5JUWA

Complex of dot1l with ss148
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
329
structure length
323
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMEYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex of Dot1l with SS148
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 104
structure length 323
sequence length 329
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5juwA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5juwA02
4YMGA 2B25A 3OU6A 1RI4A 2HNKA 4GQBA 3G88A 2OY0A 3GRVA 4EKIA 3QOWA 1UFKA 4C06A 5K8VA 4OQEA 5DM2A 3FTFA 4P7FA 3GO4A 3X0DA 2EJTA 1QANA 2FK8A 4ER5A 3ER8A 3MCTA 4GOLD 3VC1A 3TM4A 2Z6QA 5KQSA 2H11A 3G2PA 5LQRA 7MHTA 5KS2A 2VDUE 4FGZA 5K0GA 5KYGA 3MB5A 1R8YA 1WZNA 2IGTA 5E9WA 3TOSA 2BR4A 4POOA 1TPYA 1MJFA 3FUUA 2O57A 4HTFB 3OE4A 4DQ0A 3UJBA 3OU2A 1NT2A 2ZVJA 3G2MA 3H2BA 3KR2A 4E2YA 2C7OA 4LECA 1SUSA 2AOVA 1M0EA 5DM4A 3I9FA 3PTAA 3C3YA 5K0CA 2PXCA 2ZW9A 5K09A 1KXZA 2YXDA 1H1DA 1IXKA 3C6KA 4KDRA 2PX4A 5LQJA 3ELWA 5EIWA 4CTKA 4YUXA 1L3IA 4WVLA 5CVJA 3UFBA 2UYOA 1EG2A 2AN4A 2DPMA 4BLUA 5M5BA 5DWQA 1YUBA 5GM2A 1XJ5A 4KIFA 2PV0A 3EMBA 4RVFA 1NV9A 4HTFA 1NW7A 5DX8A 3TQSA 3M4XA 1VPTA 5P8WA 5BXYA 5JUWA 3P2KA 3A26A 3EGIA 2ERCA 5FULA 2CMGA 3I5UA 4CTJA 3GJYA 3L8DA 3FTDA 4QTTB 5CIYA 2PJDA 2UYQA 4KVZA 1WXWA 5K01A 2I9KA 3HCCA 4FP9A 4FS8A 4GOMD 5CVVA 4Y30A 3WSTA 1QZZA 5E8RA 4BY9E 4ER7A 2N47A 3E23A 2AS0A 4PYJA 4P58A 2G1PA 2OB2A 3FRHA 2OYRA 4C03A 1KPHA 3BZBA 3EVEA 3KQYA 3SXJA 5FHRA 4YMHA 3S68A 2P40A 1VP9A 1M6YA 4EMSA 2JH9A 1YZ3A 2XYRA 2YVLA 2QRVA 1NBHA 2AOXA 3HCAA 2P7HA 3M6WA 4QTUB 1WY7A 5CVEA 5EPEA 5K0NA 2YTZA 3P9CA 4CWAA 4YV2A 3FTEA 2O07A 2PT9A 2FRXA 1SQGA 3ELUA 3GRZA 2ZTHA 3LDGA 1RI2A 2P3QA 3AJDA 2OKCA 5IKMA 1B42A 2Z6UA 4OBXA 1AV6A 2G70A 3FPHA 3SSNA 4IKPA 1N7IA 3HCBA 3ORHA 5CCXA 4HGYA 3LHDA 3PX2A 2YXLA 4PIMA 3LL7A 5ICCA 5DSXA 1RJEA 3T0IA 3UA3A 2K4MA 3TR6A 2IBSA 2PWPA 3TRKA 3G8AA 4M7RA 3C6MA 1YFLA 1VBFA 4FSDA 3MAGA 3UJ6A 4DA4A 3CCFA 3LBFA 1VQ1A 3HCDA 4GC9A 3TKYA 2FK7A 3UJ8A 3DXYA 1P39A 2LD4A 3BWBA 4OBWA 3V8VA 4PYLA 5K05A 5EQJB 3EMDA 5EZSA 5EEHA 5LQAA 3KR0A 4QVGA 3LDUA 5C0OE 2GB4A 1KP9A 4X61A 3LDFA 1XCJA 1RI1A 3M33A 4P7KA 4FZVA 3AY0A 1QYRA 5DRYA 3OFKA 3GCZA 4HC4A 4UOEA 2ZBQA 4FSXA 3F4KA 4RTOA 2XBMA 1XTPA 5FCDA 5GIOE 5CVDA 3P97A 1WG8A 3FUVA 5C9ZA 1YF3A 4U7TB 2V7EA 3R6TA 2AR0A 3LCUA 4JXJA 5K0EA 4GF5A 3SGLA 5H02A 5F2OA 2IH4A 1IY9A 3SMQA 5BP7A 2ZCJA 5GWXA 5ICFA 1NKVA 5DM1A 3PX3A 3KPVA 2NXEA 3T7RA 4ER6A 2JJQA 2ORED 3ANXA 1EAMA 3MTEA 3GWZA 4PGGA 3TM5A 4E32A 1HNNA 1EIZA 2G8NA 3R24A 2IBTA 3FUXA 5E9QA 4R8RA 3KPUA 3FYDA 3U81A 5GOZA 3D2LA 4IWNA 2IP2A 4FT4A 4C4AA 1PRYA 3CC8A 4YV0A 3ER9A 5E1OA 2YR0A 5GM1A 4RTPA 2ONYA 1L3BA 2P3OA 3DMFA 3DULA 1O9HA 2YXEA 5GP1A 4EK9A 1ZKDA 2EFJA 3KQPA 2HWKA 3HCFA 3P2EA 5EKUA 3RIEA 10MHA 3BWMA 2JG3A 4F86A 3EVFA 4RTJA 1KPGA 2XVMA 5EZQA 4LWPA 2ZULA 2AN3A 3HVKA 1PJZA 3UJ7A 3LKZA 2XYVA 1F3LA 1Y8CA 1BC5A 4DCGA 1G8SA 4E2XA 2G71A 2IIPA 3MTIA 5E1MA 2YQZA 3EVBA 4Z2YA 3I58A 3SSMA 1G55A 4HRAA 3KU1A 3R0QA 1ZG3A 2CL5A 4M37A 2AN5A 2QYOA 4QPPA 3EGEA 4BP3A 2BR3A 4QQKA 1JG2A 4FR0A 1AQIA 1INLA 3GXOA 2G72A 3PFHA 3LECA 3UA4A 1Q0TA 1ZHFA 4C08A 1NBIA 2JH8A 3OFJA 2PX8A 3BKWA 4C04A 5K0LA 1Q0SA 1RJFA 1G8AA 2VDWA 1ZQ9A 4HH4A 4KWCA 3GU3A 4R05A 2ZIGA 3C3PA 4PGHA 2ZSUA 5E2BA 5DTQA 3EPPA 5EKXA 5LR6A 4RX1A 5HOQA 3T7SA 5MHTA 2OO3A 3HM2A 4CXMA 3FPJA 1JQDA 4YV1A 5FTWA 5HILA 2GS9A 3LCCA 2AZTA 1I9GA 1R18A 2GLUA 3FPFA 1KYZA 3G2OA 4RWZA 3UJAA 3DR5A 2ZZKA 5CCBA 2IDJA 4B17A 3TFWA 4KRGA 3DLIA 3DOUA 4X41A 3IV6A 3FUWA 3P9NA 3KQTA 5E1DA 1AQJA 1XVAA 2KW5A 3HCEA 5EOVA 3GNLA 1D2GA 3P2IA 4RYLA 4ER0A 4A6EA 2R3SA 3THSA 2PGXA 3KQWA 2QRVB 2AOWA 3SX0A 2IDKA 3DXZA 3KKZA 2JHAA 3M6UA 5T6BA 5FQNA 3TKAA 4GEKA 1QAMA 3HA5A 4DF3A 4DMGA 1TW2A 4G56A 4P7GA 4FT2A 1HMYA 1JSZA 5DT2A 1JSXA 2CMHA 3HA3A 1X1BA 5FA5A 3NVKI 1NW8A 3FUTA 1SQFA 5HIIA 3HVJA 3ERCA 4GC5A 4RTRA 1D2CA 2HV9A 1JG3A 4EKGA 1YZHA 1YB2A 3EVZA 5IH3A 5KQRA 2YX1A 3HEMA 4R6XA 2O0LA 5T67A 1X1CA 4ZTBA 2NNWB 3HNRA 3LGAA 2PKWA 2F8LA 4XCXA 4E31A 1KR5A 2I62A 2PXXA 3LSTA 2PWYA 1X19A 5HIJA 1UIRA 1UWVA 2BM9A 3A7DA 3DH0A 3EVDA 2FHPA 3GRYA 3KQMA 3PVCA 4PWYA 3TMAA 1JG4A 3UJ9A 3SR4A 1FP2A 3GDHA 4R8SA 5K0FA 2Z6AA 3AXSA 5GINE 4E70A 1RJGA 4PYMA 2UYHA 2Y1XA 3ELDA 3KHKA 3TPZA 2FYTA 2PX2A 3KPJA 3KR9A 3OZRA 3UJCA 3AWIA 4V0RA 3OCJA 5FUBA 3SM3A 3BGVA 4QVKA 3K6RA 3EGVA 4GUAA 4PYQA 1ZGJA 1QAQA 1JQEA 2H00A 1NE2A 1ORIA 2VP3A 3K0BA 1JG1A 2I6GA 5EVJA 2NP6A 1G6Q1 3OZTA 4V0QA 5K0JA 1G38A 1OR8A 1NW6A 2QY6A 3CVOA 4U7PB 5U4XA 2P41A 2E5WA 3P8ZA 5EHGA 1NW3A 1R6AA 1XDUA 4CKEA 3GIWA 5B1SA 4K6MA 4EVIA 2ZLBA 5EMLA 5E2AA 5ICGA 3HP7A 5E9JA 1DCTA 1T43A 3O4FA 4AZTA 4AZSA 3G2QA 3JWIA 4OQDA 1P91A 3CJQA 2NXCA 2AOUA 3SSOA 3G8BA 1AF7A 4AUKA 2NXNA 1EJ6A 4RTMA 3TLJA 3NJRA 3A25A 4GBED 4KIGA 5D1NA 3R3HA 4RTLA 1VL5A 3SVZA 2I7CA 2NP7A 2FCAA 3DXXA 2C7QA 3DMHA 3LX6A 3JWJA 2VDVE 2C7PA 5E8JA 3E05A 3KPYA 2P1DA 3OPNA 4PYKA 1XDSA 2Y1WA 3M6XA 3KQQA 4HSGA 3T7TA 3BWCA 3IYLW 4PONA 4XUCA 5DTRA 5EG5A 3C0KA 5FADA 3LCVB 3VC2A 2AVNA 5KVAA 2Q41A 