5JVDB

Tubulin-tub092 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
429
structure length
425
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antivascular and antitumor properties of the tubulin-binding chalcone TUB091.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 167
structure length 425
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jvdB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5jvdB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5jvdB01
4I55B 4IIJA 4YJ3A 3JASB 3C8LA 3ZIDA 4WBNB 5EZYA 5CB4A 3M89A 1W5EA 5KX5A 5GONA 4IIJB 4YJ3B 1W5BA 1OFUA 2GVIA 4O2BA 3JAWA 3RB8A 4I4TB 4ZHQA 4TV9B 5EIBD 3JARA 3RYHA 5J2TB 1W581 3JARB 4YJ2B 3RYHB 5CA1A 4ZHQB 2BTOA 4O4HB 5ITZB 4O4JB 3HKEA 5GONB 3WGJA 5CA0A 3JATB 5EZYB 1FFXB 4WBNA 5BMVB 3E22B 3JASA 4ZI7B 5EYPA 4E6EA 4I55A 3N2KA 5C8YA 1SA0B 5KMGA 4F6RB 3CB2A 2RHOA 4EI8A 4X1KA 3N2GA 3JALB 4O4LB 5LA6A 1TVKA 4I50B 2RHHA 3HKDA 1JFFA 3VOAA 3V3TA 4HNAB 5IJ9A 4B45A 3VPAA 3ZBPA 3JAKA 3JAKB 5LYJB 4F6RA 4M8IA 3HKCB 4TV8A 1JFFB 5EYPB 1TVKB 4I50A 5BMVA 5IYZB 4U3JA 2VAWA 4KWEA 3ZBQA 4X1IB 4IHJB 3JATA 4X1KB 4X1YB 1RQ7A 5JCOC 1SA0A 3N2KB 5KMGB 3HKEB 4O2AA 1Z5VA 3E22A 3UT5B 5CA1B 4TUYA 5LP6A 1W5AA 1FFXA 2RHLA 3RYIA 5MN5A 5CA0B 4TV9A 5J2TA 1FSZA 2VAMA 5J2UB 4O4JA 4EI9A 4U39A 3JAWB 3WGKA 2VAPA 3R4VA 4LNUA 4YJ2A 4XCQA 3RYIB 2BTQA 3WGNA 2XKAA 3VO9A 5LP6B 3RYCB 1RQ2A 3RYFB 4O2AB 4O2BB 5JVDA 5JVDB 5M7EA 5KX5B 5IJ0B 5CB4B 2R6R1 3RYFA 3RYCA 4DRXB 2BTQB 5IYZA 5LOVB 1W59A 4LNUB 4TV8B 2VXYA 3HKCA 5J2UA 5LYJA 1TUBB 2R751 4HNAA 1Z5WA 2Q1XA 5JQGB 2Q1YA 4TUYB 5LXTB 4O4IB 4ZOLB 3HKDB 3UT5A 4EI7A 4EB6B 4O4LA 5LA6B 5C8YB 3WGLA 3JALA 4X20B 5JH7A 5FNVA 4FFBB 4FFBA 3M8KA 4X1YA 4IHJA 4X1IA 3HKBB 5LP6C 5MN4A 3VO8A 4U3JB 4ZI7A 4EB6A 4O4IA 4ZOLA 4B46A 5JQGA 3HKBA 2XKBA 1W5FA 5MN6A 3WGMA 5FNVB 5JH7B 4X20A 5EIBC 5IJ9B 4O4HA 5ITZA 5LOVA 5LXTA 1RLUA 2RHJA 4DRXA 3VOBA 3N2GB 1TUBA 4I4TA 5IJ0A 4DXDA 5JCOA
