5JUEL

Crystal structure of uic2 fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
220
structure length
220
Chain Sequence
QVVMTQSPLSLPVSLGDQASISCRSSQSLLHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHIPPWTFGGGTKLDIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords light chain of UIC2 Fab
publication title Crystal structure of the antigen-binding fragment of a monoclonal antibody specific for the multidrug-resistance-linked ABC transporter human P-glycoprotein.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2016-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jueL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jueL01
3ZDYE 3VFUA 4HXBL 4IBLT 1N26A 4DUWA 5DGRA 5AWNL 1LO4H 1XGQB 1ZHBA 2ICWA 4OJFL 2AQ1A 2VXQL 2PTUA 3AAZA 1FFPA 1SEQH 3P4NB 4D0CB 4Z7WF 1TLKA 1GJIA 3UZEA 1W2KT 3IJSB 4Z6AT 1T1WB 3S36H 4HH9A 3IKCA 1GGCH 3CC5B 1GYAA 4JFOA 1JTTA 1AQDB 4NM4H 3P4LA 4DTGL 3LV3A 1DSFL 3PE9A 4MZ2A 3EO9L 4BFBD 1CR9H 2QEJA 3FAWA 1WC7B 5FKAA 1PSKL 3C5SA 3D2UB 3QEQE 2EDLA 3MUHL 4P2YA 2D7NA 4X6FA 3WFDL 4DK6A 2XQBL 3VXTA 5LBSH 4MGXA 5LXGH 3BPNB 3VG0H 2R8SH 1QACA 1NEUA 4U1KA 6FABL 4RFEB 1H5BC 4HIHA 4KI5F 1ZWIB 5IJKC 4LMQE 5D5MF 3GMNB 3RKDC 5J89A 3L3HB 2AV7A 4PV9B 3Q3GB 3DPBA 5CLTA 4Z7UF 1FIGH 3AREB 3SCMA 1NCBH 5DK3A 1JZ7A 5JOPE 3IJHA 1FZJB 3G5ZB 3BKCL 4V2BA 1I3GH 2IPUG 3O4LA 1YEFH 3RWFA 1ONQA 1W72H 4RSVA 3V4PL 4MVBD 2ARWA 2NYYD 4U0QB 4FQ1H 3KYNB 1CN4A 4NCC1 2NY0B 3MUGB 4F2MA 3U4EA 5FECA 1AGDB 4HUUB 1QBAA 3DHJA 3GSNL 5EC2A 4L4TD 1QLEL 4TSCL 1NCAL 4ZAKC 2FIKB 3ZMRA 2VQ1A 4Z77A 1JFQL 1RVFH 2QKIA 4BH7A 3QJHA 2AS5M 1KT2B 2FLBT 4X5XB 1RJCA 4JPWL 5KVMC 4YZFF 4Z0XA 1YC8A 2FX8L 3V5KB 1WCBB 4UIKL 5GZOD 1INEH 2EXWD 4F57L 3BSZL 1UWGL 3MFGB 3P0VH 4FZ8L 2EZ0D 4L9LC 3TPUA 1ZGLA 3EOAA 2IAMD 1KYOJ 4YQXL 4NKDA 2VDKH 1BMGA 3V6FB 3CDFA 5J1TC 5FA4B 1FAIL 2QTEA 4YDIL 1MUJA 5HGAA 1HKLH 2MOVA 2X89A 4OQTL 4GAYA 1SYVA 4YDLB 4GG8A 2W65B 3NGBB 1KF9B 2Z91A 2VLJB 3RBGA 5HYJA 2DKSA 4J4PA 3ALXA 2GUOA 4HIIB 3KPNB 3H0TA 2DQIH 3FFCE 2ZJSH 3KXFE 3QNYB 4U3HA 1OB1B 1KJMB 1WWWX 3D9AL 3MROA 4UILH 2J5LC 2IAND 4O58H 5A2LH 3QQ9C 4YXHH 3BUTA 3QA3A 1G7LB 4PREA 1U8HA 4JAMB 3SKJH 1OLLA 3ZDZF 3PWPA 2FBJH 3GMMB 3T0ED 4Q9RH 3WN5A 3UBXB 1JRHH 4K94H 1OP5H 5FB8A 1HILB 3QIUD 2LV4A 5C3TA 1YEKL 1NC2B 4U6XB 2OJZL 5E7BA 1JF1A 3JWDH 3TPKA 2YUXA 4PJIF 4PJFB 1R3IL 5T3ZD 2EECA 4LCIH 5JPMB 2R15A 5IIEA 2WBWB 1BIIB 4NO3B 1AKJA 5IR1A 3MJGX 1MHEA 4ELMA 1LO0H 4OZHA 3TV3L 5DMJB 4U1IA 4K7PX 2FGWL 3N9GL 3O41B 1NDGB 1IGMH 4F7MA 2GSGB 1CXIA 3QDJE 5DHYB 5CBEA 1T80A 4I3RL 3WFHB 2J8UE 2WUBH 5B39B 2DLFH 1LP9A 4HFUL 1AY1L 2R2HA 3T77B 4D8PB 2BVPB 2VL5B 3D39A 3KPTA 5IHBA 3GSUB 4MXQD 4JY4A 5ACZA 3HC3L 4PJ8B 5KJRL 1NDMB 3P73A 4D0DA 4LCCB 4WY7H 5FDWB 5F9WC 1ITCA 3TVMD 3CXHJ 3VFOB 4TUJB 43C9B 3G9VA 5CEZH 4S0TD 1K6QH 3QDJD 5DJ0B 1YA5A 2OR8A 2YD6A 4XCCH 1KV3A 5KTEL 4G8GD 2FEDC 1JNLH 1NGYB 2IGFL 4WUKH 3QH3B 3L1OL 4M03A 2I5YH 5FGBC 1R5WB 1I85C 2O5YH 4NO2A 1JGDA 2X4UB 4DGVL 5CEYB 2NR6C 3DVIA 2FB4H 3MV7E 1UZ6E 2YD4A 2DICA 4G43B 2NY4C 4X80L 5FYKU 3SCMC 1JPGB 3BP7B 4GKZA 5EDXA 2CDEA 3MREA 1WWBX 3GJFB 4F7PA 2W91A 3ARGA 1VEOA 5GQBA 2A74A 4PJDB 5EBMB 4Y4FA 3ECBA 1TTGA 3LMJH 3QI9D 2C7UB 1AO7D 2AV1A 3OKMA 3BN3B 5I8KL 4EJ1C 2H9GB 5DS8A 2D7QA 1EO5A 3SE8L 3GRWL 4MJIE 1BLNA 2YEZA 4LVNC 2D0GA 3RNKB 1J0YA 1MVUA 2IPUK 4X7SL 2VSCA 3E8UH 5HHPA 2GJ6D 2VE6A 5FUZL 2X05A 4CN6A 4UT9L 4HWUA 2CK0L 1A6WH 3GHEL 3OL2A 1NUDA 1EDQA 4OLEA 1MNUL 2HJFB 4UNUA 3T2OA 4M6MH 1CFVL 5FHBL 3T08A 3QJFA 4M7LT 3CFEB 4Q6IA 1FNAA 2C1PA 4JFFE 4MWFB 1LHZA 3PDOA 2KQMA 4XCYB 5IVNA 3QNZA 1J10A 5IEHA 4TPRL 5L7XL 2B5IC 3R8BB 4FMFA 4YHML 1HHGB 1TZGH 1EVUA 1QSFE 3HZKA 5CGTA 3ZHDA 1FZMB 1FNEB 2MCG1 4OCYH 1FH5L 3TCLA 1LO3L 1JK8B 5CD3A 1BFSA 1AFVL 3OJ2C 4J4PC 1A6PA 5EPMA 4XCEB 2KUTA 1U8MA 5DHVB 1F45A 4QXUL 4ZXBD 3UTQB 2R0LL 3S35L 2LVCA 2XKSA 4LK4A 4KJWD 4IRSA 3QPQC 4QKXB 5GRXG 4QYOA 4RFNC 2QR0B 3BQUB 3VMNA 4NUJB 3GBNL 4QRRA 4YJZL 3DJ9A 4S2SB 3HN3A 4EDXB 1QRNB 2Y06L 3MC0A 5T3XL 4W6XB 2ZPKL 3NZ8A 4ZOEA 4ZD3H 3QWOB 5LGHL 4IJ3C 1EZVY 1T04B 3FQNA 4HC1H 1KGCE 3SGDH 3I9GH 4F8TA 3VD7A 4FQQA 3G6AA 1ZLUK 4HF5H 1N7MH 2FHCA 2X7LB 3CSBA 2PW2B 3K0WA 2AGJL 4RGNC 2DAVA 1WITA 4IDJH 1HXYA 1Q1JH 4TTGA 2NY5H 4X4XB 4N8CH 1IGTB 4EN3D 3U7WH 2H8PB 4JRXE 1DUYB 4YFLF 4U1JA 1TVBA 2EDQA 3B4NA 4U1MA 2IQAA 4HDIA 1Q9OA 3F7VB 3FRPG 3W82A 3LHPL 2E7LA 3CK0H 3IXTA 1QZ1A 2CKBB 4J3XA 1GSMA 3SOBH 5HJ3B 4LOUC 2B4CH 2DD8H 3PGFL 2GAZB 1T22A 3FO0H 3I2CL 4DVBB 4KKLC 4JFXB 3T4AA 1KGCD 1EERB 3X14A 3UMTA 4NOFA 5DEGA 5BVPL 3HE7D 4HJGB 3MCLH 1ROWA 3VGEA 1RJYB 3UPRB 4YFLI 5E2UL 4BYHA 4OZGF 4OLXH 1CFNA 4G5ZL 3TP4A 5IT2H 3AY4A 1OOAA 1SVCP 3QUZD 3PJSB 2GQHA 1SM3L 3ZT7A 4GAJL 1I3RA 4XH2B 5IHZB 4P23A 1XGTA 2QSTA 1Y0LA 3HZYA 1OM3H 4X6DF 3JTSA 3WV0A 2J6EH 2NMSA 3BKYH 1HN1A 3HC0A 3V4UL 4L4TA 5JORB 2ARJA 1YY8A 4I18A 1URLA 4JFDE 4QXWA 3V0WL 4YFEA 2IBZY 3QUYD 5J6HB 4HIXL 4HUWA 4PRPD 1TNMA 2CKNA 3QZWB 3F7YA 4NKIH 5DVLA 2HTLD 4O2FA 4FOMA 5ESVB 3QO0A 3RJDA 4CN1A 2WBJB 5DT1H 5J8OA 4TNWK 3ARGC 1NAKH 1H0DA 4E41D 3DVFA 4Y4FC 3W81A 1FFQA 