1O54A 5HFJA 1XDZA 3HA7A 3P9KA 4P7JA 3A7EA 2R6ZA 1R74A 1ZGAA 2EJUA 4C05A 1VP3A 2A14A 4IV0A 3MQ2A 1R00A 2AOTA 3G5LA 5LQUA 1KPIA 4YUVA 4X63A 4RVGA 2P7IA 4EQZA 2BR5A 3EVAA 4L7VA 2WA1A 1RI5A 3BKXA 5F2NA 1YFJA 4LG1A 4WXHA 1FJXA 4XUEA 3GRUA 4QDKA 5C1IA 1G60A 5ICEA 2H1RA 3BUSA 1JTEA 3FRIA 3KQSA 3PFGA 2JHCA 3B3FA 3ME5A 4LWOA 2BH2A 4X60A 3I53A 1ORHA 2ZZNA 5EIFA 1BHJA 3KR1A 2YUIA 4F84A 3UJDA 5T64A 2IH2A 4M36A 2GAFA 2GH1A 1N7JA 1DUSA 3B89A 3KQOA 4E33A 2ZBRA 3MERA 3GGDA 3CJTA 3OU7A 5EMKA 3NDIA 2IH5A 2ZWAA 2PSSA 3JWGA 1BOOA 4PIPA 5EEGA 3O7WA 1NV8A 3FYCA 3Q87B 3RODA 3NVMB 1XCLA 1FPQA 2OBFA 3LBYA 1FP1D 5ERGB 5BW4A 4H0NA 2FPOA 4BP1A 3B5IA 5GIPE 4YUYA 1TW3A 4MTLA 2IPXA 3UBTA 2WK1A 1P1BA 1NW5A 1VLMA 1DL5A 1L1EA 3FZGA 2PT6A 3HVHA 2CKDA 4DM3A 3BXOA 4R6WA 3B3JA 4RTSA 3A27A 3DMGA 4DZRA 2AVDA 1MHTA 3P71T 2ZIFA 4KDCA 5DX1A 3VYWA 3M6VA 2HR1A 2XYQA 4OA8A 4RVHA 3THRA 2EX4A 5D1HA 3EVGA 5HEKA 3UZUA 4OX9Y 2ZZMA 3NMUF 3FPEA 2PXAA 3REOA 2AOTB 3RW9A 1JR4A 3MHTA 4E30A 3DP7A 1U2ZA 1Z3CA 5LQNA 2QM3A 4YUWA 5HZMA 3PLAE 4GOND 2AOUB 2PX5A 4AZWA 1SG9A 5HIKA 2NYUA 4HGZA 5DXJA 1I4WA 4DCMA 2UZ4A 3M70A 3E8SA 3I64A 4RV9A 5EMJA 4PYOA 4E2ZA 1JTFA 5EHIA 5EGSA 3DTNA 9MHTA 4KW7A 1RI3A 1VIDA 3CGGA 4BLVA 4PCAA 2PY6A 3GRRA 3BGIA 3P9IA 3ID6C 3QOXA 1X1AA 2ZBPA 3O31A 4DKJA 1R8XA 1X1DA 4Y2HA 3IEIA 5DLYA 2P35A 5DM0A 2GA9A 1D2HA 5EMMA 5FQOA 4MQ4A 3G89A 3NDJA 4OA5A 4RSRA 4AZVA 4RTQA 3CJRA 2ONZA 5FWDA 1QAOA 2ADMA 1KYWA 3EEYA 4AX8A 5K0BA 4QPNA 2B2CA 3HTXA 3BGDA 2B3TA 2CWWA 2OPBA 5HIMA 3FPGA 4M38A 5DPMA 4E2WA 2PLWA 5BW5A 5DRTA 2O05A 2ZIEA 3Q7EA 2B9EA 1SVUA 4QQNA 3DUWA 3LKDA 5E1BA 4C07A 2UYCA 3EVCA 3NTVA 5CM2Z 2XVAA 4PYIA 5DTMA 1L3CA 2IFTA 5LQCA 2QE6A 5LSAA 1IM8A 4MWZA 5DXAA 4RTNA 1O9GA 3R9XB 4ATNA 5CUQA 3JWHA 4PNEA 5JR3A 3EEOA 3CBGA 4BLWA 2P8JA 5EC8A 3A4TA 3G5TA 3PS9A 1N2XA 4CKBA 3LPMA 1VE3A 4QDJA 1SUIA 3KPWA 1P1CA 2OZVA 3ELYA 3MCZA 4IV8A 4NECA 1EJ0A 1FBNA 5F2KA 3E7PA 2JHPA 3NW9A 3OZSA 4RVDA 2ZFUA 3VSEA 8MHTA 4F85A 2HTEA 3MGGA 5K03A 2O06A 2ZWVA 4CKCA 2V74B 2HMYB 4A6DA 3BWYA 3PT9A 4PCLA 2B78A 4ER3A 1KHHA 3QV2A 3B3GA 4ISCA 4PYNA 5CVUA 1WS6A 2OB1A 4MHTA 3HVIA 5CD1A 4YUZA 3CKKA 3AXTA 4HG2A 3V97A 2WA2A 4X1OA 1KIAA 5G02A 5LQKA 2BM8A 1L9KA 2NXJA 3DLCA 4GOOD 1M6EX 1F38A 3PB3A 4MIKA 1SKMA 3BT7A 3IHTA 4XUDA 2EG5A 2VS1A 1I1NA 5FA8A 5FWAA 3NWEA 1WXXA 4RTKA 1RJDA 4O29A 2GPYA 3OE5A 2C7RA 3KQVA 3FTCA 1EQAA 5FHQA 2DULA 5DSTA 2VZ9A 2OXTA 1JQ3A 1V39A 2PBFA 3B7PA 2P3LA 3UWPA 1BKYA 2ESRA 2BZGA 2PVCA 1XXLA 5DX0A 4PINA 3G7UA 3NWBA
chains in the Genus database with same CATH superfamily
2JQEA 3M81A 4QU5A 3CROL 4LBVA 2BW0A 5DN9A 1DOZA 2MSWA 4RY8A 3H8VA 4BFXA 4ZC8A 2WD7B 5K8VA 2LCIA 1A72A 3UWSA 4DIDA 2QUHA 2PLRA 2EJTA 1YA4A 3N07A 1GRRA 4PFJA 3T9BA 3G0OA 3DYVA 4J1SA 3WQSB 3HBAA 4COKA 3GQBB 1KP2A 3KYIB 2CL7X 2XZDA 1U8XX 1WKBA 5F98A 1S8OA 2GD0A 2FN9A 2PLAA 2VNIA 3CMMA 1Q2XA 3AHGA 4C1NA 3RT9A 2QBYA 4QD3A 2RAPA 3GDFA 3KSUA 1OH6A 2E6KA 3FUUA 2O57A 3EIHA 1OUMA 1SWVA 3OOWA 4E5SA 2O59A 1AU7A 5EPUA 2E82A 4C6TA 3RJ9A 1XRNA 4ARIA 4RJLA 5DM4A 3HU1A 4P5PA 4NDWA 2O4CA 3PTAA 1X3LA 4HDCA 1IWOA 1V3QE 1YQXA 4FN4A 3U6BA 3PZRA 1OZHA 1JLKA 1ZIOA 4D25A 2PZAA 2Y1OA 1ACLA 2OENG 2SNIE 4Q3LA 3MUNA 2OVFA 1MEJA 4FFNA 4G0NA 4BV8A 1YONA 1KYVA 1ULAA 2HB6A 2I3DA 4XIFA 3Q41A 5M5BA 2C2OA 2DGDA 4YCJA 1XZFA 1OXKB 2GK7A 3RUCA 1YRHA 1IOZA 1KETA 5KWJA 2GT1A 3NYRA 3H9JA 3R41A 2GN8A 3AR6A 5CDHA 4FBIA 1SU6A 3ADOA 3TAHA 3D6UA 3WNVA 4US2R 4LVCA 2XCSB 1U0BB 5EJ2A 3EY4A 4BUZA 2UYQA 4J4HA 4N1AA 3HB5X 3TSWA 4AECA 3KALA 3GYGA 5JH7B 1QONA 2WHPA 4GMXA 4GOMD 3WSTA 3HG7A 3UAOA 4DLLA 3SQLA 2ZI6A 4BGVA 4P0QB 2GTPA 3FHOA 1MT3A 3DBHB 2QUZA 3DVLA 2KEIA 3WAJA 3R8FA 4UUNA 1YR6A 3TOZA 1XZPA 1GCOA 3K0CA 3M3HA 1J0CA 3AM3A 2QTCA 2PA0A 3S68A 3WRXC 1RWKA 3ECAA 3FPCA 4TX1A 1ADJA 3PQ2A 5HKAA 3AERB 3LY8A 3O8LA 5HRUA 2OR3A 1KEPA 1M6VA 5CFNA 3QLUC 1IIRA 4GU5A 4MW2A 5KOJB 1QC5A 3SZOA 1OI2A 3TWOA 3KSRA 1EFRA 3IOMA 4YV2A 3AHFA 3IEVA 2HBQA 1DZ3A 3IEPA 1WE2A 1TYDE 4B7ZA 2I4LA 3GRZA 3F46A 2H1LA 4D8YA 3RFXA 2PBZA 4YRMA 2PZMA 5A2QA 3MTBA 3EIFA 3FLAA 2JEOA 3IBGA 2JA1A 4CFSA 2FMFA 3LL7A 5ICCA 2GF0A 2YNMA 4YP9A 4YRGA 2FHSA 2IEAA 3ESBA 4HADA 4LDPA 3T9AA 2EBHX 2MQKA 2VNAA 1DV1A 4UW9A 3WKCA 5BUZA 4L2IB 3VH3A 1RYZA 1CY1A 4MVJE 4N3AA 2O3QA 4OKSA 1HE3A 2EX1A 2WTEA 4FFPA 4MV4A 5H7XA 3GC6A 4IEIA 3U17A 3JXDL 4OK6A 4AP9A 4P9NA 1N9GA 4F6CA 3K9LA 1NXPA 2O2SA 3DLPX 4CIVA 4EVRA 5INTA 1BVHA 4RF5A 1W88A 2X6QA 4YREA 4Z9FA 3MLEA 4EX6A 4V03A 1CUGA 3C7DB 3CUTA 1W29A 1SC3A 1FDWA 1XTPA 4JEUA 4QE3A 4ZU6X 1Z34A 3GWGA 3TK1A 5JZVA 3LX8A 2X40A 5B1EA 2O8CB 2FF7A 2BEVB 3E82A 4JLUA 4CV2A 1FP7A 3G1UA 3D1VA 4GQMA 2X0JA 2QNIA 5ICFA 1YDEA 5EE5B 1V35A 2IXDA 3F5FA 3JQBA 5KYKA 5GPBA 4XX0B 2AH5A 1YR1A 2Z8ZA 2XCQA 4J7CA 2YL2A 3WXBA 3LLUA 4F1WA 1WUHS 4Y6RA 4J9VA 3U81A 5GOZA 3F3KA 5CLHA 2ARKA 1QF9A 2KBFA 1QHIA 1VRCA 4B9AA 5JXGA 4C03A 4UM5A 3OJXA 4XAQA 2VA8A 4CM5A 2OAP1 1PHRA 2VZLA 3AOEA 3FJOA 4XEHA 1E0SA 1L7EA 4RTJA 5DWVA 5EKTA 1EM8B 1GFIA 4IIBA 4CJXA 4X00A 3WGNA 1RQGA 4MQFB 1L7AA 2RKWA 3MGBA 4E2XA 5KNDA 1M72A 4NC9A 5LN1A 1MLDA 