XTRD 3UJJL 1PSKL 5IOPA 4DW2H 1RFDH 1MQKL 5JDSA 3EGSB 4DKEL 3MSPA 3G5VA 3QDGE 4HCRA 5CUSH 1AI1H 3DRTA 5DJ0B 3P3YA 3ARED 5C0ND 3ZE1F 3AXLA 2DWEA 2DQHL 3MV9B 4QOKA 4LEOB 4BQBA 1HINL 5K33A 3MRIA 4EN3D 1IM9D 4LRNH 1JTTA 2GAZA 3QQ4A 3QXDA 3BH8A 2Y23A 3UTSD 3DHMA 1XCTB 3L6FB 4GT7A 3N06B 1UWEL 3SGKC 2PNDA 3VH8A 5JLZA 4KKAC 3NIDE 2BNQB 4Z78A 4JPWH 1JP5A 4F37K 4UT9L 1TMCB 1S7QA 1U3HD 1OAQL 2F74B 4UINH 4P0DA 2CUIA 1JPSL 4Y5YB 2VITB 4NYLB 3D39B 3O3BB 1X5FA 4N0FA 4WI7A 1FL6B 1CICD 1YEIL 3PGFH 3GUTA 2UWEA 3LKSB 3J8F7 4N1CA 5E5MB 5IJKA 4PRBB 3VWJD 3ZKMD 4LSRH 4WO4A 3MJ8B 2NY4C 1VACB 3DVNA 5SWSB 1OWWA 4OI7A 3QNXA 2RB8A 4WWID 4GW1B 3ESVF 4HXAH 4RMVA 4LKCB 4RX4D 4FFZL 1G7HA 4F7PA 2EYTA 4ODHH 1Z0NA 2F54A 2R0LH 1I3RA 5DJ2B 1BM3L 1EEYB 1FO0H 3BN9C 5T1KA 1FORL 2UV3A 2X70B 3E1F1 5IESH 1R5VA 3MLRH 1T5WB 3AUVA 1KJ3H 2XRAH 5CS7A 1NUDA 4OZHA 4GG6F 3O9WA 4MVBC 1WJ3A 4NO5B 5LCVH 2R0LL 4KJQC 5I1EH 3QT2A 3T1WA 1UEMA 5CD5D 1FPTH 5E2WL 3WBDA 3HNVH 3ZDXF 3V0WL 4Q9RL 4G8FA 3HRPA 4PJEF 1KG0A 1E4XL 4YBQD 3S5LA 5EPMA 4DQOL 5HJ3A 3IDIB 5EFIA 4Z76A 1NCUA 3MOBH 5IHUH 1FDLL 1G9MC 1D5IL 4DFHA 1XR9B 3MLUH 5DJZB 4NJ9L 4I0CC 3S88L 5L9DH 4WHYG 4UV7H 2B5IB 1N2RB 5JZ7D 4AK1A 3WFHA 5BO1H 4XPHL 5TFSH 4NWUL 4NT6B 1KIRB 2OQJB 5B38G 1FDLH 2VLKD 3C6SA 5IB4B 1SMOA 1E4KA 4U6HA 4ZD3L 4QRRB 4I18C 5L9DL 3RWEA 5BOZG 1TCRB 2VRAA 5D7LD 1XT5A 1SJEA 1AGEA 2Y6SD 3EYOB 5T3XL 1KBGH 4R4NC 5MEOB 2CD0A 2OZ4H 3BW9A 1NGWB 1TZIB 4PR5B 3UROR 4TNVF 3H3PH 1NGPL 4LAQL 2NXYD 5IQ9B 2MQ0A 5FUCE 3O8XC 4X6BA 4D9RE 1A6WL 2Z8VC 4F7TA 3BD5A 1FFQA 4Z18A 2D7MA 1UCTA 2KH2B 1GIGL 4JRWA 43CAB 4KKBC 1Q9KB 3MOAL 2A77H 2O5YH 2DL2A 1NAMB 1VDGA 4WRLA 1FZOA 4N9GB 3HG1D 1HZHH 1HYSD 3MBED 