1X5GA 2I9TA 1NUFA 2VDRH 2EYTA 3A6BH 3U4BL 5J56B 3X13A 2LU3A 2ZUVA 4MQ7B 2P42B 2FR4B 4CADA 3LQZA 1AXIB 1LE5A 1U58A 3D69B 4ODXA 5F7LB 5FM5M 3IAQA 1UCTA 3MOBH 4RA0C 1EFXD 2BSSA 5INDB 4LARH 3CLFL 5CD5C 2JK5A 4U3XA 5JQHC 2LAGB 2X10A 4Q6IC 5DZOA 3MOAH 4K2UH 2VDOL 2AQ2A 3S36X 3GNMH 4QNPF 4PJBA 3CLEL 3MLWL 3QHFH 2BSRA 4PRIE 1XF5A 3QIUA 5IB4A 3ZE1F 1VGEL 2X9YA 3VG9C 1FL3A 2Q76A 3MV8E 4D0BA 3QEHB 3D0VB 3FL7A 1S9YB 4NC2B 3OR6A 1DE4B 2OS7A 2X4NA 1M05A 3TA3B 4JRWA 4Y7MA 5DRWA 3GMLB 3KXFA 3RTQD 4HS8H 3K2UL 3FO2A 3GIZH 4IRSC 1MJ7L 3QAZB 3T0EB 3ETBF 5FCSH 4EVNB 3TIEB 4YK4B 1AXSA 1OAZH 1UENA 4LAJH 1IKFH 3VXSE 4Y4HD 4OCLC 4BFGA 5L88L 3REWA 5ALCH 3BP5A 3G6DH 4PJ7F 1CGSL 4XI5D 1IQWL 1MFDH 1A64A 4NN7C 1P7QD 5MP6H 1U3HC 1AQKL 2P7TB 5DSCA 1IAII 1XGUB 1XGYL 4L3AA 3ILPB 2BOCB 4GFTB 1XCTA 4EIGB 3OPZL 5IQ9A 4YPJA 3MLRH 1SY6A 1MHCB 5C0GB 4H88L 3MRRB 3QDJA 2CD0A 4GMSL 3RPIA 3JWNC 4GBXA 3RWJB 3C8KB 5MERB 2J8UA 4HUKB 4G8GA 2E7LC 4LQ1A 8FABA 2XWBB 3OR7B 3OKKB 1EJOL 2XTJB 2ORBL 3QULB 5AUMB 4G9FD 5IMKB 4OZIF 1CXHA 3T3PE 3CU7A 1F3RB 5K9KA 3RWCA 1MJJA 4OGAC 3ROLB 1ZGLM 3MRIB 4N9GB 1I7TA 2F54E 5D1QB 4XMPH 3OKEB 1QKZH 3LN4B 4JFEE 2EO9A 4F33B 4NHCL 4M61B 4NKMB 2W92A 4YHKL 3IDJB 3LKRB 3AY4C 3JTTA 3KPLB 4FFYH 5DJXB 3NZHL 1DFBL 2G9HA 4CN4A 1IGFH 4TQEL 3D87B 4WU5A 5BRZE 5D2LA 1N64H 1RZFL 2F53B 3LEXB 4P23C 1IQDA 3QI9A 3QRGH 4E9LA 1DQQB 1OAKH 1TJHL 4OF0A 1AO7A 1GZQA 2APVA 3BDYL 3ULUE 5DRNA 5SV4A 1ZTXL 2GKIA 2ICEA 4XPHL 1BX2B 1OSPL 3WLWD 4CVXB 5KSAD 4I18C 2GJ6A 5BOPA 2ESVB 3VFSA 2B2XL 5CIPA 5DFVD 1QUNA 1KIRA 3WNNA 3W2DL 4UV7H 5CP3H 5I1HH 1O0VA 2C4FU 2VDMH 3MV7A 4YBQD 4LPXA 1A6TA 3N85L 4R90L 3CVHB 3FT3A 3ULVL 5GZOC 3BJ91 2EXWC 1HCVA 4P9HH 5ANMB 5I1GH 3EJYC 4FXKB 5I8EB 3GM8A 2GK2A 4KDWA 3H9HB 3UO1L 2CQVA 5IV2B 1RJLA 4LSRL 4ZDHA 2J4WH 1WBZA 1KPUA 4MJIA 1IAIH 2W0KA 4M7KL 1TVHA 3O6ML 1BFVH 1NAMB 5H2BA 1XMWA 3RWHA 4ZXBA 5GS2H 2Z31A 4PJCF 5BW7A 2G60H 5FO8A 3HFML 2PYEB 3BPCB 2HFEB 3G5VA 1VA9A 3DVGA 3RUGA 1JL8A 1AHWB 4OTXH 3QG6B 4XP5H 4E5XB 4JFFA 1D5IL 3FB5A 2C4FT 4WWKA 4FMKA 1EGJL 1W0WB 3U0WL 1JPTL 2AK4D 5CJ5A 1RZIB 1F8TH 1EAPA 5I1JH 2H2SD 1YMHA 5FHAL 1OSZA 1FO0L 4M1GH 4K8RL 2E27L 3E0GA 4N0RA 4JZOB 4U3CA 1MI5E 3OKLB 2L7JA 2PNDA 3TBSA 5T33L 4YXLL 2BSTA 4OFDA 5ESAB 4FG6D 3KPSE 4PJ5D 5M7QA 3VDAA 4C55A 5IW1A 1FIEA 2IH3B 3CVIL 4MXWH 2Y5EA 3PL6D 4OGYH 3DURB 4IMLA 4EN3A 3RL1A 2XWJA 2OI9B 1T1ZB 4LASH 5GGRY 2HH0H 4P46D 2CRIA 4U4BA 5KANG 5DD5L 3RQ3A 3TWCH 3W11D 2C3XA 3LEVL 1KJVB 5F9OH 1B4JH 3CZFB 1N0XH 4U7KA 4DEPB 2CR3A 2Q1EA 4PB9L 3O3EA 5D1ZD 4K7PY 4POUB 5BO1H 1NL0H 5DHVH 4O2EB 5T5FL 1DBBH 5AD0A 2VDNL 1ZANL 4CNIB 4G8EA 2B1AL 4LVHB 2HFGH 2XYCA 5I1IH 3FOLA 1UJ3B 1E28B 1BD2D 3X3FH 1A7RH 1AGBB 3U83A 3HE7A 4PRNB 3L7EA 3FT2B 3T0VA 1VKXA 2A9NH 4TVPE 1G1CA 1IT9H 3TT1L 4NQUA 4MNHB 2J1KA 2KH2B 2VXUH 3BP4A 5KBNC 4I3SH 5SWSD 5KS9E 4R0LB 5KW9H 25C8H 3UZQA 3ULVF 4X99B 3JWOC 2ZOKA 1TPXC 4JRXA 5GGQH 3CDCA 4XVTH 3KPOB 2DQDH 5CKAA 4OF3A 1FPTH 4GBXC 3ZSTA 5JMOC 4JZJB 1Q9WB 3WXWL 4TUKH 4W68A 1OP9A 4QF1B 5I76B 4HGKC 43CAB 2F8OA 4BUGA 1HSAA 1K4CB 4YC2C 5BMFH 1FRGH 1A7OH 2DQTH 3CH1B 3NFNA 5DD6B 3FTGB 3QUZB 3UTZB 4N0YL 4NBZB 1GC1L 3NVQA 3QUYA 4AENB 5GS0H 3HG1D 3O8XD 4PRPA 4UT7H 5CUSH 3UTTD 4KDVA 1EHLL 2VWEE 1MFAL 1MLCA 3P0GB 4ZFZB 5FYJD 2I26N 3L3OA 5DI8A 4HMEA 4R9HA 3RAJL 3VWJD 5ILTH 5ID1A 4WU7A 1A9EA 1U8JA 2CKBH 5E2WH 2A0LC 4GQ9L 4JO1H 2N4IA 3UJIL 2W0LA 4XP4L 4QTHA 4E41A 2X9XA 3UJJH 2OTUB 5F71A 3MLTB 3QI9C 3ZYOA 5F7DA 5E2VH 1FJ1A 2HFFB 4JM2F 1EIBA 5GRJH 3DMMC 4WVRA 1LO5B 3MRHA 4RQQB 3WYRA 4PV8A 4U1HA 1U2CA 4HZLB 4MA7L 1F3DH 5EA0H 1T7WA 4JFDA 5D4QA 4XP9H 1QP1A 1C5BL 1Q0XH 2BVOB 3TLRA 1MHPH 1EFXA 2HVKB 3IETB 4GW5B 4HIJB 4KK8D 2VLLA 1PLGL 1CL7L 4X7TB 1B2WL 3TC9A 5B3JF 1J0ZA 1KCSL 2CUIA 2EYRA 2V7NB 4U7SA 3L5XH 3ZKND 4W4OA 4FFVD 4HG4J 3TBYA 3WDIA 2DOCA 3FMGL 3RIAF 3BKML 4OBRA 2YUVA 4YHPB 3T65B 3P30H 4W6WB 3EO0A 2HT4D 2FIRT 5K93A 2IMNA 4HCRH 4HV8A 5IGXL 2BMKA 2YPLB 4NC0B 2BDNH 2VLRE 4J8RB 1QSEB 5GZND 5E9DB 5CZXD 4A6YL 5IB3A 4NCC2 4KQ3L 5BJTA 1A7NH 4ODHL 1J1XH 2Z31C 4JO3L 4OM1L 4Z7VA 5BW7C 4KKCC 2FX9H 2F74A 3RTQA 1TZHB 4YHLH 4JHWH 4KJWC 5JA9A 3EOTH 3B2UC 1PDKA 1TXKA 5MHSE 2DWEB 3KPRD 1KJ2B 2KDGA 2AAVA 3RWGB 4WWKC 1Q0YH 1S7QA 2HLAB 1MAMH 2QQKH 3U79A 4Y4HA 4PGJA 2ZWLT 4K9EL 3BD4A 1GVIA 1SJVA 1ETZA 4PRIA 5EZIH 4XPGH 1CZ8H 3P40A 1T4KB 2OP4H 5KOVC 4DKAA 1OAXH 4I4WB 5IK3B 1G0XA 5IB5A 5HI5D 3MV8A 1P7QA 2X4PB 4JG0L 3S5LG 4N8VA 3EHBC 3HB3D 5IKCB 1BEYL 3C5ZD 5HYSA 4I3GA 4Z7WE 5AG9A 5BS0B 5AZ2H 4Z95L 4QWWC 4KHXH 1H5BB 4Y5VB 5KSBB 1KNOA 5MHSD 4DCQB 3MRCA 1EUTA 3CCHA 1XCQB 3TZVD 1MCFA 4NHUA 5J3HC 4JHZA 3I50H 2V7HB 3C9NB 4NSKB 3BAEH 3K8LA 3MODL 5D7JD 5TDPB 2MNUA 2BOBA 5E0QA 5I0ZA 4G9FA 4QOKE 2IWGA 1EHXA 1T5WB 1BQLH 2IPKB 4RA3A 4F3FA 3WFEH 4K3JL 3W9EB 4X6BB 1FBIL 1S7SB 2V2TB 4EQ3A 3LS5H 1IC1A 5DFWH 3O6LH 4HUNB 5F3BB 2J88H 4WFGD 4QHMA 1ORSA 1FYTE 4IRJB 4ZAKB 3DGGA 3O45B 3CJJA 4FRWA 1JI2A 3R06A 1S7VB 4G42B 4P4RB 3O3DB 1CU4H 1G7JB 1X7QA 3BVNB 2FH8A 4LCWD 1WFOA 4ZTOH 4KI5E 2A6KA 3QDME 4JRYE 5C08D 5D5ME 5EZOH 1TQBC 3MOQA 1S5HB 3WS3B 3QIBD 1DEEA 4MSWA 