5JVDB

Tubulin-tub092 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
429
structure length
425
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antivascular and antitumor properties of the tubulin-binding chalcone TUB091.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 167
structure length 425
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jvdB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5jvdB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5jvdB01
4U3JB 4M8IA 1FFXA 4ZI7A 5JQGB 4DRXA 3HKCA 5CA0B 2Q1YA 5FNVB 3RYHB 5J2UA 4F6RB 5LXTB 4X1KA 4ZOLB 4IIJA 5J2TA 1TVKB 5GONA 4O2AB 4I4TA 3JARB 3JATB 4TV9B 5IJ9B 4ZI7B 3HKBA 3VOAA 3JAWB 3HKCB 5EZYA 3RYFA 2RHHA 3C8LA 4B45A 1OFUA 4TUYA 4EB6A 4O4LA 5IYZB 5KX5A 4O2AA 5LOVA 3WGJA 3JARA 5JCOA 3HKDA 5LA6A 4O2BB 4TV9A 5ITZB 4I50B 4ZHQB 4X1YA 4LNUB 5EYPA 5EZYB 1SA0B 3RYFB 1JFFB 4EI8A 1Z5WA 4TUYB 4EB6B 2GVIA 2VXYA 4YJ3B 4X20A 5IYZA 5KMGA 5KX5B 4KWEA 3VOBA 4WBNA 5LYJA 3HKDB 5JVDB 4U3JA 4O2BA 4TV8B 5LA6B 4ZHQA 2RHOA 5BMVB 3N2GB 3R4VA 2XKBA 4O4JA 3JAKA 4IHJA 2R751 5M7EA 4F6RA 5LXTA 2RHLA 3VPAA 3RYIB 3RYCB 4IIJB 2R6R1 1TVKA 5GONB 1RQ2A 3M89A 4EI9A 5LYJB 5JVDA 3JALA 4HNAB 3CB2A 3HKBB 3JAWA 3WGLA 5CA1B 3N2GA 1FSZA 5CB4B 4IHJB 3JAKB 3UT5B 4O4HA 4DXDA 4O4LB 3ZBPA 3RYIA 3RYCA 1W5FA 5IJ0B 4I55A 5LOVB 4YJ2A 3ZIDA 2RHJA 5C8YA 2BTQA 5ITZA 5JH7A 4X1YB 3HKEA 4LNUA 5EIBC 5EYPB 1SA0A 5CA1A 3JASA 1JFFA 5CB4A 2VAMA 3N2KB 4O4HB 1RQ7A 2VAWA 4E6EA 2XKAA 4YJ3A 4O4IB 4X20B 5KMGB 2Q1XA 4I55B 4YJ2B 3WGNA 3ZBQA 4WBNB 1W581 1W5BA 5CA0A 4DRXB 5C8YB 4TV8A 2BTQB 1RLUA 5FNVA 3HKEB 4FFBB 3RYHA 5BMVA 3E22A 5LP6C 1W5AA 4U39A 5J2UB 4O4JB 5J2TB 4XCQA 3WGKA 4I4TB 5MN6A 1TUBB 5IJ9A 3JALB 4HNAA 4FFBA 3E22B 4X1IA 1Z5VA 3UT5A 5LP6B 3M8KA 1W59A 5MN4A 4EI7A 5IJ0A 1TUBA 4B46A 1FFXB 4I50A 5JQGA 3WGMA 2BTOA 5JH7B 1W5EA 5EIBD 3VO9A 3JASB 4X1IB 3RB8A 2VAPA 3N2KA 4X1KB 4ZOLA 3VO8A 5LP6A 3V3TA 5JCOC 4O4IA 3JATA 5MN5A
chains in the Genus database with same CATH superfamily
2C7PA 4LYAA 1UADA 3FVWA 4IGKA 1JLLA 1JPUA 1VCIA 4KUEA 2POQX 2YXNA 3ZBUA 2DWUA 2DCMA 4JYZA 5EZQA 1SCAA 4PONA 2QN2A 4BNYA 1TCUA 3GLVA 4WDRA 4C4SA 4AN4A 4XDZA 3DD1A 5KVSA 2QXUA 4GI7A 4KWHA 4N6OA 3KUUA 3KKEA 3H9BA 3SXUA 2R8OA 3VOTA 2X3FA 4QHYA 2CVQA 2IUEA 2SCUB 4ZAGA 5G4KB 4PZEA 3G0OA 1AQLA 2HIMA 3V55A 3HY6A 3S29A 4AX8A 4B7KA 5K09A 5K0ZA 2ZUCA 2F3TA 4RGYA 3QHQA 4MKHA 1E9FA 4QO7A 4AULA 2P1RA 4MW3A 1PFVA 3I28A 4UDOA 2N05A 4UMVA 4CEJA 5IVPA 2PSDA 2Q1UA 5E6UB 1E6WA 1RPRA 1ZWLA 2J5RA 4X45A 2JGAA 1X0VA 2XCQA 3AETA 3M6MD 4N0MA 2PBFA 4F3RA 1EZVH 3G59A 1MSDA 3G9QA 2IU0A 2FDCA 1UPFA 3FI9A 3BERA 2ZP1A 1H2FA 3ZVRA 1IM8A 2A9PA 3BSYA 2GRJA 4IMIB 3ELDA 4QHSA 1WSAA 2H7XA 3CLTC 4RTQA 3QEMB 2JARA 1C2YA 3JQCA 2XCSB 5K3OA 1CQWA 1EBFA 2V54A 1WBJB 1KI1A 4ND3A 1N1MA 3V8EA 1B8VA 2SKEA 2FPMA 1XT6A 3C4JA 3TTVA 3N7TA 3C14C 3P0RA 2VO1A 5L3ZA 4C7OB 2WT8A 3DP7A 2I6QA 2Z3WA 1ZXLA 3I4CA 3LF1A 2KW5A 3NETA 4LFBB 1LUWA 5GAJA 1QC5A 2FVYA 1MMMA 5IHXA 4O33A 4HNUA 5K2OA 3BMOB 2LQTA 2UZ0A 3JAKB 1FQOA 1QX4A 3G8CA 4KO4S 1A77A 1XI2A 1YB7A 4YMGA 4MHSA 1G291 2CNOA 2VTBB 1W5FA 4Y6PA 1GKKA 1ZESA 2D1TA 1V95A 2Q5QA 3LZ6A 1VBFA 5EMKA 3WRXC 3GLFA 3UG6A 2VRNA 5A03A 3D8BA 4E1BA 3R5TA 4GM4A 3PWZA 4UE3S 4BVSA 3I55F 1L4YA 2F1OA 4M8KA 4ZWNA 4KFMA 1XL6A 1G8FA 1TZ2A 4JI5O 3ANNA 4YRDA 1EP3B 5FYQA 7AT1A 2B92A 3IUEA 1C3XA 2ZXUA 4XVRA 4ACAA 1KTVA 3NGLA 1AURA 1CS4C 3TTXA 4C0LA 2I80A 4GCZA 1OKKA 3RVMA 1RLUA 3HUFA 3QPBA 1DGSA 1Y5NA 2LUOA 1FF9A 2HA0A 1B00A 1LXCA 1TYEB 2H4ZA 4Y1GA 4B48A 1AHNA 3L8ZA 5EIXA 5HX7A 1OF1A 3V8VA 5CCXA 5HTOA 1V41E 2F48A 3IQZA 1EK6A 4IVPA 3AV0B 3PJFA 4P54A 1KZ7B 1M6WA 1R6VA 3THWA 5IJ9A 4CGYA 1V39A 3EEOA 3IKMB 5LHHA 4WH0A 4QYSA 5G4KA 4FLZA 4FFBA 1UDCA 3BGWA 5BSEA 2O8CA 1CE8B 1TE2A 4L4YA 4PDLA 2AN9A 1C1DA 1RYDA 2HXGA 4IHQA 2P6MA 1NYRA 1FNMA 1ZMXA 1DAPA 4Q39A 3MMPA 4CEJB 3IOCA 4Z2AA 3VHXA 4JI5B 3DCJA 4PX9A 5BWMA 3H5NA 1RT9A 2VA8A 3CLRD 4Q1BA 5KYXB 3ERNA 1GHTA 3PU6A 3IBSA 2RIPA 4HXGA 2ETVA 2RHTA 3OCZA 4E4YA 4D5GA 2ZIMA 1YJ5A 1GRJA 2MT9A 3DH0A 1KZ1A 2JBHA 4H3SA 3WAJA 2F8TA 1HP8A 4J1SA 3GCZA 4PTLA 4P3KA 2R9AA 3EGXB 4KMOA 1PU2A 2IUSA 2PGXA 3D59A 4DHEA 2HF8A 2JFYA 3I5MA 5LZ9A 2GUWA 1H2BA 4OPHA 2DC1A 4N5LA 1O2DA 1SKUA 1C5KA 3ENNA 2FK8A 2BTEA 4BLUA 1AKTA 1S3IA 4G0YA 5ECYA 5LB4A 4BFZA 1BDBA 1BSVA 3CEHA 5BN3A 1X7PA 1Q15A 4DJEC 2YW2A 4HI0E 5FWNA 1D03A 4BZWA 2O23A 1BL8A 2IXTA 1WBDA 3M84A 3QVGB 1YZUA 1DFIA 2ZAMA 4JP8A 2X3UA 1KSJA 4K1LA 1UL1X 1V8DA 4LXHA 1NVWQ 1EN5A 2ROQA 4ZCQA 4P30A 2QTVB 2RJ3A 4B7EA 3GF4A 3TLJA 2OG2A 2WJYA 1GL9B 1UBCA 2I2DA 3HJUA 4UKDA 1TU0A 1C4WA 4CIXA 1A04A 3C3YA 3K9NA 1VKJA 3KLPX 1GZDA 1MIHA 3KYCB 4ZO4A 5FFNA 2ZIZA 5EA2A 1O58A 3TRJA 3UYKA 1GL7A 1PUIA 3IEWA 4P3YA 5KWEA 4Y2YA 2PIAA 2WZCA 2V74B 4QJBA 3AINA 4UUQA 5KKNB 4G4ZA 1AKQA 1AXRA 1H2ZA 3I76A 3AKEA 2W0SA 5EIOA 2GO1A 3T4XA 1U0FA 1JMVA 1WUIS 1XTTA 4L8YA 3VR4A 4F4CA 1KVTA 3AU8A 3SE0A 1E1DA 2PN1A 1DGQA 1JHRA 3GWZA 2Z5GA 5FTKA 4C89A 1UC4B 1S02A 1E1YA 1UPAA 4P4LA 4X3PA 4YRAA 2A9OA 3RGBA 2YHAA 1U63A 2JDID 1KPIA 2QYOA 2VZ9A 4MAAA 