5JVDB

Tubulin-tub092 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
429
structure length
425
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antivascular and antitumor properties of the tubulin-binding chalcone TUB091.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 167
structure length 425
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jvdB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5jvdB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5jvdB01
4O4IA 2Q1YA 4LNUB 4DRXB 4B46A 5CA0A 4XCQA 5IJ9B 3HKCA 3E22B 5EZYB 3WGMA 4O4HA 1TUBB 4EB6B 5BMVA 4YJ2A 3UT5A 5CA1A 4E6EA 3ZIDA 3WGLA 4X20A 5FNVB 5LA6A 3HKCB 4X1IB 4I4TB 5IJ9A 4TUYB 1TVKA 5LP6B 3JAWA 3VOBA 1TUBA 4YJ2B 4EB6A 5BMVB 3V3TA 4EI9A 3WGNA 5ITZB 2RHLA 2VAMA 4U39A 5J2TB 4X20B 5FNVA 4M8IA 4HNAA 3RB8A 4O4IB 4DRXA 2RHOA 5EIBC 4IIJB 3JAKA 1OFUA 4U3JA 5EZYA 3C8LA 3ZBQA 5J2TA 1RQ2A 5C8YA 5LYJB 2GVIA 5LOVB 4O4JA 2Q1XA 4TV8A 2XKBA 4KWEA 4I55A 5ITZA 4O2BB 5MN4A 2BTQB 4ZHQA 3HKDB 4TUYA 3VO8A 4HNAB 4F6RA 5M7EA 3RYHA 4WBNB 3JARB 3N2GB 2R6R1 3VOAA 3RYCB 1W5FA 2R751 3RYFA 3M89A 5JCOC 3JASA 4O4JB 4EI8A 1Z5WA 1JFFA 1FFXA 5IJ0B 5GONB 4DXDA 3ZBPA 2BTOA 4X1KB 4TV8B 4IHJB 3VO9A 5JVDB 5EIBD 4TV9A 1JFFB 2VAWA 3HKBA 3JAKB 1FFXB 2RHJA 3CB2A 2VAPA 4B45A 2XKAA 5J2UB 1W5AA 4I50A 5GONA 3JALB 3RYCA 4F6RB 3JAWB 1TVKB 5LP6A 1FSZA 3JARA 5CB4B 3N2GA 4FFBB 3E22A 4I50B 1W59A 3UT5B 4O2BA 5CA1B 2BTQA 4ZHQB 4ZI7B 5KX5B 3N2KA 5JVDA 4ZOLA 5LA6B 4IHJA 1RQ7A 4WBNA 5MN6A 4FFBA 5JH7B 4EI7A 3WGJA 4O2AB 5IYZA 5C8YB 4X1KA 5LYJA 1SA0B 2RHHA 2VXYA 5JCOA 4YJ3A 4IIJA 4O2AA 4U3JB 5IJ0A 3VPAA 1W5EA 1RLUA 4X1YB 4I4TA 4X1IA 1W581 3N2KB 3RYIB 3RYHB 4ZI7A 4ZOLB 5CB4A 5KX5A 5LXTA 1W5BA 3JATA 5JQGB 5KMGA 3WGKA 5MN5A 1Z5VA 5JH7A 3M8KA 4I55B 3JALA 4X1YA 5CA0B 3HKDA 4LNUA 3JATB 5JQGA 5LP6C 5KMGB 3HKEB 1SA0A 5LOVA 5EYPB 4O4HB 4O4LA 3HKBB 3RYIA 5LXTB 4TV9B 4YJ3B 3R4VA 3JASB 3RYFB 5J2UA 3HKEA 5EYPA 4O4LB 5IYZB
chains in the Genus database with same CATH superfamily
3IBCA 4EO7A 3BHIA 2ZWIA 3K5PA 5TXGA 4ZP1A 1A8HA 2UV8A 1IE3A 1XMOB 1NFFA 3AP2A 2FFJA 2PWAA 3F6PA 5IASA 3WGLA 5JISA 1K68A 3O85A 4QVGA 2AJ8A 4DC9A 1VQNV 3OSUA 4LYGA 4C4XA 3SD7A 3VZBA 5IJWA 4CQMD 4P4TA 1J9ZA 1FSGA 2BFDA 4OSEA 5AKHA 3T7IA 2EW8A 5HZKA 5LQRA 4UOZA 3GARA 3H1KH 5B3SC 1U3DA 4M49A 1AZLA 2CWJA 2B8NA 2OEPA 4D6PA 3QMVA 1JEQB 5LQAA 4AG3A 4HZUA 1IZ3A 3PD0A 3R1IA 5FUYA 4TXNA 3E1YA 1A9OA 1AN0A 2EF1A 3EIHA 2W83A 3LC7O 5FI5A 4B31A 2XB6A 2EOAA 3L7QA 4TQGA 4B4UA 4TT8A 1BJRE 2JH9A 4PI2A 1G6Q1 2QL7A 1QOQB 2CB9A 1L3BA 1FXKC 2C58A 2NV2B 4OY3A 4BO0A 4BBZA 2HA5A 3A1VA 3B8MA 1PX2A 1BYIA 3FFXA 2OECA 4IIYA 1CN7A 4AQYO 2D7JA 2IF0A 3SHWA 3W5UA 5JY1A 4K9SA 3AETB 2FGJA 2OAP1 4GLFA 1GPLA 4DNPA 3CH6A 1UT8A 2O3SA 4NX2A 4B47A 3PJRA 2GDSA 1VQ1A 1PWZA 1HE4A 1QKJA 3L73H 3MQFA 1QFYA 1ADYA 2E75B 2QZPA 4I6EA 4J0CA 4N5NA 4UKDA 5F35A 1YS7A 2MSWA 2C5FA 3WG7C 3DKPA 3H8VA 3OWXA 4TSRA 4UTOA 3FMOB 5DWQA 2XBUA 3N1UA 1V5EA 3ELYA 5KNLA 4WSOA 3O8QB 4UU0A 4KI7A 1TT7A 3EZ7A 3C85A 2BJVA 3M6UA 1EVLA 4YY3O 3G6EV 1RPNA 1OAKA 2OBBA 3DOJA 2BKUA 4MUYA 1E7KA 3EEQA 3TPCA 3Q4HB 1OW3B 4MQBA 3EGEA 4ZT3A 1DAFA 1CJMA 4H6XA 3DO8A 4HYQA 4MQ5A 3ZQ4A 2CLDX 4YMHA 3SQXA 2F67A 1NPYA 4GLBA 3MDSA 2XYVA 4GMXA 4QL3A 4R3NA 2HRBA 5G0TA 4EMTA 2DPYA 4WCFC 1KJZA 4ZVKA 1WMBA 1IXZA 1LNZA 1KETA 2WKRA 4HX5A 5HGXA 5IBCA 5EIOA 1QFMA 5JAHA 2R2AA 3EW7A 4IRXA 3VRHA 3U11A 2ZUCA 2W6MA 3HCRA 5K8JB 4GWKA 2BYTA 2FWBA 1XLWA 2PLWA 2V7QA 3JVVA 1DJOA 4GQBA 4RC9A 4QPJA 4F8YA 4JU8A 1DFIA 2FSSA 1NUPA 1V16B 5LMCA 3CTPA 3EA4A 3GR6A 4IGGA 2AN1A 2QRVA 3KZMA 4HLDA 4KXQA 2CJWB 5AK0A 4N47A 4EW1A 2OCLA 5IVIA 4KYVA 2ISSD 4WUTA 3WE7A 1VB3A 4FKBA 1U2PA 1USKA 4RCZA 4DR7O 1R6DA 3NFRA 4DN6A 3BY6A 4I9QA 3CT4A 2XUPA 3O1LA 4G97A 5B4TA 4Z1VA 3NPMA 1BXGA 1GM7A 3LDGA 2G82A 3PUJA 5BQFA 1FZQA 4FX2A 3H13A 4JF3A 9ATCA 5DLDA 2QTOA 1HO3A 3DAOA 1HDZA 2WU1A 3KXDA 4LJSA 3D7LA 5DBGA 3UEOA 4AY6A 3P7MA 4UAVA 1AQUA 1EFPA 2R48A 4XUEA 4ZOEA 4FLUA 4MUGA 1G4AE 4XD7A 4BT5A 4CKCA 4EL5A 4FYKA 2LP4Y 4A03A 1DJQA 4RHEA 4V0QA 4L02A 3HVJA 5HIMA 2XZOA 2GETA 1F0YA 1WEHA 2ZDGA 3NOXA 4QOHA 2A58A 1HYGA 2V7XA 4RVSA 4RDXA 1ACJA 3E70C 3FWZA 4PG5A 1MBZA 4BWYA 2B2CA 5JAZA 5F3DA 2GSDA 1MENA 2QTRA 3PPVA 3P94A 4IGIA 3OZGA 1USWA 3DTYA 1INLA 1QLNA 3L7MA 3O0TA 2YV1A 4ZVUA 3F3SA 3G0CA 3DMPA 4E4RA 3N7AA 2NQTA 5TQJA 4IRMA 3IIMA 2PMPA 1EFUA 2F1JA 4PGFA 3GT0A 1XJQA 3BREA 1E3WA 3DDSA 3IO5A 5G3YA 3RIXA 1Q83A 2CFIA 2F00A 4ZMRA 3UAOA 1MIHA 1CFZA 1YE3A 2CVPA 3D7NA 1JTEA 3JAWA 1N5JA 5GZ6A 3DKVA 4ARAA 3MBOA 3ZDCA 3H2ZA 2XSZD 1LXCA 4J2TA 1Z5PA 3E8XA 4PYLA 3CWZA 1H6DA 2WLSA 5D3QA 1E66A 2LFSA 1VIAA 1B3BA 4Y0AA 1J24A 4EG6A 2QTBA 5IN4A 3S0HA 4UEWA 1AV7A 4YQYA 3RKRA 1GM5A 1UXOA 4CKWB 2P40A 1PTJA 1Q1BA 1MAHA 1W29A 3ZGXA 1Z2NX 4BC0A 2DERA 1Y5LA 4NV3A 1GN9A 2LCAA 2D1YA 2FR1A 3F6CA 2AXQA 2OIGA 3CNQS 3K35A 2VBIA 3FFTA 4JLOA 3CS3A 4IGKA 2XITA 4KVAA 1ZCBA 4I55F 4L7VA 4OCZA 4P7FA 4QFBA 4F21A 4F93B 5DO9A 1ZP6A 1N78A 1FAFA 4EHDA 4MGHA 3Q7SA 3QKSA 3REFA 2CTWA 2C42A 2Q4TA 3ZMTA 1IEXA 1R0ZA 3ZY2A 3O1IC 5JS2A 3VOTA 