1P4BH 5GGVY 5CAYB 1GL4B 3PDGA 3KYMA 4GG6E 4NRYB 1VHPA 3ROOB 1JZ5A 2YSSB 1AD0B 4YHZL 2F8XC 4H8WL 4QOKD 2ADGA 4L9LB 4V1DB 1EHAA 1T0MB 2A1WL 1CL7I 3BUYB 4M48L 5DJCA 2GK0A 3ARTA 4UAOB 4RGOL 2HTLC 3MRQA 2CRZA 3LKNA 5LVEA 4K71C 4I0KA 4PRHD 5HI3C 1G7PA 1P84J 1EO8H 3GHBH 1HDMB 1AXTH 3WL9B 1C5DA 1HE7A 2XNAB 3UJTH 3ELAT 5CJQH 1ZSDB 3S96B 3QDGB 5GGUA 7CGTA 5F1IA 4N1EA 5HVWA 1RZGA 2FJFB 5ID0A 3SE3C 3PIQA 3U0PA 3FN0H 4ZFOA 4MAUH 2EE2A 2YPVH 3OF6D 4ODSL 2J5LB 4C83A 1QSZA 1OPGL 2F19L 3VMPA 1RZKC 3RGVA 1X5XA 4L3CB 2A6IA 4EUPH 4L29B 4C56D 1WBYA 2R1XB 1MFBL 4OT1H 3TBTB 1XGPA 3LQAC 5C2BH 4M8QA 1TTFA 1I4FB 4ETQB 1BBJB 1MHHA 4KQ4H 2YK1L 2ZSWA 4TNVF 2XA8L 4YUEH 5HSFA 2MQ0A 4U1LA 4W4OC 4GUPA 1CDUA 3T2NH 5I8CB 1IZJA 4H1LA 5EIVA 2AK4A 4X8XA 2JJUA 4NT6A 1OGAE 3PHQB 5C0CE 5J1SC 4R4FL 2PYFB 1HNGA 5IF0A 4NQCB 3K80A 3LKQA 3DGCR 4PJAF 5MEOB 3V0VA 1DQLH 3AMKA 3CVHH 2JJVA 3Q6GH 2JB6A 4P2QD 4MA1C 3PNWB 3MRLA 1KOAA 4O5LL 3AAZB 2XPGA 3ZDZE 1TJGH 1M7XA 1MAKA 4JY6A 1V3LA 2EH8H 3DHMA 3PL6A 5E4EC 3S35X 1L7TH 3RTQC 4Z5RB 1OTTD 1VACA 4P46A 2OL3A 4S0SD 3GK8H 2NX5E 3GSVA 3VWKD 4NBXB 4PJIE 3REVA 4JN2A 4J3TA 4N0UE 1NAMH 2EIEA 3K1DA 1CLZL 1QYGH 3LV3B 4LFHG 4MCZA 4NJAL 4XPBH 5D1ZA 3W39B 2B7DT 4QRPE 1H15B 4KZDH 1CI5A 1DANT 1DVFC 5DVKA 1T03H 3IDNA 3C5SB 3NABH 1AR1C 1U8IA 3HMXA 2BNQB 1QLRA 3KPSA 3O3UN 1RIVH 1S9WB 1UWXH 4WUUE 3E6HA 1F3JA 3SY0B 1MF2H 4PLJD 5I1DB 1YMMD 4I0PD 4UMGA 3V8OA 1L6ZA 5CBAB 1BZQK 2NX5D 4PG9B 1NBQA 5BXFB 2WW8A 4QRQB 4JPVL 3LRSB 4HIHB 4KUZH 4XZUA 2CDGA 1UWEH 1RZ7H 1BD2B 4NJ9L 1CDBA 3PWJB 1FQ9C 2NY4B 1E6OH 4OZFA 2YXMA 3SCMB 4G8IA 3O3AA 4F37F 4J6RL 3DIFB 4XMKH 3SE9L 1C08A 4QXGL 5INCB 2ADJA 3SKMA 1HYRC 5KG9A 3MYJA 1ONQB 1DBKL 2AJZA 3VXUD 1PJ9A 4JHAL 4X98A 1II4E 1UFUA 1ADQA 3BDBA 4LSPL 1RZJL 5E8DL 4G9DA 3UTTA 4M9OA 4F2MB 1JZ4A 1KN2L 4EKXA 5GRZA 1RUMH 2V17L 4LVNB 5EUOE 1JGEB 4Y4KD 4M7LL 3WIIH 5HHOE 3VWJA 4D2NA 5KS9A 1KB5B 1NQBA 2GCYA 2AXFA 3C6SB 5IBTH 2HRPH 2KQNA 2CIKB 5LKNA 2VQ1B 2V9RA 3O2VH 3WUZA 4Z77B 5FYKL 4JLRB 2X4RA 3BMWA 3WIFA 2SEBB 4G3YH 4BH7B 2NTFB 5E1HB 3QJHB 3KG5A 3S7GA 2QBWA 5DMIH 1J1PL 1U2HA 1B9ZA 4Z0XB 5I1EL 5J6GB 3ZYJA 4EXPX 5CHNB 4UI2A 3WLWC 1MFEH 1ZS8A 1LMKA 4N0CD 1KBGH 1ZGLB 1IC4H 3VI3F 3PV6A 1UB6B 1JYVA 4PUBL 1IGJB 1QR1A 4JZNA 1KTKE 1MWAL 2B5IB 1OD9A 1F90L 4MA3A 5L9DL 4OLVH 4YBQC 5DR5H 1CIDA 5ADOH 4YR6A 4GG8B 5KVEL 5HHOD 5JHDE 3SDYH 4RCAA 2DQUH 3O6KL 5T1LD 5HYJB 1WCQA 4XHJD 3ZE2F 2GUOB 4GKSA 1N6QL 1FGVH 2XY1A 1GGIH 3DROB 3KR3H 4ODTH 4N5ED 1UXSB 4O2CA 5GJSL 5EO9B 4OCXL 2DL9A 5FYLD 3ULUC 4WRLA 2XKNB 3RHWF 4RFNB 4PY7B 1UYWH 4F15C 3H7LA 5I1CL 4XNMB 1XR8A 1U8HB 4NQEB 3RGVC 3WUWA 4ZS6C 3PWPB 3EDJA 3G6JF 5B8CA 1QFUH 3BP6A 3E2HC 4ZO6A 4MDIA 1MPAH 3PQYD 4WFHE 1JF1B 4YHIA 3KPMB 4KHTH 3SDCA 2ATPA 2E5EA 5A2IH 4APQD 4U7MA 3OKDA 1C5CH 2AW2A 3D3VE 3MV9B 4HKXA 3K81A 1HXMB 1BAFL 4U1IB 1J0JA 1CBVH 4Q2ZA 4DN4H 2H2SC 3EYFA 3V9FA 1IGYB 3KPPA 5CBEB 4FNLL 3M45A 4GRWF 1DBAH 3QUML 3ULSA 4ALAH 5C0RH 3CIQA 1A7QL 1NKOA 5EOTA 4FG6C 3MRGA 5L2KE 5A3ID 4M43L 3U6RA 3D39B 5HHME 2VZVA 4NO5A 1WAAA 4JY4B 3DX9B 8CGTA 1D3CA 1F4YH 5F1SA 1A6UL 1ND0A 3ARUA 4P46C 3ARDC 1E0OB 3P73B 4KUCD 5HBBA 4O00A 1GGYA 2BY3A 4HHAA 5JOFA 2K1MA 1XF4A 3DX8A 5A2KH 4U31A 4WTZA 1MY7A 2ICCA 5D1ZC 4LHUD 2HJLA 2WIIA 3VJ6B 1T2JA 1TJIH 4JREC 3QPXH 4X9IA 4L3EE 4ZMAT 3IT8D 3U7YH 4X9GA 3UX9B 5HVHC 1A6AA 2FX7L 3HI6L 1CF8L 5GXBB 2JELL 1KJ2H 2HLFC 5EB9A 3OWEA 1E4WL 2X4TA 4JKLA 1MCQA 3T4YA 2AJSH 5E8EA 1F11A 1T1XA 3HLAA 5K9QG 2NLJA 4ZS7H 3WIHA 3ARZA 4YDKL 4JVUA 2F9BT 4Z7WA 2Q7NA 4XVUD 3VXNB 5SWZB 1FNHA 4PS4H 2YD7A 5TE6L 3U0TB 4LCWA 4PGBA 4L4VD 1T66D 1VSCA 1IGIH 1WIPA 3MJ9A 4ODVH 3ZDXF 1LGVA 1V3MA 1GGUA 5F7FA 2Q6WA 2Q8BH 4OZGE 5C0IA 4GKZB 2HTKD 3EGSA 5HVGB 3MREB 5GISH 4JFHD 5C2UB 1OAYL 1RHFA 3ARGB 2QADC 3MJ6A 3QQ4A 2A74B 1J8HE 5E95B 3EDDA 1R5IA 4QOKA 4FFWC 2V9TA 3I3BA 1RV6X 3L5IA 3OKMB 5DS8B 4OUOA 4HXAL 1Y18B 4X6DE 5I73B 4NRZA 3WKMH 1FYTA 4AG4L 1NCTA 1ZGLP 1I1CA 2EEBA 5K9JH 3QCTL 3SDXB 5E08H 4MNGA 2Y4SA 3DBXA 5J4MA 3BMVA 3QDMA 3C09B 2YWZA 5D5MA 4PJ9D 4ODUB 1QVOA 4FQJH 3C8HA 3QJFB 1OD7A 3BGFB 3OF6A 4Q6IB 4F7EA 3O2WL 4PJHF 1MJUH 3PDOB 4GG6A 2ICWI 2OTWA 1G7MA 2VAJA 2D7PA 4C56A 2RFXB 5HDOA 2VN7A 3S34H 3PP3H 1CLOH 4HSQA 1A0QH 2XXMB 2VWEC 1H3PL 2HN7A 4LDEB 4KK8C 3HZKB 5T3XE 2NY3C 1QPPA 4WEBH 5E70A 4X4YA 5ICZA 1WZKA 4GRWH 1JGLL 4QGYA 4NFBA 5MI0C 1WV7T 1EEQA 4NQSA 4G80A 4MLIA 5GSRB 3BHBA 2R4RL 4IHOB 4ZSOA 3IF1B 3ARFB 1BQHG 5IP4A 4IRSB 5FFLA 4JO2H 4ZUSA 5HDQL 2UVEA 1GPOH 3BN9D 3H42L 5CGMA 4WEMB 1U3JA 5AYUH 3GB7A 3I3DA 4QRRB 5TJWK 1GZPB 1KEGL 1PG7H 1DQJA 4NO0B 3UP1A 4QNPE 4H0IA 2PN5A 2XZCH 3FB7A 1UC6A 3LB6D 1RY7B 4KVNL 3NZ8B 1HOCA 4KRPB 1JGUL 3MXWH 4OM0H 4DWHA 5TF0A 3ZE0F 3ZE1E 3IDUA 3SDCC 3NPZB 5JW5B 4FQQB 3BWAA 4M6NH 1T20B 3G6AB 1U3HB 4Y88A 5I8OL 1OT1A 3SDDC 3MV11 2P5WE 4FQCL 1HXYB 5LCVL 1HYSC 3X3GL 1NC4B 3L3IB 3IFNL 4M3JA 1OGAA 2R2CA 2XACC 4U1JB 3PV7A 4XTRC 1TVBB 3KPQA 2NQCA 4U1MB 2IQAB 2WIMA 4HDIB 5HI5C 4P4KD 5I16B 1NMBL 1CLYH 1TZIA 3HA0A 3HB3C 3R0NA 4G7YL 3EZJB 3LS4L 1BIHA 4CMMA 1TETH 4ESKA 4PJ7E 3T4AB 4DK3A 2NX5A 2AJ3B 5D2NA 4PPTA 4PJIA 