1DT3A 1G55A 7MDHA 3Q3GE 4M37A 5FFMA 4QPPA 3GUHA 3CZMA 3ER6A 3VR5A 3ZJ4A 3QFIA 2PR7A 1OYOA 1AQIA 4FR0A 4UHCA 1IQUA 4MI9A 4UDXX 5TQ0A 1LBQA 3CM0A 1NUSA 2Q50A 2AE1A 1FX0A 2W6JD 5I5EA 2VRWA 1UBFA 3QWGA 2VDLB 2VF7A 3AJAA 4L07A 4N65A 4RSMA 1VL8A 4RF2A 5CGQB 3TB6A 3TE6A 2VDWA 2WY2D 4YYZA 2NU7B 4Q3AA 4KN6A 1YVPA 1F0PA 1OF1A 1UMKA 1SBYA 2PWAA 5JS6A 3O1HB 4HB3A 2O8EB 1WVIA 5A5GA 1D09A 1PKEA 4I6UA 1E2LA 1FTYA 4J0EA 3ORQA 4GEGA 2L82A 2LR0A 3QQPA 4IKOA 3F71A 1SCIA 3MQFA 4DDWA 5KQPA 5G53C 2FW8A 1TD9A 2VYNA 1Z4PX 4MEJA 1LJUA 2Y0DA 1G2OA 3SHFA 2XDQB 3DOUA 1M1NB 2QRZA 2XEXA 1E3TA 5EE0A 2QN6A 5EOVA 3G7NA 3CH5A 3BULA 3EWAA 4P4TA 2B92A 1F06A 3DXZA 1G7SA 3KKZA 3O2QB 1N0IA 2C1ZA 4A15A 2C7VA 1U9IA 3ITKA 1KOJA 1BCSA 4P7GA 4LC1A 5LYJA 5B55A 4X97A 3SX4A 3OEYA 1KP3A 1ENPA 1PJ2A 1Q7BA 2D0OB 2D62A 1UPUA 1SIWA 1Y7TA 2J48A 3N6XA 4EG0A 1D4OA 3H7AA 5JDCA 1CRLA 3I4LA 3HKBB 1XC7A 3HVJA 4K46A 3ERCA 4DB2A 1WB4A 5IH7A 4DYDA 4LZOA 2ZRJA 2RHWA 4X20B 2C4MA 1V45E 5AI8A 1J2JA 1NKSA 3SHQA 1SA0B 1I33A 3AR9A 3SXUB 1JQAA 1SKQA 3QU4A 4UJ5A 2JGDB 1J0DA 1KR5A 3L4BC 4XGNA 1C3XA 4YCCA 3EEFA 5KTKA 2UDPA 3AIIA 1LD3A 3BD7A 4IFBA 4JC4A 4NFLA 5DHFA 3VSDA 1KERA 4LDZA 2E6UX 2BHRA 3PEWA 1DVRA 3R7WA 3DZKA 3MN1A 4UEQA 1J0EA 3MUEA 4MDFA 1RJGA 4W1RA 1C3JA 4B73A 4JQCA 4XQ9A 2QD1A 1P4HA 2PMDA 2VHWA 1Q0QA 2Z95A 4RMJA 1MQ8B 1ADYA 3H5IA 1ZD8A 5BMVF 3OCJA 3QJGA 1OH5A 5L4SA 4LFCB 2VHXA 1GG9A 4G07A 5KDDA 2AB0A 1M54A 2P68A 3K94A 1W9HA 4P3XA 2J3HA 3KJFA 4AMZA 4GKKB 4FDVA 4YLEA 2WU8A 4W63A 1MMFB 1N75A 3TNFA 4C9BA 5ARDA 2OHHA 4N7MA 1SJ9A 3FDZB 4WN9B 1OROA 5DIFA 4R01A 4UJ3A 3RS2A 2MHCA 4U7PB 1V5GA 3NATA 1U3WA 1JFFA 2OORC 3HBMA 3U7IA 1A7AA 5L45A 3F4LA 4FQ5A 3M5PA 3F47A 3U09A 1JIIA 4QTYA 3HP7A 1M2WA 4ZQHA 1Q20A 2E85A 2NSHA 4HDSB 4IDFA 1RQ2A 1KIMA 4L95C 1SB8A 1JHOA 3FWHA 5HA5A 1Z0KA 1RRMA 1UBJS 3GUVA 4B5LA 1C7JA 1JXAA 2JPDA 4DEYA 3W4IA 1FFXA 4N6NA 2EP7A 4Y9TA 2H1HA 4FINA 4L08A 1UXIA 5FD8A 1EE9A 2QL7A 4J16C 2PH7A 4MVJI 4TTIA 5EZ6B 4ANFA 3FTPA 3WV5A 3R3HA 4CDMA 4HBGA 3R7LA 3UHAA 1DRJA 3P2MA 4OMCA 2FCAA 4Q4HA 4DLPA 2HBRA 1BWRA 9GPBA 3EZYA 4Q1VA 4F3TA 1JYFA 3RNLA 1IUOA 3R44A 3S1LA 3TLZA 2P1DA 4GQAA 5HJEA 1N33B 1VDZA 3DE0X 3IBFA 4X7BA 2DPHA 2Y1WA 3KHUA 4OJMX 1A88A 5FTKA 3IAS6 3U4MA 4E12A 3C0KA 4LZLA 3HKCA 2J31A 3I1JA 5EESA 3G9TA 2NUAB 4DBVO 3Q9SA 1EIWA 1RHQA 1T1GA 1CBUA 1U9YA 5JC1A 1P1RA 1KOLA 2H59A 3NWOA 4XFDA 1G66A 4BVEA 1E1RA 2GJSA 4I4TA 1WP9A 2XTMA 1N8KA 4FN5A 5CYGA 1C30A 4ZO6A 2MYUA 1OKKA 1LX7A 2JIOA 2GRUA 3IHLA 1U63A 1VJDA 4H17A 4NNJA 4EEKA 4HAUA 1EWYA 2RHOA 3ASZA 4BVLA 2WJIA 1YFJA 1CIPA 3QEBZ 3IDFA 3G2JA 1VL1A 1EGMB 3EIEA 5ITZB 2WSLA 3FRIA 1GGEA 5FLXA 1XZNA 3ME5A 4Q4AB 3ORYA 3DFMA 4DLXA 1TA4A 4F3NA 2LCVA 1ZGGA 1J07A 1LLIA 2VDRB 1LRKA 4RAOA 5T64A 2B7BA 2XECA 1XLVA 4M8IA 3ADCA 1RKVA 1T5OA 2OLJA 4HXEB 2G9QA 2YV3A 5SZHB 3NDIA 4YMUA 1SWWA 1YUNA 3JWGA 3GOQA 4JLSA 2UUCB 2DWOA 4Z4QA 1FEZA 1GNVA 1QBGA 3DYBA 3RFCA 2YJTD 3K05A 3PQ7A 2WUGA 1Y37A 1ZJ4A 3PXDA 2PGIA 4UBJA 1G5PA 3R0ZA 4OHCA 2QUBA 4MCAA 4BWGA 2VK8A 3S3TA 4CI0B 2R97A 2VPXA 4L6CA 1OFVA 4E5MA 1YWGO 3PQCA 3V33A 1T2EA 3HVHA 2F9LA 1DO8A 2CKDA 2D13A 2HK8A 1BKDR 3FMGA 1ZBQA 2QT9A 1AF4A 1M2JA 1T1JA 2AVDA 4OYRA 4Z3KA 1MHTA 1M1UA 2O8VA 5K3BA 4BE7B 2IPLA 2WJHA 1AS2A 4MP3A 5KTNA 2FQ1A 2P9TA 1HQKA 4PVCA 5AOAA 4JD5A 4LY3A 1FMTA 2XX3A 1YTLA 3EGCA 3GLUA 2QZJA 1T36A 4C4PA 1VYHA 5BV7A 5LP6B 3RIHA 2PX5A 2SECE 4WXRA 4V24A 1FVHA 4B4OA 1AKQA 5IJ9A 4C3ZA 1NSFA 4B6FA 1IY0A 1XXHA 2FUEA 1R3DA 5E7MA 1ZICA 4KLRA 3NBUA 3FGPA 4MUFA 1ZW1A 1A9SA 2I0FA 1WUYA 4R7TA 1ZIDA 2H7CA 5BYKA 4CCWA 3KD2A 1ZZCA 1X2LA 4JVSB 1R5BA 4R68A 2B8JA 4ACAA 1WD5A 3MWKA 1AHNA 3C87A 1MJGA 4A4DA 5KOJA 1AMUA 4NBRA 3GJRA 1U4OA 4F1KA 4FNAA 3Q8LA 3MVEA 4Q3DA 1QLWA 2FQQA 2QP4A 2FR0A 2LKCA 2YMLA 3A2NA 3D4IA 3EUSA 5ARBA 2A5JA 4EUNA 1U5BA 3UUGA 3FZEA 4D0RA 4DLNA 5HKKA 2CFSA 3SE0A 3ZDQA 1PJTA 3BERA 3QU2A 2XMBA 1E1MA 3GEDA 4KH1A 4MDEA 2C00A 4OHPA 5LP1A 4R2LA 4C2AA 3FZQA 1IY1A 4DLKA 3FNBA 1WETA 3WL4A 3IKLA 3NTVA 1Z15A 3GVHA 1Y5MA 2OZLA 3QRWA 1YVDA 4IGIA 4ND7A 1PN3A 4BMZA 1MH9A 1UXCA 4RTNA 5LP6C 1GPAA 1YSCA 1IBCA 5EC8A 4WJLA 4XDYA 1VKOA 3RREA 3IVGA 3WWYA 5MN5A 2CEAA 5JVDF 1FQOA 1MKYA 1PR4A 4KO8A 1E5VA 2HPZA 4ZVKA 1HZJA 3MTJA 2QE7D 4RW0A 3PWZA 4BZWA 1NUUA 4EUKA 3W2EA 1DFHA 5DTEA 2ZP1A 3VKGA 1DX6A 2OCAA 3RAPR 4FE3A 5AKHA 3LK6A 3J81A 1CR1A 2R4QA 2ATIA 1L4LA 3I23A 1WS6A 2JAQA 1FYFA 1KBQA 2V0CA 3C48A 4DBZA 3CKKA 3V97A 5K1ZA 1E0KA 5EKDA 5FLYA 2KQUA 4R51A 1V8ZA 4G4IA 4P80A 4D79A 2PJRA 1KOGA 2BC9A 2J7PD 4Q48A 1JR6A 2WYOA 3HO8A 4PSDA 5H3HA 2C94A 5JLJA 3B1XA 1JBQA 3JZAA 4IXNA 1S0UA 5KYWB 3PFFA 1I1NA 1M34A 4Y6SA 1O9BA 3B3QA 5EAIA 3PFIA 2W2KB 3G2NA 4TVKA 5F7OA 5IT4A 3ZHQA 1KC3A 3MWGA 2AJBA 2JIMA 2ON6A 2DULA 2X9GA 4C0BA 4YWHA 4WUVA 4JJ8A 3HV2A 3NHSA 3ANYB 3AUYA 2IYQA 1SOMA 1RJ9B 3FMYA 5KX5F 2QX8A 4PZ0A 3LT5A 4BNHA 4CFYA 3W3AH 5THXA 1USGA 3HXTA 3GRVA 1YI8A 2B6HA 2IXTA 5F1KA 1T9GS 1Y9AA 3FNFA 5JMOA 1WDKA 1RP7A 2GAOA 4UVIA 4YRBA 4RPLA 1KWGA 1MOPA 1QP7A 3AO0B 4ER5A 5G3ZA 3KZCA 2EG9A 2IEIA 2HHJA 1CUXA 1QVZA 1UBHS 1YAJA 4KU4A 3TOCA 