2ZBRA 1T29A 3BCUA 1DOZA 2CLIB 4R8SA 5F4BA 3RUDA 3RRYA 3HJRA 3ZGVA 3CONA 3FDFA 2COKA 2X4IA 3G5UA 4MIKA 2EIKB 2HHCA 3QVOA 2R8ZA 1L5NA 2OHOA 3C3WA 2WB2A 2F1IA 3STXA 1RWXA 1I7PA 3H1BA 4G4ZA 1VL1A 1Z6QA 4IR7A 4KJZA 5J4LA 1H6CA 1K6MA 2BFFA 1AC5A 4RK1A 1FFTB 1WXXA 1T5DX 3AXSA 3BX1A 4GD3Q 5AIBA 3UMMA 3J7AC 3BMNB 4MOWA 4IV8A 4KV9A 4U2DA 3G6KA 2YC2C 3RYCA 4P35A 2AEMA 2ECOA 3E48A 3NBQA 4NJMB 2R5WA 4J7ZA 2H4JA 1NT2A 3K0KA 4LVUA 3SYLA 1P2FA 4YGXB 1CY7A 3ZEDA 1WNFA 2QVXX 3SYOA 4HZIA 1L5QA 4QBFA 4RMJA 4TLAA 2VPWA 1FFSA 3T3GA 2ESRA 2OKCA 3NYWA 3WKEA 5JWRA 5LWHA 1KWKA 1X8LA 1RQLA 3G88A 2BVNA 2FMTA 2Z5LA 5CH8A 1JYFA 1M2GA 2GXSA 3FFBA 4JYCA 4E13A 5JXWA 3ETGA 1Y3AA 4I5IA 3UF0A 1PJLA 3ZE1B 5J5AA 3V7YA 3W8FA 5JU6A 4BKUA 4KQ6A 5KNBA 4I5EA 2HK6A 5DYIA 1FNMA 5M5BA 4OHCA 2E49A 1GZDA 5EGSA 1EUCA 3AUUA 2C88A 3HCPA 3MJRA 4YRJA 1ZM4A 3O8NA 1IV2A 1VYUA 5DISB 4G0NA 1GGMA 5JH7A 3LXUX 1YIDA 1CUBA 3HYLA 1CUHA 4UAUA 4B4DA 2ASVA 3ZLJA 1GN6A 1QD9A 2NXCA 5GAJA 2EKZA 3VC3A 4CF5A 5FUWA 3NMUC 2CEKA 1O97D 3OQIB 4U7HA 3VBEA 3OZIA 2QRZA 2X4LA 2FGYA 1E1RG 1P19A 2HMAA 4MAMA 5COAA 4C6TB 3NDJA 5JEDA 3PPYA 1SA0A 2FWNA 1SCUA 3LGXA 4LOIA 3OJWA 1SUEA 4FMCF 1AKNA 1GTRA 3RRNA 1FFGA 1JHRA 1Z5UA 1X14A 1ZRSA 4BVAA 2DUWA 2BR3A 3D8UA 2P2ZA 3DDZX 3LT0A 3K9SA 4WNIA 3TL6A 1J4AA 3KB2A 4AYXA 1WABA 1VARA 3PKJA 4KR3A 2Y1EA 4MVCA 1Q0RA 4F38A 9GPBA 4JKYA 5FLYA 4EDHA 3WLAA 4J16C 2ZGVA 4XFJA 4UCWA 1A5ZA 3N70A 2AQ8A 4W9MC 2MYPA 5KOIA 3GLGE 4PSUA 2Q2NA 1Z6GA 2N05A 1MNQA 2FH5B 1QORA 3B6ZA 3FYUB 4GNKA 2IPAB 4KFCA 3HDHA 1DBWA 1LFAA 3AZOA 3FKSA 4DIEA 5CUQA 5LN1A 2M6KA 4FJ0A 3AK2A 3AEQB 4W4KA 1ZW1A 1VG1A 3IE2A 4YUVA 3KQVA 3L8MA 2CXXA 1U1DA 2Z9DA 4C03A 2F4VB 4KO1S 4UBLA 2K2WA 4NPAA 4YMVA 3IB3A 4JI6O 1J0DA 4WFIA 3TJZA 4AC9A 4KITB 1K7FB 2V7BA 2XXAA 4M1QA 1UZAA 3ROQA 3ON1A 1ZK1A 4KGDA 1XNQB 4P4GA 2XAJA 1DV1A 2QY9A 4GQAA 4AF6A 5CBKA 1YI0A 1LSSA 3DL4A 3G71F 3N2GB 2YFYA 3D01A 4R5MA 1G4HA 1Z7EA 2QTTA 1X19A 2FPIA 2JANA 2EX3A 1XDCA 2YYZA 3NJ4A 3U4IA 4MYDA 3PQ4A 3DTVD 2V4ZA 2RGYA 4HQ0A 5HZHA 4LJKA 4E4TA 1ZONA 3WIDA 2GJAA 5LLSA 3TAXA 1M0TA 2DLDA 3BMOA 2WZCA 2AZMA 1ELOA 1C30A 3LPNA 5EIFA 2B5OA 1KKDA 2EF0A 4JT4A 2JG3A 3P3PA 2BRUC 4MIYA 4OPMA 1NZ6A 3UO8B 5CAEA 1WE2A 5AVQA 5KPJA 1GM9A 3ADPA 3NGXA 2AFIB 5DN9A 1SXPA 2PX6A 2BI7A 2UVPA 1HFEL 5TGZA 3IP5A 3VZCA 4RD0A 2AIZP 2HA3A 3U7QA 3F78A 3WFVA 2QX6A 2DZDA 1S72F 4LZJA 5C0OE 4CI9A 1H1LA 4YIKA 1E3EA 3VI6A 1K89A 3B51X 2PD3A 1KI9A 2GN8A 5CA1B 1AKWA 3CF2A 4ZHQB 3L6OO 2RIPA 5IHXA 2VTVA 4JMLA 3Q3VA 4WBNA 1UP7A 3SEAA 1XLTA 4BFVA 5HOEA 4LF4B 2R6CA 4EI7A 2VZEA 5J3JA 3DVAB 4C8EA 5K0NA 3H4IA 3C6QA 3W4KA 4FK8A 2BKXA 3MTBA 1DC6A 1GKKA 3NTRA 4A73A 4C14A 1U7PA 1SZJG 1X8XA 1Q1QA 2Q9AA 3SPHA 3LP8A 1UK9A 1CZOA 1U9ZA 3C9UA 3A3NA 2X7HA 1UDRA 4C6SA 1MKYA 3G5TA 4DLRA 3IR9A 3DMDA 4IDQA 3QJGA 1L7EA 1F7UA 1U6KA 1EWRA 5B58C 1DO8A 2R8YA 3O8OA 1I4OA 2C57A 3WJPA 1GDTA 3WNZA 3BRCA 3I9LA 4JOQA 3L82B 2R8EA 4GM0A 3CB4A 5TY0A 3UM9A 5CG1A 1AG9A 3E9ZA 3R7NA 2FP4B 1MA1A 2PWZA 3RPEA 4KL1A 2EINB 4GZ5A 1DWUA 3GF4A 4D3YA 2Z57A 1N36B 5H02A 4QO7A 5ALJA 3T41A 4W5TA 3OEEA 2XDQB 3SIXA 1H4QA 1SC9A 4P7GA 2IHKA 2A1UA 1UCFA 1KEEA 5DP2A 4J3JA 2WC1A 2BGMA 4EAQA 1C4KA 4TQUS 5F77A 3EFHA 2RK6A 5BVHA 3WMRA 4JOSA 4CEJA 1IY2A 2CXHA 1FQOA 1CWUA 1M6EX 3K73O 5T57A 2UYCA 3CYPB 1F51A 3JVDA 5A2QM 3PQ6A 3VNQA 5LQDA 4K6HA 4PX9A 2V6FA 5EMLA 5AICA 4G37A 2VHQA 5DE3A 5BQPA 4ZA2A 5K8CA 4FEYA 4EH1A 3PF9A 1UJ5A 3GIWA 1IUOA 3RC7A 1BGVA 3VDRA 4DR6B 1Z37A 4CFSA 1TC2A 1RS0A 4B7ZA 5JD6A 1HW7A 1E3QA 4F1JA 1SUDA 4QBGB 3BTOA 1UFRA 1R8YA 3BHMA 2R65A 1KAHA 3AKCA 2IXTA 2FZ5A 3KYBA 3WKDA 1II8B 1PGNA 4L0DA 1V1JA 3GTZA 3DHWC 1W0JA 2G25A 4KPGA 5FNVF 5KSWB 5EWJB 1S4QA 1C3JA 1VMKA 2QJWA 4RF5A 5K5EA 3E82A 5DSTA 3ER6A 3M33A 3X1WA 4XUDA 5IAAA 3R7LA 5K09A 2QYOA 4PIMA 2F8SA 4FJ1A 1KMHA 3CHYA 3DUFA 3ZZNA 4FM0A 3H9VA 1KI2A 5K9ZA 1G8YA 5DBEX 3SPJA 1L7OA 1P6XA 1SVSA 2YYYA 4I1UA 4NAUA 4HATA 1JHZA 4P34A 3KXPA 3L46A 2ZRQA 3DGFC 4FMCB 5BR4A 3RYCB 1Q0ZA 4IJ5A 2R96A 1VKHA 2R751 1A8UA 2OT3B 2QTMA 3DXZA 4FDLA 4RHCA 1H38A 1EKXA 3TVYA 3V8BA 3PX3A 3H5IA 4FPPA 3GPLA 2C31A 4DSNA 3QOYA 1RACA 4MV3A 4RTOA 3ZYCA 4RAOA 4OK3A 4AMUA 5DNWA 4AQDA 1GZ5A 3QYFA 4X54A 2QV7A 2RGRA 1SVNA 3OBIA 3R9XB 4OLJA 5DNAA 4WE3A 3QU9A 2HRZA 3X2QB 1XPJA 3D64A 2V03A 3O4HA 4GUNA 1AGPA 1D6SA 3RBAA 5K0BA 5LDDC 1SBQA 5IT9N 4Q4DA 4TXLA 3VZSA 3DR5A 3LWRC 1SHLA 1QRRA 2GEDA 3EVAA 4KYIB 4RNDB 4F60A 1B8OA 3CPJB 3RGGA 2XB4A 4F3TA 3CCUV 2YVLA 2IYVA 2AG6A 3ECSA 3FOCA 1BE1A 3FG9A 4L28A 2PYLA 3G3EA 3OCZA 3PDIB 3UAVA 2QT0A 3KHSA 1IOZA 1E1RD 2A5DA 4HJXA 4Y7CA 4NBLA 3SIRA 3C1AA 4G0PA 4PGGA 2EP8A 2W2TA 4B6FA 2J4FA 1NLYA 2Q3MA 3DVLA 3H1TA 3NW9A 1DVRA 4RD3A 4BYMA 3RROA 5HWEA 3SOPA 2J3IA 4A5OA 3K58A 4EAAA 1F12A 1I2MA 2AKYA 2AJLI 3IB6A 2P2SA 2YC4C 4ZYYA 1TE2A 1VHQA 2P1DA 3VH2A 4EX7A 5TPWB 4NFHA 3D5EA 1T2UA 4W8HA 3DWFA 4J9UE 4EW3A 2YL2A 4IVPA 5BVGA 2FPGA 5CLQA 2PR7A 1WSBA 4AECA 5C37A 4L75A 5E95A 2ATVA 1UPUA 3KSRA 4EA6A 3FB8C 1GZUA 1WSWA 3QKSB 3SS7X 4DBLC 4KXRA 3H7AA 4FGUA 3U49A 1TPZA 3BYQA 3G9QA 4MPJA 2HF9A 2VGMA 1UJ6A 4ENTA 