3OSKA 3HR5B 5FYJU 5IESL 1P4LA 3B5TA 3CDGB 5DD1L 4GXUM 4N0UA 3BESR 4L8DA 3ES6B 4Y2OA 4R4BA 5IFAH 3QEUA 1KTDA 1M71A 3P77A 1I8KA 2XZQH 12E8H 4YDJB 2WZPD 2DDQH 2CLVA 3LKOB 1I3RB 4ZTPL 3S88H 1FL5B 3VXUA 3QEQB 4NQDE 4P23B 5DUPH 5DMKA 5E4IA 1O5DT 1Y0LB 3HZYB 3JTSB 2BCKA 3B8SA 2X4QA 4MA8H 4Y4KA 4NBYB 5C1MB 3HC0B 4P3WA 2ARJB 3UZVB 1NCCL 1YY8B 1V05A 1T21B 3S5LB 2GJZA 3RWEA 4PTTA 3L6FA 3NIDF 5JR1L 1QRKA 4GH7B 4O2FB 5DK2B 4BZ1L 4MCYA 4ELMF 4Y2DA 3D85A 3VXOA 4H1LG 4OZHF 4UUJA 4PJXA 1S9VB 3IDGA 3QO0B 3SO3C 1NJ9A 1FGNH 5D96C 5BV7C 4OCRL 5A2FA 4KK9C 2IEPA 1U36A 1TTUA 1Z0NA 3I6GA 3Q5OA 2EYTB 1LP9F 3PABA 3SQOL 4HKZA 3N1PC 1IC7H 5DLML 4AT6A 5EUOA 3Q48A 4JGJA 2EKSA 5HHOA 5IM7A 1Z9LA 4OD3H 1I7ZB 4FP8L 4OQTA 1U58B 5T1LA 3EDEA 5E8OA 4JVPA 5FDYA 2XOTA 3N06B 4OF5A 2R0WH 1GOGA 1M6OA 3BEVA 1P2CA 4KI5C 2Q8AH 4K3DL 4ONGL 5C0FA 5LGJA 4OB5H 3CSPA 1BJ1H 3B43A 5FOBA 4L8CA 5IB1A 3BZ4B 3V6BR 1YEJH 2PR4H 5CJXA 4KK5D 4MQXC 3C60D 4ENED 1T6VN 5IHUH 3LEYL 1YEEH 2ZSVB 5C3LD 4LLAA 3OBAA 2GEEA 4YGAB 2BSRB 5DDHA 1AGEA 5IB4B 1FL3B 1QQDA 4J7RA 1LK3H 1X5LA 4TRPH 3OGCA 4ORGA 4APQA 2H32B 2X4NB 3OTTA 1M05B 4HK3N 4IIQB 1B0GA 5DRWB 3FFCB 3U1SL 3TO4D 1S3KH 2J8OA 1FG2B 3FO2B 3NPSC 2GTZA 2V5SA 4PJCE 5C09D 1IM3A 2AJUL 2AJXL 2NXYB 5GGTL 3HPLA 4NPYA 5BQ7A 1OLZA 1G9MC 2JJSA 3SJVE 3WFCH 3F58H 3MXVH 3OJDA 1O7SA 3BPOB 1MREL 1AI1H 5ITFA 2DI8A 1PKQE 2Y72A 5IUSA 4QTIL 3REWB 1ZHNA 4WFED 2X70A 5KVGL 3O3BB 3SPVB 5H94B 4LNRA 4NN5C 1D5BA 4ERSL 4GKNB 4WCYH 1JTPA 2HRLA 4H20H 1XCTB 4LHUA 4CMHB 5IQ9B 1LEIB 1MIMH 5F8QC 1INDL 1TPXB 5ITBL 1UXWA 2E9IA 1NCUA 3H7BB 3QCUH 4GBXB 5BZDB 3RBSA 2EIDA 8FABB 5L2KA 1PD6A 3IFOA 4Y16D 5T5NG 2NNAB 2BNUA 2P5ED 3INUL 3LIZH 32C2B 4P99A 2PO6C 3BH8A 3C08L 4X5WB 3OZ9H 5E8NA 4JFYA 4GXUN 4JPKH 3G08A 3RWCB 4UDTA 1MCHA 1I7TB 1A1OB 4G8FA 3B3IB 1E4XL 4GRLD 5FM5O 1ORQA 4HBCH 2ZUUA 2E6QA 4KMLB 1F6FB 3QHZH 3GZKA 3CFDA 2VZ1A 3TESA 1PZ5A 3QRFM 2G9HB 1HWGB 3ULVE 4KXZH 4WU5B 4L3EA 4OD2A 5C92A 5DRZB 3DMMB 4NGHH 5E6IB 1G6RA 3MR9A 3HZMA 1VFUA 3WNMA 1C1EH 4Y4KC 2ICEB 3VGDA 3LRGA 1K3IA 1MSPA 2HJKB 4U2YA 4OF6A 2QSCL 3ZKSD 1OHQA 5CIPB 1FFOB 1RD6A 4NWTH 3I6KA 1ODAA 1KIRB 5JDSB 2VZTA 3IFLH 1R3JA 1X5HA 3MV7B 5C9KA 4Y2DC 3GSWB 1A6TB 3FHQA 1G7IA 4CL7A 5GJTH 1Z3GL 4PJ9A 3EYOA 3QIWD 1ZT7A 1A2YA 3PXJA 1FLTX 1E6JH 3M8OH 1J8HA 4N0CC 4D9QD 1BFOA 2CMRH 3NA4A 2A6JA 4LKXA 5FKPA 3IFPB 3NOIA 4QO1A 3VXRE 4ZDHB 1WBZB 4MJIB 5FUCE 4X4ME 5ETUB 4PGCB 2WV3A 4X6DA 5GRVK 3HCVA 1TVHB 5MENE 3WFBH 4LLWA 2YN5A 5T1KD 5T3ZL 1QBML 4DZBA 4M1CC 4LSSL 3AXLB 2AXJA 2AI0H 2Z4QB 4N5EC 2VLME 2ERJB 3K3QA 2FATH 4X7DC 3HPJA 3G5VB 5EIIA 5HYFA 1FLRL 4FABL 5B3JE 2VXSH 3WNOA 4AL8L 5CJXC 5E7FA 3FB5B 4WWKB 5I1KL 1KFAH 1EX0A 4PJEF 2QJDA 2D2OA 4JB9H 1YMHB 1OSZB 4U6VL 1KLUA 2IH1A 3ARXA 5F7KC 3RGHA 4YWGL 3EAKA 1QSFB 1S7TA 4XPFH 3K8MA 4U1NA 3TBSB 4K8RD 4LAQH 5DD3L 3V52L 2BSTB 5MEND 4P3DA 1UA6L 5CINH 4APQC 3L3DB 4KC3B 2FHBA 2JJTA 2ADFH 5JMRA 4KTDH 5DURB 3IDYC 4LCUA 4EI5A 5IG7B 2XWJB 2VIRA 3P0YL 1V7MH 2JIXB 3I6LE 3V7MA 1SY6L 3QWRA 1I7RA 4WI3A 4NZTH 1LD9B 2RCSH 2JJSC 5K9OA 3MX0A 4P4KA 5DK0B 5DQDL 5EOQH 2XWTA 1GOHA 3THMH 2ED9A 3UEZA 2O5XL 2R39A 4G8EB 5E2TH 4M5ZH 2NCMA 4X7CC 3C6LC 4R3SA 4HKJA 1E4XI 4OV6F 1FNGB 4NM8L 1VKXB 3LKSA 4QHLB 5GGSB 2NY2C 1PEZA 2DKUA 5A2JH 2OMNA 4QCIA 2DL2A 4B7LA 4JRXB 5BVJA 1Q72H 4NQXA 2VDLH 1CXEA 1DQDH 4GXVL 2N56A 4W70A 3M1BB 3DX6A 5FF6A 2ZNWA 2Y36L 4PJBF 4UNTA 1TQBB 1J0IA 5DJ6A 5JZ7D 3EIFA 5C0BE 3IVKB 5JLZA 3R4DA 1MRCL 4UV4H 3GBML 3VFNA 4WW2A 1KN4H 1KPVA 2BJML 4DUVA 3BD5A 3NFNB 4J12A 4UINL 2R2EA 4Y1AD 4XVUC 3DV4A 2JCCF 2A77H 1HHJA 4BZ2H 1HNFA 1JV5B 4OF8A 1A9BA 2A2QT 2LU7A 1T66C 2L0DA 4KJQC 5JXED 4K71B 4O02L 4TUOB 2MHAA 1SEBB 1U8JB 5JTWA 3L7FB 1BBDL 1PFCA 4BSVA 4FQXD 1R3KA 4QTHB 3RDTA 1P69B 1AGFA 4HX1B 2AXHA 5C0AB 4ZO7A 4BELD 2CIIA 4NQDA 3MA7A 2X1QA 3HNSH 3TYFA 1BVKA 2PF6A 3CFJB 3PF2A 5EU6E 3MGOA 4PV8B 5EU4A 5D7SH 5GHWH 1RHHB 5GGRA 1MCBA 5M95B 1IM9A 1MEXL 4U1HB 3G04A 5F97E 4XGZA 4S1QL 3QFJE 4JFDB 4V2CB 1PG7X 4I77L 5JW4Q 2XZZA 1YECH 1JZ2A 4AEHL 3B2VL 2VLLB 4Y19B 4PP1C 5IVXF 3ZTJG 1FHGA 2YWYA 4LIQL 4PJ9C 1UT9A 2EYRB 4RGMC 1CS6A 1DLFH 4X8JA 4NNXA 4P2RE 1YN6A 2D0FA 5E1AA 4Q9CA 1T83A 4Q9QH 2R2BB 3CMOH 2P24A 3FQXB 2J8UF 1BM3L 1UG9A 1BZ9A 1FVCA 4MJ4A 5FK9A 1F5WA 1LEKA 5F7WC 1WIUA 3MBEA 3D18B 3RFZC 1U8NB 3HI1A 2I60L 1NBVH 1BWWA 3HC4L 1LO2H 4DKEH 3OKNB 1NBZB 3SKUD 4ZPTA 5HXMA 2C9AA 5EOCH 5DRXA 2AEQH 1OVZA 3TO4A 1CLCA 5HHNA 5IHLB 4AM0B 5H8DA 3AVEA 2OTPA 3LY6A 3VI4F 3IDXH 1F58L 4YNYB 4WDIA 1VCAA 2DTMH 5F7HA 1YQVH 2RHEA 4M02A 3FONA 3HUJF 2E7CA 2AABL 5IMOA 4NUGL 5D2LF 1S7QB 1A7PL 4EI6A 4UQ2A 1BPVA 4ELKA 2B0SL 3ARRA 4WIQA 3TCXA 2DBJA 3BO8B 3LB6C 3QUKA 4PRIB 4UTAH 2IBBA 4TSBL 5J11B 1DVFB 3LH2H 4P49A 4KY1L 4U6YA 4HFWA 2DQEH 3BWUC 4CU6A 5JUEH 5KSUA 4XNUH 3MV8B 4JEGB 2JJTC 3MUJA 3SGEH 1JZ6A 3LZFH 4N8VB 3T1FA 2DYPD 3BD3A 4PJGE 2PCPA 4HGWA 4EI5C 1JWSA 2VXTL 5HYSB 4RMRA 1UZ6F 3W0WE 1AD9A 2CXGA 2M26A 4MAYB 1QBLH 2J2ZA 1V3JA 4UIMA 1BOGB 1KNOB 1F4WH 4U1GC 1KIPB 1TITA 3MRCB 3CCHB 3SJVA 5ICXA 3TN0A 1BQHB 4NHUB 1G0DA 1UVQB 2IALA 1UM6L 4D9LL 4QY8A 3VXSB 2H32H 4Y16A 