4UBDD 4RFEB 2JB6A 4OV6F 2QLVB 4YXKL 1LVEA 2B4CH 5CGYD 1U3ZA 4JG1H 1N5YL 3T0WA 4P2RD 3MLYH 4L9LC 1DN0A 2IALA 1YEDB 3O8XA 2AAVA 3V8CA 1WITA 1MLCB 5T3ZL 3U9UB 1OOAA 1UCBL 3DUUB 3ARFC 2CKBL 1FH5L 2XZCL 1MIMH 1RZJL 1U8IA 5I9QB 1EZVY 2DQTL 3S35H 2HWZH 4QKXB 3MJ9L 3T2NL 1HH9B 1N4XL 2R2CA 1VGKA 3IFOA 2HJFB 1TNNA 4Y0GA 2P5WD 3F12B 4O2CB 5T3ZH 3FO2B 4LAJH 5FKPB 2HVJA 2V9TA 2VDML 1T0MB 4LRNL 1RIUL 3BWAB 4M8VA 2GUOB 4JR9L 5T3ZD 5DEGA 4MB3A 3ZMRA 5FDWA 1YDPA 3KLAB 4PV9A 5BXFB 1JJUA 1L9NA 1KT2A 3U82B 4APQD 2VIRB 5CLWA 1HKLH 4XP5H 3JV5A 1RIUH 4HF5H 4PB0H 4LLUB 1JGEB 3ES6A 1A64A 2LAGB 4LCWE 4LSUL 4I9WD 3QXWA 3KYKL 3OAUL 3NVQA 4QRQA 1KN2H 2C3GA 5FUOL 1R0AL 4V1DB 3VXTB 1MREL 4JN1H 4O51B 4BSVA 4RGND 5E00B 3ZSTA 2PW1A 1XF5A 3RJDA 3SDXF 4ISVA 4FFZH 3K0WA 3MRGA 2YWYA 5AUMB 4LLMA 3A6CH 2C1PB 4JANA 5I1CH 1V3MA 3JSSA 2JK5B 4HWNA 4PJGE 3GJFB 2IH1B 1MHPH 4L29B 1XEDA 3D85B 5DHVB 3MRBB 1D5BA 4J3VA 4ZYKA 5EC1B 1OGTB 5IESL 1IQWL 3K81A 3MGTB 5TE7H 5JNYA 1BVLA 3MV9D 2F54D 4GXVH 4H8WC 2IPTH 4X4YA 4WFHE 5J13B 2ZPKH 4C56B 4H5SB 5DURD 5ANME 5E9DB 5ACMA 1XGPB 1F4XL 2Q86A 4B5EA 1U92B 4WEUD 5ALCH 3BPNB 3BVNB 2VXTH 4N1EA 3RPIA 2V2TB 2XN9D 1A6AA 3EZJB 1IEAB 4HS6A 1CQKA 1A0QH 5GGUB 4PRIE 2F8XC 1LK2B 3ZYIA 2PYEB 2IAMC 3RHWF 3KXFE 1XFPA 4JLRA 4KPHH 3WS3B 4JQXC 1U2CA 5JW3H 3O3DA 5CEZE 1YEFL 4K23H 4EDWH 5L6YH 4Y2OA 2X4OB 5EO1B 3P40A 3M8OH 3OGOE 4P46D 4N0YL 4P5KB 3FZUC 4CL7A 1S5IH 4JKKA 1RPQA 1FO0B 2DQJL 4ODVL 3ECBA 1VGKB 2HJFA 3QCTL 1SJHB 5L2KB 3GMRA 5JHDE 1GZPA 5ADOH 3SDXA 1NMBL 4M62L 2XWTA 4ONGH 1I1AC 1NDGA 3GO1H 1J8HB 4KGJA 4PJ9A 4QRTB 3JV0A 3OKLA 1M7XA 5D70L 2QKIB 3RWGA 2R1YA 1FL3B 1IKNC 3X14B 1UZ6F 2JB6B 1RFDL 5GSRA 1CGVA 2FYYB 1O7VA 1QKZH 