4P5PA 1EFHA 2GH1A 3ITKA 3L6UA 3ROXA 3UOWA 1V5IA 4BCCA 3PDWA 4EYOA 1ZFNA 3OKAA 3EISA 4MA5A 3F47A 2YJ3A 3CCBA 4KIFA 4LP8A 2QSAA 4C82A 3MRVA 1NKDA 4WV3A 3TG2A 4LF7O 5DGIA 3AHEA 1LVGA 3EXHA 3H17A 5E38A 4UXHA 4KXWA 3SZGA 1Z13A 2F3QA 2C9CA 2JK1A 3QBVA 1C1DA 3H0CA 4D8TA 2FPPB 3IXLA 2CY0A 1Y9EA 2REQB 2WIFA 2LZ0A 1E1DA 2QN6A 3QVSA 3LXXA 5EE1A 1LBHA 3W8EA 2JIZA 4JZ2A 3RSSA 2FOLA 3O3CA 1QP0A 4TSFG 1QO9A 2VQEB 1ANKA 3JAMM 1XAGA 4F4UA 4IILA 5B3SB 1M2EA 3QUAA 3ZWXA 4LF8O 2C3YA 5LMZA 3E8FA 4DRXA 3ABKC 1M2JA 2BMWA 2EBFX 4R2IA 2MR5A 1ZH4A 4G26A 5EP3A 3WKAA 3ZNQA 2B7BA 3LCCA 4JL6A 3HTNA 4TKUB 1XBTA 3EYWA 4BQFA 4HTFA 3GJ7A 4ZYXA 2C20A 1YS4A 3ACCA 3EIQA 3G8AA 2WAMA 1QC5B 5BNZA 4ICGA 5A4IS 4G25A 2NYAA 4ZV9A 1E2HA 5TARA 3OF3A 1P80A 3A31A 3WS7A 1XVTA 2DMRA 5CTAA 4BB0A 1Z5GA 4OXNA 4FGJA 2GTSA 1JG2A 2B98A 3WQHA 5AW6A 2IWHA 3WL8A 2G5GX 5I5EA 3AU8A 3IP1A 4XUCA 4LWSA 4GWGA 1OC4A 3AHIA 3BHNA 4KR7A 1XDZA 2VVTA 2PJZA 2Y99A 4G5OA 8ATCA 5FI3A 1EFVA 1X39A 2GPJA 1UKEA 1YZFA 3ZN0A 3VOAA 1EHIA 1KBZA 5EI5A 1YIJF 2DSNA 4EJSC 2WM8A 1HI9A 4UV9A 1GU7A 4QJIA 3BMXA 3IDQA 1FBTA 1QB7A 2GT1A 2WPDD 3HNPA 3IHKA 2PKQO 2E21A 2MT9A 4URZR 4MWSA 1N3YA 5K8UA 4OJTA 5L9AA 4FM9A 2O2SA 4KU4A 1D6JA 3CMCO 5DJ5A 2XQIA 2ZIXB 5EZ6B 2QTFA 4RU1A 2H65A 3U1BA 2HMTA 3GH3A 2HMUA 1P2BA 1W41A 5ALVA 1Y1SA 2PSFA 3NBYC 2C4TA 2COEA 1BSMA 4R40B 1X9IA 2WVHA 3DE5X 4QAQA 1OV4A 4GOKA 2KLBA 4WHMA 5EQFA 4AURA 4E5SA 5JSYA 2AD5A 3A06A 4X24A 1NV9A 1CK2A 1V35A 1VEWA 4JI1B 3EDYA 2VFAA 4K1XA 4CJXA 1V16A 2KYRA 4ZOAA 4F7WA 1N34O 2J7PD 3E7PA 2I6TA 2BMVA 5EUCA 2P9QA 1E3WB 1JQ3A 4DV1B 1DKMA 2CFCA 3BTUA 3N53A 1ZD4A 5EKDA 1Q3HA 2B9VA 3UJ7A 1C0LA 2L6LA 5I9LA 2GERA 4J1TC 2XIQA 3CRVA 5LIPA 2QUJA 1HEIA 3SZUA 4TMKA 3F8WA 3GT4A 1N2OA 3RSFA 2V3CC 3KKKA 5J1TB 4ZK2A 3OR6C 1UFOA 2F43A 3ZCTA 4F4HA 2VK8A 2ZI3A 3RAPR 1VJCA 3BGOS 2OQIA 4DXHA 2XUKA 1UMDA 3TLMA 4HDMA 1CC1S 3LNTA 1I6LA 1VPLA 4KMOA 1M9NA 2DOKA 2FZ4A 3IE0A 4W6QA 2AF3C 4PA3A 3PYXA 4KWIA 2MOKA 2WFZA 4L8GA 1LTQA 2I2AA 4MMXB 5FBQB 3O38A 1DEAA 2VPIA 3W5IA 5HX7A 4MWTA 3GXOA 4BVTA 3MWEA 3PE3A 2AG5A 4QDZA 3B6EA 3K0AA 5AXAA 2PJDA 4IYRA 1YONA 1AA6A 5LP6C 3CEHA 2QTVA 3OUUA 4U0JA 1R9MA 1NBMA 2VJMB 3JQAB 2QT9A 3MUFA 1UBLS 3IIJA 1L7NA 5LL6P 1BCSB 3PEWA 3H5RA 3RVKA 5A4MS 3OCYA 1TCAA 2J09A 2PZ8A 3MRXA 4K5QA 1SC5B 2C7PA 2YHIA 3GRYA 1M2VB 2FXIA 4R1MA 2X6BA 2I0FA 3NK6A 3V46A 2ZJYA 5L51A 4TKUA 1X1AA 4EFNA 4BBJA 1RJDA 3OEYA 1A5TA 4KQ9A 3OM3B 1V3QE 4P9OA 1KSJA 1T3TA 3FIJA 3IHWA 1Y5IA 3Q2KA 4PR3A 2XTAA 3I4LA 3VV2A 5TJHA 3WTCA 2O0MA 2JEUA 3BWYA 2HJSA 4WN9B 3R7BA 3GIDA 5HF5A 1HE8B 1RSOB 3V4VB 3E6AA 4NICA 2CXOA 4CMJA 4NL4H 1YFJA 4GMDA 1N1DA 4FC7A 3QVUA 1XI2A 5KQMA 3MFYA 5HK8A 2H2WA 1D6MA 1F4PA 2CNWD 1EVJA 4PE5B 5EQJB 1H2XA 3VKFA 2EERA 4P4SB 2QAGB 4YV0A 4O4IB 2CN1A 3MMPA 2OHGA 3C3PA 5K03A 2GCPA 2HLPA 3OFSA 2W37A 2W2QA 5ENVA 5JYBA 1IMJA 4PNEA 3N9IA 4HWRA 4PDVA 2GZMA 1WLYA 5B1OA 1II8A 2NO1A 3H75A 2CT8A 2JIQA 4Q3NA 1IJBA 3L9WA 5L4NA 3EPJA 5FLXA 3GQBB 2FSPA 3TKYA 4W4TA 3E83A 4JLMA 1WNTA 2EJWA 5HRCA 1MZPA 4B73A 3CM0A 2J4CA 1ZGCA 1ZVMA 2OTLV 1T0HB 3NDRA 1YR9A 3FKJA 4I8XA 2DOSA 3SJAA 4EJSB 2WTUA 2Y92A 2EKLA 4XR4A 4YRTA 5BW6B 2C2BA 4DWWA 5IDWA 2HVJC 3J7AR 4PVDA 4NB5A 1Y76B 3QTLA 1N5LA 7MDHA 2GKSA 4D6TH 3SYQA 4BLVA 1FFXA 4FBMA 4RLQA 4EG0A 3HJBA 4I8IA 3ZV3A 4V1CB 4D44A 1NJGA 4JJFA 5GONB 4TM8A 1P29A 4RIHA 2Z4RA 1ML4A 1KRHA 4ND4A 4X5OA 4LXQA 3A1EA 5DB4A 5A0VA 3F90A 2XDQA 4MPDA 1KIFA 1CG6A 4YREA 3DGEA 4N01A 1QHGA 3RTEA 4ESEA 3STZC 3KJGA 3MLAA 4NEQA 1Q7EA 1E5XA 2J3DA 4RE6A 4FFLA 4N5MA 4PQRA 4QYMA 4X8HA 4DVGA 2I3AA 1WXEA 1XRPA 3KCQA 5SZHB 5FF9A 3QUQA 1SQBH 4TROA 3RJMA 3ZY5A 5IRCD 1T5BA 1DKOA 1E6EA 2OOSA 4BECA 3I5DA 4AO6A 3TZ6A 3D6MA 3IKJA 3MJHA 1AD2A 1KYTA 1EINA 1N3BA 1Z4QA 2YRXA 1T9DA 1HDYA 2FMKA 2GRUA 3QVWA 4NLLA 4Y9UA 5HGJA 1TLFA 4AW9A 1F6BA 2Z43A 2IV7A 3K12A 2V4DA 4Q7MB 2VAXA 4MQFB 3GJ6A 3N2ZB 4DLYA 5DP1A 5BXZA 1BQ3A 1U1CA 3ZWYA 3WLLA 3IKTA 3HJGA 3JQFC 5L3SA 2FPWA 3NHLA 1IH8A 1B23P 4ND7A 2PHZA 4HXEB 4NOMA 4DWVA 5COQA 4CVNA 3VOBA 5THQA 3JATA 4U0KA 1YNOA 1W4LA 5HE9A 1P9OA 2QUIA 1T4MA 3M9LA 3QWBA 1MW8X 3C6ZA 1QGYA 1C3OB 1ENOA 1KC8W 4LNUA 3OX4A 4GRAA 4I3FA 5SV2A 3DUFB 3KEGA 3LAWA 5FR1A 2ZSEA 4H7FA 2IYZA 1PCXA 2JFHA 2AWNA 3CCVV 1NLMA 4M0LA 1I2BA 4R68A 5E1OA 3VNAA 4B81A 4EY8A 1D1QA 2E6UX 4HAIA 1NRIA 4C87A 1QHFA 2V59A 3CZQA 3DEIA 4EG3A 5A3RA 5CXQA 3NV7A 5F1KA 1XYVA 1GQFA 2BFBA 4N54A 1G20A 4L4ZA 4WZBB 1FXVA 1YGPA 3L04A 1W55A 1GZ6A 2PYJA 2FEOA 3WB2A 1UP4A 3KD2A 2XMCA 3W6UA 2EBWA 1B00A 3V7EA 4YJFA 3EIFA 2ATKC 2COUA 4QUJA 1MB4A 1ZVJA 4OHBA 3IQIX 5IAOA 1GKUB 1PQYA 1QK4A 2FPIB 2I55A 3OM8A 4N82A 1YJ5A 1NUTA 2DF8A 4TKVB 3MYRA 5KCZA 2F48A 4S1TA 5FTKA 1G21B 2J41A 4ITUA 1J9EA 2J3LA 5CITA 4UHKA 4PWTA 1R9NA 2FUEA 1G8SA 5CT5A 5E3IA 2WJVA 4XDZA 1N6KA 1XQ9A 1P1FA 1LC3A 3PLAC 1TMGE 2AT1A 2KJQA 1SK8A 2E0IA 2XUIA 3EFOB 3GJ5A 1AGXA 3DV9A 3GMDA 4W7IA 2QJ1A 4FOLA 4UDNA 5AJYA 1NVDA 4UUBA 4K9PA 2G83A 1WLEA 1Z6XA 2C1XA 3DBOB 2UYQA 3L1KA 4DMRA 2PHNA 2CNOA 4ARVA 3U56A 4POAA 4MS2A 1J97A 4X65B 2BDTA 4H27A 1ZMTA 2PQ2A 3OHMA 4Y2UA 