3KZVA 1H94A 4GRAA 4H3VA 1GTVA 2C2XA 4PXYA 3BIJA 2R8RA 4HWSA 5E4FA 1PYDA 1VIMA 4MRVA 1B8PA 1W1WA 3A2KA 4UNNA 2R86A 5IC5A 3ZLTA 1R9NA 1LI4A 4BZZA 4X7PA 2EW1A 1VCNA 1F20A 1UFQA 3R3SA 4LBZA 3SBXA 2LNDA 3D3QA 1DC4A 4II3A 1JHQA 1NVEA 3KR2A 3WB9A 5I9IA 4G2TA 4RLFA 5JCJD 1TC1A 1T5HX 2AOVA 1RADA 1OAOA 2PX3A 1HM5A 2CJFA 4G5GA 3H9UA 4HNAB 3DVSX 4O2AF 1QH8B 4RA6B 5DYWA 3T7CA 3WQQA 1BVUA 1OWMA 1ZN9A 2V4ZA 3U40A 4E1BA 3L7JA 2AK2A 2VA9A 3QMMA 5FBHA 3PKJA 3NWPA 2XI8A 3RBVA 1Z3IX 2Z8YM 2F4NA 2ERYA 1HKHA 1RWOA 3B7GA 2I91A 5KYUA 4AYTA 2RCNA 4JQSA 1SHTX 4KFTA 1YULA 3NGXA 1UEXC 2EDCA 3H4VA 2FA9A 3SJCA 1IG3A 1P9LA 2CLMB 3ZDZB 5GJVC 3H6GA 1JJBA 2VATA 3W7AA 1BRMA 2X4GA 1KVTA 4EIWA 4ZOLF 2BFNA 3CTMA 5BQOA 1ACMA 2WF6A 4PLFA 5J43A 3PPYA 3K9FC 3N2IA 4LF5B 4Q37A 2VEOA 4JYAB 4H1TA 1RZRA 3G5AA 3QF4A 4O8BA 2J3JA 4FOSA 4L5JA 2C84A 1T6YA 1WZUA 4Q1BA 3BS4A 4RETA 5B7PA 4X66B 2JLUA 1G64A 1RLIA 1TRKA 1PTJA 3TRIA 3BFXA 3UT0A 5LA6A 2DUNA 5AVVA 2A5FA 4U8HA 4ZIRB 4UTXA 4GHWA 1NI4A 5EJFA 3QE4A 2ILTA 4BTEA 2AEFA 3NNNA 3WDLA 2ZB3A 2YS7A 1LB1B 4P4UA 1H9AA 3OBBA 4ETMA 3LFTA 4EFLA 1CUSA 2QAGA 1TO2E 3KV3O 3GHYA 2X9QA 1H9BA 1M6YA 5CBKA 1RBZA 3H75A 3HDGA 1QX3A 1XUOA 5FL7D 4EB6A 1RQNA 3IOBA 1EDBA 5IJXA 2RKOA 4QTZA 2XXJA 5CJ2A 3DWFA 5H68A 5DW3A 3LQ4A 3VR6A 2IF0A 4V02A 4QUGA 3ZU2A 3JPWA 3EEBA 2C59A 5CYFA 5ALUA 5FYQA 2VP6A 3M2TA 3R3YA 5IKMA 4TXLA 5MN6A 4Q3KA 1B42A 3PUXA 1Q83A 2ZE6A 3AEUA 5FPQA 3RKRA 1XZJA 1VG0B 4IKPA 4KOEC 4FJ2A 1LA2A 1W581 1J6UA 1RBYA 1XZKA 2A57A 5FOXA 2OXIA 4BWFB 1UBUS 3IQFA 4WN3A 5DSXA 1YI1A 3ZWNA 5BW6B 4QJIA 2JLBA 2WFLA 1N32B 3PXPA 1DIBA 1NUHA 1T5DX 1L4UA 5ALNA 4DA4A 4LF6B 1GU7A 4G67A 4LC0A 4Z4IA 4OQZA 2QP3A 8LDHA 3IUYA 4OBWA 5IWCA 4N0EA 2QXYA 4PYLA 4KGDA 4Y2QA 2P4EA 4YWJA 3ZHMA 2G67A 5LQAA 3KR0A 4QVGA 1SG6A 3WKEA 3T9CA 3WLMA 1EFAA 2VQSA 1GUFA 4GI1A 3IT0A 1XCJA 4KX5A 1XJQA 4MKXA 1L5GB 3OFKA 3NUQA 2WTXA 4GWLA 3C8MA 3OCWA 3Q3JB 1JHDA 3W5VA 2JJ8A 3ANLA 4G0ZA 3Q2KA 4QOEA 4I4LA 2M1ZA 4CEIB 4RF3A 4URXR 4XPZA 3SWWA 4RC9A 4PZEA 3TW8B 4Z4CA 3FSJX 1KARA 5AW7A 3GBVA 1CF2O 4NZYA 4N3NA 5CXQA 4ASUD 4BBZA 2BKXA 1YO6A 3RLIA 4H6PA 1OXVA 2FVXA 4NZ9A 3DTVD 4V0OA 3T1YB 4ECAA 3FOBA 2JCSA 4FD3A 2IBTA 1H8EA 2V0NA 2ZUFA 4R8RA 1E1QA 3CUSA 1LWOA 1J1ZA 2IUEA 1BD4A 2Q7DA 3ETDA 2PXUA 1YQTA 1E6WA 4KN8A 2L69A 3RGGA 4CKZA 3N8DA 4MR7B 3OLWA 4IIEA 4ZOCA 1F7VA 5C3UA 3HWSA 3G59A 3GJ4A 3WLSA 1UAAA 1Z17A 1XZDA 2CSUA 2VHUA 5IT9A 4PAGA 1BFUA 1BQ4A 1IEXA 5DBOA 3GA0A 4ZAYA 5TJHA 4XCVA 3WBJA 4CMBA 4ND4A 4ZODA 1WNFA 1C2YA 1LQ2A 3B5JA 2A33A 1BC5A 2KB0A 2ZIAA 5HE9A 5FOVA 5L7TA 4TROA 3JAWB 4LHYA 4GMDA 1ISRA 3GDOA 2HNBA 1V5IA 5B6PA 3EH2A 1SHJA 1JG2A 2R96A 1OC2A 1P1IA 4MWGA 4ZTUB 2F7SA 3PFHA 3V4ZA 4WKBA 2DPGA 1Z4KA 2D74A 4M9RA 4AIIA 5CJPA 4CG2A 2FJPA 1T2CA 2VTVA 1DARA 4HH4A 4BNVA 1Z75A 2LTAA 4EO7A 2IJGX 5U9CA 1L7OA 2JAUA 2ZJYA 3I6ZA 4AB1A 1S2LA 4NOLA 3T7SA 4EYSA 1EUQA 2Y6VA 1TT5A 4JFRA 1ENYA 5K4AA 5L3SA 2H1VA 4MMXB 4PPQA 4FGWA 5CFMA 1X13A 2AXVA 2D5AA 2ZWMA 4IM7A 3I5MA 4DV1B 1Q7GA 1HE1C 3VHRA 4EFNA 3B7HA 3RFTA 3HZRA 1H2EA 1DG9A 2PZKA 4GI3A 3HU5A 3VWSA 2CFOA 3WHLA 3FUWA 3K32A 5CB6A 2EBWA 4M4SA 4DA7A 3L2OB 3NT2A 2G3YA 5J4VA 3F98A 2REBA 2VLBA 3UYKA 1KBOA 3GR6A 2FR8A 4JYMA 1UM9B 5C4IA 3HBNA 3P96A 3SC6A 3QVLA 4JGBA 4AQYB 3ZCTA 2RHLA 3NDPA 2NPFA 1E96A 3L01A 2BGJA 2DPXA 3H18A 4LXHA 3A1UA 2D1RA 3H84A 5FOQA 4ZQEA 1I94B 5F3WB 2ODPA 3CLVA 3IUSA 3UOAB 2HC9A 4URHA 1QDUA 4EA8A 4F8EA 2AF3C 4XVCA 5ALFA 4EKGA 1UDAA 4LGCA 1NQWA 1QCDA 1YB2A 4NU0A 2JLZA 5ILQA 5JY1A 2CVZA 5T67A 1JMYA 1USIA 1EM6A 3LC0A 1Z4OA 3ANSA 2VBGA 3AJ8A 4KZKA 4JBHA 2PKEA 4NEQA 1RWBA 1JQ5A 4JP5A 2VCHA 3GVXA 4KUGA 2JD2A 4J0FA 3PIRA 4L0QA 5K3AA 3T3EA 1DCTA 5CH8A 1EX7A 4YI3A 1EVYA 3AHHA 5T4BA 1U5CA 3WBKA 3P9YA 3W5JA 2PO5A 1T8TA 13PKA 5J2UA 1NF9A 3BD6A 2H5IA 3DE7X 4Q3OA 5FLKA 3W6PA 4DW8A 3D5QA 3JVUA 3UHFA 1QJCA 2CXNA 3VDMA 3CTPA 2DWPA 3KHKA 3X43A 3MJCA 1MNQA 1S2DA 2PZJA 2ZATA 3QPBA 4Y2YA 4D6PA 3G9XA 3P0RA 1XVVA 3QK7A 1R4AA 3K1AB 4L73A 2R66A 4E13A 1CQIA 3IIKA 4UU0A 3BB1A 4YRPA 2PAFA 4XSGA 3R9KA 2FV8A 4TMWA 3WFJA 1QAQA 3OF3A 1JQEA 2E49A 3V9PA 3WK6A 1XPUA 3WGQA 3K0BA 4A23A 1JHXA 3VMFA 3W06A 1DW9A 2ECQA 2NQTA 3ACDA 2IHKA 3NBQA 1J0XO 1DO2A 1MG5A 4KQXA 4EHAA 5AKYA 4FYVA 4AG5A 2OV4A 2WWXA 3FVQA 3T1VA 2Z56A 4Z5CA 2RGXA 1R6AA 4XI9A 3DOHA 2AXEA 3T9DA 1OH7A 1PT7A 1M8KA 2ZLBA 4PO8A 4PX3A 1NJ5A 2F00A 4NFSA 1R7RA 2Y9PB 3IKVA 3T99A 5FDFA 3NXHA 1PG5A 1E5DA 3MIZA 4B3JA 3VR3A 4TQUS 1OB5A 4DEXA 3P52A 4PLGA 2EF8A 5C1PA 5ALYA 2ZT8A 5FJIA 1GGJA 4CQMA 1A76A 2LDBA 1ZD4A 3GQVA 4IQFA 1Y9EA 3IV7A 3IQGX 4IG9A 2J3DA 3JZMA 3T95A 1Y3FE 3EZGA 1E9FA 4D42A 2Y0EA 1KMMA 1T8WA 3ANNA 4IP0A 4IVRA 4Y8VA 4MVJF 4GBED 3V1UA 5WRFA 2VSXA 1H05A 1L5OA 4EDFA 1FJGB 3BFVA 4HFNA 4AXBA 3C3MA 3GGJA 3KT3A 4XW2A 2NXWA 4P81A 5K4GA 4KQMA 2PZ8A 1X80B 2QMQA 4G25A 1QBKC 3TDNA 5CYOA 1J5PA 1XDSA 4DR7B 4AC9A 2WWWA 1HT3A 1RXWA 4DXHA 3G9QA 1WH6A 1JIUA 4Q4DA 4XUCA 5DTRA 1JN0A 5D87A 1U6JA 3PWKA 2PXQA 2C3UA 1N2CE 3RC8A 2GYYA 2XLCA 1Y9QA 4WY2A 3NTRA 1UF9A 4REQA 1FQJA 3BL8A 2A14A 2C42A 4QRHA 3QENA 2O50A 4I66A 4M0DA 1PRUA 5LQMA 