5AZEH 1OP5K 2BOBB 1PKQA 1XGRB 4I2XA 4JDTH 3O9WD 4MS8C 4XVSH 4DGYL 1HWHB 5F7EL 3TT3H 4F3FB 3CUPB 1KENH 4X9FA 1NGZA 4B53A 1KJ3L 3VGFA 1EPFA 4R7NA 3L3KB 5DQJA 1R0AL 3B9DA 1KCUH 4LLUB 2EDRA 4X83A 3RU8H 4R4ND 4QHMB 4PRAB 3ZT6A 2P8LA 1ORSB 4G6ML 1RIUL 2P5EB 2I07B 2BFVL 5EC1B 3RUGF 3W5NA 4QGTA 4M7JL 5F7MC 1KCRL 4PLKD 2DIBA 1X7QB 4HJ0C 3B6SA 2ENYA 3GSXA 5IW3A 3MRNB 1B88A 3CXDH 4BKLA 4EIZC 1M7IA 2XZAH 5I74C 4MSWB 1NCDL 3KYMB 4PGDA 5C9JA 1DBJH 5CJOH 4WW2C 5DVMA 4L8SA 3VGAC 1C12A 3O6FA 1CTOA 3JWOH 1OCWL 1N5AA 1K8IB 5D70L 2QQLL 2D4DA 1CDGA 4GW4B 1HHHA 3KYKL 4LGSB 4NNYA 2F54B 2NY1D 3LQAL 4JFEB 7FABH 3MZTA 5HD8D 2X40A 2FO4A 3FFDA 1KC5H 2R1YB 3QIWA 4O9HL 5HGHB 1X5ZA 3NCJL 1FNLA 1HEZA 3RDTC 5T1DL 2DF3A 3SE4A 5BRZB 4WI6A 4FTVD 4AIZB 2XRAL 2X6MA 3BIKA 1RZGB 4DOHE 4GSDL 4GS7C 2OK0H 1HH9B 3MQIA 3DARA 5DMYA 5LG1A 3CFBB 5CEZD 3U0PB 2QQNH 4S1SL 3K46A 4ZFOB 1H9VA 4LKCB 4F15B 3VFGH 1CGWA 5D7IA 1MOEA 4DUXA 3RGVB 2A6IB 1KUMA 5T1KA 3NN8B 1WBYB 1XGPB 1QLFB 3WMSA 4M8QB 1HQRB 1L6XA 1TCRB 2RBLA 3E2HB 2XXCB 4ONFH 4QXTA 4MNQE 3I84A 3DX7A 1ULVA 1QPXA 4JPIB 5EBLB 1BQUA 4XC3L 3ZYZA 3O2DL 4ENEC 3MJ7A 1T83C 4JR9L 3BXNA 3H9SD 4H1LB 3B8YA 2DLIA 4HK0B 4NC1C 5CIPH 3GMQA 2R29H 3IS1X 3MBEC 1RUQH 3VXPB 3AUVA 4X4MA 3MGAA 1YY9D 4FFZH 4K7FB 1FO0A 3V0VB 4JFZL 1INQB 5MENA 3X11B 4I9WD 4Q6YA 5I71C 1TQCB 3CSYA 1YEHH 4PLOB 4OUUB 2APBA 2D7OA 4JY6B 2D3VA 4RZCA 2WINA 3DI3B 4NWUH 2H45A 5E00B 4YHNA 1EXUB 1OAQH 1VACB 4UOW0 2OL3B 4WENB 3FB8A 3ARDB 5CLWA 2ZCKL 3P11H 3REVB 1AE6H 3W9DB 4UTBL 1ZHKA 4LP4A 3BZFA 2W60B 4KPHH 1RK1A 2JB5H 4IS6A 1RJZB 4YPGB 3RY6A 5AYQA 1NCWH 1UH2A 5F93C 1YDPA 3FQUA 1CYGA 4JJ5A 4HQQH 3QSKB 3MLXH 3IDNB 2DI9A 4F7TA 1MI5B 3IDMA 3TJEL 2I24N 2DBLH 4M5YL 3MBXL 4OLUL 1Q8MA 1BQSA 1MCEA 5I30H 2CGRH 1QLRB 1WT5A 3GO1H 3KPSB 4WJ5A 3VXQB 4X6EB 1RFDL 5E6YA 5D8JL 1J5OH 4NZRH 4XMLH 4BJLA 2NXZD 4RNRA 2HKHH 2B39A 4X5LA 3G5YB 3AS1A 3DUHA 4XP1H 1IEAA 3RNQA 4QRSA 4XNXL 5J13C 3QXUA 4XZUB 3V8CA 2CDGB 4WHDA 1JHKH 1U8LB 1YEIH 2GYSA 5FYKE 3TN0C 1A3RH 3EOYG 1RURH 1DDHB 1QNZH 4Y16C 1AIFB 3GIVB 4G8IB 5TF1L 4JGMA 2H2PC 2ZUWA 1VPOH 4HIEB 4MX7B 5DUMH 1C08B 3SKMB 5JA8B 3OXSB 5KG9B 5DTFA 5C0DB 5MEQB 1YYMH 3GKWL 5TDOA 3BEWA 4KI1A 1J12A 2AEPL 4G9DB 2EE9A 1YZZA 5E5MB 2JTDA 2ZZUT 1CT8B 4LVOB 4UT6L 3FKUS 3ZKMD 3N1GC 4Z7VF 5KS9B 1YEDB 2GCYB 2W9EL 5EBWA 1RU9L 1K8DA 3BT2H 2W0FA 4FQXA 3TM6A 1T89A 2X4RB 4NRXB 3FJTA 3SN6N 1UCBH 1FORH 1I9JL 5SWQA 3AS3A 1S8DA 5DWUL 1UQSA 3EYUL 3O11A 1M4KA 3ZDXE 1C16B 2VXVH 1X9QA 1KB9K 3VW3H 2DQHL 4X6CE 1AP2A 1ZS8B 3PDDA 3V95A 3O6FC 5HHVL 1LE9A 3PV6B 2UZXB 3PWUB 5DVOA 3QG7L 5DXWA 1YEGH 1K85A 1YNLL 1QFWH 1NEZA 4HW6A 4K3EL 3F62A 4WHTB 1DLHB 4EDWL 4YHYC 1L7IL 2PETA 3ARBD 3FOMA 4KFZC 1CXLA 4UB0L 5ISZE 2NY3B 3QIWC 4KKBD 5MI0B 5IFJB 3ULVC 1MRDH 4KJPC 3SE4C 2G5BB 1D6VH 3HZVA 1IEHA 1DL7H 4MZ3A 4BQ8A 4O2CB 4MJ6A 5F9JA 4KROC 4E0RA 4ONHA 5JQ6H 1LK2B 5EU6A 1WZMA 2I9LB 3Q2CA 3MFFA 3MPCA 3SKNA 4OI7A 1W72A 3IXAB 1FC2D 1T7ZA 4Z0BH 2GSIB 4RRPG 4PJHE 2UYLA 3QFJA 4XNQA 5I1AA 2D0HA 4N90E 5HY9B 4P5TC 4MDIB 2HP4A 3G5XA 4S1RL 4YHIB 3JV4A 1DQMH 2ATPB 1KTLA 1KEML 4JFQB 3TH2T 1CG9A 1SYSB 4L8BA 2VJXA 5J12C 3SDDB 3D2UD 2FH6A 1RZKH 3HS0A 1A6VL 1QO3A 2WQRA 1X4ZA 3FO1A 1CDHA 1AGCA 2PTTB 4Q2ZB 3EYFB 1AC6A 3VDBA 4JM2C 1IAIM 2ZG3A 4K8RC 1FN4B 3Q6FA 2VLRB 3MRKB 5EOTB 4HKBA 3T3PF 1Z5LA 3O4LE 4DVRL 1IAOA 3F8UB 3U6RB 5BZWA 2DYPA 4ZUVB 4X9BA 2XN9E 2VQUA 1QA9B 2F58H 5ICYB 1ND0B 3ARED 1AJ7H 1P53A 5C6TL 3K7UA 1XF3A 5CSZA 1KULA 5LQBL 3E3QC 4HWZA 4F7CB 2BP3A 2IG2H 4ZUUB 1XF4B 4FXGB 3RY6C 2NY0D 3IYLW 4DKFL 2WIIB 5E24E 4U05A 2A73B 1KB5L 5IB2A 4NOBA 3DSFH 3ULUF 4KJYA 2HWZL 4GMTH 3O9WA 4JANA 1CD0A 1U6AH 2ZUSA 4LPWA 5DD0H 1A6AB 5D6CA 4R7DA 3HRZB 1WT5C 1ADQL 3T4YB 5DMGC 1EMTL 5E8EB 1T1XB 3GMPB 3HLAB 4PJGA 2FYYA 1NLDL 3CH8A 2Z93B 3W0WA 4OCWH 4EBQL 4Z7WB 5EUKA 2VSDA 5MEPA 3F6IA 3TO2A 3IJYB 1MCLA 4YE4H 2QHRH 4PGBB 4JKPH 2B8OT 4IOIA 2D7TL 3F12B 4UOW1 4MD0A 1JVKA 2GW5A 1DJSA 2C4XA 3SO3B 1BVLA 4QRUB 5BV7B 2VDPH 4ZYKA 1R5IB 2VLJD 4O4YL 4JQIH 1RAMA 1WWAX 2ZG1A 2LVEA 3GI9H 4P5KB 1UM4L 1GC1C 4ORZC 3U36A 1ZHLA 5ADPH 5I6XC 4M9PA 4POZD 1T2QH 5B38A 5JXAH 2DQGH 1NMAL 1FYTB 4NNPH 4FQXC 3BZEB 1T89C 4OFVA 4OGZA 5ENWB 1HI6A 2MPAH 1G7HA 2OR9L 2Y07L 4FTVA 1B0RB 3DBXB 1K9TA 2Y1VA 5I15H 1OTUC 4JRYB 3IAPA 4RGNE 1RZ8A 2R23B 5D5MB 2P8MB 4ELME 3FZUD 4OZHE 1N8ZA 2D4FA 1NC2D 3U9PH 4Z7UB 4XXCA 4QLRA 1BP3B 1P7KA 5TE7H 3H3PL 5CGYD 3KHOA 3L3GA 3ARQA 3L95B 3MLVL 1OARL 3QWQB 4JY5L 3BGMA 3C5JB 3UDWA 4OCSL 1CXKA 1P5UA 2CR6A 4OGXH 4XCFH 1N3NB 4JO4H 5HHQB 1FZKA 4EOWL 1RUAH 3S4SA 3WE6A 3BHBB 4HEPG 5JIPA 4RMWA 2IMMA 5H35A 1FFNA 1GIGL 3F6LA 3D0LA 4LDLB 5TFSL 3NPSB 2WK2A 1MH5B 4D9RE 5FA3A 4LCYA 4ZUSB 3ARVA 3GI8L 2VC2L 3AGVA 4PJ8D 1UACH 5DQ9B 4ZNCD 5L6YL 1IL1A 1PQZA 2OBGA 3L5JA 4OI8A 1MFCH 1T1YA 5C07E 3A67H 2RJMA 2Y5TA 5FGCE 4CBPA 4ODBD 3UCRA 1U91A 2DWDA 3LKPA 3BYYA 4HBQA 4YBLC 3CNKA 2D31A 1YN7A 1V7NH 1JP5A 3ULUH 4X0KA 5JW3L 3CGTA 1ZKAA 2BNRE 4FHBD 3QXAA 4XC1H 3SEPA 3WSQL 3VD3A 4LQFH 1MQKH 4NQVA 4I48A 5CZVH 5C0CB 4ODWA 3STBA 1DTUA 1IAKA 3EJZC 3NFSL 4R8WL 3S37L 4KKAC 3ILQD 4D9RD 3CD4A 