3U39A 2XLCA 3OF5A 4MWDA 4UCXA 3RSHA 3VNBA 4EPWA 3LOUA 5I4CA 1ZCZA 5HQJA 5K8IA 3VU9A 2Q5LA 3JQ9A 1T0BA 3AY3A 4YJ2F 4F9FA 2PYJA 4O4HA 5FUQA 4O6VA 4AI8A 2BMJA 1HA3A 3TDKA 4B3CA 3UM7A 2BEJA 1QYRA 2AFIE 2XF8A 4WK0B 1DQPA 1NKVA 3DQZA 4BGEA 4DR6B 3W1VA 1LQUA 5I8ZA 4GNRA 1GUZA 4ZXFA 4UCQA 2D74A 3S6JA 4C6RA 3IQHX 1EXWA 1HE5A 1XD2A 2NO4A 3CR8A 4A27A 2CUGA 1VHAA 5IKPA 4QQNA 1IBKO 1XFDA 4H7DA 1JKJB 5A9TA 3WLPA 2PMCA 4Q03A 5FTJA 1LFAA 3CCVV 1FP4B 1OV4A 1PNTA 3A4IA 4NX2A 4OXXA 3T8YA 5JZVA 5A2GA 4H6WA 2GTSA 4INJA 4KFTA 4C0KA 2YIMA 3RRZA 3U4AA 1FVOA 1K9VF 5C1DA 2C58A 4XIYA 1D2NA 1UOPA 4H0NA 4DXHA 1W34A 4EKEA 5IU6A 3A04A 1F20A 3CNOA 3RS7A 3IOYA 1MC4A 1XVIA 5T67A 3SPXA 4PICA 4R2XA 4C1BA 1Z73A 3HB3B 2Z1UA 4UFZA 1UFVA 1XLVA 4G2NA 3K1YA 3KYJB 3R3SA 1FJGB 4IXDA 3I0ZA 5ADVA 4PDMA 1CQIA 4Q7LA 3NVKE 3H2BA 1ABFA 5G0WA 3WQBA 3CPWF 4EHLA 5FEMA 4B71A 1T2AA 4J90A 4Y6QA 5EWRA 4LZLA 3LPCA 2AH5A 5KWSA 1QIFA 1P7PA 2VH5R 3AEYA 5I7AA 3VTAA 1QYWA 3RTCA 2ZBEA 3FLAA 3BORA 3W5BA 2BFBA 2F8LA 5HIJA 3GBSA 2IZ6A 3K9AA 5AVVA 5IULC 3TUJC 4IVQA 1DQRA 1JKIA 3UAXA 1ODKA 4JC8A 2MR6A 4RSRA 1NYQA 1Y34E 3G5UA 3VR6H 4R8SA 3ZU5A 4S24A 3HRIA 4QPJA 1F2TB 1X1RA 1TAQA 2UXBB 5WRFA 3TX2A 2V7EA 3FOCA 1NLYA 3H1LH 1A97A 1NDHA 2WE7A 4BBAA 1QIMA 5A4KA 2ZYDA 3S7TA 4Y18A 2V7XA 1KAMA 2GHYA 1FDUA 2RHMA 2VBIA 4HUQB 3AUAA 2JFPA 4B5KA 4HYOA 2QM0A 1XDZA 2Y0EA 3CLHA 4X91A 3TCKA 4Y3UA 5K8LA 4D25A 3MS2A 4Q7KA 1G1MA 1ORVA 2N0SA 2NSLA 2Z9CA 5IAGA 3WY9A 4MV9A 1GO1A 1SUIA 3CJRA 3FR8A 4H1UA 4X93A 2ZT7A 5BSHA 1BS3A 1JJOA 1YXBA 3L0PA 4AJNA 4QOGA 5JV5A 2KBFA 3DL7A 3CPQA 4P4SA 1KDYA 2LBXA 2UUBB 2WJJA 1HX7A 3SDSA 4QOIA 4J9ZB 1F1BA 1GLVA 4YC7A 1VLLA 1W75A 4BAYA 4UVBA 3ZRXA 2AFRA 4FGWA 2BLNA 3I9OA 4UHKA 2I1LA 4L02A 1FP4A 1SXPA 2RHOA 3EULA 3HI4A 3R3VA 3KKPA 2IOFK 2IP4A 4KNWA 1R5OA 4AUMA 4LF9B 3MQFA 1Q8RA 3ROKA 4TRMA 3KSZO 2JHGA 3GJSA 2R8YA 3FBAA 5I5GA 3PKZA 4ZC8A 5AKLA 2RONA 1NH2D 3O7WA 1Z0DA 2V4ZA 2BKVA 4MS1B 5CUQA 1L7VC 4DLAA 4EK9A 5L6LB 3LKVA 3NVKI 3FPCA 1H38A 2GSWA 4RK7A 3AK2A 3SBDA 1HFJA 1YC5A 1CQIB 1ORRA 1ZKMA 2AT1A 4FZ3A 4EHJA 1DBVO 2H4YA 1WB4A 2F4NA 5IJ0B 3C8MA 1BE0A 1F4MA 1AU9A 3ZPXA 3NBXX 3QUTA 2OYCA 3NV9A 3CF6R 5JH7A 2EKQA 4ZMSA 4JWKA 4ZU6X 2B9ZA 1J2TA 1V55C 2C99A 1R9NA 2OGWA 3M6FA 5L7YA 4BZZA 4D4MA 4Z49A 5LQNA 1QFZA 1NT2B 4MKRA 3R23A 4O2RA 3VH1A 5FBRB 2Q1SA 3ZCPA 3AI2A 4BVEA 4E07A 1AN9A 3FB1A 5J5VA 1F2UB 1EYZA 2JEXA 1G5PA 3IOBA 1R6BX 3OQPA 4K35A 3QQPA 3SVZA 4ZYZA 3LDGA 1F2TA 4HFRA 4LYGA 3QVSA 4ZOLF 3CIOA 1SN7A 1AR4A 1E1CA 3NHJA 4ND8A 1OTYA 2EDCA 2NUPA 3CCUV 2XQJA 3DTVA 5F21A 3M0EA 4K2AA 2XE7A 2BE7A 3KLOA 4RV5A 2DUUA 4H9GA 2GYWA 1Z0JA 2QUAA 5BR1A 5C5IA 1ZITA 3QE4A 1P80A 2PV7A 2FYUH 1YBVA 3GRFA 1ZJ5A 5CRIA 1DSSG 5ED4A 4QX6A 1PJCA 3BWCA 4YCNA 4I66A 2ZBDA 2DJ5A 1GGVA 4BQOA 2YICA 1K8QA 3FM9A 4KGVA 4MS4B 3VAAA 5BV0A 3HU1A 2OTLF 1T3TA 4XUGB 5L45A 4A6EA 2YV5A 1YIJV 2A8YA 3LX5A 3HDJA 3X2EA 3VH3A 3T1TA 3KXKA 5C5DA 4K0RA 5A71A 1GIAA 4DYLA 3IP8A 4FGJA 4OA5A 1P77A 1JN1A 2OEPA 1MAUA 2J0VA 3H5IA 3ODPA 1YJNV 4INZA 2EW8A 3PENA 3ZU2A 5HQ3A 2VNKA 3P9NA 1KC8W 2W58A 2ZW9A 5DGXA 3FTQA 1WPRA 3NTVA 1BE1A 3CYFA 4RD3A 1Q1EA 3FNFA 3JVHA 1JAYA 3HFRA 3CE2A 2BM8A 4C07A 4AO7A 2XOEA 3EMKA 3ADDA 2O50A 2X8BA 5AOVA 4S35A 5FWAA 3SZRA 3VGPA 2R97A 2JGJA 2YHSA 2H0AA 4TWZA 5LM3A 4AMYA 4PI2A 3ZH2A 5A9GA 2TMYA 3M6IA 3T7EA 2EKLA 2FWJA 1CP2A 2QJ1A 3PSAA 3IBCA 4YJKA 2X23A 3W4JA 3LDTA 1NQUA 3FTFA 3ZGOA 4GP6A 1MOPA 3GGGA 4Q4HB 5EHQA 2OESA 5I9SA 3SM9A 3T5GA 5F1OA 3KEMA 3CVXA 4AN1A 3H8VA 3DMTC 3KXDA 4V0KA 4I50B 4WLVA 1ID1A 4IVNA 2X6AA 4X62O 1VRWA 2O8NA 4G8DA 1GFZA 3PFFA 4D6TH 3ZYCA 5GP1A 3IPLA 5BY1A 2BN4A 2O2ZA 3N2NA 1Q5PA 1T5LA 4QREA 5DXJA 1WXFA 3O31A 4ZO7A 1DXHA 1RQGA 4L5AA 1J21A 3U4QA 3OWHA 2C2YA 1CT9A 2NVUA 1ZD1A 3BL8A 1U1FA 1QV7A 2CN1A 1PNMA 4EYEA 1EXVA 1AOXA 3G89A 3AC0A 4NHOA 5DLEA 1A9PA 2X5OA 3KZKA 3BDVA 3MDOA 4C4OA 2WP0A 2XKBA 4CLDA 4XLLA 3FYUA 2GWHA 3S2UA 3VPAA 1YT5A 3B89A 1X14A 3RC3A 1P0CA 1SHJA 2F1JA 1XWIA 1DRVA 1MLDA 1TJ5A 2JHCA 4WFJA 5KU7A 1C7JA 3OR7C 2AUNA 4B8ZA 3UFBA 4NU6A 3KJGA 1CRZA 1D2DA 1KF0A 3CBQA 3GUVA 3NDJA 4BVGA 5JAUA 4AP5A 3T4EA 1LA2A 3VHQA 3T9FA 5FPTA 3ZI0A 5HIIA 4LOHA 1U4OA 3UAOA 3GRPA 4WXEA 1U7TA 4BAUA 4K28A 3EJ6A 4L0DA 2AE1A 5DXFA 1NSFA 4O08A 3LQRA 1JFFA 4BKRA 4DVJA 1J0XO 2H1LA 3H5AA 4E5YA 1E96A 3E53A 2IJGX 3NT5A 1AQJA 3EWNA 4NUTA 3KHUA 2VRWA 5FIUA 3OOHA 3D6NB 4CU5A 1U0BB 3ES9A 3UBTA 3BQMB 2FMFA 1PGPA 5C32A 2ENUA 1EFTA 3SJAC 2OTCA 4YP9A 821PA 2I62A 1IQ0A 3H1BA 4MGYR 4NCJA 1XX6A 2NO5A 3GIWA 4ER0A 4RU1A 3PNLA 3G1WA 2QK4A 3RF6A 4UXJA 2QDXA 1FDVA 1QR9A 3AG1B 1YR6A 2RBEA 2EATA 4Q1DA 2CVFA 2A35A 2O3TA 2IE0A 3L0SA 4BEBA 4HFMA 2WTUA 5JJIA 2EF0A 3WRVA 4NXMO 2QRVB 3D6FA 2AIFA 1E7WA 2QYHA 1US8B 3IAXA 1KB9F 3OTWA 3I0MA 4OHUA 1MB0A 4M0KA 4EA7A 3M8KA 5LQJA 1Y63A 4NDAA 5E3IA 4JJEA 1AGRA 2WD7B 1D0VA 3SX2A 3SY8A 1LQTA 1IEWA 4LH7A 1TRKA 1ZM3A 4I50A 3LWNA 3LW8A 3VVBA 1SZJG 3ABSB 2QN3A 3AL2A 4LWZA 2C82A 4AY3A 3QI7A 4CLRA 4MQFA 2QA4F 1W0JD 3ZVMA 1GN6A 1MAAA 2QRLA 3IKEA 2VC2B 1E1KA 3EIEA 3I01M 4KVFA 4YV7A 1T13A 2XGSA 4YHHB 2HAEA 1E9VA 