4YXWA 5L3FA 3V8RA 4AZ0B 4BNXA 1XEAA 4V0ME 4MS4A 1GYRA 2GBGA 3DW3X 2PNJA 4QPDA 1TK2A 2VYQA 2FN3A 3EHEA 3OIFA 2QX7A 1X1BA 4M86A 4R81A 2OZPA 2WNIA 3MB8A 3OOSA 3QU4A 1JR2A 2O2CA 4GBJA 4H31A 3INRA 1G2QA 4M7PA 4JVNA 3ES9A 4FFMA 4CS4A 4MVJM 1SR8A 3HS3A 1ONPA 2WSBA 2QF7A 5F1PA 2E9SA 5KNBD 4H16A 4I4IA 4B35A 3RE3A 3CC7F 4EW6A 2J8ZA 2Y4NA 1R3KC 3BILA 3V8QA 3F6BX 3DE1X 1H2AS 4JAAA 1XMPA 1ZUNA 1ZHHA 2PK3A 1NQOA 1ODCA 2QI9C 5AESA 5KYWB 3UENA 1K5PA 1G64A 3K9CA 2YN2A 3OT4A 5KJ6A 3B2EA 5HJEA 1NBMG 3KJEA 4FFDA 1CUAA 1K4KA 2X0KA 3D2LA 3HBLA 3W8NA 1W25A 1AZSC 3HYCA 4PCVA 5AHRA 3FBAA 2ZTMA 3SQMA 1TAUA 2YYSA 2D06A 5AP9A 1E18A 1MTZA 3DVAA 3JWIA 2HX0A 5JY6A 3KDPA 2B94A 4GSLA 3UUGA 3AVVA 3ELDA 4CM9D 3A6LA 2CKMA 3H9UA 4N21A 4Z2WA 1RA4A 1BE6A 2WP8J 2GJKA 1WCIA 1WPGA 1X13A 3AEKA 2UXCO 2R7MA 3O92A 5ERGB 3NNDA 1YAHA 4RF4A 1JG3A 2EJRA 2VP2A 2X9VA 3TPFA 4F5YA 5C4IA 2P0AA 4X9QA 2OAEA 1C7FA 3EEFA 4PO3X 5JVDA 1JDNA 1P2VA 4IHJA 1QFXA 2GYUA 5H68A 3UWOA 4C7VA 4TXJA 3I1IA 4K6KA 4O25A 2YCLA 4PA7A 1FL9A 1LSUA 1PFUA 3LECA 4LDJA 4YCSA 4Y67A 2JLBA 2CWWA 5FO1A 4D4LA 1KK1A 1H47A 4YMIA 1VYTA 2YXBA 1HV8A 3WYCA 4HPWA 3ZCQA 2NTNA 2JD0A 3CO0S 2AN9A 3ZWDA 2G1UA 4CRWB 2ES4A 1EVZA 2XMBA 5AVJA 3WY9A 1W44A 2NLOA 3RYIB 4M60A 1X8KA 4AO7A 1HQCA 2AV6A 1GZ7A 3M8KA 1GFWA 3KKEA 2KG7A 5TS2A 4AY4A 521PA 4DILA 1XD2A 4JV5B 1GYPA 2AQHA 1D0IA 2JCXA 2ETXA 1Z56C 1C81A 1VSTA 2RGUA 2VRWA 2H1CA 1RXVA 1KO5A 4L51A 1ZESA 1URFA 5I01A 5GQSA 4P7JA 3LX5A 1JKXA 3FMFA 3VC2A 3ETLA 4EHIA 2PL9A 4NTYA 4BBAA 2HQOA 4Q4JB 2BKVA 2NVUB 1F4NA 3UCSC 1Y34E 1OGJA 1YBFA 3A9TA 3DT6A 1AHNA 1H9BA 1RHUA 3MTQA 1PL7A 1XDWA 1UOQA 4HDQB 1ETHA 1Y8QB 5AJTA 5SY4A 2GYVA 2FAXA 4Z3KA 2IP1A 4YPVA 2ENWA 4AKSA 4Q4HA 5JDIA 2O2GA 3HSKA 2FZVA 3WGTA 4B33A 4IDAA 1TUBB 3OE7A 4EQ6A 4J80A 2JCVA 2PRKA 2J67A 5A5FA 1Q6YA 1PUIA 3DYBA 3KLMX 1ZL2A 3ZVMA 1HNZO 3Q0IA 1QQCA 3AJEA 1FS0G 4NBWA 4NWIA 2ON6A 3JVIA 4NPCA 1RXIA 3R66A 3TFQA 3DDUA 2E55A 2I78A 4J7CA 5HUHA 1TQ8A 3G2PA 3VX4A 3E23A 2XE8A 4GPZA 4XJXA 3PNVA 4QE9A 3OZBA 3UTCA 1KBOA 3U0OA 2ACKA 1RRPA 5JQWA 3G6BA 1JBKA 1VQ8V 4HQKA 4FLMA 4QD3A 5J59A 5LOVB 3EC1A 2P7IA 2YI9A 4ZBMA 1PFKA 3OLZA 4HGZA 1BQ0A 4LBEC 3QXXA 3V2UA 1I6KA 1W2HA 4RK5A 5HUQA 5ICGA 1IWBB 5HY0A 1UKAA 3AUXA 3D0KA 4X95A 1ADBA 1O6GA 2QS9A 2YQ4A 3AF2A 4LK3A 2WTMA 4HNAB 4F1WA 2HV8A 2QJFA 4KXLA 3EVNA 1L7XA 2ZM6B 4P83A 2GLZA 2P9ZA 3NHRA 1GQ2A 2O1WA 1ISFA 1SHUX 4B7UA 5MGBA 4Z51A 1ZA1A 4JK3A 1L5RA 2E37A 2EHDA 1JHDA 1KR2A 3KNZA 3OPNA 4PZUA 2W2LA 4EEKA 4DREA 2ONKA 4DJ5X 5JJNB 2HREA 4B6SA 2WU3A 3UH1A 4ZO6A 1H5NA 1NBHA 3B3JA 3QH4A 1GDHA 4HGOA 2JFNA 5EUQB 4J0IA 3WRYC 1NBIA 5K0EA 1XEQA 4HH0A 1KQGA 1IAVA 3NIFB 3S03A 3JCUZ 4N0MA 4DTCA 5B30A 2PH3A 1AUOA 1OUMA 1R1DA 3KR1A 4GC5A 4UOQA 3FFQA 3CZPA 1QO0A 1ZC3A 5DLYA 5FBLB 2WG1A 4EY5A 4D4HA 2VRZA 3DTVA 3AKDA 1TQ6A 3DWEX 3R0IA 5M04A 1U11A 2QEQA 3GLVA 2JPDA 3UT5B 3NM6B 4H35A 1IK4A 1LRJA 5FTNA 2W8BB 4PLVA 4PQFA 3S2SA 3AX6A 1OTYA 2UU9O 1DO2A 3E8MA 2IJHA 1GOTA 3X1ZA 4F04A 3BVOA 1CZUA 1TEXA 1G6HA 1M2OA 2CDNA 1D5AA 1J95A 1WP9A 5IG2A 1F2TB 3HCBA 3AB7A 3AXTA 5C5CA 4QYIA 3RWOA 3MUNA 1WY7A 1SQFA 2IS6A 5JXIA 2N75A 4DADA 4DV5B 2XIJA 2JI7A 3GOHA 2PR2A 2H29A 1F2TA 5DGTA 1PT8A 1CSEE 1OT3A 1MT3A 2J3QA 1MW9X 4FT4A 1JJ2U 4RTRA 5CVJA 1NHGA 1RYNA 4LGYA 4WZZA 1SC4A 2OBNA 1XOIA 4RNCA 1UT6A 3HXKA 4GVXA 1R3LC 4IVNA 5FXMA 4HH4A 1PYDA 3GBSA 5IJAA 1F48A 3A10A 1QCEA 4FLVA 1OLXB 1VBNA 3E8SA 3EZ6A 3SM9A 3ZGLA 3L4KA 4Q93A 3QJYA 4U2KA 4WJKB 3CX3A 1QDLB 2CNLA 4MWZA 4DCMA 3DTVB 4B9AA 5JJEB 2ETNA 4PR0A 1W36B 1U0OC 1J2RA 2CLSA 2HMWA 1VQ7F 2GBCA 3QFRA 3ZDXB 3EZFA 3RYIA 4UBJA 2JJYA 3N86A 1AO3A 5E1DA 4QHTA 2AMFA 4EGSA 1DMSA 1NA5A 1E79G 1Y80A 4MWEA 3HV0A 4FGLA 4YAGA 5KWJA 2ZTHA 2CXSA 4AY5A 1W4ZA 4K7JA 5CCXA 2FQYA 4JBHA 3CPEA 3W2TA 2PT6A 2PL3A 3TJMA 3ADBA 3MHHC 2ISQA 2OCKA 3L1VA 3QU5A 3CURA 4R31A 3UQ8A 4GKBA 4R9VA 3DE3X 2VC2B 3U6BA 2NUAB 1R4ZA 2AG0A 4JH0A 2JFPA 3HXLA 1MXHA 4GPD1 3IV6A 1N2GA 1HY3A 3EBOA 1A95A 4ZT4A 2G9NA 4A7PA 4BQPA 5AM4A 1EP2B 3OOJA 3UPUA 3M5DA 3ETJA 2Q69A 2H7YA 4WACA 4YIOA 3IOBA 1O97C 3DVQX 4GX1A 1JIUA 1V37A 1YUNA 3P2JA 1R6TA 1L5KA 4YIHA 4EYQA 1K0FA 3WTBA 2F8TA 4LJRA 2OV4A 3P5SA 3PGKA 1FA9A 4DLTA 5HY1A 1YF3A 2Q2OA 3ZWCA 1FSPA 4G1BA 4P3NA 2Z1UA 1VI5A 1T9HA 5L7WA 3KTDA 3IAM6 1CETA 2QWQB 1J56A 2RB4A 3DMTA 4MI3A 4Z86A 2EVWX 3AB8A 4UFOA 1KVRA 5MN4A 1RLMA 3IUQA 4B44A 5AUOB 2OCGA 3KQHA 5KTPA 2R87A 2I80A 3AUKA 5DECA 3KYCB 1E9EA 3N59A 3PN1A 2QPLA 3HRHA 4BO5A 5GANK 4J75A 1L5SA 4H0LB 3FHLA 4JJKA 4TWZA 2VPQA 3M4SA 4PHTA 4BFYA 3GEHA 1SRRA 4ZAVA 2ZOVA 1SJ9A 2D2EA 3K92A 1NMYA 4HNVA 4L6IA 2Z1FA 2IPXA 3PHBE 2ZAYA 2Z6AA 2O05A 3HVKA 4KDRA 3QPBA 5IXYA 2E85A 2OM6A 2VXOA 2NW6A 1Y6GA 3DDWA 1U7DA 1U9IA 1V6AA 3CH7A 3K0FA 3EB9A 1EN4A 2CHUA 3GFTA 4PAWA 3ORHA 3C74A 4M55A 3PUYA 1PL8A 4ARUA 4MUEA 1QH8B 3JALB 1BW9B 1TUEA 1XCOA 4MKZA 1I5YA 1LX7A 1M1YA 3F4KA 1M56C 3E8GA 4ERNA 1D5NA 1MG1A 5L8VA 4MW4A 3PXAA 1LK7A 4FMPA 3LDEA 4YJHA 4X85A 2G9IA 1TZBA 3L7CA 4TWBA 4H9GA 2YWCA 4QDXA 4RUEA 1PWYE 5SYAA 5AMXA 4N48A 2H1FA 3FYDA 1JHUA 3IMCA 3TMYA 4NDNE 1PLKA 3R5FA 4UM8B 