3TYGL 2H3NA 4K9EC 3KPQB 2MJWA 1LDPL 4D3CL 4KV5E 2EIZA 2MKWA 3EOBA 3UTSE 2EE6A 4GAGL 3RVWC 1CK0L 2C3VA 3VFPA 4YXKL 4UNVA 4PRDA 4OD1L 4H1LH 4OSUH 2PO6B 1U8PA 4CMMB 3WIHL 2P44B 3L9RA 4PJIB 2VUYA 3MLUL 1YJDL 1P4LB 1RMFH 5GS2D 1H3UA 3MNVA 4L8DB 1IGCH 4K07A 1JWUA 5L2JA 2HKFH 3QEUB 1M71B 4ZPVA 4KTEH 4H25A 4QRPB 2CLVB 4N1HB 3O9WC 1BJ1J 3ESVF 1V8HA 1K2DA 2NXZB 4AZ8A 4DZ8A 3TF7C 1U8OA 3L5WA 3WEXA 4DGIL 1ZT1B 3LSOA 2OL3H 4FQIH 4XCNA 5B21A 4AQ1B 2YRZA 3BE1H 5IFHL 1MIEL 3KJ4C 5KN5B 2X4QB 4IMKC 4P9ML 3ZL4H 4WUUB 5ABDE 3HNTH 5D7LE 3JWDC 3GGWA 4XBPA 4HC1A 3NH7L 3GSNB 3L3JA 1XR9A 4PTTB 4PLKC 1I1FA 5IQ7L 5FCUH 1UGNA 4MCYB 3HMXH 3D85B 5T1MA 3RVXC 2VDQL 5ERWB 1F00I 3T2QA 4XHQA 4UUJB 2Z8RA 1N4XL 2X4OA 3QQ3A 4NN6B 1PZUB 4LEOB 1RUPH 5DJZA 2D03H 3D48R 4R96B 2EH7H 3T8XA 1RULL 2BVQA 4HMCA 1OGTB 1IBGH 4YAQA 1CE6A 4H8WC 3P9MA 2FNBA 4QRTA 3NTCL 2NY1C 3I02A 4Y8AA 3ET9F 2WANA 4WO4A 5F8RC 5JNYA 5EUOB 1G9NL 1WAAF 1ZA3B 3ARBA 2E9WA 5IM7B 4AEIL 3BQUD 1LILA 4FZEL 4K3HA 1M6OB 5C71A 1XGQA 1P2CB 3I75B 1QRND 2DIAA 3MLSL 4HUVB 4CAGA 2P45B 1BOYA 1T5XA 4G6JH 4R2GC 2PUQT 4R26L 3MNZA 3IU4H 4TVPH 5CSBA 5FYJH 4AY0A 4XXCC 4D0CA 4Z8FH 1D5ZB 3QO1A 4X6CA 3T09A 1SMOA 3QEGL 3NFPB 1T1WA 2JKXA 5SX4H 3CC5A 2J6EA 3KYAA 4HWEH 1AGEB 1WEJL 1P5VA 4ZG1A 2ZP0T 4OIIH 5ISZA 3UDWC 1JGVL 3WLBB 2MCPL 1QQDB 5JHDB 4AMKH 5GS0D 1WC7A 3STZB 1BGXH 4IRZH 3QISA 2K9UA 1HINH 1B0GB 4BQ9A 2IPTL 3FO9B 5HI4D 3IDYB 2YMXH 4EUPG 4RX4D 1WVZA 1JNJA 5DJ8B 1IM3B 3EYVA 1JMXA 4NPYB 5BQ7B 4LF3B 2F5BH 3QFDB 3LDBB 4MMZC 1YY9C 3HE6C 4XBEH 1NGXA 1YYLL 2VABB 1FE8L 1A4KB 4PJHA 3OJDB 3QUMA 4RFEA 2DQJH 1ZWIA 3QNXB 1EEYB 4YIQA 5ITFB 3GMNA 2V5RA 4PJEE 3L3HA 1MRFH 3Q3GA 4NP4L 1S7UA 3GSRB 5GRUL 4HJJL 5KVFL 2FSEB 3C6LB 4RWYL 3OB8A 4KMTH 4L4TE 5A16A 3S97C 4PBWD 4R97C 3WO3B 2V5TA 3D3VB 3HMWL 3KYNA 1A47A 2NY2B 2VR4A 4JCMA 4YGVB 2UV3A 3NIGE 3UAJD 2FD6L 5IBLC 2EDHA 1AGDA 1J1OL 5D1XA 4TOYH 5EH1A 1A3QA 4FQLH 3RIFF 3P9LA 4UZGA 4GG6F 2FIKA 1KELH 2EYSB 5L2KB 3MA9H 1KT2A 3IFOB 2DI7A 5HHMB 2DLTA 3BH8B 1WCBA 2X1XR 2XN9A 1UM5L 3AU1B 5E8NB 4JFYB 2WBJD 1NANH 1CD1A 4G7VH 4MDJB 5TPWL 3G08B 3IRPX 3PXHA 1CDCA 4UDTB 2LTQB 1ED3B 2G5RA 2HT2D 4G8FB 4OFYD 2GFBA 1ORQB 4XWGL 5CILH 1EEZA 4L4JA 3V6FA 2B1HH 2COQA 4JN1H 5CP7B 4HAFA 1XF2A 1DN0A 2UUDK 4L3EB 2VLJA 3GSQA 2Q3ZA 4OFIA 2IANE 4AEFA 1YNKL 4HIIA 1JNHB 1LNUB 3KS0J 5FUOH 4LHJB 3MR9B 3HZMB 4PJBE 3S98A 3KHQA 5KVDL 1RZJC 3MRFB 3BKJL 2R0KL 3T0EE 1SJEB 5IW6A 2YN3A 3JBG7 4MJ5A 1OL0A 1OAUH 4C54A 1J0KA 2O5ZH 1G7LA 3I6KB 3NACH 5T3ZE 3BYTA 2JCCE 2JLLA 3OV6A 4CDHA 1UJTA 3GMMA 3V7AE 5ESQA 2R56L 1D5XB 1KCVL 1HILA 1U8QA 4L5FH 5FYLL 4OZGB 2FGZA 4U6XA 4F58H 3ALWA 2KZ1B 1I3UA 4S1DD 1ZEAH 1BFOB 4LKXB 2NY6B 5FKPB 2AK1H 4J3SA 4TSAL 3TBVB 5C86A 4YHOL 2OZ4L 3TA3D 4ZFFB 5D72H 4WO4C 3MJ9H 2XA3A 3MLYH 2OJEB 3ARBC 4X6DB 1UZ8B 1IC5L 2YXFA 3ZTNL 1NDGA 4XPAL 3T0XA 1N59B 2GSGA 4KKBC 5TDNA 1N5YL 3KJ6L 3DUSA 3MRBB 4DZBB 5BV7H 5B39A 4Z76B 1F4XH 3TEUA 3MO1B 2UZIH 3LAFA 4M1DH 3P4OB 1MCOH 2IQ9L 2XG4A 5EIIB 1EEUA 2BVPA 2VL5A 4FQ2L 5IVXE 2KKQA 5C0EA 1CICA 3OAUH 1KLGB 4PJ8A 1NDMA 3WD5H 1U8KA 1MCPH 2CXKA 1I9RH 2CLZB 3MJ8B 5F1OB 4KZEH 2R69L 4LCCA 2QHLA 4P2CG 3R1GH 1NGQL 1WUNT 3QCVL 3K4AA 3RIAK 4G8GE 4Q0XL 4M62H 3VFOA 2GI7A 1S7TB 43C9A 5L8KB 1X6NA 4U1NB 4LEXL 2WAHA 3BH9B 5FV1L 4G6KL 3DNKA 3EYSL 4OQ1A 1S78D 35C8L 2EO1A 4P3CH 2YKLH 1NGYA 4KVCL 4EI5B 5F96H 2XTJD 1OTSC 5E94B 4PJXF 5E8PB 3VI4E 5I18L 1R5WA 4LPYA 4N0FB 4U1GB 2OSLB 5TQ2L 3TBWB 2ZKHL 5K9OB 3VRJB 2AJVH 3HUJE 3NAAH 5C07A 2Q87A 3PWNA 4F9PA 1NUNB 2XWTB 5D1QD 5D2LE 3TFKD 1RK0B 2GIYA 5E6ZA 1DP0A 1AO7E 4G43A 4PTUB 5EUOF 1BECA 5EZJB 5B38G 3GJFA 3Q1SL 2BNRA 5EBMA 2F53D 3MLZH 1G9MH 2GJ6E 5JHLH 4KAQH 3GJEB 5EO0B 3LKSB 3FQWB 2P5WB 1A5FH 2H9GA 5EORH 1Y6NR 2NY0C 4HXBH 2VLKB 4KGLA 4OCNC 1EBAA 2VO5A 5D1XC 5AWNH 2FRGP 3RNKA 4OJFH 2QQQA 2VXQH 15C8L 3WXVL 3R0MA 5B4MD 2ESVD 1I1AA 2IADB 3DX6B 5JW4R 1Q9LB 4P59L 3UTSA 5J06A 1VADA 1G7QB 4YX2L 5DFTA 5DJ6B 5I74B 1QOKA 3UPAA 5I19L 1G6RL 5JLZB 2H1PL 1HKFA 3ZTJH 3V4VL 3VFNB 4DTGH 3VGAB 4JG1L 1A3LL 3VXMD 2R2EB 1DSFH 4PJ7B 5I9QB 3EO9H 4XCYA 1HHJB 1KIQA 1QFHA 2BX5A 1A9BB 1E27A 5EOCJ 1PSKH 1CVSC 4BSVB 3CU1A 3WFDH 4YBHA 5EU3B 1FZMA 1FNEA 4HPOL 4LIQE 4YDLC 2XQBH 1SBSL 3MRJB 3RDTB 3RUGE 2IC2A 3NGBC 1AGFB 1JK8A 2CIIB 2Z35A 4NQDB 1IMHC 3MA7B 2VZSA 2CLRB 3TYFB 4XCEA 5DHVA 1BVKB 4LLMA 1NGPL 1UWXK 3UTQA 4XNYL 6FABH 2PYED 5D7LA 1OWWA 4HT1L 1EBPA 4N9OB 1W0VB 1GHFL 1RUKL 2MMXA 3BQUA 4LNVA 5JDJA 4NZUL 4OZIB 4HUXA 1HIML 2IFFL 1F02I 1F42A 3BKCH 4EDXA 1RQ5A 3V5HA 3V4PH 5CWSB 3FZUC 1QHPA 3DUUB 4HPYL 3QWOA 3WJJA 1T04A 3WNPA 1YUHA 2R1WB 4LSQL 2I25N 3PHOB 3GSNH 1WBXB 2ZCHL 1QLEH 2X7LA 2PW2A 1ZA6B 3F5WB 1A8JH 4KMQA 5EWIL 4TSCH 1NCAH 5FK9B 1LEKB 1WGOA 4QHUB 4BZYA 3FT4B 3N1MC 4X4XA 3HI1B 1JFQH 4AH2B 1BREA 1FV1B 3WN5C 2H8PA 1DUYA 4JPWH 1LQSR 2FX8H 5I71B 4UIKH 4KK6D 1QBBA 5HHXL 4BFIB 2NW3A 1MQ8A 4F57H 3F7VA 3BSZH 2WUCL 1Z9OA 1UWGH 4RX4A 4HWBL 4LSVL 4FZ8H 2CKBA 3IDIB 3O0RL 3TJHD 4YQXH 3OMZA 1HQ4B 1WZ1L 1CICC 3LPGA 4RDQF 2GAZA 4TNVK 1FAIH 4JVWA 1DUZB 5IMOB 5GGTA 4YDIH 2DQCL 4OQTH 4EI6B 4UQ2B 1K4DA 4HEME 1UKQA 