chains in the Genus database with same CATH superfamily
1WZNA 3DBHA 4IDBA 2FSVA 1Q1ZA 3GJ0A 3CSSA 1KB9F 3TM5A 1KL7A 4F56A 2HA5A 1X1SA 3EC1A 3DLBA 1HSOA 1OV6A 2IELA 4EFBA 1IV4A 2VQEB 3APQA 2VQ3A 3NBUA 4G4GA 4GG1A 4HX2A 3VZQA 5IAOA 2Q2OA 3IDFA 1YJCA 3TTUA 5EKTA 2WPNA 1X1QA 5JLJA 4EO4A 3AKYA 1WZ2A 3KZKA 5SV2A 5EIBD 3KUKA 4AULA 2ZS7A 4KXFB 3K04A 4MJ3A 1MZPA 5CA1A 2MCFA 4LF8O 2J3HA 3F74A 1XCMA 3OX4A 1XMPA 4FLEA 3GB7C 4CE6A 4GCZA 1ESCA 4IMIB 2R8EA 4LJ5A 3KPUA 4CH6A 1IPFA 5KREA 2H8PC 4RM2A 2ST1A 4UHDA 3TD6A 2VHZA 1ZJWA 4UPEA 3HDGA 1XTSA 8ABPA 2YEVA 2JI8A 3D4OA 2GAIA 4KQFA 2HFEC 2IPXA 3FOAA 1I5XA 1QIGA 3CB2A 5F51A 1T29A 5CLIA 5CMLA 5AVXA 4QFMA 1NURA 1XR3A 4PONA 5E7JA 2P75A 4JYBA 1NMQA 4RVHA 3WLAA 3UMVA 1W1IA 1GU0A 5KUMA 1KQPA 2F9LA 2IUTA 1SBHA 4ZAXA 4CBCA 3LI2A 4CM9D 3JAKA 3JAKB 1EHCA 2QOEA 2ONJA 1JMYA 2CYCA 2WUWE 3HVRA 1SKBA 3I72A 5A4AA 5BQPA 2JAWA 4UB6Z 1JDSA 4LXHA 4HDMB 1KYVA 3KSUA 1X7OA 5HNKA 5GOZA 3T3EA 3D7LA 5KJ1A 1WCYA 1H8HG 2A06H 3HKEB 3T0FA 1SUSA 4FT4A 3OU7A 4MWEA 1GTG1 3A6PC 3S28A 2AG1A 2I1QA 3N0TA 3NKFA 1PZFA 3VNBA 2XTMA 2WTEA 1HOXA 3U4CA 4AY6A 2WFZA 4W5OA 1YJBA 4BUJA 2YI9A 1ZRHA 2O7QA 4KXVA 5GM1A 3QVOA 2OBLA 3ZCUA 4EMUA 2OHIA 1G5TA 1DEHA 1EJBA 2XNDD 4N8SA 1OIWA 4ROSA 1DLBA 4YR7A 3ZHOA 521PA 2OXEA 1KQGA 3ZRVA 2IYEA 3AOEA 1QLNA 4QQKA 2DUUA 3K2QA 4CEHB 1JA0A 1EBBA 2DUMA 5A06A 2ZXWC 4RD2A 2EXXA 3E2MA 1TU3A 3TRFA 4B3RB 4YPOA 1O6ZA 3B3JA 4OKNA 5AUQA 3ML0A 2NUPB 4F60A 4P4GA 2HR3A 4XDKA 4C7UA 2OAEA 2DKNA 5JLAA 1M1UA 3MJ4A 1GDHA 1TYAE 4H33A 1ZD1A 4MRMB 1OYYA 3P9NA 3STTA 3ROFA 1HQCA 5LZ4A 4IIBA 1WDMA 3L04A 1XE3A 1U4SA 