1E8NA 2O4CA 3RRZA 2FB5A 3G49A 4U7JA 4FW9A 5BNTA 5GVSA 5HZMA 1RW4A 3ZK9A 2QP3A 2PTMA 1KGSA 3PFGA 5L6LB 4I9UA 3O26A 3JQDA 4P2ZA 4CT5A 2PUCA 2HNAA 3OLWA 5HS4A 4ND8B 3ZCVA 3UOAB 5JROA 4R2WA 1R12A 3NB0A 4MW3A 1W5BA 4R7GA 3PJDA 2QXYA 2XQGA 4OHXA 1KJQA 4PGMA 4C0HA 3SI7A 5DLPA 3U5ZB 4W8GA 3SYNA 3SJBC 1PD0A 1T5LA 5KMGB 1XSEA 1YRWA 2MSCB 1A9XB 1FVFA 5HDBB 3R8XA 5A4FS 5FP0A 2YS8A 3UM7A 1TT5B 1HTWA 3IMEA 3MTJA 3FI9A 4LG1A 4RELA 4D9NA 3W9UA 4DL9A 2WSYB 4I81A 1G7TA 4UHJA 2R25B 5FJ4C 4L5AA 1CVLA 2D1RA 3WLFA 1ZY2A 1WETA 5EVCA 1CDZA 1YIJV 2SCUB 1BO6A 1DKPA 2E74B 1PJAA 3HPRA 3M1LA 4I4CA 1UDWA 2YH2A 3IEIA 1JEQA 3KU4A 4FPXA 4IV5A 4R16A 5JMOA 1JHXA 1GU1A 1DADA 1QQ6A 1X38A 2NN3C 3K7EA 1D1PA 2GKOA 4XCVA 1M6WA 2ZM5A 1X1CA 2IVFA 3RIGA 3MCQA 4CMAA 4HPXB 2JGKA 3QO8A 1M2KA 2NYUA 2AI2A 2V6BA 2I7CA 1TA8A 2V55B 2VHTA 3JZFA 1VP7A 4YRFA 1SZXA 1XUOA 4IH1A 1F2VA 4IICA 2O0HA 4QUEA 4U8HA 3SCZA 1OI2A 3A37A 2HA0A 2VDJA 3LCJA 1WPBA 3PFFA 4HQLA 4JAUA 2NVOA 3ABOB 2JB9A 4TL9A 2BGWA 3QG1A 3ZBHA 3DXFA 4EFEA 2P8JA 1PHRA 2B25A 1JTFA 3UZUA 2XQFA 4AN1A 4BQNA 5F23A 2PO7A 4JBWA 2M32A 3S70A 2I67A 1XZIA 2O3UA 2GVIA 1A04A 1JU4A 2H5JA 1A1VA 2WPDG 1OYWA 2HWXA 1FRVA 4RA6B 1NAIA 2EJVA 4YXFA 4B7CA 1ZNQO 5E1BA 3LUDA 1PZHA 3ER9A 4MVSA 1B6SA 4B1FA 4RIEA 5FWDA 1YR1A 2JCSA 4OB8A 5JD4A 4HSEA 1Y76A 3W6ZA 1OCCB 1NX9A 2GR9A 1XDUA 4C06A 3OOWA 2NXEA 2YJTD 1G18A 2XX3A 5BRNA 4YROA 2CVHA 2D2XA 2I1LA 2Q9CA 4LRSB 1IG0A 1GHTA 3K5WA 3KHKA 1QE3A 1YBVA 2JI6A 4EK9A 5ILOA 2VDOB 3RTCA 1WXIA 2WF8A 1PN3A 1XMSA 1NE7A 3BCHA 4L5IA 4FZ5A 3FDJA 4Q4AB 5HIJA 3U1VA 1NN1A 2AMJA 1EGHA 1Z7BA 4B0PA 4D9GA 3RVMA 4MR8B 4TV9A 2QD3A 1XCMA 3W3AH 3S8EA 2EP5A 3FJOA 4BPRA 1AROP 5LBIA 3WWPA 1K34A 3CKMA 1Q92A 1NW6A 3OP4A 2GV9A 3ROZA 3WOHA 3PX7A 2Q45A 4GYCB 4KGVA 1NW7A 2B7LA 1UZMA 3DOUA 1GPKA 1HE5A 3IQDB 4BIUA 4FLWA 2W7TA 1UINA 3IVMA 3NTOA 2R72A 4F6EA 5AQ1A 5IF9A 3I56V 2Q6AA 3C87A 2QYHA 3VYUB 5HFJA 4N39A 4QHYA 3OIVA 3ILXA 2ZTSA 3HR7A 3B9PA 1W57A 4D82A 4QIWF 1GO2A 3KBOA 3IEKA 1YJ9F 1ONOA 2QX9A 3BQNB 1FPQA 4ATNA 3AUSA 2DBRA 4G4IA 2W48A 1O94D 1CZHA 3IT0A 5FA5A 4AS1A 4LMRA 4XLTA 5JS8A 5C2JB 3GLGA 2C2GA 3P19A 3QMMA 4PQYA 1THGA 4W5HA 5KNBH 2P9TA 5JDIC 3LWVC 1I24A 5AO9A 2Q8VA 4JYZA 4ZCPA 4ZVSA 3OFND 1LDBA 3CVXA 2NU7B 1ECLA 1TM4E 2CNWA 2DWQA 4JGIA 5EMMA 4A0FA 1YULA 1YKSA 4DANA 1DIAA 4PIVA 1M2VA 5KNDH 4HDSA 4A8TA 2XHEA 3ECAA 4WCFB 3G5AA 2EFCB 4BZQA 4C3VA 4C9BA 2ICAA 3WOVA 1JQ5A 1P4JA 4TUYF 1P7PA 3KETA 4JTCB 1KJ9A 2WFMA 2Z1EA 1UBSB 1O8BA 2Q0XA 3EXHB 4XLLA 3VFDA 2R0QC 1JEAA 4YP5A 2OV2A 2II6A 3Q8KA 1G5FA 2XQJA 4EY4A 3GN1A 1PG5A 1H42A 3ZP4A 3OOYA 5D5HA 2DR0A 2WYIA 2C7GA 3RD5A 4HFMA 4KE7A 2EEZA 5HFMA 1YGYA 1ZU4A 3GI1A 4RDIA 1GY8A 2VJBA 1CR0A 2Q49A 2QVGA 4QQFA 1CY0A 1C50A 1TJYA 3SJQC 2HLDG 2WK1A 3CF6R 3I37X 3NM5A 1TOAA 2BONA 2KB0A 4H4DA 1HLGA 5AD1A 3NWJA 5KYWA 1SS3A 4MT8A 1G6KA 2FPGB 2OBFA 1XBIA 2VNJA 1YZ3A 4FLEA 1OCRC 4DUYO 3I83A 3PUKA 4GEGA 1MMMA 3K70D 1P8JA 2XHZA 1OBFO 2RSLA 1E58A 2W42A 3STLC 2XUMA 1BE8A 1Z29A 4HVTA 1RSZA 1RI2A 2BEVB 2CW5A 3BSWA 3PCXA 2Y9MB 1KO7A 2DXIA 1X94A 4TVSA 4GYYA 4EI2A 4DAEA 1FMJA 3ZHSA 1BVUA 1NVMB 4Q00A 3HU5A 4ACBA 4N7BA 3SIVA 1RVV1 3VHRA 3ICXA 1ADCA 2EZ9A 4U3JA 3DSQA 2IDZA 3I6QA 3ISJA 3K15A 3R24A 1BGWA 4M1ZA 4R40A 3FMGA 5ALXA 1JXAA 1KNQA 1VI2A 2P6RA 5B5SA 3SPGA 3GJ0A 1L9XA 1RJ9A 1NQ5A 1M6VA 2FG5A 4JI4O 1VG9B 2QZ9A 3D6JA 3FNEA 2AC7A 4U3FH 1U4NA 1A50B 4EY7A 3AUAA 3TRHA 4OH7A 3TLYA 1W46A 2X0EA 1JDTA 5EIAA 2GEFA 3DXRA 2ZITA 1EE9A 4E0BA 5HMMA 1FSFA 4QGAA 5FJIA 2D5IA 4JGSA 1RT9A 1XHEA 1KVTA 1Z62A 3I3SR 3GPIA 5AM0A 3LDHA 3QF4B 5KUMA 1MAUA 3GK3A 4LC9A 3TD3A 4WFJA 4XFKA 1V2GA 4OJNA 4MCIA 3IUNA 4MKXA 1VPWA 3GGCA 1NDUA 4MR7B 1CF9A 4X88A 1SOAA 2UUOA 4X94A 2XRZA 3IA7A 3OQHA 1XNGA 3SBEA 3S7ZA 3ICQB 3L0CA 5F21A 2A5YB 3CR3C 1PR4A 4O8CA 1XU7A 3TZQA 2YWDA 3JWGA 4GS5A 4HWSA 3V7NA 5IH3A 4KNYA 5EIBD 3PXDA 3H6GA 5E4FA 4OXYA 3M5WA 2OKGA 5GM2A 1V5WA 4JC0A 4L8FA 3RJ5A 4CMHA 1E2KA 3KZVA 1W2GA 1OXUA 3LOPA 3TTVA 3LF2A 4CI0B 5JI2E 4TYWA 1ODIA 2A1IA 4C0KA 3AUFA 4CCYB 3Q7EA 3W6NA 2RKBA 3HWRA 1HSZA 3S2UA 4E5YA 4AKIA 1EDOA 2PYZA 2WF6A 4RHUA 3RV3A 4JELA 3TCXB 2DR2A 3CISA 1NF2A 3B60A 3WK5A 1DBRA 2I71A 1Q20A 1RPZA 3KQQA 3NVMB 3HR8A 4ZT5A 1BDBA 4J0FA 1OFVA 4YP9A 4WGGA 5L3VA 2ZWVA 1XWIA 5TQVA 4PYMA 4OXKA 4RS4A 1XE3A 3AY6A 3G79A 4D9FA 3BRWD 4EG8A 3X1JA 1KY2A 4K9LA 3L0IB 1VDZA 2YX1A 5H8WA 1FLNA 1YXMA 2I6FA 2I66A 2FE1A 1E77A 1MA0A 1Z16A 2EXXA 2IITA 3CN7A 2OV6A 1Z4JA 2J0UA 2XWPA 4LV8B 1KECA 3P0ZA 3KJFA 4I5FA 1F6DA 2Q6KA 4KBGA 1UAGA 4O8ZA 4AU1A 4LHYA 4CLHA 4AM8A 5C9ZA 3E4CA 4TXHA 5AYVA 3MGBA 1YVUA 4BFTA 3C43A 5JADA 4GSYA 3NYIA 1E8DA 3QG5A 3IYLW 2DPGA 4Z7JA 3LHSA 4E94A 5JAUA 1VIDA 3FZEA 4GGPA 4WDQA 3S6JA 4GC9A 3BEOA 4CR6A 5DN6A 4V2UA 1YT5A 4OO3A 2ZXEA 4MRRA 2C3OA 3H2GA 2YVAA 4OA5A 1ISSA 3LY5A 3MCUA 3Q3IA 4B46A 2OYQA 1XTJA 2B3TA 1EFCA 1LJUA 3HY3A 4KNWA 4URVR 3AP1A 3RRFA 3AG7A 3V4DA 1Q7RA 2BHLA 2IZ6A 3COYA 4MKHA 2IZ5A 1P31A 2ADOA 1GPNA 2XOKA 4IZIA 5IW8A 3TVTA 2PQ0A 5C8VA 1AGNA 5A9GA 2ZRFA 3A6HA 3CX8A 2XECA 3EJWA 2AG8A 2QXTA 4MVXA 5CPBA 2C3MA 3CNLA 