1KI6B 5IYZA 3VKUA 5C7OO 2BR5A 4LKRA 3IPLA 4WESA 2XOEA 5ALGA 1Z73A 2HIAA 1XNRB 4DL9A 5IJ0B 3CIFA 2FCRA 2XH8A 3ESXA 4OK3A 1H85A 1KYIA 5ICEA 4HFRA 1DBPA 3PFGA 4Y9RA 4JLAA 4FMDF 3L6EA 4RUKA 2JIZD 4NJEA 3R5SA 4MYHA 5DBHX 3V8BA 1Q19A 4C2BA 2JH3A 3OSZA 1L5MA 2WG2A 4J03A 2ZTLA 1CIVA 5TARA 2XUPA 3SIWA 3FLMA 1JXOA 1K5GA 1I7DA 5C8YF 2XE4A 3T9EA 2NU6A 4DPMA 1FPMA 3SF0A 1RLTA 1XNGA 1AE1A 1VJCA 4C78A 1WZCA 5KSYA 4H0NA 1QYVA 1IXRC 4IOJA 1TPZA 4XFKA 4HUQA 5D8DA 1WW2A 5BQPA 4D98A 4D97A 2GERA 1IJFA 1P1BA 3UXHA 3NHMA 3PGVA 3R0VA 4TGLA 3PPIA 1O5OA 2CNLA 1LW7A 2FE1A 4UHFA 4ZK2A 4C5CA 5DBGA 3LA6A 4KQ1A 4HMQA 4YMTA 3I9LA 2VYFA 5I4CA 4AS3A 5G1NA 4HLUA 1ZLXA 3LOUA 2QT0A 3FPEA 3U39A 3P9PA 1TCCA 4G37A 4CM1A 3BDNA 2O52A 2Z0MA 4KI0A 2GEJA 3RADC 3ZS9A 3AR3A 3CB4A 1SG9A 3QU9A 2QVBA 4IUCS 4MEBA 4YHHB 1OXXK 1V8FA 2Q0QA 5DWDA 1N57A 3TIVA 5C81A 3KLBA 1KSJA 4ZYZA 1VI6A 4XVRA 1FFHA 2Q5OA 3H16A 5EGSA 1P45A 3HH8A 1D4AA 3C70A 3R40A 5SY9A 2PKQP 3LVBA 3RRMA 5IPFA 4CL8A 5CP8A 4JKYA 3KOMA 5CITA 4J49A 2O2JA 2D2XA 4YASA 2FU5C 2O20A 3MS2A 2XMZA 4GLJA 4CMAA 5IM4A 1B14A 3VDRA 4CZ2A 2UZ1B 1Y7PA 3K6JA 1L5RA 2WQ6A 4D5EA 2IOQA 4CMIB 4M6WA 3V8QA 3UK7A 1WRBA 2VL7A 1SXJE 3H3FA 1GQ2A 1I7LA 1KYWA 4MPTA 3UBMA 5D7NA 5ARCA 4YJ2A 4N0DA 5BW5A 4KVFA 3ETNA 3IS3A 4PZDA 1TEZA 2VOJA 1UKVY 4YN3A 5FTNA 1QGOA 4IJMA 2B69A 1KGDA 1N6RA 4MQEB 4DNXA 5LOVA 2P65A 3W90A 4UNSA 2XCTB 3S2FA 2BH9A 2QE6A 5AH0A 1IM8A 1TA0A 3PE5A 1JR3D 1DQRA 1C7ZA 1QXSA 3K8YA 2QT1A 3CNNA 5JZMA 3EYWA 4I9NA 1SVLA 2N0SA 3IC5A 2NUTA 4R2WA 1IZ8A 3TECE 2IU7A 1LPSA 1Z45A 4ZJPA 3MCZA 3WP0A 4E5UA 5TQJA 1MDBA 2BFWA 4PV7A 5JAHA 5H9VA 4TQ9A 3UUFA 5F2KA 1P7ZA 3DL4A 2MMCA 3QWFA 2V6MA 4Q4AA 4I1SA 4KSBA 1JALA 2CVOA 1EBUA 3BCHA 4DRXA 1E2JA 3WLTA 4J4TA 4LNUB 3QIAA 1YDHA 3GN2A 4NEHB 4ZQFA 1E4OA 5EMHA 5K0SA 3P0HA 4R9SA 2XDQA 4YJ3F 1QV7A 2QRHA 4KQEA 3TTVA 1AQ6A 1H6DA 5K7SA 4OGLA 3FBGA 3PGKA 1ODCA 3LGSA 1CT9A 2VCEA 3AXTA 4PSVA 4DTCA 4EB3A 1ZXXA 1XLUA 4RPCA 2XTAA 1QHFA 5E2IA 4DDMA 3H0CA 1QVWA 3NEJA 2FQYA 4LBWA 3P0IA 4LJSA 5E3JA 3ICCA 4GVPA 4TTTS 1Y8RA 2DY0A 4L76A 1DAOA 3B6MA 1V8OA 3HZOA 2XSZD 4F2GA 4ZAWA 5EERA 1TE2A 3AUSA 3WLLA 3GVPA 1EVLA 2G5TA 2ZDHA 1FQWA 1Z6PA 2XWQA 3DMDA 4IVPA 5EIXA 3A9XA 3C3WA 8OHMA 2X0EA 3M5DA 3K70C 5IK2D 1LK5A 2B3DA 5EFOA 2V7WA 5HKLA 1QIEA 4WRRA 1PRVA 1BWPA 5FPSA 3BYZA 4JJEA 3DKVA 4KN5A 2XJ9A 4TKMA 5L40A 1CNEA 1UXHA 3CVJA 3VX3A 4EKIA 4RWEA 1KMNA 4WDRA 3P5SA 3L0SA 3LC2O 4YRTA 3KSMA 3IH5A 1KKMA 4ZREA 1O94C 4MYCA 5JE8A 3PSAA 1ZK1A 2NVUB 3ZC3A 2H6EA 2O2EA 4CR7A 1XZ8A 2VHYA 5JS1A 3PQ5A 4R2HA 1POWA 4P86A 5DH9A 2NVWA 3VZDA 2FQXA 2L0XA 5L95A 2PXDA 1NW4A 2BHLA 3D02A 3KYCA 1JTVA 5KS2A 3ZWWA 1VMIA 3CLTC 1LU9A 1K98A 4KKXB 4DSZA 3SIXA 2H5LA 3DAHA 3TQTA 2HZ7A 1ZEJA 2CCJA 4HUJA 1E7SA 4Y1FA 4CIDA 5AM5A 3WLJA 5E95A 1TVEA 2BGRA 3W7VA 5EZ5A 1CJVC 5LZ2A 4OB6A 4TYQA 1Z16A 3MT8A 3FSGD 3NORA 2IDZA 1XMVA 1XKXA 4QFBA 4D0SA 3HUTA 2ZW9A 1KAGA 4OQ4A 2H54A 5B2EA 1CZUA 3C6KA 3L8MA 2MTBA 2PX4A 2FX5A 4JP3A 4KAFA 3SZLA 3GARA 4JB2A 2HYIC 2JEZA 4ZO8A 2W4QA 3L84A 3FH0A 4AL4A 3D64A 4O2LA 2VDPB 1QRSA 1RAAA 3O93A 1NFRA 1KNXA 3DHWC 1T10A 3VZQA 1JDUA 3QVJA 1PEYA 5B58T 1ZOOA 1NV9A 5KNCH 4OYHA 1UM9A 2DCMA 5C5IA 2B8TA 2CFRA 1FSSA 4FJ0A 1E3OC 3M83A 1N5DA 1N8NA 2FQWA 2ECFA 4HPWA 1RWQA 4AG6A 4JT8A 4CTJA 2H4YA 4WEQA 3GJ5A 3TAUA 5EINA 1YR3A 5AI0A 2YJ4A 1A7JA 2OM2A 3FTDA 1JHAA 3TZLA 3CT4A 3UXMA 4E4RA 1AN9A 1T2VA 5HM8A 4QU9A 1NVXQ 2AFIB 1VHWA 2H85A 2HFKA 5EE1A 3V8EA 1JKJB 1ZUWA 3T0FA 4MMZB 4ZCRA 8ABPA 2VTEA 3K6SB 1DJMA 1QB2A 3GGSA 3I1YA 3U6KA 4WECA 1E1KA 3HCPA 1EZZA 1Q0PA 2N47A 4RS4A 2IHJA 3AJRA 5CX1B 5IUKC 1CUWA 3WGOA 3CBQA 4PYJA 1X7YA 1VJGA 1HQ1A 1W36B 4PZUA 1HBJA 4OPMA 1GEEA 4BNGA 5JISA 2QJFA 5FHRA 4NBUA 3MSXA 1VHJA 3QKRB 4O0LA 4LI3X 4PCVA 4JVMA 2PIAA 3EAQA 4LI0A 4O1IA 4XQ0A 5JPIA 2C5BA 2EGGA 4EMSA 4EY8A 1V95A 1K5DA 2RGYA 1R4NA 1Y9DA 1FS4A 5I9LA 3T7EA 3TQFA 4V38A 3ROGA 1ZI6A 2J0EA 2RJNA 1CK4A 2BEKA 1NI3A 3D0KA 4L3VA 2H2WA 2J33A 1SQGA 3ZDCA 3F6CA 3U7QA 1CSEE 1H2AS 1M2EA 2C4VA 2JA2A 1BXGA 2OSVA 1N6HA 2VLIA 4X0EA 1WHSB 4TL7A 1NYTA 1WULS 2P90A 4TV9A 2IZ0A 1GNTA 3RT7A 2JEYA 4RK4A 1H3NA 4S24A 4J3NA 2YXLA 3JATB 4KR0A 1EGHA 1BMFA 2Q6KA 5JZBA 1KVRA 2XWJI 2ZS7A 3WLOA 3N6VA 4BATA 4IRUB 3TRKA 1X7ZB 1ZCAA 5KYNA 4YAIA 2C31A 1DIHA 3CCFA 2BNNA 1VQ1A 3HMQA 4OX9B 2LIVA 3R1FA 1WVGA 3UJ8A 2JHFA 3TUJC 4EATA 1NBMD 5BWBA 2LD4A 1Q92A 3BWBA 3VV3A 2IDMA 4E88A 5F1OA 3CWQA 2FFHA 4M9XA 4RSGA 1ECJA 3OEWA 5LD2B 4TYWA 2GHQA 3DWIA 5BOSA 4P7KA 2QQEA 5I9BA 2BFCA 1SQSA 4FX5A 2IVGA 3BJRA 2QM0A 1PS8A 1U8TA 4YK7A 3WIUA 5ECGC 2OXFA 3KIPA 3LTEA 3QELB 4M86A 1RPAA 5FUVA 4DJDC 4TV8A 4LSGA 3K5PA 1PD0A 3QE2A 4K81B 3V80A 5IAKA 1NVDA 2JRLA 2L1PA 5I7VA 3GFGA 3OO1A 2IWHA 4HWKA 4QZVA 4PS0A 4JCXA 3ENWA 4FVTA 4Q3BA 2JC3A 2IZ6A 1CUBA 4RPHA 3HJHA 1NG1A 3D1JA 1J20A 2AMFA 3AP2A 3BHMA 2FZCA 4RPKA 4RCVA 5BN4B 1Z35A 1LSSA 2IOFA 1EAMA 1G21A 3B9RA 3GGGA 1DC6A 2VUSA 3BMOA 3H0KA 3MMZA 3NHAA 5CLLA 3T06B 4UTNA 1HMPA 4BZQA 4IPTA 2GPJA 1GTG1 5CFLA 3KPUA 2D0PB 3FYDA 4MO2A 4BQFA 1Y1RA 4LJ7A 3WLRA 1UBNA 3U2QA 4BS9A 2MYPA 4GX5A 4DSUA 