1B06A 3ZDAA 3K2XA 3X44A 1OHHD 4MAFA 2ET6A 2LWIA 4QLBA 4H1WA 4W5OA 1UBRS 2BKXA 2WYIA 3N58A 3PE6A 3Q15C 4CH3A 1B6SA 1UOOA 3ELCA 4JX9A 1W49A 4CMCA 4DMRA 5H1YA 1MQSA 5C18A 3WK5A 2EAUA 1UK7A 4C20A 4C8GA 2ZRAA 2XADA 1SZDA 2Y4UA 1I5XA 2OHXA 1Z6GA 3QPWA 2FMHA 4F7DA 2Z1EA 2O7SA 3UMCA 5BVGB 4YCCA 2VK4A 3T5BA 4LA4A 1I8TA 3HCPA 4V0OA 4ITVA 5FTMA 1AE1A 4DCPA 5DMXA 1D5WA 6YASA 3PGVA 5KQGA 2KTVA 4JJIA 3U9SA 1V8FA 1Z8DA 2YZMA 4P84A 1G66A 4MQUA 2IG8A 2XT0A 4J03A 4D9FA 2AVNA 3H7AA 3L8HA 1JU9A 2CJWB 3HKDA 4Q9DA 3STVA 1Z38A 5CT5A 4U5QA 2CLKB 1ZOPA 2O05A 4I81A 2ZSKA 2E4ZA 1JFFB 2HX0A 2PYDA 1PD3A 4OQQA 3IBTA 3Q5GA 2G82A 2HR3A 1Q0PA 1VJTA 3T5DA 4BMNA 1CJTC 1QH8A 4B74A 1I7QB 3KKNA 3T7SA 4I2VA 1B6QA 4A0GA 1FFBA 1V48A 3JQDA 5K45A 5K5EA 1O7JA 3KR9A 1WUKS 2FWBA 2XGMA 1VQ6V 1D1TA 1TKCA 3KTAB 1NMEA 4FINA 4DUYO 4PAWA 2A9RA 4LP8A 1X74A 1TF7A 4R71A 3PUVA 4EZEA 4YI3A 1OKKD 3FTEA 4DK0A 1CUDA 2YQ5A 1R12A 3LDCA 1JA0A 3DT9A 3L40A 3EIWA 4HSGA 4MV0A 3RBZA 4CH4A 3KYIB 2NT3A 2CZWA 3ETEA 2QV7A 3RS5A 4D9IA 1UPTA 5FI0B 5GJVC 2NXWA 4NI5A 1CZRA 1OD6A 3N3AC 1ZP6A 3V1UA 3OPMA 2WD7A 5E4JA 2WAYA 4EYGA 3MLBA 4I55A 1MQAA 1U3DA 4ZI2A 2RHGB 4OKNA 1P4GA 2EGGA 1JHXA 1NQWA 1MC8A 3P2YA 4HX5A 1G59A 3KJHA 4QBKA 1BROA 3U7EB 1Q3KA 1JJ2F 4PGGA 1X0XA 4DV7B 3I55V 4K0KB 1ZVQA 2H1WA 3EUWA 1Z4NA 1E9AA 2Z01A 1MX1A 1M2VB 1W0JG 2W93A 1IZ0A 4QU0A 2Q67A 2GX6A 1ZWZA 3GMSA 4MWSA 5H59A 4DIUA 2IKSA 1OFTA 2ONCA 5JPIA 1NKSA 4RJJA 1SURA 1KYXA 1BGYH 3AU9A 4ZAWA 3HKEB 4F3KA 2H9AA 3SPJA 4PZ0A 2WF6A 3AL0C 5BVHB 2O8DA 2IJHA 4RTSA 2Y0BA 5J40A 3FB5C 1ISMA 1PG0A 4RFSB 1UZMA 2I7XA 4XSVA 5BP7A 2NP6A 2VT7A 2FRXA 5DNUA 4MLDA 1QB7A 1SCDA 1TC2A 2CVPA 2VYVA 4J7CA 4MGIR 4XKJA 1R0BA 3TZ6A 2GBGA 4XASA 3ZMTA 3DBLB 4XSHA 1AHIA 4N1AA 1KERA 3N07A 1EJ6A 1U90A 4P83A 3ASOC 4IOKA 3REGA 5BORA 1IBMO 1WMAA 4ZHWA 3C7TA 4YP0A 4DIBA 3F47A 1JD1A 4PXSA 3TTYA 3ET4A 3AR6A 3MFQA 4PC3A 3WGGA 4CZ2A 1U0OC 3E61A 2C0QA 4ID3A 4KCGA 3OU7A 2NXCA 1TQ6A 2XQKA 2CK3D 2BGLA 4MQMA 3UM9A 1Q7TA 4XFKA 3QEJA 3UBMA 4F2GA 1XXLA 4JI4O 2CNWD 2GN1A 2RN9A 1Q3HA 1I3KA 3IJPA 3IVAA 4HEHA 4GRAA 4J94A 1PFGA 4PQGA 4Z1VA 1OAAA 3D3QA 1J1ZA 2JJ1A 4HNQA 4R8RA 1MT0A 1J9GA 4BFVA 4US2R 3GBVA 1RBQA 2YYSA 1KE1A 2MINB 1YH3A 3DC2A 4R83A 4OV6B 5B1EA 1PAUA 5IAJA 4J0JA 721PA 3IAAA 4OF4A 5HIAA 5KTTA 4XWGA 3G2IA 4OQMA 4OSPA 2CJFA 2BSXA 4YP1A 2C59A 4O2AB 3CRQA 1ONIA 3Q8HA 1N7HA 1A2BA 3MINB 3OOJA 3PXAA 1JDVA 3SCZA 1F4VA 2RGWA 2ERXA 1YFKA 1G5IA 3WLFA 3RYFA 2CF6A 3OX3A 1PD0A 1FNDA 3CCFA 4F2WA 3N8IA 3LYBA 1YZYA 1UQRA 5KYUB 1YUNA 1Z74A 1RWWA 3CKKA 2ZPAA 4RVNA 1Z29A 1LSUA 2QNRA 3JSAA 3KVOA 1N8SA 2KBEA 2VHYA 3LVRE 3DOEA 4R50A 4Q19A 2HP0A 5DYGA 3R3WA 5JD4A 1B76A 1RHJA 2B1IA 3T4ZA 3H1FA 3HI6A 3OEHD 5JQWA 5B4UA 3LPLA 4JI3B 2IHNA 1VF5B 4L5IA 1H94A 3QXCA 5COAA 1NQTA 1Q7RA 2A1UB 2W6ID 3I9NA 4YIKA 5ALUA 2CLCX 5BMVB 3IQEA 4KL1A 4FVMA 3ILXA 5FTWA 1C0EA 1GTJ1 5KNDH 2UXBO 2AL7A 3VZDA 4HB0A 5AVOA 3OUSA 3WNQA 4MSWC 4LF9O 3SYPA 1HE8B 2KB0A 3LLUA 3EHBB 3F6RA 3NTLA 4RGQA 1UBKS 4KQKA 2ON6A 3K7EA 4UHJA 5D8DA 3DC7A 5B1SA 4F3NA 1VE9A 3BRQA 5A5EA 2XQVA 4L1KA 3FZYA 3WHLA 3R0JA 2LW1A 3SI7A 3R7WB 5IBPA 3X1YA 1R15A 1J9EA 2BH9A 1L0LH 2CLLB 1T5DX 4RJKA 2IHYA 4ZT7A 3G2QA 4BBPA 3MBMA 3KPWA 4G86A 1M90H 2P9GA 2WIKA 1NXPA 3ABQB 4N3AA 2AZDA 1E7QA 3SFVA 3KB8A 1YI0A 2VKQA 3IIJA 4CT5A 1HE2A 2YN2A 3PC6A 4RKEA 4BWAA 5DGIA 3ROMA 1WNSA 5BW8A 4RPLA 2B9VA 1FYXA 1EJ2A 5CB4A 4UASA 4AF8A 4LMRA 1Q6IA 1JR4A 2JBWA 2Q5FA 4TQGA 1WCIB 3R9IA 1YJXA 2NP7A 3VJKA 4PA3A 2AMYA 4G4IA 3WKDA 1CIJA 2XRFA 4RZUA 4YAFA 4CDGA 5BYKA 4TKUA 3K53A 1TCCA 5CEFA 1KRWA 1Q1AA 2WILA 2PZ8A 3OD5A 3Q9LA 2DYRB 1Z6ZA 1ENVA 4HDSA 3H1GA 4MJ3A 1UFQA 2I1QA 2AC4A 3KT8A 1NG9A 2ICAA 2WLSA 2JZOA 3QI2A 2JD2A 4YO7A 1JEAA 3S02A 1GGJA 2CSUA 4HQ0A 4QASA 1B3BA 2I6UA 1E5XA 3LT4A 3K6KA 1U65A 3L7NA 3IUJA 4NAUA 4H4CA 4NMLA 5C5CA 2PZKA 5JC1A 3R7SA 5CVVA 1MX9A 1PVOA 4LHZA 2HRBA 2VZ0A 1Q82W 1STOA 3L7OA 3MCAA 4PQRA 4RGBA 3NTRA 4HB3A 1ACLA 2OCDA 5KYUA 1YJWF 3K0AA 1IFXA 3FZNA 1CUBA 3HJNA 4KWTA 3EYWA 1OXMA 1SD5A 2IYUA 1H9AA 3A1EA 4E5UA 3SGIA 1OWOA 1Q83A 3NK6A 1N6RA 5C80A 3OE7A 3MOSA 3TK1A 1GKIA 1T8WA 3C9UA 1P2BA 1RPTA 3GFVA 3RBXA 1SXGA 3K31A 4LSMA 4S0XA 2L35A 3DBIA 4RJIA 3A6ZA 3OG9A 3CMAF 3MOIA 4Q4CA 3B77A 4RELA 3VKUA 1M6NA 1VL6A 3A25A 4J2HA 3TUIC 5BUSA 2PRIA 3QVXA 3QVWA 2BLLA 3TD5A 3OLVA 3LWZA 1QQ6A 3O8OB 3QWFA 2AOXA 4I08A 3ZI7A 4BL5A 4CKWB 1E2JA 1SB9A 4MWZA 5HZMA 4ETWA 1XE3A 1GM8A 3S2ZA 1DINA 1RHRA 4XWAA 4D9NA 3PXBA 5LIRA 1LNSA 2PU7A 3FD8A 3E0XA 2O5EA 3DDNA 5FWYB 3VOAA 5EQFA 2ECFA 3QFSA 4TT8A 2YV4A 3H9JA 1V5GA 1WJGA 4RMJA 1BXKA 1DZIA 2ZFUA 3K6SA 4JX8A 1GLGA 5CMLA 3CX6A 3ZJUA 3N8DA 1QXSA 1XXHB 4LYJA 5AMXA 1U0SY 4BRSA 3AERA 2GEVA 1QLEC 2UZ1B 1KIFA 2F1HA 2R8BA 4NYIQ 5DZSA 3IBYA 1IK4A 4BQIA 3FIUA 3AM4A 2KG7B 4EOGA 5F2VO 1G8SA 3QVVA 1O9HA 2WB4A 1QR8A 2C03A 4A8JA 5CLGA 1TZJA 2AGVA 1L5GB 2OWOA 4G37A 4I3GA 4P1ZA 4EB6B 5C7OO 3UA4A 3PFKA 2CYBA 2VXYA 4MWCA 5EERA 4TTAA 1B93A 3OAAG 2XAAA 1KC3A 3ZNQA 2WV7A 2G9RA 4UV8A 3UJNA 4TKUB 4N0PA 3SS9X 3W78A 1YRLA 2XUIA 2FSUA 4L16A 3QBTA 5SZKB 1KEUA 1QO0A 