3LRGA 4TSAL 2ZUTA 2ZG2A 4FFVC 3UC0L 1KEGH 4R0LC 3RWCB 1S8DA 4PJHF 4LCUB 3FB5A 2FR4A 1RJLB 1J1PL 4YZFF 3PWVA 4BFEA 3GIVA 5TPWL 3HG1E 4HQQH 4ZODA 1QA9B 2AKRB 4NN5C 4OD3L 4LSSL 3ZE2E 3ORJA 1IAOB 1H3GA 1NLBL 1HI6B 4HGMA 1IEAA 3ULVF 2IH3A 3CFJB 1J18A 5IVOA 5CZXC 4JFHD 2H1PH 2IAND 5EWIH 3GEWB 3JV4B 1FVDB 2C5DC 1T04B 2CK0H 2UYLA 5TPWH 3LKNA 4C57C 5BS0B 2F58L 5SWZB 3JTSB 3BKJL 4ODBD 4D3CH 4I18B 6FABL 4OCNC 5IWLA 1TJGH 1IGFH 3SE8L 1RUMH 1T03L 3TBVB 4RAVB 4M9OA 3VXMA 4POZC 3UAJD 1K2DB 2OMNA 3WS6C 3EJYC 5FOJA 1A9BB 4OJFH 5C07B 2V5YA 2OTUA 3BKJH 1T20A 4D3CL 5KSVA 4LHUD 1UB6A 3W39A 1AP2B 4HKBB 3T77B 3DVIA 4ZPTB 2X89D 3U2SA 1KJ2A 4HLZG 4BQ6A 2VLLB 1CXKA 3MV7E 2ICES 1IC1A 1T2QL 4S1DD 4YPJA 4BQCA 4JRXD 4H88L 3MRRA 1HOCA 2J8UA 4POUB 4GS7B 4PJCE 4HUKB 4YHPA 1YN7B 3OXRA 1RHHA 2L7JA 1N8ZB 3FQUB 4N8CH 1QBAA 3MRCA 3HHRB 5HYJD 2BVQA 1FG9C 1VESA 5DT1H 2FHCA 4JZNB 3VXOB 3PWPD 4UQ2A 2VLRA 4Y16C 2Y1VA 4NQSA 1JPGA 4OLXH 3X3FL 4F33A 1S7XA 4CADA 1VGEL 3MRMB 1Q8MA 3BPCB 1NFIB 4P48A 1MJJA 3DURB 1QRNE 4L8SB 2Q8AL 3F12A 2HVJB 5SX5K 4J6RH 4DAGH 3ZKQD 1D5ZB 4RMSA 1JHTB 1WBZB 1XZ0A 1UVQB 4X6DB 3IFOB 4HKJA 3UO1L 2HFGL 1Q0YH 3QDJB 3RZCC 1S7UA 1AIFA 3DXAB 5JDSB 12E8L 3PP4L 5FYKD 1U0QA 4J3TA 3KPNB 2ADFH 1ZT4A 3TIEB 2AQ1A 3QIWA 3NAAH 5AYUL 5K59E 3IS0X 4WV1C 3DGCR 4QYOB 2EDDA 4IIQA 5E94A 5CILH 3N1QC 1BAFL 5D1XD 1PG7W 4OLVH 3UTSA 4FQQB 3P2TA 5E5RB 3PHQA 4J8RA 4IRSA 1FFNA 3LN5A 1I7RA 2P8MA 4UUJB 2F53E 4GG6A 4K94H 2D7NA 4L5FL 2DQFA 3KYNB 4K2UH 4WCYH 4XBPB 2VDRL 1F2XK 3AU1B 2Z35B 3QA3A 3QUYB 2UZXB 4HGWA 5EU6B 4J3UA 2RGSA 1DVFB 3O45A 2BNUA 4U33A 5FV1L 5GRUL 4BFIB 1DLFH 1YQ2A 3HUJA 1IT9L 2CGRL 2KDGA 4WU7A 4QO1A 4HKBA 1MNUH 3T77A 4NQSB 4U2ZA 