4IY1A 1UPCA 4JBXA 1GZ6A 2AI3A 2O23A 3H2YA 4AQDA 3D3WB 4EK9A 2IH5A 1SCDA 1JHUA 2XB6A 3RUEA 3KUCA 1UIMA 2A9PA 3GH1A 4K6HA 4XD7A 2ZJ8A 4CLEA 1ZITA 1U3VA 1K6MA 5FL7A 5JD5A 4MUEA 4QT4A 2A0WA 3R7NA 5CT9A 4ZT4A 3CEJA 3AGPA 3D54D 3MTIA 2QTAA 3LD9A 3VHXA 5I8WA 3K8ZA 3Q6IA 4O59O 4NDZA 4HRAA 3BCRA 3T7IA 2IYUA 3FDZA 3K96A 4ZJUA 2FEPA 5I7OA 4ZYVA 2R6CA 3GJ6A 4M9ZA 3HADA 3ZHCA 4BRSA 4JYBA 4WPGA 2QBYB 1Q0TA 4LFAB 2D59A 4FFRA 2VJBA 1SR8A 1RXYA 4KRYA 1LDGA 1IN6A 2B1QA 2WNIA 3I2GA 3M4JA 3N87A 4NVRA 1KO7A 3RUPA 4KWCA 2FR8C 4BIIA 5CB4F 4GW3A 4KH0A 1L5QA 3LKVA 3MLAA 4PGHA 4TVOA 4JN6B 4NPHA 4ZOQI 3LAWA 4EUEA 3FPAA 3TJRA 1EK6A 1F2DA 1RAIA 1X15A 1XB2A 3DZDA 1YRWA 5ICSA 2O8DB 2D1TA 1HEIA 2O54A 1UWCA 4I3FA 1QTRA 1I9GA 1LSOA 2GLUA 1U31A 1JG6A 2FKAA 4HS4A 1KYXA 2RHRA 3CVVA 3CKMA 3LRPA 1NAIA 2W70A 4OQPA 2WUDA 3BQ9A 3OIVA 1YZTA 1JIXA 3GF4A 4IEFB 4A6EA 5ERYA 2QMUA 2KEKA 4HLDA 2ACEA 1K8RA 1J06A 5IM5A 1RKBA 3H0EA 3THSA 3F9RA 1Q1QA 1G6HA 4LHXA 5EFZA 3U44A 3DAGA 2H3HA 3PD0A 4JELA 2ZS8A 3GG2A 3TCXB 5BN5A 3GLFE 3EZXA 3UICA 2VQFB 2PZGA 2Q4OA 1U6KA 5FA5A 3U61B 2R9VA 4AN0A 1T9HA 5BSUA 2PXPA 3GZJA 3QKIA 4B6QA 1G8MA 1JEJA 1FSGA 2VH2A 4TQGA 3ZUPA 2YX1A 2ZRMA 3ND9A 3MRXA 1MTOA 2O0LA 2NU9A 3UYLA 3EXAA 4L8GA 1IM5A 2ACKA 2X5XA 1H2RS 4GSYA 4RABA 2PXFA 4G24A 2VXOA 4JSTA 4QGAA 1MXHA 5DDIP 4BLSA 4EMBA 1D7OA 3DDOA 1EVEA 3KVRA 2IXEA 2JB9A 4MIEA 3ZXUB 3JWPA 1YQQA 4PWYA 1S6YA 2I76A 1D7AA 2DU8A 2OCIA 1NDUA 4NZNA 3ZKCA 1MABA 1SVKA 1JDNA 1WXDA 3OI7A 1S1MA 2YWFA 3PR3A 4LSZA 2GARA 1A2OA 1DUVG 5KZMB 5ENZA 2KX7A 3PUYA 1ISHA 5ALQA 3KPJA 2ZUVA 3O9ZA 3FMOB 5JAOA 3GUCA 4B6OA 4IL5A 1RYYA 3QFHA 4CDGA 3T5BA 3JQ9A 3OD5A 4CQMB 2J08A 3LOPA 5BVGB 1QUFA 1QLHA 1TK3A 4IXMA 2AG5A 5EVJA 3R7FA 1RAGA 2ZPTX 1DS6A 3H4TA 1X57A 2GJ4A 2CKMA 1F0KA 2PRYA 1OR8A 2BGLA 3IB6A 4GOXA 4O1MA 1S7GA 2C1EA 4JI0B 3PCXA 4RHTA 4RYDA 4JIMA 1NW3A 1T1SA 5ALLA 3U7RA 3NVKI 1I3KA 1EK5A 1IL0A 2W11A 7ABPA 1KO5A 1L7BA 4B74A 1X1RA 2EATA 2IRWA 2VJDA 1C14A 4NSNA 5FOUA 3SHWA 1CJMA 5FYDA 1E79D 5EIBD 1Q5PA 4AZSA 3G17A 3T5PA 1JDSA 2L49A 1Y80A 3DZ8A 4HY3A 4TPKA 4XJVA 4IFEA 1A8QA 4AP5A 2XB4A 3FSEA 5JD4A 4NBVA 2NXNA 1H3FA 4Z3DA 1XVTA 2FPUA 2QL5A 3LBNA 3WY9A 4OY3A 4MJLA 4RS3A 2BZ1A 3ZHXA 1JLLB 1Q3HA 3VR4D 3EHEA 1VL5A 5JD6A 5JYBA 1BTOA 1NNSA 4BFZA 4KITB 2DB3A 1V1RB 3GJXC 3CZ5A 3RUIA 2OZPA 4DE8A 2C58A 3NIDB 3DEZA 4F38A 4KUEA 2ZJ0A 3CNQS 3BH0A 4M1SA 2AW6A 2Q3CA 3UFDA 4GL4A 4L02A 4X54A 5AW9A 4HSGA 4BFYA 3T0GA 4F9FA 5EHXA 1BH6A 1YRYE 1E0DA 4RE6A 4IHJB 2ZJ3A 4X1IA 1NRJB 2B9VA 2FEMA 1LBIA 4HQKA 1VRVA 4S2EA 4BVHA 1X1EA 2R87A 1IUPA 1W1UA 2JFYA 2QR3A 3ET4A 2IWRA 3SYNA 4ZICA 1DPFA 4B84A 1NJ6A 1V71A 3G0GA 4DHEA 1X1QA 3CLSC 4ALJA 4EI7A 4OAQA 4ITUA 4Z2AA 1OY1A 5C1BA 1FU7A 5EZYF 1XD2A 5A5EA 1Q11A 2WA1A 1V96A 2D5BA 4MCHA 6Q21A 4Y67A 4A2WA 2GRLA 2ERXA 4XUEA 4BO6A 3SI7A 4DLYA 1RTTA 1THZA 1QRRA 2G9VA 4YV7A 3T3OA 2ZXEA 3BSFA 2LZ0A 3LPDA 3MOIA 4I19A 2GASA 4BJHB 2G4VA 1VMEA 1PFGA 4ZPJA 1RYMA 1S01A 2KPOA 3ORRA 3DQZA 4RHCA 3H2HA 3VDXA 3RD5A 3E5NA 1ITZA 2XCLA 2GAFA 5SY6A 1JWAB 1W94A 2AT1A 3DVQX 1XD2B 3MERA 1LS1A 4E07A 3C85A 3N76A 1CU1A 4I50A 4R41A 4PIPA 1QFJA 1ZIYA 3O7WA 2JFGA 3CE9A 3NTLA 4RVCA 5DT9A 3RM3A 3N8IA 3X2SA 4IZOA 1BAPA 1XTBA 4M87A 4Q03A 3IP3A 2DUWA 2X5NA 3BJEA 3QVKA 4R16A 5CK4A 4BP1A 2QD4A 2XE7A 4H18A 3A2LA 2A9KA 4TV9F 3WYFA 1E1DA 3I52A 1AVTA 5U1PA 5IU6A 4OI4A 4NP6A 5EP4A 3BFPA 4PZLA 3GJ0A 3AQIA 3F8WA 2M6RA 3VV2A 5I7UA 3ENQA 2LYPA 3L0ZA 4M0EA 4DABA 1SXJA 1MTZA 3E9MA 4LDJA 5B53A 3FBWA 1WV1A 4KDCA 3U0VA 2Z2KA 2I71A 1XYVA 1LH0A 4K9QA 2NUBA 5TQ0B 1N6PA 4GE3A 4L6AA 2ZRLA 3L7NA 3ABZA 1ZS9A 3EGXB 1E2HA 4QHTA 2AFIA 1XZMA 1VJ5A 4WEOA 5PNTA 4H7EA 3R9IA 1KJWA 3Q7QA 1UDRA 2VOEA 4K86A 4PHTA 2FWRA 4CM9A 3SK0A 4EYEA 2C9ZA 5I45A 1CQWA 1U7OA 2ZE7A 5DXJA 5KI6A 4RD3A 4BO3A 3KDSE 1L6RA 4K9SA 4PFQA 2BFPA 4E03A 3N2LA 3VFDA 3MAJA 1NXWA 3LXMA 1LK0A 4J1TC 3ZZ1A 4F6LA 2WIKA 4ONEA 3ANTA 3OOSA 4R2IA 2NZJA 5TPZD 4PCAA 5IFLA 1NJFA 2AD5A 2KJQA 4BWYA 4F5DA 1SHKA 2R1VB 1LNSA 1OC4A 3O31A 1OX4B 2BGKA 1NVVR 1QCYA 1W75A 3OA0A 5FBQB 3THXB 1Z0DA 3SZUA 1ZA2A 1P61B 1YBHA 4ZCMA 4JX9A 5BQXA 3LBHA 5AKGA 2HXSA 4FB4A 2E89A 3IURA 4OA5A 3GFQA 4QAJA 4RTQA 4GLBA 2XOKA 4GGMX 4O08A 2ADMA 2W4IA 2CXOA 1XRRA 1REQB 1F8FA 1UK8A 1SBHA 2EHJA 1TZBA 3KAPA 2PLWA 3WYNA 1FYXA 2YZNA 3U7QB 2WM8A 1LPPA 2WAXA 2GRAA 2Y3IA 2YIJA 2YCBA 1BVRA 3IQEA 4P5EA 4DVJA 4BFUA 4J2OA 1GUYA 3DWGA 3GT0A 1JR3E 2B7CA 4LRTB 4U0KA 3RFUA 5DTMA 1G3RA 3GLKA 2JFWA 3PGA1 5LYYA 4BYMA 4HVLA 2A30A 3I9MA 3W2TA 1JYEA 2CV1A 1KAHA 3JWHA 3WYGA 1Y81A 1ZYUA 3CBGA 2WMYA 3ZLVA 3ZH9B 1JH9A 3PS9A 5EN4A 2VZ0A 4G4SO 3KVVA 3W2GA 2A5LA 5I7AA 3MEJA 1CPYA 3KBOA 4K6OA 1CE8B 4JWTA 5LP6A 1EXMA 3X1ZA 2GJKA 3MGGA 1EHYA 1VC2A 4JBGA 4MQ5A 821PA 1AQNA 1QV9A 1BHO1 1ARZA 1IN4A 2GJ8A 2QZSA 1RWVA 5EUBA 2DEUA 2WTAA 4C1BA 4GS5A 2BONA 2PBLA 3QPWA 1KHHA 1G5TA 1OKKD 1GFZA 4NBKA 4BQNA 4ODIA 3A1FA 1W1IA 4X1KB 3BK1A 3OFSA 4B3FX 3EQ2A 5A6VA 2IV7A 1KIAA 4PLHA 2I65A 2QAIA 5SY4A 3WGGA 4G81A 2Y76A 3ISVA 3PB3A 3KLPX 3C14C 4D2IA 1X0XA 4ABTA 3W78A 2VQ6A 1IN1A 1ZIXA 4MIYA 1APBA 4PY2A 2JDIA 