1ORQC 1ZU5A 3LW8A 1XTVA 3TD6A 4I1PA 4JTAB 2EILB 5GGXA 4NYKA 3CUEF 4PS1A 4CM4A 5BXQC 5J2TB 2QSJA 3EIXA 4NQZA 1JEOA 4HNHA 2HS0A 2C78A 2UXDB 3REQB 3GPCA 4LUCA 4F4DA 4NMLA 1L4NA 1FUIA 3C6MA 2J07A 1Y1QA 3BFKA 2XXBA 3FAVB 1YDWA 2VR1A 4ZPXA 3KKYA 4FBLA 4D98A 1X8JA 4H0FA 3NR7A 4CTNA 4CLEA 4JQSA 1V6CA 3HV2A 4DY6A 3T0IA 1ZS9A 1C4WA 5DNEA 3VUEA 2YIBD 1TMYA 2OWEA 1RP3B 2OO5A 3M84A 1Z6ZA 2XCLA 4C4WC 4R2KA 5AKJA 2GCEA 3RUIA 3CX7A 1SN7A 1BVHA 4OI2A 4FSHA 1JJ2F 4X45A 3UA3A 5CAEB 5EHXA 2CHGA 1TU3A 3IX7A 4QREA 3MBMA 1XZEA 1CQXA 5EKUA 1Z2OX 3CXCU 4D7SA 2X40A 4YBRA 5H3HA 3TD5A 3SJAC 3QYPA 3QU7A 2QY6A 3SIUA 5K4AA 1S4MA 3TIXB 5K05A 4IM7A 4G3XA 5JBIA 3C41J 4ZXFA 4PX3A 4EUKA 1MRZA 3LYLA 1LSJA 4WJZA 3WYGA 2BMFA 4FHDA 4A91A 4MTFA 4WFGA 3NM4A 4EX6A 1WHTB 1FRNA 2QBYA 1N2CB 2DGDA 4FFRA 4LN1A 1P0MA 5BN1A 2EINC 2GA9A 2WG0A 5CM2Z 3B13B 3ILHA 1W40A 2HL6A 4ABMA 2I8LA 1V1MB 4OQLA 5DV9A 1QCDA 2C95A 4J29A 5ERXA 2JGEA 2RMKB 5B1SA 1XPUA 3ZI4A 1SQXH 3RFRA 1KGDA 3T5BA 1UM8A 3FPFA 1PJSA 4OQNA 2BKLA 2P6JA 3CC7V 2W6JG 1RIIA 1O94C 4IF6A 3VA7A 4TTVA 3OQNA 1QH1A 1EJ6A 2AOUA 3UATA 4B32A 5F9HA 4NATA 2GF9A 4DV7B 1Y8ZA 3IPRA 4KN9S 3WJ2A 4WFQA 3O93A 3CEMA 3A7DA 4HDNB 5AOBA 2YWHA 3H2BA 2ALEA 3ADOA 3KOOA 4AG6A 1PR6A 4LMBA 1IZ0A 3U3DA 5EQTA 4Z1OA 5JNTA 5KNDA 4E2YA 4R9SA 3WNDA 2W8BA 5ICFA 4ZOLB 2OO3A 4WECA 1Q3KA 1HYEA 3BJRA 3O8LA 3OMLA 4TS1A 2AUNA 2R00A 4MW2A 4S0ZA 2B3DA 4RETA 1OH8A 2IYQA 4R3WA 4YIPA 4DCJA 2JCGA 3L8CA 1KYWA 3NH9A 3HB7A 2HK8A 4NWOB 4JYAB 4BVHA 1OLUA 1O5TA 3V4SA 3TQTA 4LHXA 5K4HA 2TECE 4DIOA 3K0BA 4YB8A 3CC4V 3EGCA 5BV7A 4X92A 3HY4A 1YCIA 1U80A 5IDQA 2A79B 2QN3A 1JA1A 4LDNA 1XELA 3HP1A 3QVVA 1IN7A 2BHNA 1NTOA 2PRSA 2YZGA 3KWMA 2R79A 3EVEA 3Q0TA 4FYJA 1DBSA 1Z83A 4KRGA 3VVCA 3ASZA 5E3HA 4U7DA 2NUAA 1CTQA 1GO1A 1CIVA 2F93B 2L17A 5AVWA 2YVUA 2ZJ3A 3ON5A 3WJ7A 1SVLA 4F3RA 2YINC 1GQRA 4G0ZA 3ZY6A 1GFSA 2FDXA 5TB5A 4AP6A 3BTVA 3TW0A 4LE0A 4LYAA 2UXNA 4D6XA 1EP3B 4PQEA 1ZCZA 3ZU5A 4EENA 2IHVA 5KWEA 3AKEA 2E3CA 3B2QA 4OQEA 2NUBA 2P4VA 2H3HA 4KSBA 2A06H 1BXRB 3UAXA 1Y1LA 5J23A 1MIOB 3SX4A 3TGUH 4PXSA 2PS3A 4J41A 3PHLA 1G59A 1H2FA 3F1KA 5J2TA 3KUXA 2CV1A 1E0SA 1VPVA 1XROA 2SKEA 4RL6A 2LV8A 2HJHA 5D2CA 1V11B 4YP0A 1IPEA 2C2YA 4U1RA 1E9FA 2CV0A 1P5RA 4YQZA 3PA6A 4BU1A 4XCXA 4RWUA 1TQ2A 2NO6A 1YJQA 4B84A 1IN8A 1WD5A 3KV1A 3SIWA 2I54A 3G1UA 1H7MA 1UXHA 4PO9A 3G80A 5HF8A 1NXSA 4QOSA 4JLBA 3GLHB 1AS3A 1YZNA 3MGCA 5ENZA 2A9JA 3V1YA 4KE8A 1JB1A 2XCOA 3RJTA 1KC8H 3GGJA 4TMXA 3T80A 1QIJA 1WNSA 3TUZC 2PEYA 2O0KA 2IL1A 2OFFA 3D3IA 3TZLA 5AW4A 4JB0A 1VMIA 2HIMA 2ODBA 3MT7A 121PA 2QJOA 4BW0B 2QLJA 2R1ZA 2E4ZA 4JMPA 4PV7A 4RF3A 3TW8A 2BL4A 1P4RA 1QYCA 4GT1A 4C30A 4KAXA 4FMDB 4PZAA 1C80A 2XOKG 5G1PA 1OR8A 1QDUA 3U48A 1MC1A 4FXOA 5D00A 2A1UB 2Q3FA 4IMJB 1W5AA 4D26A 4BRSA 1UBTS 2KTVA 1JA8A 3IGAC 4FM2A 1JPVA 5DI9A 1HFWA 2OHFA 2Q68A 2QN8A 4JQYA 4IIGA 2OCHA 1CE8A 3FF4A 2NT3A 1GCOA 3JQRA 4FKMA 3P97A 2J6IA 3ZX4A 5KKCA 1PNVA 2FN7A 3OE5A 1W59A 4BQQA 4J49A 4BQIA 2W00A 2YVKA 3ZXUB 1E1NA 2QQEA 4LC1A 3OPYB 1GSOA 3RK1A 1WHTA 3VAYA 2C1EA 1X7YB 1O54A 1RQ7A 1M67A 2ZWOA 3B3AA 4G0XA 4U4AA 1DKQA 3PCRB 3NTQA 3EF3A 4MYHA 4YT4A 4D9EA 5EPEA 1TECE 4M0EA 4U7OA 3T95A 2QM8A 3UQYS 5H9WA 4OHZA 1N0WA 1OYOA 1SELA 2Q5EA 1K8RA 1L3CA 1LK0A 1W4RA 2B30A 1IN5A 1C7RA 2YJNA 1JLSA 1NM5C 1NI5A 5E9JA 5KDDA 2ID7A 3AG1C 2QX8A 3B48A 2O19A 4LF6B 1C9DB 1R4MB 5JLAA 3R5SA 3CNNA 5AI9A 1KHHA 3ZW9A 4C22A 5LUAA 1Q21A 1U65A 1PG0A 1N2ZA 4QWWA 5I6DA 1YJAA 3I9FA 4EKIA 3NGLA 1ZW6A 2IYWA 2QN1A 3VKWA 4CIXA 2NZUG 3DBIA 4FDAA 2EGUA 1R1MA 1JVSA 1GZSA 1MB9A 5LOVA 2AWOA 2JEOA 2Q1UA 4P08A 1IULA 1IG3A 2GJSA 1O1YA 3AYZB 3MJ4A 3PYLA 4WK4B 5C53B 2F3UA 4A6XA 3NNNA 1Z45A 1U3CA 3K8QA 4WZAE 4X3PA 4CM4B 5IF3A 1PJ2A 3SYTA 5I47A 4C1NA 3EGXB 1K9SA 1R0KA 1IDSA 1AVTA 2IHBA 2EAUA 4JI0B 3MCAB 4M4SA 1RXCA 2Q2WA 4MDYA 1FXUA 1P2GA 4GICA 4BJ3A 4D8YA 4IY1A 2FX5A 1MF7A 3PA8A 3BCSA 3L6BA 4MHOA 4MKRA 2YVQA 3ABMC 1ZK0A 1NKSA 4ZK6A 1CRPA 2Y76A 4JV5O 4AS2A 4WXRA 4PAQA 1OBOA 3KSAC 4UMDA 2VBFA 1Y8QA 3I5XA 1CULC 1KZ4A 2PGAA 3DFKA 2ERCA 2V7QG 5IT9M 4GXNA 4RGQA 4DCGA 1ZL8A 3GP5A 3GT7A 3COPA 3KPYA 3MJSA 3QW2A 2GM9A 5HQTA 3PNBA 2G0AA 3SEQA 3ZOPA 1TA0A 3A1CA 4E5KA 2OTJV 1Q82W 3N0TA 2LNDA 5KVCA 1XDGA 3UCFA 5A5EA 1MNAA 2BFFB 3II6X 1EJBA 4FIDA 2L82A 2QT1A 3G9TA 4AJ2A 1J0XO 2RDMA 4AZ3A 3W3AD 1RQXA 3R9KA 1ISRA 5B6JA 5DHRA 3I6IA 1E3LA 4JUCA 2WE8A 1BKYA 4A27A 2EZ8A 3ZMSA 4B3RB 3VQVA 2HRCA 4OJMX 2QPAA 5DTIA 4XIJA 5GOTA 2UZHA 1RVDA 1KYOF 1KYVA 3B9BA 2DFPA 3A4TA 3TAHA 4GMFA 5CHYA 2OCIA 2CBZA 1RPJA 4M2LA 4W99A 4NH4A 4CIBA 2IYYA 3CCJF 3TSWA 5EO3A 2P2YA 3INYA 4D80A 1FVXA 3HXTA 4HVAA 3GAFA 1YFKA 4K9DA 2IJGX 3IELA 3R3ZA 4MS1A 4XSHA 3SXPA 3T3EA 3CCVF 3PFWO 1H2LA 3ELWA 3UW1A 4C3OB 2YY7A 2O3RA 1S1CA 2D5LA 3OM1A 1CQZA 4BLSA 3THWB 4TOIA 2Q4DA 4XM1A 1SD1A 5AHKA 3U31A 2ODAA 5D7BA 2R5FA 2XGGA 1FMTA 4XEHA 2C8VA 4OHOA 5EKTA 2DEUA 5FBRB 4FZRA 4PZZA 2ZRDA 3RR2A 3WKBA 2I2FA 3MBIA 2M98A 2CC2A 1GITA 2Y0DA 4NOKA 4AIIA 4P9PA 1YE8A 2FMLA 2PF4E 1VL0A 1Y33E 4RD2A 2YXDA 1U0TA 2C99A 1ZN2A 4BKOA 3K0DA 3AUYA 4D0RA 1F51E 