3BQUD 2IANB 4PLKC 1U42A 1VKXB 4Y4KD 1N59B 3MFFA 3H9HA 5DK0B 4Q97A 5KN5A 4PPTA 1QD0A 5JOEA 1MWAL 2Q1EA 3MGAA 3DX6A 4NHCL 4YHOH 4L4TA 4U1KA 2XNAB 4R97C 2GY7B 4OKVB 5IG7B 1AO7D 4PRNA 1QFWL 3QQ3A 5J1TC 3KXFA 3PJSB 5DUPH 4XHJC 4ZSOA 2J8HA 3AMLA 3GSOB 4XP5L 4G5ZL 2F19H 1LEGA 3SBWC 5GJTL 1NSNL 5HVHB 1IC5L 2C1OB 2JCCE 3ULVL 1T7ZA 2BRRH 5F9WC 4Y4HD 4Z7UA 1CFNB 4PJBE 2AKRA 4OUUA 5FUOH 2EIDA 4LSTL 4NQVA 5BV7B 4OJFL 1LO3L 4HCRH 1A6VH 4L4VA 5T1KD 4D9LL 3TA3B 1EMTL 4PJ8B 3CLEL 2IPKB 3EO0A 3GSRB 5D6DC 3MCKA 1OAYH 4EVNA 4I0PD 3HNTH 3DUSB 2X05A 4HWUA 1V7MH 1S7SA 4PP1C 5CBAB 4K8RC 5TE7L 3NBNA 3WL9B 4R26L 4HC1A 1HYSC 2QQKH 5C0CA 1H3WM 3LIZH 1IGML 4G8EB 1S7RB 1MEXH 2JE8A 3BKMH 1NPUA 4L3CA 3ZSSA 3SDXB 3QHZL 2YRLA 5JXEC 3MLUL 1MHEB 2X1PA 3GGWB 5DVNA 1JPGB 2IEPA 3IDNA 1RJLA 3VXSE 2JJTC 3MLWL 5F1SA 2DQGL 5HDOA 1J8HD 4FQCL 3BT2L 3F6LA 5HYEA 1AQDA 1BQHA 1W0WB 3IDUA 4JM2C 1TENA 2BNQA 5TF1L 3B6SB 4R6UA 4Z78B 5BRZE 2XOTA 1MVUA 3P4LA 1UXSA 3RBSA 4PY8I 4ZUUA 2YPVL 3D2UD 1LNUB 4HBCL 4LHUG 3AS0A 4Y16D 3BT2H 1U93B 2OZ4L 5C9KA 2NY2B 4O2EB 3EGSA 2Y07H 1BLNA 1CVRA 1OP3H 1F4WL 3TBYB 3ZKXC 2P5WB 4UIKH 3RRQA 5E08H 2FEDC 3D0VA 4XNUL 2Q20A 1OTSD 4DZ8A 1IAKB 1LDPL 3OTTA 2CRZA 1CXEA 3GMPA 1IMHC 1S7XB 5F7WC 4I5BB 5JR1H 4OFDA 2XZQL 3O6MH 4OD2A 4ZO9A 5DHVH 3QCVH 4Z7VE 1HZHL 5LG1A 2DYPA 1HQRB 1S78C 3FFCB 4UIKL 3N9GL 3PG2A 4YQXL 1RUAH 3F6IA 1IGTA 3CLFL 4BQ9A 1WGOA 1CICB 4XVUC 5GS0L 4OTXL 4PIRF 3B9KB 1BHGA 3KPSB 3VDAA 1HILA 3CMOL 4UTBH 4NQXB 1NGZB 4P9MH 2NYYC 2VDRH 4OZFH 1MIML 3V7AE 4YQXH 3HC4H 3ULSA 1HCFX 3AS2A 3P11L 4OZIE 4OGZA 4L3EB 3OGCA 1CLYH 4BZYA 4WTZA 3LQZB 4WFED 4XH2A 1DLFL 1FJ1A 3B9DA 1QRND 3CIQA 2ADJA 4OCYH 3ARVA 1CK0L 1L7IH 2R56H 