3TEJA 3P2KA 3DMRA 4G97A 4ARVA 1JR3D 4MP8A 2E4AA 2F9MA 2M7WA 3HSKA 3IEKA 3MSXA 3BTUA 4ILKA 4P98A 1N33O 4NV0A 4U63A 2PLRA 1IATA 4Y6OA 4DCMA 3FNHA 3GEGA 1S1CA 4RA6B 4C4RA 1K3EA 4CCAA 1PTJA 2QI9C 5L95A 3QY9A 5JFOA 1NG1A 3OMXA 1QBKC 2I4LA 4JLNA 4UVGA 3SD7A 2HUPA 4EYOA 2IZZA 4XOUA 3CCRF 2ODQA 4CFSA 3EXG2 1K3UB 2CB9A 1RZVA 2A3NA 4JQOA 4BU0A 3CCSF 4TVSA 2HA3A 4ZD6A 3U7FB 2HOQA 4D4KA 1ZGGA 1OPRA 5L7WA 2GBLC 2AG0A 1GD1O 5D5PA 5CK5A 3U9LA 3U7HB 1SVOA 2PJZA 1JB1A 1EX6A 3GRAA 4XR9A 4WSOA 1XZEA 1V2GA 2MYNA 3Q0EA 5HF5A 1YJNF 3MLAA 1CQPA 3K2IA 3AUSA 2YXZA 5JDIA 3OZUA 2D00A 5ECGC 5EP1A 1OFGA 4FSHA 5FBQB 3C7KA 1VQ8F 1JVNA 2JGIA 2W9XA 4K88A 2GJAA 3B3GA 4UOQA 1PFWA 3TBKA 5B57C 2CUZA 4CKWA 2A0YA 3QXXA 2QMHA 5B1BC 4EP1A 1XTUA 2VJOA 4YDHB 1QAHA 1EFRA 1Z0FA 2PX5A 3ONFA 1IN4A 2VJDA 5IZCC 3L6EA 3LO8A 1OXTA 1H8EA 1Q20A 3NGXA 2Q3FA 2AJLI 2C20A 2H1SA 1RP3B 4G85A 1JHAA 2F43A 2O48X 4JQZA 3SEQA 3ZDZB 3H01A 2CF5A 3K1JA 1QGDA 2FW9A 3L1KA 3A9SA 5AG2A 2ADOA 5F9MA 1IV2A 2C2XA 3OE7D 3WQSB 4EGSA 1Z7YA 3VYUB 1JALA 1N8RH 4MA4A 1D0SA 2E4YA 2OXFA 4G5SA 3OT1A 3PL1A 2QD2A 4S04A 2I4IA 4S0ZA 4EWLA 2WU8A 4IO1A 1S2NA 1FKAO 2ZM5A 1HO3A 3C85A 4QELA 5ILGA 3MEQA 5CFLA 4AIRA 5JNWA 2VWJA 4OMFG 3PD1A 5K0LA 4A5UB 1SUCA 1Q0HA 1RE0A 2AJTA 2J48A 3W5IA 5DNAA 4YAIA 5DLYA 5C5EA 5B64A 2WF7A 1E6CA 1OH6A 3C5EA 1JIQA 3BYZA 3FSJX 3D6AA 2AHZA 1I94B 1V4BA 1ECBA 3AR9A 3REQA 3A4NA 2ZK7A 4FCVA 1R1DA 2PWPA 4PPNA 1ML3A 2RDMA 1HGXA 3GYGA 1G2OA 3L71H 2X0NA 4AMGA 2W8BC 4A82A 3B85A 4UHCA 3PDHA 2VA9A 1LX6A 5ADUS 4W6QA 1ZNWA 1TW2A 1OXXK 2JD0A 2QS9A 2YWGA 3OZBA 4MOWA 1B0AA 4P7KA 4BMYA 4DABA 3PG5A 3LRTA 1QM5A 3CMEV 3AFNA 3IH5A 1PBTA 3DLTA 4DR4B 3LUJA 4FYWA 4EUFA 3BF8A 1K4MA 2J08A 3R5HA 1CYEA 2ZYIA 1ZI9A 1UZAA 2QAJA 1AKWA 1E3WB 2GCIA 2WTBA 3IAM6 3P2MA 4ISCA 5TARA 4RXMA 1WUHS 5EE3A 2Q3EA 4Y9UA 1E3MA 5HY4A 2FWPA 3M6WA 1KEEB 3BIOA 3DVQX 3GX1A 1QP4A 3RIMA 3EVFA 1DHRA 3NVDA 4BZQA 1QQBA 1A69A 3IAUA 3A9VA 1W0CA 3BJMA 3LP6A 2DSTA 4AROA 1RRPA 1YR1A 1E1QA 1II0A 2Z1DA 4P4NA 4JUFA 1QLHA 3JQBC 4RH1A 5JIBA 3Q8MA 4QYIB 2B6HA 3RRBA 1P5RA 4NCHA 1Q14A 4LTNA 4YACA 3OLCX 1WZIA 4FLXA 3FFMA 1C0LA 3VA7A 3A1DA 3ZDBA 5D01A 3SHTA 2DQKA 2ID4A 2JGRA 5CYOA 1QVWA 5SZIA 5JYEA 5KUKA 1I1HA 1GU1A 1ISJA 1YR7A 521PA 1QHEA 2FY8A 1DOHA 5CA1B 2HHAA 4GO1A 2HPZA 4GUDA 3V8MA 3W7AA 2NPFA 4BT5A 5E7QA 1PW7A 3FVVA 1BQ3A 5KYKA 3LWPC 1T3HA 2Z95A 3TUZC 5F3RA 4EJ0A 2WDPA 4AJJA 2V3VA 1O4WA 5CCEA 2VUSA 3JQAB 3RFXA 4WZBE 5KSZA 3EZ6A 1QMGA 3LWDA 4R7GA 2VR1A 2PZGA 3L05A 3OTIA 2X1VA 4V1CA 3OZTA 4FCCA 3D6UA 1R3KC 1O97C 1EGAA 2BMWA 2HJFC 2AFIB 2JB9A 3COVA 3D3JA 3H9CA 3O91A 1XEWY 5GIOC 3AQ4A 4GP7A 1G16A 4RQBA 1HLPA 2VI5A 3CLSD 4FX2A 4IJQA 4K86A 3A6PC 4FYKA 4NATA 3A9UA 1KGDA 2JIZA 3PDIA 3QNEA 4BKPA 4JKYA 2YJGA 4IG9A 5IUNC 5DHUA 4B0OA 3W0LB 4BN4A 2ZR3A 3NIDB 4L73A 4FZRA 2O1EA 2R84A 2XA1A 1RE1A 2E4XA 5D00A 1L4EA 1DG1G 4X1IA 2ORVA 2QPLA 3E9EA 4WLEA 1YQDA 1KEZA 2QLJA 2HFKA 1NM5C 3A0RA 1CZOA 4MVWA 5JWOA 2BJVA 1Q0QA 1G8AA 4EITA 4PLYA 2VKTA 3U80A 5CH5A 1ZVVA 3PC4A 4XZ3A 1N4AA 1E3WA 2X8JA 3FUTA 3MXOA 3C1OA 1SQ0A 3KP1A 2PMBA 1KEKA 1VE6A 3EZ7A 3HJCA 2EWMA 5ALYA 2WVJA 5IY5C 2B9EA 2ZJZA 2I3DA 3OFND 3VQVA 1DAEA 1GVHA 1UFOA 2YWEA 4RZQA 1KC8H 4WE3A 5EMMA 4DW8A 1WSBA 4D8VA 1G8HA 4MW4A 3SEFA 1NOIA 4IBOA 5TPWB 3RU7A 2ZVZA 1KFKB 1Y48E 1PL6A 5KLVH 1AHPA 2VQEO 2XODA 2PO7A 4BLTA 5L3SB 3ZLJA 1XA3A 3G2NA 2IYAA 3E6AA 4FNOA 4LE1A 5KTNA 2VQDA 3IOMA 2QWNB 3DGEC 3WYNA 4ARZB 5I3ZA 3DE5X 2FXIA 3HJAA 5DULA 4NOMA 5E4FA 5EUCA 3FVRA 4S1VA 2RGDA 1YQUA 3DE6X 4JYMA 1C7IA 1FMCA 2UZHA 1E9RA 3OO0A 3TEMA 1TD9A 4M7PA 1FRVA 3HWRA 1U0HC 3OMAB 5JXJA 5IRCD 1P2TA 5KBYA 4J7AA 4INAA 4C4AA 4QBTA 1QFYA 1YI1A 3F3SA 5EK0A 1C9YA 4BFLA 3PLRA 4KR3A 4BQFA 2HKOA 1XJWA 4FJ2A 5DWVA 2BJWA 1BWQA 1NJIW 3A4MA 3F0EA 4G9EA 4W1QA 1TLFA 5CLJA 1X86B 1P60A 2XMGA 2Z8YA 4W7SA 4KKVA 2VRCD 2NZYA 3E8MA 2HK9A 2NSHA 5H80A 1CY2A 4HYEA 4XJSA 4O2BA 1EZ1A 5LZ2A 1XKQA 5CA0F 2HL6A 2RGNA 3S1LA 3E70C 1ZGJA 2Y1OA 3IKLA 1K7YA 6GPBA 1RCFA 2HBZA 1PZHA 2IHZA 2V0NA 4FIDA 1LU9A 1OA1A 1F7UA 1FFAA 3NATA 1KQGA 2X1MA 1KZ4A 5H83A 4F4LA 2OZBA 4QA9A 1GNPA 1JT9A 1PE0A 2JD1A 3FUCA 2NZ2A 3GT0A 4M1YA 1U2DA 4UVIA 3ACDA 4JLJA 4ZOAA 2P27A 1RRVA 1XG5A 1M1XB 3AKDA 4FOOA 4K5QA 4YA6A 4R2LA 5IAAA 1KQSU 1DTOA 5EAZA 3ETQA 3DSRA 4JHXA 2R00C 2CE4A 4O4LB 4URYR 1DEKA 4TTPA 3VPDA 4ARBA 1P1RA 4UVCA 4V0MA 4OIFA 3NEYA 5C8YA 1B15A 1COWG 1O95D 1P5FA 1SC9A 2JS7A 2EG5A 2UYOA 4HMOA 4MW7A 5F4ZA 1SRYA 5LGUA 4RD1A 4W99A 3RM3A 5JJKA 1NZJA 2EP7A 4ZHQF 4Z2WA 1OI7A 1JIJA 1U2RA 1XJ0A 1OCCB 2EL9A 1EK1A 3DEYX 3HGTA 3QEOA 2W48A 3DZGA 4TUYF 4XCXA 4PG8A 1L5NA 4XWWA 4D8YA 3EXIA 2HLDA 4RPGA 2MSEB 3NG1A 4WXYB 1SWWA 4N12A 4W8HA 5TPWA 2BRUA 1AA6A 2G5GX 2DBYA 1LSSA 5EMLA 3T7KA 10MHA 1XQVA 4D02A 4YAWA 1T2VA 1CIVA 1R4MB 4P08A 3TDNA 2GHIA 5I4KA 2DB3A 1RXCA 1SC5B 1JPJA 1W0KD 2WNIA 3ZWCA 4IM7A 4LJ9A 4TYQA 4CMEC 3QXHA 3G6EF 5EBWC 2CHUA 3EZLA 3C90A 1IBLB 3I72A 2HS4A 2G1AA 1R9MA 2TECE 3GEEA 3U31A 3AFGA 3VDXA 2X6QA 4A73A 1P1FA 1RJDA 1RKXA 2PF4E 5SYMA 4MVJH 1GG9A 1P29A 1YZVA 2HU2A 2F3SA 3PUKA 2WYVA 4QE3A 4QWMA 