4EKYA 5AVMA 4QPCA 3WG7B 3IAUA 1OH6A 1UAAA 2PRYA 5JH7B 1H2EA 2RGDA 1HC7A 2I1QA 2Z83A 4W82A 5L3SB 3SYPA 1A9PA 5EXPA 3TBKA 3AG1B 2MYUA 4S1PA 2YNMC 1I7LA 3NHSA 5CX1A 4BVEA 1KK3A 2JDIA 4O2AA 3GFSA 2ONCA 2NPOA 2HDHA 3E58A 1W48A 4W5QA 1W581 5LXTA 1X25A 3ZRWB 1ZMXA 2P11A 1RE0A 4MVJF 4MI9A 5DGDA 3E0QA 5CA0F 3WP0A 2IX3A 2AX4A 2FJ0A 3AG6A 4ZZ0A 1R27A 2UXBB 3L6EA 2V6JA 5J63A 1BWSA 2XNSA 4KDFA 5B36A 2C2OA 4LS3A 2FEAA 1F8UA 2QLFA 3CSSA 4ZAYA 4G01B 3P9QA 1BAPA 3O65A 1U8EA 3R65A 5DM1A 4AK9A 4QGSA 4G1FA 3MJTA 1ILEA 2EIXA 1H2YA 2NU9A 3M6AA 3TXQA 1DELA 1IJFA 3QMWA 2PMEA 3BDIA 4ZDIA 4CYMA 4U9HS 3FSGA 2AHYA 2VQFB 2LKDA 4CH3A 2YBEA 2NU8B 3FLMA 2OXIA 5CBHA 3CRNA 3R0QA 3R6TA 4I4NA 4MVJH 3HJTA 3I6MA 4KAFA 4OYYA 4HDOB 2R3SA 1QUEA 4LBWA 3B9QA 1LC0A 1U8CB 4Q6WA 2ZPAA 2XWJI 1GTVA 4ARZB 3CX6A 4YRIA 4KR9A 2Y77A 2B1IA 4F86A 3ZVNA 4J4BA 5C8XA 3HB5X 4P53A 5IJ9A 1GNLA 2B4TO 4UBMA 3C5EA 2QU8A 2L0XA 2FNAA 3IPXA 3OJ0A 2Y69B 5JYCA 4AWBA 4AP9A 1FYVA 4NYMR 3T9DA 3M5CA 3SHOA 2JAUA 5AKEA 3VSAA 4YJFB 4BNYA 7GPBA 2J9YB 1V5FA 4MSWC 5D6OA 1VLMA 2R68A 4X8MA 2PE5A 5HS6A 4AYWA 2HJGA 1NQ3A 4IDHA 4C4ZA 5A4AA 1YEWA 3VR3A 2IYLD 2R7NA 1F8YA 4IJVA 4CLRA 2P9GA 3MPUA 1TLTA 3NJRA 1E4EA 4XYBA 1H2SB 4ZQIA 1ORHA 5CD9A 3C7AA 5KSZA 2LCIA 4MUHA 3TLGA 4B0OA 2WQ7A 3D8TA 5B8FA 2RFLA 1SWVA 1MVNA 2QP4A 3JQEA 3ND6A 3LUHA 3O2NA 4Q16A 5AT1A 3TM5A 4FMTA 4J0GA 1G98A 5GV8A 3VO8A 1IDN1 4S1NA 3ZU4A 3MTIA 3MTEA 5K1XA 3J81M 3AC0A 5IM5A 3DZBA 3BG5A 5H82A 4DB4A 3DPIA 4CTOA 4YV2A 2ZUFA 1A97A 2Q3CA 3I56F 2A94A 4ZALA 2UZ0A 3QE0A 1MEOA 4PRYA 4U5XA 2QLTA 4RJ2A 2FW8A 4TMYA 4EO4A 2IHTA 2AIFA 5JANA 4YI5A 2JHPA 5IC6A 4KQIA 3L8HA 4R1PA 5FLKA 3X2SA 1QWOA 3SKVA 2YHIB 4QJ3A 3H3JA 1WP7A 1YOVB 3HPQA 1UBOS 3M6XA 1ZD9A 4INJA 5AVXA 3CGWA 3A9UA 1B73A 1DAMA 1K6XA 1Y0BA 2DJ5A 2IEDA 2R6FA 3HLTA 3VR5D 3H1LH 4K1LA 4BB9A 1V54C 2OHHA 1UEXC 3SPCA 3DFUA 3P32A 3ESQA 4M0MA 2XB9A 2XRFA 1KMNA 4MWBA 5G4VC 1OY1A 3RU2A 3UFXA 1GMGA 1DV2A 4RULA 1HT3A 1PFWA 4ND8A 3T0FA 4OQQA 3OT1B 3HHPA 5KJCA 1G55A 2QUBA 2A67A 2R4UA 3ER8A 2V74B 1P6QA 4XDHA 1KB9F 1EFTA 1RRVA 3WK9A 3K9HA 3T4UA 1COWD 5FPKA 4R5HA 5DTJA 5KHJA 4BW5A 1Q0LA 3ASVA 2Z3YA 2KB1A 3OJLA 4FFSA 4LJ9A 1L8AA 4NC9A 4R50A 4UNQA 4XIFA 3WP1B 4DLWA 4QG7A 2LW1A 5BW4A 4L08A 1B6RA 1ZK4A 1JR3D 3D1VA 5CXUA 5G3ZA 2X8JA 1ZISA 3GLIB 5JUWA 3NK7A 1YB1A 3P26A 3WGZA 1YS9A 3GVXA 2HC9A 4MZXA 3FHTA 1YQNA 5EMJA 3JCMM 2Q0QA 3OCJA 4RXMA 4ZVQA 3K1ZA 3RASA 4ARIA 4EJSA 3EG9B 2Q29A 4NNPA 5HCIA 4BP8A 3ASYA 4DLSA 4X90A 1W36C 1OFGA 4HX9A 3JALA 1BW9A 2NZ2A 4XGKA 3SHFA 4ALJA 1QV9A 2GEVA 4YUXA 2ZANA 1ZNXA 2F1MA 1P1JA 3ZNNA 1R0CA 4EHHA 2M9MA 2GYYA 4IFTA 3ODGA 4P7BA 1GTG1 3D2BA 3KHTA 1CYDA 3GLIA 4ISBA 3AWIA 5B12A 2UDPA 3DLPX 2A57A 3PQDA 2ZR7A 4ZT7A 4B3BA 3SWWA 1L1EA 2O50A 2W6JA 3L7IA 4KYTA 1C7ZA 1I3NA 3OZCA 1K8XB 1TTQB 3UN1A 1U2DA 3PQ5A 4Z54A 3OQJA 2Q9BA 3FUXA 2OAQ1 4FDTA 5H16A 4QEZA 2UYHA 5JAIA 3KYCA 5KC8A 4R0MA 3A6PC 4BE7B 4G0QA 4AJHA 5DSXA 3G1WA 2VF2A 2HVKC 4MW7A 5C7IO 3HVRA 3VDXA 2RAVA 2ST1A 3C6YA 4QGBA 4Z53A 3NALA 1A9SA 4IT5A 1GA4A 4JP1A 4TT3D 2GZRA 4KLCA 4IP0A 4IWXA 4MV8A 5F2KA 4INZA 4C3ZA 4G2KA 1VA4A 4G1UC 1GR0A 2EKBA 1UKVY 4TTQA 4BAUA 1HDRA 1VQ9F 1VCOA 1RC8A 2Z09A 4CCSA 1J5PA 2HP8A 2DFLA 2QN9A 3DHEA 4RIIA 4ZARA 3H2IA 5EFOA 3TDMA 2X8JB 3OY2A 4JA2A 2Q5ZA 3LDDA 1XVAA 5ALIA 1W47A 2ITDC 3ZKWB 2IU6A 1SQPH 1EZ1A 2Q4BA 4DBLE 3I3OA 5HWSA 1NZDA 2HP3A 4YAOA 3WYEA 4D9JA 5AVZA 3EE6A 1CZNA 3QA3E 1UZUA 4QSMA 1N77A 4U2EA 2KGWA 4IIFA 1G2OA 3K0AB 5ECWA 4B74A 1WDLA 5B1YA 3P30A 1WXDA 5ALWA 5BZBA 1UWVA 2HIAA 1VQ6V 1G38A 3I0NA 2WTBA 3PI6A 3P9PA 2Q5OA 1GTZA 1YRAA 2BKEA 1GSAA 2MSLA 4OUDB 1T8TA 2QEXV 3GMIA 2G7ZA 3AHJA 3U4HA 5DNYB 3MUOA 5A4JA 1ND6A 2GTIA 2JRCA 4IJKA 2EYQA 3EC2A 4ZAFA 5IMBA 4CUZA 3LYUA 4E32A 5KOYA 4CLRB 2AZTA 1BMDA 3PTLA 1UBJS 3VO1A 3QKUA 3SHVA 3W05A 1EDBA 5E79Z 2BMJA 3D7MA 3V1LA 2KX7A 5AVVA 5L3EA 1EK6A 2AI3A 4JA0A 2OV3A 2B33A 3O95A 3WDSA 1FU8A 1ZEMA 3GCWA 4OYHA 3ONFA 1NI4A 1IMOA 1KL7A 1AZTA 2YXHA 3BSFA 4J91A 5FQNA 1I5XA 2QA4V 3W7UA 3H5NA 4JB3A 1A32A 5SY6A 3Q8WA 3W4JA 4BU0A 4ZKDA 1JVNA 3C39A 1ZBDA 1WD7A 2OILA 3NBXX 1VQKF 3PE4A 3R6WA 1TJ3A 1NMUB 5DASA 5DVZA 4LF5O 1TM2A 5LQSA 3M83A 1N92A 4EGJA 4DIFA 3O8DA 4NBUA 1BN6A 4PYKA 4BO6A 2KTUA 1KI6B 1SB9A 2C8KA 2JBHA 1WUHS 4D9HA 2VO1A 2CVLA 2WU4A 3RVDA 2LGJA 1AS2A 3GLKA 4WI1A 3ZD8A 1VM6A 3KUCA 2YFKA 1SOMA 1NUSA 3ZTWA 1FUUA 1BZYA 2HH9A 2NOAA 1F7YA 4ITVA 3HM2A 3CBGA 3TETA 4NU0A 1R18A 1S2NA 4UFPA 3I32A 1JEYA 4K8XA 3IUEA 4IIJA 1CRZA 2JVIA 3U80A 4DR2O 4FMBB 1QIKA 4RGBA 2ZREA 2F8LA 5CU7A 5TISZ 2DBZA 4EJ6A 4QPPA 5JS6A 1AK1A 3K3WA 5I9NA 1K0UA 1EX7A 1BNCA 2CXRA 3KEFA 3KKMA 4O0LA 3VDNB 3V4RA 1W9HA 4NS4A 4LFAB 1N2BA 1MEEA 4BGIA 1ZNZA 1VHAA 2Q3HA 4DR3O 2FRDC 5LQUA 1WDKA 2HSJA 1LNQA 3ZRWA 3HO6A 1JV2B 3MT8A 5ELLA 1YMUA 1P1BA 4MGKR 5BPHA 1GPMA 4P4LA 1XHLA 1ZK2A 2F62A 2P69A 1RR6A 3GL9A 1CS0A 3NAGA 5FPHA 4CQJA 4TLEA 1FFCA 3AB3A 3QW4B 3CCJV 4HFJA 4RZ3A 5CX1B 1Z2CA 5CXSA 1WKVA 4NXMB 1JLKA 2AN4A 2V96A 4NK5A 4GI1A 4REQB 2Q8PA 1Y1RA 1H66A 1UPXA 4BBPA 3L4SO 2J3JA 2O7SA 4K86A 4NZ9A 4RVUA 1X7HA 3C3BA 