5FGBC 2J12B 4PJAF 3WEXA 2EH7H 2VNCA 1C12B 1WBYB 4JFPB 2Y5TA 3B2VL 2JK5A 5T5FH 4M7KH 3G6AA 2ZUYA 2FX8L 3GBNH 3HAEH 4U1LA 3KPMB 1CDUA 3SDAB 3MREB 1UVQA 4X6DA 2R56L 1KJMA 3RDTA 5AWNH 2BXYA 3WNNA 4L4VE 2HT3C 1HIMH 2LABA 4AQOA 1A2YA 1A7PL 4HV8A 2XPGB 3BPCA 4M5ZL 2RIKA 2ILLA 2WINB 3S96A 3ALWA 3IKCB 4ZFOA 2X4SA 5C0EB 5E8OA 1V7NH 4X80H 1TITA 4PJ8D 4PJ7A 3SQBA 4WWKA 1A4KA 5ESQA 4YHNA 5ID1A 1IGYB 4JRXE 4KY1H 2Q7NA 3ZYZA 1WFOA 4P46B 2O61A 3CPLA 2W59A 1JUFA 3TZVA 1Z0MA 1ZK9A 4LDOB 4N9GA 4IHOB 1J87A 1ITBB 1A6VL 3EJJX 1J1OL 2RAMA 5BVJA 3QEHB 1J8HE 5D7JC 2VC2H 3MQIA 1F02I 1T5XB 3RWIA 3WUWB 4LDEB 3BDXA 5JHDB 2QQKL 1A4JB 5IQ9A 4QT5A 5D1ZB 5INDB 1HQRA 3FFCA 4LASL 5DUBB 3I3BA 5JORB 4AENB 1KELH 1C08A 4WW2B 5DMKA 5I1LA 2ZP0T 1UFUA 3KPSA 4K8RD 4ZFZA 3UO1H 2BSED 3L3HB 4KKNA 2GJ6E 4GBXA 2FYYA 4QRUB 1CTNA 1JGDB 3EDJA 3MPCA 1NEUA 1MY7A 5HDQH 3LS4H 5EOCL 4GQ9H 1ACYH 2VN7A 5GGVH 2R0WL 1KXTB 3R8QA 1OAZL 1X6NA 4P3DA 4J1UB 1LILA 4PJGF 2ZZUT 2HYMA 3T2OA 2ZUQC 3GRWL 1QR1A 2F53A 4R9HA 3BO8B 2GSGB 4MQ7B 4NQEA 3BFOA 4P5MB 3OX8B 3SKUD 3CK0H 1KLFA 1MY5A 3D18B 5E9DE 1NCCH 1DQDL 5F7EL 1GJIA 5E1HB 4C56E 2OR7A 5IW6B 3V4UH 1F58L 1L6XA 5ESAB 1RZFL 1FL3A 5DVKA 3MTRA 3K80A 1QZ1A 4OGXL 5C0BD 3SGKA 3HAEA 5AG8A 4NQCA 3V2AR 2K3TA 3QQ9C 1S9VA 3FONA 4PV9B 3GJFA 4M48H 2FH6A 4YHYC 5FOBB 1U8PB 3KDMA 5FFLA 1H3UA 4MA3B 5I6XC 1NMCC 3GHBH 4GW1A 5HI3C 2QHLA 4O2CA 4HIEA 3LVEA 4UU9A 3Q6GL 2G75A 4LCWB 3CC5B 4OM1H 4F7CA 1KCSH 5T5NG 4JGMA 2VDQH 1T1ZB 4WU5A 1MCPH 2GK0B 3QDME 3VFOB 2AJUH 1HH9A 5C3TA 3PWNB 1S7SB 4RGNE 2VDNL 1TJGL 4HIHB 3MLTA 5DJ8A 4JQVA 2YUXA 4R96B 1REIA 1CFTA 1J0HA 1T1XA 1KLGB 5E70A 4I4WA 2WBKA 4UNVA 1H5BA 3SKMA 2D0FA 4LSDA 5DR5H 4YEEA 3O2VL 