1A2QA 3PF9A 4WADA 2AYZA 1UC9A 2Z2XA 1D2EA 1RWXA 2WF8A 5D6OA 3Q41A 3Q11A 1VL5A 1G3MA 4RCYA 2OORA 2Z2ZA 4FOSA 5GOTA 3ZY4A 4JL8A 1OLUB 1U0TA 3IT1A 4X6YA 5JWHA 4W5TA 4JEIA 2C77A 4CM9A 3DFKA 5G2OA 2J7PA 1KH1A 1TUEB 5EP2A 1XMQO 1DMSA 3DL0A 2DFDA 4R7TA 2VAPA 4GUNA 1QANA 2GPTA 3ELYA 3G3EA 4ZJZA 3VO8A 1UAYA 3A2MA 4N9WA 4CQLA 3PEVA 3FSGD 5MN5A 1TFUA 2BDEA 3D7MA 2EWWA 3K5IA 4ZI7A 4HLCA 2QRMA 2VFAA 1K6MA 4DMCA 1E0JA 4C6TA 1H65A 3DFZA 5EZ6B 5B12A 4Y2RA 1YONA 4LZOA 2ZRJA 5D3MB 3IHTA 4J49A 4W4TA 3RRYA 3WIOA 3G0CA 3I6YA 3FHCB 3WJQA 3ZY2A 1T9GS 4F1JA 1I36A 2A9FA 1NULA 3UXMA 2IYQA 2KYRA 1GT6A 1N78A 1PL0A 1C0IA 4J91A 2VN8A 1ZNYA 3WJ7A 4D0RA 2O2YA 4QDJA 4G09A 1Q43A 2X76A 5AI8A 4CKCB 3NWJA 2COKA 1HRKA 4WNAA 5DYNA 3ZGYA 2HZBA 2DTEA 3BH6A 1SDSA 1N3BA 1Z33A 1YS2X 3V7UA 5FBKA 4JL5A 4K9LA 1YVRA 2V0CA 3O4GA 4C22A 3SYNA 3M6UA 1A96A 5CPBA 2VRCA 1OCCC 4N3NA 4WAUA 4W1PA 3KNZA 1PW5A 1H8HD 4XIFA 1YHQV 4B3RO 1Q7YW 1EWRA 1IHDA 2Q3CA 2XOKA 3FWHA 1PDOA 1QJCA 4GQBA 4NZ9A 5HA5A 3SC4A 3ZDEA 1I7LA 2KGWA 3EX7C 5HUHA 1DQZA 2CV1A 3I42A 4GPBA 3STZC 5A2QM 1SBIA 5FBLB 3UFXA 1XYGA 1MX3A 1G21B 1DF4A 1LDYA 1NBAA 2H1VA 3LXRA 3FHOA 3LSUA 3NJ8A 4DMHA 4KAAA 1FXHA 1PD1A 1QPBA 4DCSA 3JZDA 3M1LA 4IILA 2UXDO 1Z2GA 1VRVA 2WM9B 3HM9A 1HR0B 3MZ0A 1WXGA 4HDCA 1MVLA 4PAOA 3IAS6 1AB5A 3U7IA 5E1MA 1GQSA 1W6UA 4URWR 3FIJA 3OQHA 3RAJA 1Y4MA 1C0KA 1YJWV 2VHXA 2HFEC 1YRHA 1VI5A 1QO0D 3BVOA 2P6UA 3T41A 3WLEA 3CKYA 3R9WA 3T9CA 3CNQS 3HXTA 1AX9A 3CEPB 1JBKA 1KK1A 1X8JA 2VDVE 3HUTA 3NWBA 5BO5A 3V5NA 3EODA 1OAPA 1DC3A 1FS5A 2AOUA 3TLGA 1F06A 3UKJA 3UKOA 1RC1A 1IWPB 4JA0A 4B3FX 4N39A 4EIWA 4RTJA 3A58B 5K1PA 4X84A 5IFLA 1HXHA 1LTHR 5ITSA 4JQCA 4IXTA 3EDCA 1XRPA 1GADO 2ZT5A 4PCVA 5E95A 5K8VA 4BU1A 3NBZC 4C6TB 3QEAZ 5BY2A 1TQ8A 2COUA 4BKUA 5KNLA 2X0JA 4URVR 4X66B 2BMVA 3MS4A 4LJ6A 5T6MA 4EA6A 2O52A 2BI8A 2JEZA 5SY9A 3K9CA 1DBQA 1OWPA 2QLMA 4AWAA 1Z45A 4XVHA 1SHLA 5LKAA 2IZ5A 2FQYA 4WKNA 2WDZA 3NM5A 3QG5A 4UCOA 2J41A 4RORA 1FXSA 5FBHA 3AP1A 4JCCA 3ND9A 2B78A 2DMRA 3V4SA 2I6RA 3WKBA 4DDVA 4DGSA 4OXSA 1RBYA 5CX1B 4YRIA 1AILA 1J8QA 5KSYA 4ZCLA 3EMBA 1WS6A 1IB6A 4MMXB 1ZNZA 2EQBA 3RS3A 4AUKA 2J7PD 2IXEA 2OTJV 1HDXA 2FGKA 3AJEA 1QV6A 3KOMA 4BC1A 4PYKA 1C7QA 5AVTA 1EUQA 1W76A 1EVEA 3HH8A 2Z2JA 2RGEA 1KI2A 3TQOA 1BFUA 4IIYA 1XF1A 2VF2A 4JGBA 3S0HA 5LYJF 1VBNA 4YMVA 1HYBA 1IEQA 1Q0RA 1ZD5A 3DUFB 3UAYA 4R3UC 3HNRA 3PUZA 4EEKA 2BGWA 1EDOA 4C01A 4RTNA 2SCUA 1AGPA 2P35A 1ZW6A 3A4TA 4HR7A 4Y7CA 4KXLA 2DKFA 5DW3A 1NJSA 3ZMVA 4PZZA 4BP3A 2XNDD 3O4IA 1QKKA 1JTVA 5G53C 1FW6A 4CMEA 4X1KA 2ZE5A 3W5DA 3DE0X 1VQ9V 1ZK2A 3DVAA 4J0EA 4WLFA 3QMPA 5EJEA 1G1XB 3AEUB 2UU9O 4UCTA 1E7YA 3CZMA 1YS7A 4JC4A 4MYHA 4UAGA 4EGAA 3RNLA 5FL3A 4KL8S 4HGRA 2WFAA 4MVRA 3C3SA 1BE6A 1TF5A 4DZZA 1R66A 2XXBA 5CBHA 4B6SA 1FYVA 4X7BA 1JVMA 3OEEG 1XJCA 3PNOA 3X1JA 3W7SA 5M29A 2BMFA 2FCAA 3QOYA 3EZFA 2XRZA 5KVCA 3CEAA 1NPYA 1QF7A 3KVYA 1K7XB 4BJ1A 3A0HZ 2FI1A 2NV2B 5C1IA 1DWUA 3Q87B 1E3LA 2W0FC 1MZFA 2CXRA 2G40A 1XZGA 3DHNA 3FRIA 4GMGA 4OYLA 1YS9A 1NJ6A 4JOQA 5HBGA 4KP4A 1MRSA 1CNEA 4PELA 2QU7A 3VYTB 4BJ5A 4CF4A 4FB4A 1GPUA 4MNTA 1YNSA 1Q7YH 3ERCA 2J4CA 2GLZA 4K8ZA 3KE9A 3QMVA 1Q8IA 1KS2A 2Q2NA 4HVAA 4Y7DA 5KU1A 4PRZA 1MHTA 3VV2A 3JAKA 4RBNA 4KX3A 1LVUA 2P8JA 2QPOA 4LHSA 1IL0A 3ZN1A 2VTBA 2QGZA 3GNTA 1OCOB 5K03A 3K9SA 1IHUA 1XRQA 2G1UA 1J22A 3IBGA 3WFVA 1FXKC 4BT7A 3F4BA 5K0FA 1V7ZA 1X7ZA 3K5MA 4OX9B 3FVQA 4LE2A 4LDPA 4RXTA 4YMIA 5C31A 1OH8A 4IQ8A 3RYIA 1BMDA 1G3RA 1EUDB 1MV5A 2CXPA 2HJVA 2JC3A 3D3WA 1V5FA 3K8OE 2H59A 4PTZA 3PQEA 3DXRA 1N2ZA 3QPVA 1HKUA 4LQDA 4DIOA 4WFFA 2Y69C 1P7WA 4RKQA 2HX1A 2G9IA 5FEUA 1FJ2A 1PJ4A 2YV2A 5GZ3A 3DEHA 3B7WA 1QRRA 3MPOA 3L9DA 1VKRA 1T24A 1TPZA 3GGOA 3A37A 1AR5A 1FQKA 1L8AA 1FS0G 1AUVA 2B82A 2YHIB 3O8QB 1XDUA 3RR2A 3AGPA 1N32B 3VM6A 4BAGA 4BFSA 3DBHB 1XAHA 4Z4HA 3BXXA 4JEMA 4KKXB 5IBQA 1X25A 1Z2NX 2J09A 5TQVA 3FDZB 3PEYA 4J7UA 1LW6E 2Q0OC 1XZLA 1ODCA 2H1IA 1HLDA 4H1TA 2EZUA 3DVAB 2YNMD 2JFGA 1EDDA 3AEUA 3AOEC 4MLZA 3ABKC 1BE3H 1OJLA 1XOIA 4K9NA 4IEEA 2VTVA 1COZA 1Q0LA 2AQIA 3WWCA 3C6ZA 3FPKA 4DRYA 3L2OB 1I3OA 1D2HA 3HZRA 1QYCA 4Y9RA 1WU7A 5KINB 1DJLA 3RSZA 4A5SA 3K9FC 3SJZA 1AUOA 3RU9A 2L42A 5KHLB 3HXPA 3JCZA 2IEGA 4FONA 1U40A 1GQRA 1E1RG 1H42A 2BC9A 2GZDA 3KDAA 1USUA 1ORWA 2VDNB 4H35A 4KQHA 4DIEA 1JEDA 1ZR4A 4I9HA 3K16A 3DOJA 1XCGB 4IEFB 4UUOA 4JU9A 4DC0A 2DH6A 4Z54A 5C37A 5IM4F 4Y67A 5KOIA 1VSBA 3FDFA 1QK4A 1UJ2A 4KPYA 5FNVB 1WIWA 4HDKB 3G5LA 2X0DA 4M36A 1I7SB 3TIVA 1YDEA 1W96A 2JAWA 4R1QA 2IH2A 4JI2O 2C3YA 5TRTA 4E5VA 2XNKA 1XLTC 2HDWA 1IZYA 4C4ZA 1X77A 3JARB 1MJ5A 1ZN2A 1HNWO 3NHMA 5CW1A 4YRKA 1ST2A 1G18A 1U02A 1ZWKA 3KYCA 1VF6C 2B3DA 2IYXA 1X7ZB 3GCXA 2LDXA 4POAA 3UH1A 1SKMA 3GFPA 1NU6A 1RZRD 2JBAA 4AVYA 1GPMA 4I14A 2UUOA 5HCNA 3KHTA 3WQRA 3ZJVA 3LXUX 1KMHA 1BH2A 3VJRA 2AE2A 2JGDA 2WA3A 2BI7A 2PFSA 4RF4A 3WIUA 4A26A 1KK3A 1KD1W 1R18A 1M10A 2R72A 3E48A 3O1JC 1OSNA 1R1BA 2PKXA 3NAQA 1OCZC 2HR1A 1F8UA 1GVNB 1X70A 5G4LA 5B4TA 1X42A 3DOFA 2ZJ2A 2B36A 2XDYA 5BQ5A 4BNJA 1GRCA 3CC4F 2IVZA 2HP8A 3IT3A 4KGXA 