1GY8A 2C07A 1KNQA 3V4OA 3RS4A 3WS7A 4B7UA 1CLUA 1MRSA 2DBVO 4EJMA 1R0CA 1RFLA 1N5JA 2VQDA 4QDUA 3U56A 2WVHA 3S27A 3IQZA 2HBZA 3P27A 1F2UB 1NXQA 1L5VA 1GZDA 1RWNA 2VP0A 4NDNE 4ZCPA 3RTBA 1A9ZA 1HDEA 4YBAA 3IR7A 3HGQA 1JFRA 3G88A 5ERXA 1A9YA 4Y6QA 2OGWA 1R8SA 2OWEA 4P93A 4CM6A 1BX1A 5IANA 5KX5A 2JGEA 1NVWQ 2E21A 3WKBA 3G0DA 4C01A 4P6VF 3VISA 4BNFA 3RV4A 3G7SA 2X13A 2CMDA 5CCEA 4HQRA 1BS9A 4OHRA 2ORWA 4GOLD 4Q4CA 1WPGA 5HBGA 3GCXA 2X6TA 1DDOA 1M1YA 2P5YA 1CR2A 1ZJZA 1X1SA 4IYRA 3MWLA 4CTMA 1WBBA 4IOMA 4CM8B 3COJA 1ZNZA 3JARA 2C8KA 3IDOA 1PSDA 1VDMA 3IBYA 3L5KA 1ZISA 2IHZA 2O8DA 1EFCA 1QIKA 2B94A 4O2BA 3E7FA 3V8PA 4H60A 1Z2AA 3A6DA 4HN2A 1CZHA 1I01A 2BMJA 1E6LA 2PS0A 4KBYA 1ZPDA 2B0CA 2VP5A 2PUBA 4QHYA 3Q5GA 3D3EA 4PE5B 3K09A 1UDCA 5LZ9A 4F60A 3KHSA 3UK6A 4X3CA 1T2AA 2UYOA 3PHCA 2C2YA 4PS1A 1THMA 3TB4A 4E1VA 4DUPA 4BLUA 1ZZGA 2G7MC 1E3QA 2VWHA 3JYLA 3B2QA 3REQA 2I6QA 1NXTA 2QMEA 3N58A 1IPEA 5JTTA 5L6LB 4CKWA 1AIPA 2F3UA 5BV2P 5IHXA 1DWUA 4BBAA 1MHPA 2JHGA 1PV1A 2WRZA 1RXIA 4LJAA 4V0ME 2A1UA 2YW9A 4FBMA 4YC7A 4O4JA 4ZO4A 1KU0A 2FNAA 3VXKA 4EBBA 4HYQA 2JFUA 3D7SA 4XLLA 2ZRKA 2M6SA 3MYRA 1NVBA 3O83A 4WT7A 2FFRA 5IYZF 3ZHOA 3DB2A 3CIOA 1Z74A 4WZAE 1Y7YA 3TELA 1VMDA 4Z9AA 2J07A 1TFRA 2JGJA 5C34B 4BNIA 3L41A 1RAFA 4IWYA 2IP4A 1L5HA 1VE1A 2HJSA 2HL6A 4Q02A 3DO8A 4TYYA 1IMOA 4Q1DA 4PZPA 1PK9A 1JEAA 3TZKA 1TLFA 3OIWA 1VB5A 3MPUA 5CIQA 3TTXA 5T41A 4ZEMA 5CEJA 4AG3A 2D1SA 3DBVO 3A6PC 1RQXA 4I2VA 2M98A 1FRFS 4BRZA 3TDMA 3PA6A 2F6RA 4QL3A 5A6SB 4DFDA 3RRZA 3FYSA 2E4UA 1ZH6A 3ODGA 3K20A 2WG0A 3PUIA 4CI9A 5IT0A 2XHZA 4KYIB 1EDZA 1N5RA 2OC4A 4FGJA 2YNMC 2PD4A 3L07A 3SEQA 1OAOC 4EF6A 4J0GA 2OKCA 4G5RA 3PL1A 4CQMD 4OQQA 1KZ4A 2QROA 2V7XA 3IAEA 1RYHA 3HY4A 3ZK7A 4KIJA 4JL6A 1L1RA 3VDNB 2CLHB 1W5SA 3LHDA 3Q3HA 4L3OA 3KAQA 3PYXA 5F64A 5CA0F 1HR0B 1PZMA 2CBXA 1RJEA 3OZGA 4TYMA 4E94A 5AVZA 3S8EA 3ZI0A 4P3YA 3PU6A 2PWPA 4WNCA 4FSDA 1OGIA 2Q8PA 4HAXA 1Z7WA 4D6XA 4QOHA 3H3XA 1HTWA 2FK7A 3H7IA 4HDRB 4ZQIA 5HVNA 4M0UA 3GLGB 3OTHA 1I2DA 3AVVA 1ZK2A 3IA7A 3EMDA 1JKFA 3TRHA 3LVFO 3WKAA 5CDFE 1XMOB 1EWRA 3PI7A 2F4VB 2SBTA 1ZFNA 3UHOA 3OUTA 4KXYA 2HDOA 5DBIA 5JSFA 1DJPA 2VK1A 3VX4A 2MYTA 2JFPA 1OH8A 1DOHA 3WZ2A 1QGDA 4DLRA 2E2WA 2FE4A 4WERA 4A7PA 4R8VA 1MO6A 5C31A 3NBFA 3HJCA 2ISQA 4I8TA 2GBLA 1M1XB 1NURA 2FWMX 1KO8A 3PJDA 3PJFA 5BR4A 2EZ4A 2I8AA 1GQYA 1NAHA 3GEBA 4PQEA 1UZUA 3SD7A 4W5WA 4D1YA 2G5GX 3IAUA 5EMNA 5THKA 1PERL 2A2ZA 1HTBA 4DUYB 2XXQA 2PRIA 4Z4GA 4LVOA 1M73E 5F4ZA 1XVLA 2OHGA 2VRCA 3O4HA 1V7CA 2WPNA 3I8OA 5B4UA 2PUGA 1E2KA 1FS6A 2BJHA 4Y6OA 1FTGA 1DB3A 5J3JA 2BDUA 1ZKDA 2LCFA 3N0XA 5B3JC 4RD6A 1RHUA 2PUVA 3GOHA 2W6IA 1KPGA 3LM8A 4BGIA 1IB6A 4Y9DA 1XIVA 2ODRD 1IONA 2PXLA 2P2LA 5HMMA 3PHIA 4DCGA 1PSWA 3AF4A 3EMKA 3PE3A 4G6ZA 5CG1A 4UUMA 4XA8A 3KTAA 4Z2YA 1P9WA 1WQ1R 3DEIA 1LS6A 2CBZA 5ER6A 4D9JA 4BVJA 3HE3A 3MBOA 2C7BA 2FPLA 4IHQA 1HO3A 4ZVLA 1WM1A 3CWZA 2F62A 1QIDA 2EWVA 3GEPA 3ONVA 2G28A 2HDHA 4RHUA 1Q0SA 4ZKDA 3V6LA 3K1ZA 4CMHA 2J8ZA 4TRNA 5C7YA 2QW8A 1JLHA 1GL9B 1ECCA 2B30A 4J1WA 4LMBA 1N2ZA 2ZUUA 5BMVB 2FPSA 2HMTA 1R0WA 4PLYA 4U63A 4YJDA 4DM4A 2OFYA 5EUQB 3W8FA 5KYTA 3B1WA 2ABWA 4RD1A 2P9BA 3SM9A 4DWOA 3GUUA 1WHSA 4IDCA 4NE9A 4NG5A 1MFPA 5P21A 1MD9A 1EWVA 1IXZA 4JASB 3IUMA 3BB3A 3KSBC 5LNK6 4REMA 3TFOA 5T8KC 3RT1A 1GDTA 2ZSBA 2HINA 4HAOA 3KQWA 3EDCA 4IIGA 2PL5A 2FW1A 2ZR8A 5CM9C 4EKEA 3JQFA 4RMIA 4BX9A 4CL0A 3M1YA 3A9RA 3IUJA 2OFWA 4MQFA 1JSXA 5KJEA 2J4CA 3WRWA 5D3MB 2YHUA 3PRYA 3VOTA 4KNYA 2X5JO 1LQCA 4U7WA 2DQSA 4YS6A 2OQVA 1IBRA 1UT5A 2VJPA 4B8WA 4ZDIA 1Q15A 1D2CA 1JG3A 4UM7A 2GILA 4D4LA 4TZ0A 1TZMA 5DCYA 1DX9A 1FX0B 1VLZA 2RH4A 5IAGA 1TEVA 2PS9A 2X2EA 1TJPB 4KACA 4MUAA 4D3FA 1L4EA 1IVYA 1TM5E 3C8HA 3MJ4A 4H4CA 2Z9CA 3L06A 1NE7A 1WJGA 1K08A 1GTL1 4A27A 6REQA 1NBOA 5HIJA 3H5OA 2BM9A 3A7DA 3FA2A 4HFMA 3CCBA 1Z5WA 4DA8A 3WGLA 4CUJA 2GYWA 5JJ5A 1GHTA 2WKPA 3UJ9A 3NASA 4IZIA 2O6LA 4KYVA 4HX2A 4N9WA 1CP2A 3Q0IA 1E58A 1L7MA 3FNQA 4PAMA 4A0SA 1WDMA 4PYMA 4B3CA 2J0VA 3OP9A 1F7UA 2FLVA 5K3DA 3MD0A 4WA7A 5J2UF 4P3PA 4OM7A 4OMDA 4UD6A 2XR1A 1E3EA 2WT4A 1NR1A 3BGVA 2XBLA 3JRWA 3KEOA 4MOWA 5FUBA 3BRQA 3VI3B 2KLHA 5D51S 2H00A 3K9GA 2GPSA 3S8MA 2I7DA 4DT1A 4I9FA 3U3WA 1DJOA 3P4UA 4KQJA 1G38A 1J2RA 1RKQA 3GLHE 1N6NA 3LO5A 2ZSHA 2WUFA 2P2CA 2W71A 3N2ZB 1BS1A 1CZRA 2Y6UA 1TYEB 3HS3A 3QBDA 4A8JB 5I7EA 1ODKA 1T43A 2Y1CA 5EJ9A 3W5DA 1WVMA 3TNJA 4EARA 4BX3A 2NT3A 2OCKA 2D5IA 3CJQA 3OPQA 3W5SA 3HN7A 3TD6A 2GESA 2NXCA 4DLZA 5DCLA 2JJYA 1TEXA 1S8NA 2AG1A 3BH7A 1YJBA 5NULA 3KJZA 4MW9A 1ND5A 2R6AA 3TZEA 4RTMA 4IEEA 1SCBA 2P2SA 3TXAA 1XAGA 2CXHA 4IIHA 3JQEA 4I9GA 4RTLA 1C29B 1GUBA 3ZIAD 2I7XA 4JJGA 1QHGA 1CJBA 3ZDDA 4O8ZA 1GNLA 3Q11A 3AHIA 2E37A 3MJVA 1L4YA 1JLRA 1WH8A 2QU8A 3KJQA 4EPXA 2YHBA 4TKVB 2VZEA 1LGYA 1CJTC 3K9QO 4EO9A 2BWJA 4LYDA 3INNA 1CY8A 1P19A 5F51A 2R6JA 4JU8A 3BA6A 4OHKA 4A26A 3ENNA 1O03A 3D4NA 2YV4A 3LCVB 2AVNA 4S1PA 2AZ4A 4RL4A 3UMCA 4BCDA 1ZS4A 1M34E 1V0JA 5AXDA 3H1BA 3GLGE 1N7GA 2JVIA 4EVSA 1WXIA 2EW2A 4YT8A 3CA8A 5KHOC 2OZLB 3D31A 1M2VB 1G9XA 1TZ2A 