4O9HH 2XTJC 5B4MC 3LKQA 4LSVL 3ARFB 3N50A 1GVIA 2PR4L 4F57H 3VWKC 5FA4B 3ES6B 3IU3B 3BP6B 3LKRB 1NC2A 1KEML 5SWQA 5DR5L 1J10A 3RDTD 2HG5B 2HT2C 1OM3H 4PRID 3F7RA 4TOYL 3RTQD 5IFJA 5EG6C 1KPRA 4OT1L 4OCWH 4LLMB 4U6HB 3RU8L 2OJEB 4D0CA 3RWEB 4DCQB 4DN4H 1DQLL 2FJHB 3T8XA 3HI5L 1G9NC 1RMFL 1MPAH 2VLJE 3QCUL 5I1AA 1MFCL 2HJLB 1P69B 5KS9F 4QRQB 4TOYH 4W4NA 5EBWB 4TNWF 5I8EA 3UYRL 4YDJB 2AEPL 4UIMB 5EUOE 4FP8H 4PLKD 3JVGC 1I3VA 3VI4E 4PJIF 5C0CE 5EU7E 2ZUWA 3QCUH 2Y25A 2C3HA 5IVZA 4QRRE 4JY6B 2R23B 5D5ME 4KK5C 4PRPD 3R1GH 4S2SB 2JB5L 4Y19D 3WHXB 4X6CA 3VRIA 4QRSA 4PJEE 5K9QG 4RFEA 4ESKA 1U8NA 4IJ3C 1OY3B 3UYPA 4KC3B 3GK8L 4R4FL 3A67H 1IZKA 3QDHA 4M93B 4QRPA 1A14L 1CF8L 1GC1C 1QPXA 2V5TA 1PX3A 4HUXB 4KVCH 3TWCH 4QTHB 1DEDA 4LPYA 1AKJA 4OM0H 1AO7A 4JPIA 5JTWA 2LVCA 4YFLF 4ZOCA 1J0YA 1MFDL 5IB4A 5E2UH 3TO2A 3ZT6A 3SDAD 4DJMA 4MXQD 3SJVE 3RY5A 5IBLC 2YXFA 4HG4K 1K4CA 3O3BA 3HC3H 4N0FB 4O4YL 3MLXH 4JQVC 1GXEA 3DV4A 1GOFA 3GMLB 1YJDH 1DQQB 1PW3A 4XBEL 5DMGC 1CDIA 2BX5A 4NSKB 3L3DA 5D93C 4M4PA 1FRGH 4ETYA 5D1QA 4OCYL 3FKUS 1TNMA 4MJ5A 1Q94B 5FM8A 1TQCB 1D3CA 2EDWA 1L7IL 2HLFC 3QXDB 4OFYD 5EOTB 4XPTL 5GZOD 3VXUE 1T1WB 2L7UA 5HVGB 4XP4H 1A7RH 3QQ9D 4P4KB 5E1AB 3CDGB 5L2JA 4XCFH 4G6FB 1RZGB 5A2KH 1B4JH 4GG8A 1M05B 1NFDB 1RUKL 4J2XA 4KRPC 2P49B 1Q0XH 5FYJH 2W0PA 3JV6A 3GUTB 4MAUH 4KHXH 4PG9B 5EZIH 4Y4KC 4H25B 2BNQE 3REWA 1CWVA 3QIWB 2AJXL 3BZEA 3W39B 1M6OB 5C6PB 1A1NB 3QO1B 2PXYC 2NQCA 3DETC 3VFMB 4G8GA 5CP7A 4LLWA 1JPTH 1AO7B 2J88L 5IBTL 4DUVA 3NCYP 3MV9E 1URLA 3I3DA 4F7CB 3ULUE 4BQ8A 2QADC 3QDGB 1DTUA 3SKNA 5I71B 4F9LC 5E6ID 4I3SL 1N5AB 4R7DA 3C6LC 3C5ZB 2E7LA 2YUZA 4YXKH 1DEEB 3NOIA 3OKDB 4LLYA 3CU1A 2PO6C 5HY9A 