5GTIZ 3F49S 5JD3A 2VNSA 3DBHA 2BFDA 4RE5A 2P2SA 1W55A 4D9BA 3DCYA 4QAJA 2IT1A 5E79Z 2WVHA 3FDZA 2ODTX 1S01A 3GVIA 3CXCF 2VYND 3NHYA 3ME5A 4HQOA 4TL8A 1C3LA 4NE7A 4ZVUA 3T5PA 1ID8A 1MNAA 4V24A 4J42A 1FFSA 1GNQA 5FLXA 3B1ZA 3ASNC 4E94A 3WMRA 4XDHA 5ERGB 8ABPA 2IYFA 5IC4A 4QQKA 2OZPA 1E6EA 1M2JA 1BKSB 1GTL1 5ITWA 3SXPA 1E59A 2ZSAA 4F46A 3KG2A 4B9AA 4KPUA 4PR3A 4R84A 1ULBA 3COPA 1X4TA 1ZISA 3EH2A 4K9PA 3T3HA 4YMTA 3DB2A 5ISMA 3K8QA 3Q98A 2F9LA 2GXSA 3TVYA 4NS4A 2GD1O 4D7AA 1E3QA 2J0SA 4OH1A 4LXYA 3Q8WA 4YGYA 3KT0A 2PUVA 5E7MA 3AM1A 2P0EA 4UBIA 3RSFA 3A3YA 3F2VA 1SQ6A 3PUYA 5DISB 3DAFA 4EKIA 1Q3TA 3P0IA 3ABMC 1P8JA 2FPPA 4NS1A 1M3SA 5AUOB 2PUEA 3DEZA 3GLUA 4KOAA 3AVTA 3JYPA 3DBRB 1A76A 1L7XA 3ITDA 4XPIB 1BU8A 5FNVA 3VR6A 1DPFA 4OP1A 1KFCB 2DT8A 2H65A 4R8MA 5AK0A 3EQ8A 4CKCA 4ENWA 4RIFA 4AI6A 4EW1A 2WPDA 2IDJA 2NACA 4ZQIA 3SIXA 3NHBA 1LUVA 1I14A 3WBKA 1KKMA 1L7RA 3C8UA 4CI0B 2REBA 2P4VA 1RPNA 3NWEA 5LN1A 1JEQB 1OE0A 2DOKA 3LUKA 2QVYX 3M4YA 1EGVB 4Q3CA 3DMHA 4ROTA 3SJCA 3UMFA 4H13B 1JGTA 1FNCA 4LY9A 4M9XA 2PIDA 3IEIA 4HJRA 1L4UA 5A4DA 1O0CA 1CJUC 4CL8A 4E2FA 5LQUA 4B31A 3VYSC 1QAOA 1YRYE 1FP6A 3D8RA 3HEAA 4CRWB 4EL0A 1AP6A 5HFMA 1R0CA 1K5GA 2H8KA 1TUBA 2FYTA 1PFKA 3EZGA 3HPRA 3IJEB 1G8MA 3E7PA 1YEWA 3ONVA 1XTJA 2EJRA 2Q4OA 3HG7A 3HLTA 3O2SB 2O7VA 2ZIXB 1I33A 3QFHA 1KAOA 1TM2A 5DCYA 4HRXA 3EEIA 1J8VA 3IVCA 2UZAA 3W34A 2FPIB 3BMXA 3BD8A 1P74A 4P58A 4U7PB 3AHDA 1C81A 2ZI4A 4JBLA 3Q3JB 2YYZA 4PFKA 4ERNA 3HXLA 1MG5A 3W7WA 3EC1A 4HVCA 3DPIA 1XV2A 4DJFC 4HUQA 1XMSA 2PPLA 3IKVA 4PG6A 1QQ7A 1EFHA 3RSGA 3U3ZA 4DQUA 1FMFA 3AT1A 3PHJA 3VNSA 4TZ6A 2Z3ZA 3FWYA 1VE3A 3UOAB 2X41A 4YUVA 2BEWA 5IHPA 4HXFB 1LR1A 3CUTA 4FMTA 4Y9TA 3WGHA 4IX1A 3TPFA 1SFRA 5AJZA 1RAIA 3HQ4O 4XQEA 2G77B 4OHBA 1I0IA 1FEZA 1H1LB 2NO9A 2R6DA 5IYZB 2C5SA 3EDRA 2XRMA 5THQA 4F21A 2XB9A 4Q7MB 2GNPA 4UHFA 4REOA 3U11A 1QNMA 3O38A 3CJTA 3WGQA 2VP3A 1MH9A 3BICA 3GV0A 1PBNA 3JD2A 1OHHA 1COMA 1YZLA 3FNQA 1RYHA 1VG9B 3PYMA 4HEA1 2ZWMA 5SICE 1E89A 1HH4A 1NE2A 2ORIA 4ATNA 6ADHA 1QE0A 1VF6A 3OX2A 4W8OA 4H18A 5TY0A 5H5NA 4XPIA 5IDWA 3MD0A 5ALMA 2YI8A 2D0PB 1F38A 3FHLA 2QMUA 3V2HA 1N3YA 1M0WA 3GRCA 4AIIA 3IAHA 1CQJA 1N36O 1IZ8A 2G9ZA 2HHCA 3EXHB 1GG5A 4JR2A 1K06A 1SG0A 4GLFA 5FI1B 1GP2A 3VJLA 1W0KG 1HC7A 3U3OA 2FOIA 1X2BA 2VS1A 2B33A 2QJFA 2E76B 2ZTLA 3HABA 1ZU5A 4MMZB 1XMOO 1RXSA 4KRFA 2XGOA 1NMZA 3NP9A 1PT8A 4H3KB 2DLNA 2HTFA 4CBCA 2K2WA 2R86A 5ALLA 4JP2A 3NHAA 5FF9A 2HEIA 4GKJO 3WS7A 1QP8A 2RHJA 3UC9A 1GR1A 4E03A 3GJXC 1N5KA 1OW3B 3T1CA 3H2GA 1QDEA 4P6VF 2QJWA 3A3PA 4C21A 2D2EA 3IEXA 5LJLA 3GNSA 2VAWA 1IWBB 2C2OA 2FEWB 2NZ8A 2LGJA 2Q41A 3G0DA 3NOXA 4ND8B 3ORQA 3O4VA 3RUPA 3COZA 3ZOKA 5FQOA 2VLBA 2HSEA 1VPVA 5DO9A 2Q0QA 1MVOA 2JH8A 4PLCA 5B1IA 4U39A 1RPJA 2JJ2G 1XMQB 2QA5A 4MKGA 4G5QA 4HLUA 2HEPA 3DT8A 3MNFA 2AZ2A 1AMNA 5TF4A 4LRYA 3H8SA 1FFGA 2OCCC 1U0LA 2WICA 3OCUA 5L3RA 4XVUA 5IKMA 1BRMA 1CDOA 2C4MA 4NJOA 4EBBA 2EIJB 2GPYA 3VFDA 1N5IA 4IXWA 3CCEV 4B6PA 5KREA 4OQZA 1QWOA 1JJ2U 2NNLD 2VT6A 3DHWC 4QOEA 5KX5F 2DUNA 1JR9A 3ETNA 4Z1MA 1OFVA 3LPMA 3OZDA 1QVFU 2JI7A 2GB4A 2XMZA 4KV9A 4HV4A 1P7YA 4TWRA 3EB9A 3H6KA 4PLFA 5DHTA 1R6DA 1Z2AA 5EJ5A 5TR9A 3H8WA 1Y42X 2MYPA 2C7QA 4JLKA 3F5FA 3O2JA 5E7IA 3LOPA 2O8FA 1VG1A 1IXKA 2J6IA 5KYGA 3LMEA 2E87A 2DBVO 2R11A 3F46A 2GQ0A 3QYAA 2L82A 4M9QA 3UGTA 1NMSA 3WDSA 3KKKA 3K94A 4GC9A 3ROPA 3WXBA 1DLBA 1IMJA 3C3KA 2DQ4A 4NAVA 3D6JA 4ZEOA 3S55A 3CE6A 1OAOC 4A2CA 4LF6O 4LGYA 1KI4A 1JQJC 4G5OA 4L9AA 3T35A 2YIBA 3DVLA 4G0NA 2Y4OA 2EZ8A 5K51A 1NMXA 4RUEA 1SMKA 3F6EX 3OA2A 1JILA 1HL3A 1XTBA 2NPOA 3I9LA 4NBLA 3WP0A 2GTHA 1GTSA 1R37A 2RK6A 4INOA 4B3MO 1ITZA 1PFYA 2A4MA 1P2VA 2FDXA 3LQ2A 4WL0A 4KPFC 3W5VA 1TIBA 2ZS7A 1AUQA 2I2BA 1FSSA 4JKOA 2FG5A 2NMUA 1RTTA 1WOMA 4FM1A 1WWKA 4RNCA 1I08A 1V8OA 3W5HA 3BHJA 5C8ZA 1VMEA 2FWAA 3IEQA 4XWYA 2NVUB 2G07A 1KZHA 1LDGA 3EGOA 1Q86H 2HO5A 4H0FA 4R8VA 5FX2A 1FCJA 4AX4A 3L4BA 3OFNG 2HK8A 1RKVA 2FF7A 4CC6A 2IW3A 1B16A 4MROA 1DK1A 1PZFA 3ZTYA 2BIFA 2E74B 5AM1A 4BW9A 1M72A 1ZD4A 1EEXB 4EX6A 4QGAA 2ZCVA 3PX3A 1W1IA 2E18A 3QPCA 2R1ZA 2IS4A 1L7NA 1F4PA 3NDIA 3QLVA 1E3TA 2FR8A 2P0YA 2UXNA 1J23A 5CB4F 2JLYA 4HK4A 4ZQFA 1KJQA 2HMYB 2WHYA 3N76A 4JBXA 2BSQA 1SG6A 4JGSA 4IRMA 1JT2A 1QYIA 4PGAA 5AYVA 1SEPA 2XWBF 4L5BA 5LLSA 2P6RA 4QICA 4KQ1A 4HUJA 1Q3EA 1T2CA 3RK4A 3CZ9A 3AJAA 4W4LA 3EFHA 1CLIA 3CGWA 3WVNA 1RJFA 4D4HA 5BQPA 3FOEC 3MTDA 4LJRA 1HQYE 4OXNA 1JIIA 5KYNA 3CJHB 1RWVA 4RY9A 5T64A 3H6HA 3KPJA 4KXVA 5HJ5A 2OL4A 3C3DA 3SHQA 1U5CA 1A2OA 1NLFA 2XGJA 2LCIA 4LXIA 2OO7A 2RC5A 4KLAA 4RHXA 3AONB 4LDQA 1K5QA 2P3LA 4TN5A 2Q8NA 3BRWD 3HBJA 2E0IA 5LJIA 3H18A 3I5UA 2O8FB 2IYNA 4DS3A 1JJBA 3FB8C 4LBZA 4B0PA 3P96A 4DLSA 2B1JA 2LBPA 2QVXX 4ARSA 2D6FA 3IMKA 2HN9A 4G9GA 1HSZA 1NV9A 1OZGA 2Q9UA 3PKIA 4HFNA 1OBVA 1JDZA 4AD8A 4F86A 3THWB 3FTDA 5F2EA 5J43A 1D0IA 4WBXC 3DOUA 2VDPB 4RWUA 2PWZA 1CB7A 1XA0A 3KEQA 3KHSA 4OI4A 1W19A 2FWRA 3NPAA 2QRVA 1SPXA 3U49A 3HGMA 3UMRA 2A7XA 5B55A 4QEKA 4GKJB 1TZBA 4FJ1A 1KU0A 2YZ7A 3GDFA 4FUTA 1WB9A 4HX2A 1TIKA 4YAJA 