2GN6A 3OT1A 5C4MA 2DHQA 5JBNA 4NWIA 2HA6A 3O21A 1UL1X 1IWPB 3IVAA 4FN3A 2C92A 2EKDA 4RH0A 5E3HA 3NX4A 2G6BA 4MKGA 3EQ7A 5BORA 1DTEA 3AVYA 2YWDA 3NXSA 1T8RA 1R6VA 1L5KA 1XCGB 4JCOA 4KQWA 3IR6A 1EWTA 1SKYE 4M1YA 5DM60 2ROQA 1AKUA 2HSZA 3D8HA 4DV5B 3T4UA 4PRLA 5EIFA 1BHJA 1HFEL 2YUIA 2A1IA 2GEFA 3RJ5A 3L9WA 2GH1A 1XTTA 1WMBA 4DJAA 1T24A 4KQCA 1HZZC 2AX4A 2HMSA 4KXVA 4DANA 4OHYA 4EPWA 4LNUA 1ZD2P 3R3ZA 3JYPA 1ZY2A 1E1LA 1KH2A 1BOOA 1M5UA 2I99A 1MOSA 3PEFA 3T5DA 4LC9A 3WGVA 3K0HA 2LBPA 1IN7A 3EGXA 1KH3A 1MQ9A 2GN2A 2WHYA 1XCLA 3MUOA 3Q1KA 5I47A 1FP1D 2R44A 4N12A 1PFKA 2AI2A 1P0IA 1U0RA 3RSOA 3O4VA 3VAAA 4GDFA 1P0PA 5H70A 4NENA 3UBTA 4MICA 1B1CA 2V55B 1KORA 3RSCA 1A8SA 3C3DA 4BC0A 1Z7YA 1ODJA 3RC3A 4AF6A 3DGEC 4ZYYA 4GGPA 4UOZA 1UP6A 3IFSA 4F8YA 4KTTE 2FOLA 2BFFA 1DAIA 3H8WA 1R6TA 2LIPA 3NYWA 3OO0A 3WIDA 2Q9CA 2R1VA 1BX3A 3DOFA 1YBFA 2ZIXB 5CM8B 3ITNA 4RHEA 5TPWA 1DC7A 3U3RA 1Q14A 4H0FA 1CF4A 3MJDA 3G23A 3BEOA 4QXQA 3KB8A 1FLNA 4IH9A 4J43A 1I30A 3ZBTA 1IBMB 1PX0A 1WQ4A 3M1AA 1O4XA 4GOND 4YPFA 1EUZA 1VZ3A 1IZYA 2AD1A 2CLIB 2QW0X 3BHNA 4DJJA 2YJZA 4KO2S 4M8SA 2G36A 5EMJA 1XXHE 1U8UA 5FBKA 2WWYA 2GKGA 1N3LA 5BWCA 5ITWA 1US8A 3FJ1A 4BIMA 3DTNA 3V1YA 3JZDA 9MHTA 4QRIA 1GGFA 2VPTA 2XVZA 2H4FA 4W99A 5TPWB 3RVDA 3IAS1 1JEDA 3FFXA 3W1VA 3RG8A 5AW3A 5I7WA 3EOBI 2X41A 3ROEA 4DIOA 4X64B 1QR2A 1M8GA 3LUGA 2NVUA 2VT7A 3X1KA 3LI2A 2JBAA 4MQ4A 5DHPA 3LY9A 2FRDC 1XEXB 2ZB2A 3WYCA 3E58A 4I6EA 1HC7A 4JKIA 3TNLA 2DR3A 3UAYA 1YHNA 4B7CA 4DMMA 5K3CA 3SJBA 1GYPA 3MCVA 4L3WA 5HOEA 1AGPA 1PJQA 2ZT5A 3EARA 2G5PA 3RYHA 2H29A 1UBTS 2PGNA 2ZTSA 1IZ7A 1P2UA 2OO5A 4MI1A 5EUCA 5KYUB 2VNKA 1K7FB 4D9HA 1BMQA 1JPUA 3D2BA 4MVWA 4RVOA 5LQCA 1XK6A 2ZJZA 2IFTA 1VXOA 3LW7A 2H9IA 3A6ZA 3B1JA 3OKFA 2D06A 5I7SA 1E2MA 2POCA 3HXKA 2J7UA 1G8PA 4MW4A 3NIBA 1K86A 2QE7A 3I2HA 4AICA 2EQ5A 2WIBA 2P8JA 3D4OA 1L8QA 4JYCA 4OD0A 3BG5A 4K9RA 4PR0A 4BGUA 4S04A 4QDJA 1Y6ZA 3O4RA 3ESRA 1XX6A 2PGLA 4NJEB 5D86A 1J21A 1Z29A 1UEJA 2ZB7A 1LDMA 1I4TD 1JILA 3K9HA 3M1LA 3GFFA 4PU8A 3PUJA 4CM9D 5BV8A 5JNLA 5IJAA 1N9GB 2BE7A 2Z5LA 3Q2OA 3GJ8A 4JUFA 1MB0A 2O06A 1N8TA 1R5NA 2ZIWB 4I5IA 1XLTC 1SCAA 2HMYB 5KKNB 2VTBB 2B78A 1RXUA 4ZVTA 3KZKA 3OT5A 3A11A 4OMFG 1P0CA 5HKKD 3FJYA 1ZUNB 4BX0A 2W8BB 2WA2A 5K0ZA 4W5RA 1CEEA 1XF9A 2VJNA 4KR9A 3QITA 1Y3BE 4OSOA 2PPLA 1Z2PX 1K68A 4LV6A 1CG6A 4NYMR 1ADFA 3EUAA 2OA0A 3RRXA 2VS1A 3AESA 3V2UA 4O25A 1VE6A 1W46A 1QVRA 2O0JA 2K2QB 3GJQA 2PD3A 3UK2A 2HMVA 3OE5A 1F9AA 4FDTA 4MW5A 3RYIB 1GSHA 1MIHA 2ANBA 1U7XA 3AUKA 3BIXA 2PBFA 3FYTA 3OQIA 3TLEA 2NZUG 1D0IA 3N0VA 3COSA 3JQAD 3OJCA 4D3ZA 3I4CA 3ECSA 1TEHA 1EK0A 1EDOA 2NADA 2BFAA 1R4MA 4NMWA 4YAJA 1J8QA 2B25A 4LXTA 3ZI7A 1AB6A 1G2QA 5H4HA 2GXSA 3BIFA 3LWDA 4RK1A 2O5CA 5BOVA 3SC2A 2WPDA 1VG8A 1X39A 4MDYA 2ZSFA 4PBSA 3I2YX 4C0WA 5MGNA 1WIZA 1QANA 2L8NA 3UAVA 2GJ9A 4LV8B 3WJ1A 1NHWA 3R3WA 4G8CA 3LXRA 3S7ZA 5JARA 5HF8A 4DHWA 5HFNA 4LY0A 4QULA 2NPOA 4U02A 2FW7A 4EECA 3THWB 1IK6A 3LT2A 3ZPXA 3HLKA 3ANMA 2EVWX 1JDPA 2FZVA 3EHDA 1U8EA 2AFRA 4RVNA 4Y1RA 1ND6A 1NT2A 3SC3A 1NQ5A 4HB2A 4B2LA 3PVSA 5LUBA 3ULKA 2AJCA 1SUSA 4B3IA 1KJZA 2YWBA 3W4JA 3OQNA 1WBJB 3I9FA 4KQGA 3V1KA 1NOIA 3DCJA 5KU1A 2HT6A 1PS0A 1BYUA 2ZJ6A 4Z8XA 1D8TA 2DM6A 1G8JA 3GJTA 3ON5A 4PWZA 1NXOA 2P9CA 2IY8A 3EXHC 4PPNA 5HW0A 5LOVF 4DS3A 4MYUA 2YIVX 1ZMRA 5COQA 1QOPB 3ZHVA 2PWZA 1N3YA 1HF0A 1QHXA 4WKGA 1MVOA 1JB1A 3BWVA 4X90A 5M7EA 2PV0A 4HTFA 4E6EA 4WX2B 5TEWA 1OREA 4Z86A 4ZAFA 1LPMA 4G65A 1N0HA 2CY0A 5JS8A 4KPEC 1TU4A 5FWNA 1R27A 1IEVA 4OUKX 1G0OA 3RF6A 1E5LA 3NHBA 1O8CA 1R5OA 3UPDA 5IXYA 1HLPA 4WZBA 4LDRA 4V0LA 4DMKA 2P0YA 1KRXA 4OLHA 2JJ2A 4D4HA 3VPGA 5ALWA 3KS9A 3PSHA 1SG0A 2RAUA 5FPTA 1U3GA 4FS8A 3OPXA 3O94A 2WW8A 3H1GA 3E3AA 2VPQA 2Y71A 4YA6A 3AVXA 4KV9A 4DUGA 1TUEA 2P0AA 2QTRA 1EVKA 4K28A 2Z2IA 4N8DA 1P44A 1OXTA 1GSAA 4HYTA 4GZMA 4DARA 5JCPA 3QKSB 4AN1A 3CF6R 2P40A 3C41J 5CLIA 4D8UA 2O3JA 1SBIA 2XQKA 2L42A 3UV3A 1YZ3A 1GUAA 2V8OA 1WMFA 3GIDA 1RZUA 1LEHA 3QUAA 4RZUA 3HCAA 3KSZO 1DHRA 4WACA 2XMQA 4MKRA 4AD8A 2WUWE 4L5AA 1CY0A 4CWAA 2ZSEA 1MDFA 4ZJZA 2WVGA 3CS3A 3CX7A 1UBEA 2IBMA 2M32A 3AJDA 3M6LA 1RM3A 3VUEA 2QMOA 3P7MA 4LVNA 3RK0A 3X1XA 3TO5A 1ZD1A 3I9JA 1ZJYA 5L3VA 1IHUA 4QXPA 2K4MA 2EQBA 3TR6A 1C0EA 2O2YA 3IAAA 1SK8A 2YIDA 3NRBA 3L04A 1RMYA 3MAGA 4CEHA 4PGFA 3PA8A 1FNCA 4JOCA 2QGZA 3CLRD 1P2FA 2TMKA 2O8CA 2GPWA 1AD2A 2Y4OA 3UANA 1U28C 2EXXA 2C9DA 1YIAA 2V45A 4MA0A 2IV2X 3LDUA 3NHRA 2FW0A 2HRRA 3PENA 5F73A 3STHA 3UT6A 1RXVA 4GWGA 1N34B 4CIWA 4G4GA 1ZCZA 4UBLA 2QQ5A 3KWJA 4M6WB 2WHRA 4IGFA 5F2EA 3TL6A 2G40A 2VJYA 3C8ZA 4QYTA 1JFVA 3LE8A 3DMTA 2OBXA 3SHVA 4CBVA 4YRSA 1D9ZA 4US0R 4IIFA 1GKKA 2WAOA 4KB5A 4J1XA 4ND2A 4BZXA 1CUCA 1V2HE 3QSYA 3AEKB 1YF3A 4EW3A 2ZCVA 1XCOA 2VN8A 3BK7A 2BCGY 4HDOB 5A06A 5DBFA 3HJTA 1Z06A 4XWTA 3VJLA 3AR8A 4JSRA 1PWYE 5DGXA 1H22A 2IPOA 2QRPA 4O63O 1EUCB 3AR2A 3U26A 2FPKA 4D0NA 1FZTA 1C2TA 2G8NA 3GLRA 3L4SO 3R5FA 3NH9A 4YNBA 4YLGA 2XKAA 1O5TA 1ONBA 4C4AA 1N5KA 5I9TA 3RNOA 1NPDA 3HFRA 3RTEA 1ZGHA 3WNZA 3VR4H 5LQDA 3EISA 3RSLA 1UUFA