5FBHA 2MMGA 4AD8A 5BSVA 1TGVA 4D8WA 2KLHA 1SD2A 4YJ2A 4E88A 3K72B 1JD1A 2PJRA 4H1WA 1BN7A 3CQ9A 3KR2A 2PQ6A 3S3WA 1XGKA 1YDHA 1CUFA 2A59A 3BULA 3B1JA 4Q9IA 5LQNA 4MWDA 1I94B 1E2UA 3ZMUA 2Q41A 1M1YE 3I2YX 1A7JA 1NVPD 2O2HA 1DI0A 2O2IA 5DN6D 3G7SA 4X20B 4N12A 4WZBE 3T5CA 1N2IA 1XEFA 1Z0FA 5KAMA 3OH8A 4L8WB 3JW8A 3RIMA 2XNDD 1COMA 2SHKA 1OCZC 3X1XA 2GXUA 2OL4A 3CTMA 3O4JA 3PICA 4JUBA 5CDFE 2E7ZA 3WZ2A 2GZHA 1PJ4A 1U8ZA 3AVQA 1W0KA 3FNBA 4I3HA 5K51A 2N42A 3MTGA 5C8YA 2WJAA 4G41A 1UC9A 1BA3A 2HB6A 2DY0A 1DC5A 4Q34A 1DEXA 5ALEA 3AF0A 3W7VA 2GEJA 3V55A 3AL0C 2ZUWA 3DLBA 5JWHA 3FB4A 1QO7A 1YR3A 1BT8A 4J07A 1QNMA 4B71A 1H9AA 1RYFA 5BMOA 4PXYA 4W9RA 1R6NA 1GAQA 4AJKA 2R9AA 3LD9A 3PEVA 3T9BA 4JI7O 1SG0A 3ORYA 1Z7GA 2YRWA 1KP9A 3GAZA 4FX5A 1UBCA 5JZSA 1ZD8A 1DKLA 1DDGA 2GCOB 2VK2A 3DL2A 3P4XA 2GHTA 4L4RA 4LYEA 4PINA 4F3YA 4UJ5A 1FSSA 5LQJA 3D4PA 1PT7A 4ODIA 2JZOA 4PZ9A 1PDVA 3MWJA 1WULS 1Z47A 3G2LA 4RWZA 5SZJA 2JFZA 2P3QA 5JBNA 3ZS8A 3T1YO 1CIJA 1YDFA 3DJFA 4X1KB 4TV8B 3ET4A 3GNTA 4BNGA 1HQDA 3L7YA 2DQ3A 2XWSA 3HKBA 4IMPA 3ZLVA 1DBFA 4GLOA 1H6AA 3VYUC 4YMUA 4LYDA 2QRGA 1DAKA 4MS1B 4LGVA 3W1VA 1LLDA 5KWVA 3ABSB 2XAQA 1NNUA 1CUJA 1Y4DE 1KKCA 2AFIE 2C8JA 3BWMA 4WFFA 2L35A 2FSGA 3AVPA 3BQMB 3L5KA 3L7OA 4FIZA 4PWZA 2B8WA 2BGNA 4HYYA 4LSWA 4QJ5A 3QWHA 3AILA 1BHQ1 1ZA2A 3GRRA 3RFUA 3AOEA 1JR4A 3WZMA 1T4DA 1AUXA 1UI9A 3B1ZA 3DKKA 4K6CA 3BXFA 1ACLA 4CS2A 1FRQA 3P45A 5DYGA 5KVQA 5UKDA 1Q15A 2YZ7A 4CEHA 2D59A 4HLUA 1ST3A 2IG8A 1CUEA 1UWCA 2IODA 3FTCA 3PXBA 2O8FB 2J0QA 1ZN7A 2CMFA 2IEIA 2VHJA 4GX2A 4IX9A 4HADA 4GHWA 4MW1A 2AEJA 2WIKA 1X1DA 1ZD2P 4MPTA 2QI2A 1S72V 3V1TC 1QUFA 2N1MA 3BD9A 2MQEA 4N8DA 2BFNA 2W6IA 3F6YA 1W88B 5IVPA 3B1VA 2BRUA 2ZAOA 1M8GA 3C6XA 3PGA1 4OJKA 3U4MA 1CQJA 3QSGA 2FLVA 4G4VA 4HEHA 4MXDA 2PBLA 2J5RA 2VH1A 3O31A 4S24A 4DV1O 2CTQA 4YXWG 4R2JA 2P9FA 5K8VA 2O8VA 1UM9A 5AH0A 4AJ4A 4YCMA 2G76A 2MSKA 2ZXFA 3AR5A 3KSDO 3LWNA 1VOTA 4JR2A 4ACAA 4AKGA 1EFRD 2FZKA 2RGNA 4LGCA 3R4VA 2HNBA 1FDVA 2EKDA 1GARA 2DQKA 1SVIA 4QRIA 3KPWA 2FQ1A 1P60A 2F4NA 4KJXA 5AJHA 2QTLA 4ABYA 1RMQA 2JFGA 3HMKA 1BG6A 3Q41A 4IDOA 4G36A 4PY2A 2DH6A 5JMWA 1OYYA 4YVFA 4UARA 2XGJA 1PT9A 4RFVA 1T4BA 2ZIVB 2JEXA 2HK9A 5L7YA 1E6LA 2ZYWX 3R3SA 1IHOA 4ZEWA 4ZHWA 1MAVA 1YC2A 3T7AA 4UOEA 2QIOA 1EVQA 1I80A 2PGGA 1UXJA 1W88A 2JAWA 2O20A 2OXFA 1C14A 1WMEA 3MAQA 2BM1A 2C4VA 3CINA 4D9IA 2SICE 4EPYA 1RRKA 5ICMA 2A33A 3JRNA 4C7KA 3G23A 2QWOB 3C9RA 3SVZA 3L75H 1PFYA 3SG0A 3K0GA 3K09A 5IEJA 2N47A 4DSTA 4ERHA 4RK7A 1QWSA 1YVEI 2FN4A 2DTDA 2P5TB 1QK3A 4QJBA 4TWJA 1ZSYA 2A9VA 4X00A 2BZSA 3DT8A 3IGFA 4H3VA 4KL8S 4UCVA 1SHJA 1RFGE 3U3JA 1NMEA 1P5FA 3TRDA 1R3IC 1CP9A 1T8UA 2LR0A 1QMGA 2X22A 3ZH2A 5TGTA 3B40A 4PA4A 1OQAA 2XTZA 3OAAA 5EE0A 1UPFA 2FI1A 2HZBA 1N2XA 3TKAA 3GFQA 4C4OA 2Z95A 4D4KA 2GN0A 2ZSHA 4L07A 2X8LA 5JPDA 5TVKA 2A0LA 1TM7E 2PGXA 2V5UA 2VK4A 3QUSA 4MV5A 4RZXA 2C7OA 4KXUA 3QVLA 3P9XA 2EFDB 2Q73A 2PLFA 3B9RA 4QRDA 4RFSA 3HCAA 1R9JA 3WLQA 5BORA 3PRKE 4KXYA 1YQEA 1GP2A 2VQDA 5E9WA 1GAEO 4JSYA 1C3EA 1Y7TA 3OICA 3V7UA 2JHCA 5DT2A 4ALNA 4D43A 4YJ2F 4BVFA 2PKQP 3ZHYA 1CYEA 3V4ZA 4CF3A 4LFAO 4NZZA 4KO2S 4RKRA 5KA6A 2RHJA 4ZAZA 4DR3B 2NUPA 3DEZA 1B8PA 1ZX1A 2RK4A 3DF7A 3HDQA 4RDCA 2MCFA 4BLTA 4DLLA 2AW5A 5JFGA 3RVQA 4IQ4A 1XVUA 1CDEA 1PEYA 3I1YA 5TMEA 1IIBA 1U8UA 2NVWA 3NHFA 4CMBA 4F9FA 1CJBA 2XF2A 2QTZA 4G1CA 4FVTA 5AKZA 1KNXA 4KUMA 4ROTA 1TJ4A 5FFMA 4TX1A 3W06A 4GH5A 2BR5A 2CL7X 2CLHB 3PEUA 4N6OA 4JC8A 4K9OA 1ZSNA 4F71A 1KI7A 4OMUA 4LY6A 1X1SA 4Q3OA 4FYPA 4OKNA 1H8ED 1MC4A 5CHEA 3FOBA 4G5XA 4E03A 1C30B 1UEJA 1GUBA 2GRAA 4IJ6A 1DLBA 2W0FC 3AJDA 4ZAWA 4MYRA 1CUGA 4FNMA 3TLKA 1E1CA 2FX2A 4JFRA 4WZBA 5FOQA 1SCBA 3S0YA 2PFKA 2A7XA 3RIYA 4TLBA 3R7SA 1LBQA 2F9FA 3OW2F 4KQGA 3UH0A 4DVJA 5A5VA 2CXPA 1N5KA 4EHAA 3AJRA 1NYTA 2CLCX 5IS2A 1HKUA 1PDOA 2PSDA 2PMBA 2HN9A 2Z3VA 2DYSB 3FTNA 4I2NA 5ADHA 5CD1A 3OUZA 2OO7A 3KSZO 3I6BA 4YR7A 3EQ2A 1GTL1 4CODB 1WDMA 3VQTA 1J2EA 3BK7A 3FZGA 1XZGA 3QPAA 2QROA 1J90A 2VPPA 2Q67A 3FJ1A 3EZNA 3G6WA 1FY2A 3PWSA 4WXMA 3T61A 3W1WA 4DIUA 5C8DA 2EJ7A 3DE2X 3ZCPA 3GPBA 3HSSA 1H0HA 4EZEA 1P3Y1 5KREA 2VPXA 2DFKB 2X2OA 2BOVA 3M0EA 1Y4AE 4R7CA 4XVQA 4YJ3F 5AKYA 3HO1A 3FMVA 3B6KA 1Q11A 4JP8A 1J2UA 1R6XA 2C3UA 1PR3A 2RI6A 3KVRA 3FYUA 4NQ3A 2WTEA 2EDAA 2Q3EA 5CA0A 2ZIOA 5TRTA 5A7HA 5BUQA 4CTJA 2GQ0A 1R66A 5HJ2A 4G09A 4DCTA 4L74A 1OLUB 2HA7A 1W2BF 2Q5IA 3HH8A 3M6LA 3L6RA 4M54A 1MV8A 1YASA 3LMKA 2J0VA 3MTDA 4ONEA 3K0SA 1NKVA 4KDEA 2FG7C 1GPDG 3CV3A 1IZ9A 4LSMA 4WADA 4RQEA 1P7YA 3E0XA 4BNDB 4F9TA 3R09A 1DHRA 4K05A 2C2KA 5JEEA 3ZU3A 4A8HA 4WZ6A 1NVPB 1D1SA 1V26A 4URXR 4CQMB 1OWPA 5FA6A 3ENKA 4GBGA 4IKEA 4JUDX 4XSVA 5CM9C 2X6AA 3MHPA 4WZAA 5IJZA 2ZRNA 1PS0A 2GPAA 1Z2GA 1NQTA 1J8FA 3BL6A 1HDEA 4WERA 4YPFA 4ROSA 2AXTZ 1OGIA 2ZRGA 4N9WA 5JJLA 5AI6A 1XQ6A 1QIEA 2ZD9A 2ADFA 2HM7A 2RI0A 4GPBA 4MV4A 4OI1A 3PC8C 2XUFA 3NAMA 1KI6A 2X3YA 1XUQA 4BO3A 3QPCA 1XMOO 3CLSC 5KVSA 1EX9A 3TEJA 1OCOC 4F8EA 2I22A 4NFLA 4B2PA 3MJCA 4KLZA 3WK4A 5LNK1 2BGGA 4C3UA 4HUTA 3I2FA 4PPFA 3I9KA 1YR6A