5DX0A 5ARDA 4DY4A 4LRTB 4LF4B 3K32A 1G41A 2WUVA 4P38A 4DLXA 2ZTVA 1T1RA 2CK3A 4F97A 1ABBA 3BEHA 4JI7O 2HA2A 4HQ6A 3M4SA 2C7VA 2HU7A 2YMQA 4WEQA 1WLYA 1ZIOA 4CF6A 5L4SA 3V7EA 5TMDA 1LJUA 1ZQ1A 2OM6A 1C30B 3EORA 4RTOA 2D7JA 2GSDA 1IG0A 5EXXA 2HC9A 3EZ2A 3Q6NA 4BB5A 2ZWPA 4H1HA 1NUPA 4GZLA 3B8MA 2GAFA 2QRHA 2P7HA 3HVKA 4JGIA 2GZSA 2X1LA 1E66A 3CUSA 1GEEA 3KQTA 4D3ZA 2EFDB 2HA6A 2F62A 5GONF 1W47A 4I1VA 1ZI8A 2B98A 4HXEB 3FZGA 3AWDA 3ESBA 5FOUA 2CNLA 2GZRA 3D8UA 2JW5A 3E1GA 2Q5JA 1MDBA 2XQGA 4G07A 3H05A 4HN9A 3VX4A 3ZCQA 1HG1A 1DX9A 4FKMA 5CT4A 1E2EA 1UJWB 2MMCA 3IILA 4JZ2A 1PYGA 3PEFA 3SLKA 4C3ZA 5JTTA 3ZWOA 3FPJA 2HCRA 3O74A 4ENVA 3F8WA 2IVFA 2Z4TA 1VGVA 1B26A 1K5PA 2X6TA 4FOTA 4G8CA 2QTAA 4WN3A 5DI9A 5DYWA 3FXAA 1RBMA 2V6FA 3SDBA 2YI9A 3NO4A 2QX7A 5FAKA 5KYYB 3QU9A 3I2KA 4KIGA 1E0SA 1V26A 4GKKO 3UV6A 3GLFE 4G4SP 3MTAA 4BWVA 2Q62A 1QE5A 4O4HF 1CUXA 5JALA 2FQWA 5AW2A 1L7QA 2X42A 4ZQCB 2YJZA 4C4YA 3QO5A 4FR2A 1G3IA 3D5EA 2H2DA 3M5DA 3I5XA 2W6IA 1SG9A 4MPJA 5CGZA 4N82A 5TX7A 4MB6A 2VXBA 4FMPA 1Y6QA 1Z17A 3UF0A 5B7PA 5K4GA 3ITKA 2X6CA 1NXWA 4PS1A 5F78A 3B5EA 1G21E 2PX0A 4ADSG 5IT9N 5ALPA 3HHPA 3IKJA 3RVJA 3VYUC 3SJ7A 3H84A 3ZN2A 1QH9A 1W5TA 1SHKA 2FCRA 3HP7A 3KSUA 4FMCB 2Q5HA 3SYOA 2LP4Y 4LZPA 1KQNA 3ZOPA 4C78A 1CY0A 4U5XA 4TWJA 4WNYA 2XMQA 2GD2A 4HMQA 2OLJA 3TXAA 3TW6A 1GUYA 4OTZA 3ZWNA 1HNXO 4YVFA 3WJ1A 1NC3A 1FXKA 5PNTA 3SQNA 4G67A 4GOND 2F7SA 2DFTA 1MG1A 3QU2A 1E4EA 2EBWA 1S1MA 2J9ZB 4XJVA 2W90A 1L8QA 4LY3A 1Z8FA 4BW5A 4B3TO 1WD7A 1MDFA 2VZEA 1I0HA 2D5BA 2LCFA 4YRFA 5TEWA 4XJXA 2PX2A 3EVTA 3GCGA 2OFXA 2X7HA 3IR7A 5DSTA 3OHMA 1RAHA 2QLLA 3I30X 1L4NA 2HB6A 3FKJA 2YUAA 2LBTA 1YCDA 4GFDA 4GHWA 5BNTA 5EJ2A 1ZIYA 3GJQA 1O94C 3WJRA 3ONNA 3DB1A 1OB2A 1U94A 2EX3A 2QVCA 1IXZA 2D5LA 4IG4A 4LEIA 4UEOA 4WCVA 3FGNA 4XDYA 5CT9A 4AF7A 1N7IA 1ZFNA 4RD2A 4XGQA 3PFCA 1G5TA 5BVHA 2FTKA 1E79G 2FUKA 3PJSK 5AHRA 4LRWA 1NVVR 2GZMA 2WWRA 2KQXA 3BJRA 4HNSA 4HAUA 3WTCA 4FQ5A 1OCZB 1P81A 2DTDA 3K96A 4DR3O 1GZ5A 1NVUQ 1VMKA 2IDZA 2W6ZA 1YF2A 2KSDA 4WBNB 1KC1A 3M6AA 4LC9A 2BR5A 3TM5A 1FX0B 1JYSA 2OVBA 3BJEA 1ZSPA 2I7DA 1M76A 2VCYA 1RWBA 3C16C 5LP6C 4H1VA 1BMFD 3GT4A 1RMQA 4DARA 1SWVA 5BZBA 1XWWA 4TSFG 1UXGA 1YO6A 2AX3A 4MIEA 3KSDO 3PXXA 3ACBA 5CYFA 5FL7A 4NMWA 1GARA 3FA2A 5IH3A 5CGQB 1HKHA 2JI4A 3VBEA 2AMJA 4MKIA 1PO7A 5J9PC 4RZHA 3TGUH 3U1TA 3GPDG 1JOYA 2VQFO 2Z8YM 4OFBA 1GGEA 2XDWA 5B6JA 1IXRC 3PGKA 2OAP1 3VZPA 4JLMA 1YXMA 3ABUA 2IXGA 3KKMA 4FWTA 1GUBA 1ISHA 4PV1B 4LJ4A 4UBKA 1TM3E 3OZEA 1W57A 1RABA 2BGIA 2BFEB 4ZFNA 5THKA 4PZPA 3QJGA 3P4UA 4GAEA 4LJAA 2WPNA 1VE5A 5EZYF 2I8LA 4ZT5A 2CH7A 1DB3A 5EIBD 3RREA 4NKGB 3DV0A 1QAQA 1QHGA 1XZIA 2R00A 3EUFA 3IXLA 3JQ8B 2A1IA 3L7MA 3N6VA 1UPBA 2ACVA 3Q85A 3QLEA 3VNAA 4D9EA 3BKWA 2IX3A 2XECA 1PJTA 3V9PA 4B4WA 1T15A 1MQ9A 4BLOA 2ZXWC 5F7OA 1Y8AA 1TYDE 4FNGA 3C6MA 1GG8A 3CVOA 1NBIA 1IUKA 3FWNA 4FKBA 3LUAA 4KN9S 4D3YA 5EJ9A 4JTAB 2BBWA 1ADFA 1ODSA 3FZEA 3KKZA 2Q2QA 2HG5C 3K1AA 2QWRB 3AEXA 4CMIB 4DSAA 5F9FA 1CUIA 1PQYA 3LI2A 4PN7A 1L5KA 4UXIA 2PMDA 3DEKA 3W7UA 2W6JD 2L69A 1K3FA 2AZTA 5BUCA 4S1NA 1W73A 3MF4A 4X1OA 4LYYA 5TMBA 2MSNA 2WIGA 5MFPA 1MA3A 1MTOA 2G7MC 3HCAA 1N2XA 3TFOA 2BAGA 1GTVA 1K88A 1Y4ZA 3GLSA 4ZKIA 4DRZA 1RKUA 1YKSA 1HEYA 1L0NH 2BGKA 2NAPA 3AK1A 2WNSA 3VSCA 4OQLA 3GP8A 1TADA 4KAJA 3R44A 4MVSA 2FFJA 4D6YA 1NXOA 3NYQA 2BCEA 3G0IA 4G6ZA 2QUBA 1BXGA 5L4LA 2JLRA 4QEZA 1K8YB 5E9JA 3BX1A 5EVJA 3TGWA 2FEPA 1POWA 4HNGA 3AK4A 3TLAA 5CB6A 4NR1A 2WU0A 3L02A 4JI6B 1WPBA 1GCOA 1UMDA 1I10A 4EGFA 4BGIA 5KYVA 4AJOA 4E08A 2QRPA 4TRNA 4MDFA 2G9UA 1ICIA 1FX0A 3HDHA 3HWUA 4BFTA 3L6DA 2ZYWX 4B6QA 1Y80A 4C82A 5E1AC 1NNSA 2OKCA 2PMPA 1UPCA 4JB8A 3C43A 4DCNA 5C81A 3M6LA 1UBMS 4TWKA 2PRKA 2ISSD 4PO1A 5AJWA 5AW3A 3GEHA 5JRDS 4JI1O 3IUYA 3LNMB 2CFCA 1D5AA 2VPTA 2XUJA 4K46A 4XB6B 5CNIA 1JJFA 2ZQZA 3ZEAA 2HEGA 4YI5A 3VTFA 3FYEB 1VECA 3FJYA 3GVPA 3NV7A 3B1YA 4J4BA 4QU8A 2W6CX 1WPXA 5HP8A 4OOEA 5CB4B 2OD2A 5DF1A 4EF4A 4ZMBA 3UPTA 2DT5A 3A36A 5L3EA 4I5GA 3H2IA 1FZQA 1K8RA 1W88A 4FZJA 4J0FA 4TQFA 4ME6A 5I9MA 2XDQB 3TVTA 1R5JA 4YAKA 2R68A 3JVVA 1R0ZA 2IPMA 5KVAA 1TKAA 4IUBS 3P27A 4K6FA 3EAQA 3W2IA 5LFAA 2ZYRA 4ZVMA 5AM3A 4PM4A 1TJ3A 3ISTA 4BYMA 4P4TA 4NNJA 4XPZA 4GKVA 3ADKA 4D0NA 4H7JA 1J7JA 3LX8A 1JIKA 2Y67A 3MUNA 1IHOA 2VWGA 3RW9A 1UFYA 2V0GA 4E4EA 3NBAA 2GPBA 5EBMC 3OHPA 3K1AB 3CCMF 2PYZA 3ELWA 3Q8LA 3TSOA 3GJ0A 3WICA 2Q4EA 4UPDA 3K0AB 1ZM7A 3WG7C 3I9KA 4GLOA 1HRDA 2ZBQA 4YFYA 3AI3A 3PNMA 1EVKA 2XUOA 3RF7A 3ZHYA 4A10A 1JAHA 5I9NA 1RWKA 1W5SA 1Z15A 2V4DA 4KAXA 4MVJM 4R6XA 1UFIA 1M5TA 2JCBA 2YEVA 4HEA6 4HGOA 1IY2A 1ESZA 1CEZA 4C4WC 4OX9O 2OE2A 3CTMA 3HMQA 3ONEA 4NOJA 2QG9A 5DVZA 5EQDA 5LBUA 4NK5A 3IFSA 3ZZTA 3N5CA 3IAS1 1TTPB 3CCCA 2I67A 3QKTA 4KYUA 5IJWA 4UNIA 1AQ6A 2GPAA 3K0CA 4IIBA 1BEEA 1KIMA 1V25A 2J4FA 4CODB 3D02A 2Z08A 3W06A 3KFLA 2HMSA 5A2QA 3LT0A 4G1MB 9MHTA 1YB2A 4UCUA 2D62A 1NVTA 2QL5A 1JTFA 3SE7A 1M2HA 1Z0KA 4BUZA 2BEVB 2WM3A 1D1SA 2WVGA 3AM5A 4J0DA 3WX0A 1APBA 3U44B 5H6RA 4EJSA 1WV0A 3LDDA 1U28C 2EDAA 2YJNA 1CSEE 