5EZLB 5KZCB 4LRNL 4CVWA 4HJGA 3QUKB 3UPRA 4MD4A 2QV2A 2OQJB 5ALBL 3U9UB 5KSUB 1MFNA 2BK8A 4P2OB 3EO1A 3GFUA 2WWKT 4XH2A 4C4KT 3D9AH 3B83A 5IHZA 2CJUL 2BVEA 1F2QA 3EFDL 4PRPE 2A9ML 2R0ZL 1J18A 1AD9B 3C2AL 1A6ZA 4PJCB 3ILQC 3Q5YA 4UIMB 3KWWA 3QHTC 2H26B 4LPUA 1GAFL 3SJVB 1YEKH 3TN0B 4F9PC 1A4JB 2OJZH 1NMCB 1IEBB 1DBML 5J6HA 4E41E 1CXFA 1R3IH 4HCRA 1LEGB 4PJEA 4Y8DC 3K2MC 1T0NB 3QUXB 1VGKA 4ZOAA 4JDVA 2VAAA 3TV3H 5D71L 4KRLB 1JYNA 1F97A 2FGWH 3VH8G 5IWLA 1IARB 1X5YA 3N9GH 3RVUC 1IFHL 5TQ0L 4BFEA 1OP3K 3WHE0 5LAXB 3FB6A 4R7NB 2WWMC 5DQJB 1JPSL 2BC4B 4I3RH 2A38A 2P8LB 2ITCA 4MQ7A 2YPLE 1R24A 2FR4A 4HFUH 1AY1H 4YLQT 2JE8A 3AC0A 5I17B 2Y6SD 2YUWA 4HZAA 3B6SB 1I1AC 3WCYA 3HC3H 4UQ3A 3PGDB 5KJRH 2BRRL 5INDA 2FWOA 5ACLA 1FNSL 2IAMA 4TULL 3RZCB 4NZDA 1CFBA 3WFZA 4JM4L 4F37K 3O6FB 1MELA 5E99L 1U92B 1I8MA 1JTOA 1HHHB 3U30B 3T3ME 2VQTA 1S7RB 2Q20A 3CX5K 4K7PL 1NLBL 1MVFA 3JZ7A 3NCBB 2FO4B 2Z9TA 3AB0C 4Z7VE 5KTEH 2NY7L 1HEZB 2YPLD 2IGFH 3KDMA 1I9IL 3QEHA 1QSED 1VESA 3L1OH 5E9DD 1S9YA 1F6AA 1PYWA 2IANA 1DE4A 5HGBB 4KROB 5HYQA 2K7QA 1JIBA 5I75C 3GMLA 4DGVH 2LAAA 1ACYL 5HDLA 5J0BA 3KLAB 3T0EA 3DETC 1ZMYA 3BQUC 5MEOA 3TIEA 3HI5L 4X80H 2R4SL 2P43B 2DM3A 4P5TB 5D6DA 2JCCA 4LSTL 4PYHA 4OLZL 2VITB 4NCDA 2VZ3A 1B0WA 3HNVL 3LN5B 1MJ8L 5DZLA 3TH4T 3WJJC 5I8KH 4H0HB 2E6PA 5J12B 3SE8H 3GRWH 4DN3L 2AP2A 2P7TA 3MLPA 4X7SH 2VH5L 5FUZH 3S8WA 4UT9H 2BOCA 2EDDA 4WHYH 3VXRB 2CK0H 4JM2B 4TYUA 3GHEH 4DAGL 5CCKL 2AXGB 1V3KA 3RHWK 1MHCA 4WW2F 5BS0D 5C0GA 3PP4L 3MRRA 4G9FE 1MNUH 3CSYB 1JNNL 1D9KB 1CFVH 3RWJA 5FHBH 5MERA 3RKDD 3CPLA 2R9HD 5HI4C 3S6CA 3OKKA 3FB8B 2NTSP 3QULA 5IVXA 5AUMA 4XAWL 3TVMA 4TPRH 5L7XH 5IMKA 3B9KB 3SBWA 4YHMH 4V1DE 3MRIA 4N9GA 3UYOD 5D1QA 3QB7C 3OKEA 3LN4A 2N7BA 4RFOL 4XVJL 3PP3K 1FH5H 4F33A 1LO3H 4JJ5B 4ZQKB 2ZUQC 1AFVH 4GQPH 3IDJA 3LKRA 3NA9L 3TGXA 3ORJA 3MNWB 4QXUH 3EYQD 4IRJD 5IBUG 4F7TB 3KPLA 3ZZ1A 4ZAKD 3IDMB 5DJXA 4OLWL 4QHNB 4H26A 2R0LH 5ELIA 3S35H 2A6DB 3KVQA 2AJYL 5GIRB 2F53A 4XBGB 1BJMA 1FDLL 3LEXA 5DYOA 5HGGS 4B50A 3OG4B 3GBNH 4DFHA 3UC0L 2VKWA 2GTWB 3TIDB 4QRSB 1A14L 2Y06H 3DVNB 4Y5XB 5T3XH 3MRMB 4CVXA 2ZPKH 4LSUL 1NSNL 2ESVA 4V1DD 5JIKA 4EUPB 5LGHH 3HUJA 3DRTB 3OKOB 4MVBC 2XFXA 2NYYC 4XRCB 2AEWA 4XP6L 2AGJH 2PXYB 4M3KB 3V79C 3RWDB 3CVHA 4WWID 1QD0A 5DTFB 5ANMA 1JHTA 4ZUTB 5DGQA 5IWLC 1S5IL 3A6CL 5TDOB 3CFCL 3QDGD 2HT2C 4FXKA 5FM4A 5I8EA 1TENA 4MQSB 3DO7B 5GRWA 3H9HA 5F70A 5I6XB 1D6EA 5IV2A 5GGSY 3GBLA 3KLHD 3LHPH 2BERA 1K8DB 4OI9A 4WTXA 2W0FB 3QQ9D 1D5MB 4UDUA 3VCLB 1NAMA 5LWYL 1CE1L 3PGFH 3VXMB 1E4KA 3I2CH 1S7WA 2WWKO 1S8DB 4C4KO 3T0DA 4F9LA 2EZ0C 2AK4E 2IAMC 5C0BB 4DW2L 2HG5B 5BVPH 4ZFGL 1AHWA 1P4IL 4U2ZA 5E2UH 5JO5B 2ZCLL 3QG6A 4E5XA 4G5ZH 4ZO9A 3UYRL 1W0WA 2UVFA 1SM3H 4PJ5E 4GAJH 1RZIA 2FJGA 1CCZA 4LU5L 4NQCD 1FC1A 4JZOA 4M4PA 3OKLA 5DO2D 3HZVB 4S1DC 4MQTB 3V4UH 4FQHA 5F6IC 3MRDB 1JBJA 4MJ6B 3JUYA 1ZLSL 4BSWB 3V0WH 3FRUB 1HCFX 5EU6B 3OAZH 4HIXH 1A1MB 1HZHL 3SKNB 5C7XL 1R3LA 4HAGA 1T1ZA 3T0EC 2F5AL 4XAKD 4IM8A 3QIUC 1EO7A 3QFJB 4XNQB 1XZ0B 1KJVA 1L9MA 1MLBB 3CZFA 1BD2E 1JHLL 2BVYA 4PD4K 5D6DC 4X7FC 4XPTL 4A6YB 3G5XB 1JJUA 5GGVL 1ZLVH 3HRPA 3U4BH 3VA6A 4L8BB 4RISL 5SWSE 3SDAB 4P2RB 3BRDA 1E28A 5ACMA 2BNQD 3HS0B 2FEDD 1QO3B 4J1UA 4JFPA 4LPVA 1AGCB 4PB0L 3FT2A 1S9XB 2FEEL 3MACL 3RA7L 4X99A 4HK3J 3CLFH 3Q6FB 3RVVD 4MXQC 1RIHL 4DQOL 1JYXA 1Z5LB 3KPOA 2NR6D 1N2RA 1S78C 1Y6MR 4W81A 1IAOB 2VDOH 3HG1E 1Q9WA 2NY4D 3MRPB 3UTTE 3RX8A 4QF1A 5I76A 3SCMD 1K4CA 4P57A 4WI7A 5FYJE 3TVMC 3MGTA 4PR5B 3CLEH 5CSZB 3MLWH 1J88A 2BY2A 4PGZA 3U2SB 5DD6A 3FTGA 3QUZA 3UTZA 1VGEH 4AENA 4M6OL 5D1QC 4OLYL 3DRQA 5TE4L 5IB2B 4K23L 1U42A 1GGBL 2W9DL 1E4JA 3U48A 4Z7NE 5D7IF 3PHSA 4PJAB 1LO4L 3QXDA 4R7DB 3K2UH 1MJ7H 3PWVB 3KJ4B 3MLTA 4LLQA 1SEQL 3RL2A 4MXVF 4NKOB 1LO5A 4PJGB 2FYYB 4RAUB 4RQQA 2DN7A 3H8NA 3W0WB 5EUKB 4KRNA 3S36L 1JZ8A 3PWLB 4WFFD 3TO2B 5L88H 1Y6KR 1GGCL 2C3HA 3AM8A 4NM4L 4IOIB 1CGSH 1IQWH 4RMSA 2HVKA 4GW5A 4HIJA 4PP2A 1CR9L 1AQKH 2X89D 5CS7A 3GMRB 5FGSA 1XGYH 3OGOE 1LWRA 5KAQF 1CGUA 2OM5A 5HYJD 3OX8A 4J4PD 3OPZH 4ONOA 1EHNA 3MV9E 2EDEA 2ZOLB 4H88H 5LBSL 4YHPA 4GMSH 3T65A 5LXGL 4LLVB 4J3OC 4LBEB 3BX7C 3QPQD 3VFTA 1XIWB 5B38B 3VG0L 3F7RA 2R8SL 2YPLA 4OV5B 1EJOH 4J8RA 1SBBA 4NQED 1QSEA 2ORBH 1U95A 5DC9B 3ABZA 1E4KC 3EDFA 3KPRE 3PWPD 2OXHA 4F9LC 1FIGL 4R2GB 1NCBL 2QSVA 4OBSA 2EDNA 1TZHA 1I3GL 4JKWA 1AHWC 1YEFL 1W72L 4NHCH 4YHKH 2DWEA 4FQ1L 1KJ2A 5SV3A 1CFTA 1AKJD 3L3GB 3RWGA 2HMID 3MV9D 2XI9A 2HLAA 3NZHH 1DFBH 1U41A 1IE5A 4TQEH 3V6ZB 1RZFH 3BGMB 2YD8A 1WAAE 4ZXBC 3X12A 1TJHH 2AERT 1OWRM 3BDYH 3S4SB 3RI5F 1RVFL 4I4WA 5IK3A 1ZTXH 1FFNB 1RSFA 4XPHH 2FEEI 1WWCA 1OSPH 2X4PA 3O2DA 4DOHB 5I0DA 3ZSSA 3OXRA 5IEKB 3D39D 2B2XH 5F1NB 5FA3B 1INEL 4LOUD 4QEGA 1OF2A 1QEWB 3W2DH 3HE6B 1PQZB 3P0VL 1PEWA 4ISVA 1JF5A 2ICES 3QXWA 4Y5VA 1H5BA 1UB5B 2Y5TB 3N85H 4LLDB 2UUDH 1BZ7A 4Q58C 1NFIB 5FXCH 4R90H 1ZLWK 2VDKL 4DCQA 3ULVH 1C7TA 5IJKA 3VE0A 1XCQA 5HPMB 2D31B 5CSGA 1HKLL 4I5BB 4YO0B 1ZVSB 4NSKA 2V7HA 3VFWB 4MNQB 5TDPA 3TJHC 3RP1A 3UO1H 4WFGE 4EN3C 2EC8A 3TNNB 2YC1B 1MCWW 4LSRH 2EC9T 