1QUNA 3BIKB 1W72H 2ITCA 1I8KB 2EZ0C 2E9JA 1P6AB 4M02A 3GSWA 3PWPE 5C0CD 5L88H 1RJZA 4F7PB 3D39D 5IHBA 4XP6L 5EU3B 1JGLL 4MYWB 5EBLA 4Z7UE 4ZOAA 5FA4A 1HOCB 3CDGA 4PJXE 5L2JB 3UDWC 3AAZA 1BD2B 2BNRB 5DD6B 1P7KB 4RX4A 1UM5L 2G75B 1S7UB 4RQQB 4YHLH 3UBXB 1CDYA 2D31B 2BVUA 3I85A 1C7TA 1D5ZA 1GOGA 4JE4B 4WI6A 3L3IB 4C4KT 4YEFA 3LKPA 4WFHD 2I5YH 3AS1A 4FZEH 1XGQA 3HUJB 5JQHC 5IUSA 2VYRE 5H2BB 1MAML 4TUJB 3OPZL 4YE4L 4NC1C 4MNQB 4YDVB 1O0VA 3K46A 3MXWL 3MV8D 3H9HB 4LKXA 5DK0A 2IFFH 5HYJE 5CJOH 1KN2L 3WJJC 1RUAL 3CZJA 3BP6A 3EOTL 3LKRA 3WFZA 2NNAA 4ERSH 3P9MA 1SM3L 4LPXA 5IJKC 3CMOH 5CWSB 5F9DC 2C26A 1FBIL 4TVSa 5F7YC 3RY6A 3MOQA 5E6IB 1NCBH 3MLVL 2HG5A 3WUZA 1C5CH 2W07A 2BVOB 3IJYA 2MJWA 4IIQB 3IDJB 1MRFH 1I9JH 4NO0D 3GMLA 5EZOL 1EHAA 3HE7D 1ZVSA 3SCMD 1X9QA 1BJMA 5BVPL 4D0DB 1JWMB 1DN2A 3BKCH 4UNUA 2WQRA 3MLXL 2HMIC 4Z7QF 3CSYA 4F7EA 2YRZA 1T89A 1PJ9A 4I3RH 2VXTL 3ZL4L 4PRHE 4OV5B 4B7LA 2AXJA 3I75A 3MRKA 3FB8A 5C6TH 2HKHL 4TUKL 4JY6A 3X14A 4HT1H 5ACZA 2DLIA 4L3AA 1YMHA 5F72S 3MA7B 2MMXA 3ILPB 4O00A 4I3RL 5C07D 1FE8L 5HHXL 4X9BA 1BD2E 1MF2L 4JFZL 3ARDC 1NEZG 4G7YL 4PJXB 1BPVA 2BVQB 1RUKH 4ALAH 2CPCA 3O4LB 5C6WH 1T22B 4WUUA 3BX7C 1Q0XL 5FUZH 4ZXBA 1MUJA 2EDYA 5TQ0L 3O8XD 3TJHD 3GRWA 4JZOB 5L8LB 2WQ8A 3F5WA 3A6BH 4OCSL 1RD6A 4CU7A 1KLUB 4FFYL 3DX8A 4OAWB 3UP1A 3BGAA 2MCPL 3OJDA 2GJZB 4GBXD 4JQIL 1DQJA 2E6QA 3F58L 1T0PB 5FDWB 2C3XA 5EC2B 2BVOA 4PGZA 1JHKL 3ZT5A 1G7PA 4NUJA 2VH5L 1BF2A 2X1WL 1U58A 5BZDA 2JJWA 4GAJH 4DN4L 3T0DA 5DK3A 2HFTA 2F53D 5I74C 1T6WA 1AO7E 2W60A 3FRPG 4X4YB 2JIXA 1Z3GH 4NKDA 2GYSA 4K7PY 4P5MA 4PJ8C 3QUMB 2G5BA 2PO6A 3UYRH 2L0DA 3QIWC 3O3AA 4M5YL 4XPBH 1CVSC 4JN2A 4P2OA 4WV1A 5DMKB