2GNAA 2JIZD 2RCYA 3SX4A 4WPGA 1A32A 2GETA 2O6LA 2QJTA 3CRNA 3O8NA 2XRYA 3QKWA 7MHTA 3MTBA 3RYHB 3FB6C 5LQMA 4ASUG 2PFGA 3BSWA 4OLJA 5HCUA 3DXZA 3I64A 4IR7A 4ER5A 5AO9A 4CKZA 5B1DA 2K2QB 5HY1A 3BMCA 1R8XA 2SKDA 3VUEA 2J85A 4REQA 5JJLA 2PZBA 1E2HA 3PJDA 5JS7A 2JFHA 1WDMA 4K9QA 3VQYA 2F4VB 5ELLA 1HNXB 4UEJA 4FFRA 1P3DA 4PYLA 1CLEA 1JFRA 1I2AA 1WKBA 2FN8A 3FSEA 1WB7A 3N6XA 5L51A 1Q17A 1E1QD 1A82A 5FV7A 5KHKA 2NUBA 1QK3A 3ROFA 5JCOA 1NJIH 1U1DA 2BT4A 1ZL0A 1DAFA 3KE8A 4HBGA 3ID6C 2Z8XA 3H65A 3G02A 3F7MA 2C97A 2PL3A 3STWA 5GINE 2VUUA 2F8MA 4QHTA 3S2IA 1WJZA 3OM0A 3QQ5A 3N1UA 1AM4D 4E30A 2Q7EA 1EP1B 2J32A 5C7YA 1KI6A 1T3GA 3KEGA 5AKJA 4XRGA 16PKA 3HA3A 4LNAA 4UMFA 2ZTSA 2PKYX 3TECE 4HL6A 3GRKA 1JWAB 4GKKB 5LXTA 1CRQA 1RYFA 3VOUA 13PKA 3KZXA 1MGPA 1X6VA 2FPKA 3PQ7A 2RGRA 3WGTA 4A1OA 1TVMA 2J6BA 3V4RA 3CRAA 5K3FB 3LWQC 5LMZA 3A06A 3EF0A 1AGYA 2I2WA 3RVKA 2BZSA 4ZIRA 4WUTA 5JR3A 4RZSA 1QZZA 4G27B 1JLKA 2YIJA 3FCSB 4MW0A 5E9AA 3ADPA 2P77A 1VBKA 1KAQA 2BBSA 2J67A 5AK5A 5GWXA 3V4VB 3WHPA 4DEVA 4NY1A 1R3JC 2VHVA 1CUUA 2B25A 2J5XA 2NYRA 1U28A 3VSDA 3QUBA 3TNJA 1EUCA 4PE5B 4E2YA 2HS3A 3LPDA 2ATEA 1GQOA 1OYOA 1G55A 1KO1A 3LNTA 1KKLA 2Q7GA 3RBAA 2H2FA 1L4HA 1CEEA 2RBGA 4OFZA 5JJ5A 4EJSB 5KHHA 1Z5UA 2ZATA 5HZHA 2GK6A 2O3SA 3KZOA 3AR5A 4P5DA 4B4OA 1J9ZA 4IRUB 4UW9A 5LNK1 3MS7A 2F43B 1NVKA 3ORFA 5EPOA 2Q4DA 4O4JB 3BAAA 3DGEA 1ONOA 2PKQO 1J4AA 5JAPA 1FYDA 1PDVA 3E8GA 3AOGA 2DR0A 3O5AA 3U3MA 2O57A 3VPXA 5E3HA 4LF4O 1P75A 2WHRA 2YIBD 2EG9A 4JSTA 1W40A 2P7IA 5CURA 4PAQA 5KTRA 3IAEA 4HNAA 4IWYA 5CB0A 3UCEA 4NNPA 1BZKA 1V11B 1XI1A 2EZ4A 1Y8QA 1H9BA 1ZMBA 2JVJA 4FU0A 3CCEF 2G0NA 4MCIA 3T9EA 4RQEA 1MFPA 4OEHA 2C5EA 2PUBA 3FOAA 2G7ZA 2ZNIA 4DYHA 2WTMA 1ZD3A 1DRKA 1C7RA 1RLTA 1LNQA 2LPMA 2W2VA 4OYYA 5DNWA 2B5WA 1JA1A 3L49A 1RWNA 3SHFA 2XUMA 1W5EA 1GNRA 5JHGB 4IH1A 4WVLA 4M8NE 1DKPA 2CEAA 4DA9A 1ODIA 1G7SA 3K0FA 3OCVA 4NZPA 5KUTA 4RLHA 2UYKA 4DXWA 2PLWA 3DTTA 5TGZA 1KI6B 3B8EA 4D9GA 1DG3A 4IICA 3TNFA 3DVRX 4DY6A 4EL5A 1OFHA 5CM2Z 1E1RA 3U13A 4KXXA 1NI8A 1BX3A 3LHSA 1LTKA 4YXWG 4JB0A 2ZT8A 4K9RA 4RPJA 3B6MA 2CDYA 2A5JA 2WSMA 3J7AU 3D1VA 5B5EZ 4E70A 4FX5A 1MOZA 3UWKA 1JH8A 3LCUA 5LUAA 1WXXA 5BYBA 2WSIA 2ERYA 1PEAA 2OC9A 4WACA 3WOVA 4RY8A 1EA5A 3AHCA 2BGGA 4YHHO 1MHPA 2GAAA 3A3KA 4IIFA 3T9DA 4B09A 1TCBA 1KEEA 2VDOB 2B8WA 3B2EE 2J33A 2NAFA 4D4IA 1EUCB 1U8FO 1ZJ4A 4BOYA 2WZBA 4QBFA 3R7BA 1EM8B 4HAOA 5F7ZA 2C7BA 4Z4GA 3OQJA 3SPGA 3CWCA 4HH1A 4V03A 3QEBZ 4TUYB 3K57A 3O2QB 4LW8A 4AC9A 4RSMA 3I62A 1UDRA 4QSHA 4KBGA 5LVAA 3BHNA 4M7WA 1GAJA 1HDGO 2JJ1G 4NXMB 1XVTA 3AP2A 1NU1H 1BKYA 1UJBA 1ZOLA 1K8AW 1X19A 1G20A 5C3MA 3L4EA 3HP1A 4JTDB 2GLXA 3F7YC 3BGVA 4QL3A 2DWEC 4Q4AB 1N3LA 1WPGA 4BVKA 1K8AH 1M2NA 3ZQKA 4JLAA 1T35A 2C00A 2QZZA 5TVGA 4FB5A 3H19A 3U16A 1E2NA 1UJ5A 1TVKA 2R4QA 3CEIA 1Z4MA 3TSAA 4E5DA 4Y6RA 2C57A 2P5SA 4HNAB 1LJ8A 3OW2F 2QR3A 4UVDA 4TV9F 1JDTA 1KBQA 1ST3A 1MR3F 2AGAA 2XNDG 4ABMA 3LHKA 1X94A 2O9JA 1WP4A 2VIIA 5EIHA 3URKA 1UBTS 1AR1B 3F8SA 1WB5A 2PT5A 4RHFA 2XY4A 3HJFA 3I9FA 4G81A 3MJVA 4ZPJA 2W8BB 1TC1A 2FW8A 4JJAA 4FEEA 5D6NA 5T4BA 3G8AA 4HY3A 4B08A 1QG4A 1S0UA 1WRBA 2IDKA 3GA5A 3NANA 3PHCA 5FFMA 2O2JA 1PNOA 3OM3B 2AKAB 5AXDA 1GGNA 3L70H 3M3DA 3PDIB 1ULTA 5K4AA 2ERCA 2ZBFA 1DJNA 5EC1C 1I1QB 2AF3C 4G9BA 4P4GA 4QNRA 4B3JA 2Y1CA 3S0WA 2VS0A 1NI4B 3DM9B 1Z2DA 3IQXA 4MJ7A 4F6CA 4NJMA 5CDFE 2HMUA 2E21A 3BJZA 1KARA 3QXSA 4GYJA 1VJ1A 2XIQA 1IBSA 2XKJE 5ALQA 2Q5EA 3ZGZA 2FP4A 1JDUA 1E79A 2VP0A 1P17A 2R7MA 2VRBA 2YVUA 1SC1A 1MJHA 1YHZA 2FPRA 3TTTA 3LKBA 4O2AF 1SCUA 3JQGB 3O7MA 1TO1E 4LHEA 3QKRA 2BEUA 4DWOA 1HSOA 5DNCA 2X8JB 1OIXA 1NBOA 1AKRA 2CLMB 3EF3A 4FYIA 3H9GA 1VQVA 4R1PA 4KE6A 2ZM6O 4WINA 1MZEA 4XDLA 4N18A 1X59A 3F5QA 3PWSA 1Z5VA 3P5BA 5HQTA 2QN6A 4MW1A 4KNVA 5FOTA 2Z2IA 1K5DA 2XWPA 3PR3A 1GTG1 3E2IA 3RI3A 1F12A 4GRDA 4CWAA 4D46A 3M1XA 2R7KA 1T36A 3MERA 1LJLA 1QHXA 5GM2A 4M0PA 2GVNA 5IWAB 4JI7B 2C54A 3PYXA 1SUEA 4OIMA 1RSOB 1M2GA 3DPSA 5FWXB 2HS0A 1N2OA 1WTAA 4DKJA 3D7KA 3PXGA 2OSBA 3GI1A 3R5FA 4A8JC 1JR6A 4JA2A 2PFKA 2YXBA 5L3SA 1NR1A 2ZJYA 1M74A 2V4MA 1ONPA 1E1RD 3IERA 4YRMA 3CRCA 3HB7A 2R62A 4BZPA 4R1NA 1DRWA 1FP7A 4OXRA 3IVMA 3N6RA 3ZY6A 5B1NA 3PQ5A 1TA0A 1Z82A 1NATA 3ZHZA 1NIJA 4BXOA 3PVSA 3BZBA 3M2PA 4DSOA 3SYLA 1VQMV 3ON5A 2DQ0A 3RSLA 3SIWA 2CXUA 4MCAA 4WLUA 5J5CA 2GK7A 1Z3CA 1NNEA 2JHAA 4R7ZA 4DTCA 1JWLA 2WIDA 3RDPA 2NLOA 2IBZH 1MMFB 1I2BA 2FPUA 2JEYA 4MQEB 4Q34A 3ZWPA 2UYNA 2W8BA 3FMIA 2FJUA 4QT0A 4O2BB 4ZVOA 3I56V 3RC9A 5JY6A 1I2CA 5JO0A 3R6GA 5BPFA 2M98A 1EX9A 3HYSA 5C8DA 1F8XA 1Y6JA 4M88A 3KJEA 1U7DA 2PAFA 4ND6A 4D74A 3ZEIA 4H0CA 2CHFA 5I7HA 3P19A 1E0DA 1PJQA 4DLBA 1EK0A 2VH1A 4M0UA 4EARA 1XLWA 2ZE8A 1K68A 2H2GA 1KKDA 4OYHA 4BLRA 2Y27A 4P33A 2Z6AA 3KELA 4GI5A 2ZSHA 1X92A 4MULA 3V4ZA 4YRSA 2Z98A 3ZMUA 4ASUD 5EE0A 2ZINA 2DWQA 1SBTA 3GFOA 1R74A 4C88A 1L7OA 3VHLB 4AMVA 5KUMA 1TUIA 2ALJA 2BEUB 1BWSA 2N3ZA 3NVAA 4D80A 2OD9A 4C4PA 1IDOA 3KFXA 4NFSA 3UXHA 4YBRA 4CV1A 4REMA 4U0KA 3CG6A 3AHJA 2FSVA 3F6BX 4MVJA 5FO1A 2I3GA 3GH1A 3TLYA 2YXYA 1WETA