2DQIL 1T5WA 2GT9A 3GM0A 2IPKA 4M7KH 2ZJSL 4I48B 3W9EA 4X6BA 1S7SA 3O6MH 4LCWE 3PGCA 2V2TA 1IAKB 5C08E 4UILL 4LL9A 4PGEA 4P5MB 4O58L 4YXHL 4IRJA 2APXA 4ZAKA 3O45A 3SKJL 5IOPB 3HFMH 5SWZD 1BVZA 1Q9KB 4G42A 2FBJL 2XY2A 3BVNA 3O3DA 2C3VB 4Q9RL 1JRHL 4K94L 4Z78B 4PRBB 1D5IH 3G6JB 3WS3A 2X1PA 3JWDL 1EGJH 3HE7C 3U0WH 1JPTH 2BZDA 4XB7A 2P47B 3ARGD 4LCIL 2F8VA 4PRHE 3L9RB 1TCMA 3KNBB 3FRPA 5FHAH 1FO0H 5F7YC 3QUZC 2E27H 4K8RH 1NPUA 4V1DA 1LO0L 1JWUB 3CX2A 5T33H 3V5DA 4YXLH 3KAAA 4MNGE 2W07A 4ZPVB 3OG6B 2X1WL 4WEUD 1IGML 4XX1E 4H25B 4DZ8B 1K2DB 3CVIH 2JF1A 3L5WB 2CRMA 3WL9A 2WUBL 4XCNB 2XNAA 2DLFL 4GRWB 1ZSDA 2ILLA 5KSAA 5I1LB 5CD5D 5DD5H 4C56E 2FJFA 3QUYC 3LEVH 4XBPB 4Z9KB 1YPZF 4TTDD 1NFDF 3V7AG 3DI2B 4OZ4B 5EU5A 1XR9B 1CGTA 4PB9H 3ZLQC 5J9PB 3M07A 5T5FH 4WY7L 2VDNH 1A1NB 1ZANH 1JI1A 1RPQA 2OMBA 4L3CA 2MSPA 4GOSA 4L29A 2B1AH 1O7VA 1FYHB 2R1XA 3TBTA 3STLA 1I4FA 4NYLA 1BBJA 4ZSOE 1FVDA 4Y89A 4Q7DA 4ETQA 3CAFA 5CEZL 3VD4A 1VFAB 3J8F7 1K6QL 5DJZB 2ZG2A 5F89A 1KSRA 3T8XB 1X5AA 2BVQB 3TT1H 5D7KD 4XCCL 2V6HA 1JNLL 1VFBA 5TH2A 4QRTB 1HHIB 2E6JA 4WUKL 5DJAA 3VRIB 3I02B 4P2QE 4WO4B 3ARFD 2X4SB 4U6HB 3RKPA 2I5YL 4UU9B 1MWAB 4NFDA 1FZOB 4IRSD 2PYFA 2O5YL 2WLYA 4PLNC 1CD9B 5JIHA 3VH8B 3B9EA 4HLZG 3WXWH 2G2RB 4QRRD 5D9SB 3A6OA 4BK4A 2FB4L 3DV6B 4NO0D 2BHUA 3PNWA 2V2XB 1DANU 1T5XB 4N0YH 2ZUTA 5JPNB 1GC1H 3SQBA 4KRPD 3DXAB 3MNZB 1EHLH 4Z5RA 1MFAH 3QO1B 4X6CB 1JYWA 1FL6A 2EDYA 4N1CA 3LMJL 1U3HD 3RAJH 5KSVA 1UKSA 4GQ9H 3VFUB 1H8SA 1NC4D 2VMFA 4XP4H 4QHKI 3UJIH 1Q94A 4AIXA 1ZHBB 2ICWB 4PJ5A 3W39A 4PBVC 4PJGF 5ISZB 3E8UL 1H15A 1FFPB 1YMME 1A6WL 4RAVA 2BNQA 5D2NE 1FCGA 3H6JA 2ITDA 4HH9B 3IKCB 4MA7H 5F9WB 1S9WA 2ZNXA 1GCFA 4JFOB 3EYVB 4J23A 4M6ML 3SY0A 1C5BH 5FGBA 5I1DA 4Y4HC 2MTPA 2FZ3A 1I85A 2X5PA 5CBAA 1JRHI 1NGXB 1PLGH 4O51A 4PG9A 5BXFA 4OGAD 4QRQA 1T0PB 1CL7H 4PJHB 3QUMB 4Y5VC 5FKAB 1B2WH 3LRSA 1KCSH 4XI5C 3VXUE 4YIQB 4JGUA 1BD2A 3K1KC 2R9HC 3PWJA 4X6FB 1TZGL 5LGKA 1S7UB 2ED7A 2MWCA 5L8LB 4PYGA 3VXTB 3FMGH 4OCYL 2FJHA 3BKMH 3DIFA 5A16B 5INCA 3V6OA 5SWSA 1JZ3A 1X5FA 3QEQD 5IGXH 4P23D 1KCLA 4U1KB 4QHKJ 4X7EC 4KTYA 1FG9C 1PY9A 2GY5A 5D1XB 1JGEA 2AV7B 4A6YH 1KB5A 3P9LB 4PJXE 3WDHA 3EYQC 4IRJC 4KQ3H 3C6SA 4ODHH 4J2XA 4JO3H 4OM1H 2CIKA 3VU2A 2DJSA 2ZUXA 3IJHB 4JLRA 2SEBA 2NTFA 4LLYA 3O4LB 3RWFB 4BA8A 3UYPA 5J6GA 1ZK9A 2XN9B 3HG1A 3GSOA 3O8XA 4ZD3L 4HC1L 5CHNA 1D7FA 3U4EB 5FECB 1CD1B 3I9GL 5JOPD 1JN6A 5EC2B 4HF5L 3EJYD 4K9EH 1N7ML 4K55A 4IDJL 1UB6A 4M00A 1Q1JL 2GFBB 3LPWA 4KDTA 1IGJA 2NY5L 1EEZB 4N8CL 2QKIB 1MCSA 3U7WL 4UAOC 1H3GA 4PY8I 4JG0H 4BM7A 1XF2B 1DN0B 5FYLE 1BEYH 3GSQB 1CDJA 3CK0L 3DROA 5KSAC 5F9DC 1UXSA 4Z95H 3EOAB 3SOBL 3TPUB 1PAMA 2B4CL 5EO9A 2DD8L 4NKDB 5EO1A 5IW6B 5IBUB 3FO0L 5DFVC 3VDCA 3U46A 4MJ5B 3KLHC 2XKNA 4NDMA 1MUJB 3OHXA 3PQYE 5HGAB 4PY7A 1EK3A 4GAYB 1SYVB 3MODH 4XNMA 4NQEA 2Z91B 2HT3D 3NCFB 3MCLL 4Q97A 3K8KA 1M7DA 4OLXL 5ESQB 3H0TB 5IT2L 1U8QB 2NPLX 3SKOA 2YPKA 2Z92A 4K3JH 4GJTB 1FBIH 3KPMA 5AEAA 3MROB 1PGRB 1N6UA 3QA3B 4MD5A 2CH8A 4PREB 3MV9A 1OM3L 1K3ZA 3FFCD 1HXMA 2J6EL 4PY8J 3KXFD 3BKYL 3RVTD 3WN5B 4S10A 5FB8B 2NXYD 1IGYA 4MLSA 5TDNB 4IJ3B 5DO2C 4E42A 3DUSB 4NKIL 3KPRA 4YHZH 5IIEB 4H8WH 4RGNB 5IR1B 1AKJB 1OP3H 1MHEB 4ELMB 3DX9A 5C0EB 4OZHB 5DT1L 1CICB 2A1WH 4M48H 4AEEA 1U8KB 1NAKL 1CDYA 4RGOH 3PUCA 5SX5K 2Y9RT 4F7MB 2VDRL 5CZKA 3A6BL 4M8VA 3EUUA 1KXQE 4U6TA 1LP9B 1QFWM 1EVTC 3MTRA 2R2HB 3VJ6A 1BHGA 5ACZB 3PL6C 3C5ZA 4GBXD 3MOBL 4D0DB 4ODSH 1WK0A 4LARL 2VNCA 3W11C 1IILE 1OPGH 3ARWA 2F19H 4L4VE 4P48A 3TZVA 1MCDA 1MFBH 4YH6A 3MOAL 4K2UL 1X5KA 2HVJA 3GNML 3V0AC 5D7JA 3RVVC 4JFHE 5C07B 5SWZA 3VXNA 1CWVA 3PWNB 1ZAGA 2YK1H 9CGTA 4JCLA 2XA8H 5FGCB 3U0TA 4HH8A 4BQCA 2DLGA 3QHFL 3KGRA 3SGDI 4B7IA 1R3HA 2HYMA 2VR9A 2A0LD 2NW2A 3V6OC 2BNRB 4R4FH 4B5EA 1PX4A 4LFHD 4NO2B 2OR7A 1JGDB 3DMMD 5E6ID 4HS8L 3GIZL 3HAEA 1Y18A 4CJ1A 1L4IA 5C08A 2KZWA 4O5LH 2MQCA 3QIBA 4X6CF 1I1AB 1OAZL 2CDEB 4F7PB 1XH3A 3UTSB 1VADB 1IKFL 4Y4FB 3ECBB 3SDXA 3MV7D 3VMOA 3HKFA 5ALCL 3O8XC 2AV1B 3G6DL 2CO7B 5F3HA 4POYA 4ODUA 4KKNA 1MFDL 2EDKA 1CLZH 4NJAH 4XT1C 1BLNB 3UTPE 2YEZB 1X5JA 5MP6L 2P1YA 1MVUB 4PRHA 3VWJC 1ZT4A 3AS2A 5L0QC 1KIQB 4U1SA 5HHPB 1E27B 3OJVC 2VE6B 4KDTC 2RFXA 4AJ0A 4ZOBA 4WI8A 3AB0B 3MLRL 4MJID 3WKNA 3RZWA 5DVNA 3BW9A 2Z35B 1CQKA 2C1PB 5GSRA 4LLMB 3BFOA 3QNZB 4IHOA 2Z31D 5I75B 3IF1A 3ARFA 4JPVH 4DJMA 4KKCD 5IEHB 5D7LB 3VRLF 5HYIA 3B2UD 4NJ9H 1PG7W 4N8VG 3UTPD 4HUXB 3VG9B 4JFFD 1KB9J 4WWKD 1KCKA 1GZPA 4XMPL 5HYSG 1QKZL 2V5YA 2ARJQ 4J6RH 3SE9H 3TCLB 4NO0A 5CD3B 4QXGH 3ZKNC 3V5HB 4FFVC 1DBKH 1CIUA 5EPMB 1U8MB 1U93A 2WQ8A 4JHAH 3H2WA 4FFYL 2YA2A 1QSFD 4LSPH 1LDSA 1RZJH 2E7HA 5E8DH 3WS6A 1IGFL 1KN2H 2HT4C 1N64L 1YUHB 5JW5A 4QYOB 2V17H 5K59E 4M7LH 1T20A 1U3HA 2M2DA 3QRGL 2EEAA 1OAKL 1ZV5A 2HMIC 1P6FA 1J0HA 3EHBD 2EDWA 5DURD 5GZNC 1NC4A 2QSQA 3L3IA 3N1FC 4P2QA 5FYKH 5IVZA 5CZXC 5B8CC 3LN9A 2JIXD 1J1PH 5I1EH 4QWWD 1YQ2A 1CFQA 2NW3B 3FQNB 4UV7L 3VWKA 1FFRA 4NN7B 5I1HL 2VDML 5J3HD 5I16A 2M1KA 2C5DC 2DTSA 4PUBH 4P9HL 4MHHI 5I1GL 1MWAH 2DMBA 1F90H 5L9DH 1P7HL 2AJ3A 1K4DB 5KVEH 3HR5A