4JLAA 2GK6A 3FOZA 5AJYA 4OX9B 2W8ZA 4LXGA 2XQJA 4E31A 3GRKA 3VC1A 2IHKA 4L4SA 1DC6A 4WESA 2FDRA 1W88A 1RQRA 3N6XA 5ALFA 4DF3A 4MV4A 1NUQA 4PLCA 1NQWA 2QQ5A 4HYTA 2VUIB 1V9PA 4MGYR 5LZ2A 1POXA 4P2GA 1Z16A 4RHEA 3F4KA 1RCUA 2FPMA 2JFWA 1NQTA 2IVZA 2LDXA 4RV5A 3W1EA 2VR1A 3L1VA 5BWOA 5BSVA 2EKLA 3EY4A 1AKVA 3VQXA 4MHSA 2J0UB 4KGVA 2IFTA 5KTKA 4Z49A 4J3NA 1UOQA 2ZTUA 3C0KA 4OGWA 1ORHA 3HA2A 3TMAA 4DM4A 1PP9H 2QAJA 1O9HA 3FYIB 1TUBA 4UD6A 5JWPA 2O1SA 1J0DA 1GVHA 3HDJA 4WECA 2D1SA 1VCHA 3P3NA 1UFKA 1YJ9F 2O2EA 2Y0PA 4US0R 3OLVA 3EXHA 2HP0B 1E2MA 4DS3A 3E86A 2IBZH 2HQBA 5I7OA 1AR5A 3DBRA 4X62B 1GTZA 4KFRA 4IAOA 2ILMA 2EU8A 1XAJA 2WLLA 4BW9A 2MOKA 2VWKA 1KDRA 4GZ3A 3PUJA 1VQ6F 2OGTA 3SGIA 1H47A 2XMZA 3BJEA 3QVTA 3A6DA 1VTKA 5HY4A 1MJ5A 2PGLA 5EJ9A 2A4MA 3GJQA 3NPAA 3DSQA 2Y1GA 5B7GA 3MELA 1WMBA 1CEZA 4M76B 2HCBA 4P32A 1GTRA 3P4XA 3QKWA 4G0OA 2ZYSA 3QLUA 4BRUA 1U8CB 2A0WA 2NWQA 4H35A 3F0FA 2XZTA 4ZQFA 2CMDA 2PSHA 2OTJV 1PWEA 4G0VA 1EPUA 4W9MC 2C4WA 3TNDA 4PWZA 2JF0A 4I9QA 2FEKA 4C0BA 1DQSA 2BZ1A 5LGNA 4YYZA 2LO1A 5LHGA 2BONA 4TTJA 3RC9A 1N5KA 1PE0A 4WXRA 1NIPA 2G25A 3AFMA 1D8AA 3F0EA 2QEQA 2UZ1B 4DWOA 3JD4A 1TW3A 2N74A 2Z2YA 4GECA 3V4ZA 3CWCA 4U6QA 2G70A 4X1IB 3ROKA 3TZKA 2RHCA 1EFDN 5L3BA 3AO0B 1AGPA 1WQ1R 2O6LA 4PW0A 2G77B 1JR9A 2BOVA 2QUJA 3AUJB 1G8KA 1W88B 3LDFA 2VK2A 5FYDA 4C22A 4M0KA 4PAQA 4RTSA 4U8GA 1RPJA 4BHTA 1OHHA 1W0JD 4DYDA 1ZMRA 2BHNA 3B8EA 4BU0A 1KARA 3IT0A 5LOVF 4UHJA 5EZSA 3E61A 4YS6A 5KDLA 4NMHA 1OXUA 4QSMA 3R7LA 2CHQA 1ZGZA 5JTTA 1H2HA 1QPGA 1WF6A 3IBSA 3KOOA 1AO3A 3NUZA 1TUEA 4S35A 2WD7A 3WGNA 2EJCA 4B6OA 4NL4H 3AWDA 4ON9A 1ZNYA 3FVQA 1M57C 1EAYA 1H2LA 1KUQA 1NVKA 1P2VA 2O4CA 5KC8A 5M5BA 3CYOA 3L1UA 5BPHA 3JVIA 1ONNA 2YMQA 3TPZA 4K9LA 3KEMA 5B3KA 5C8ZA 1KK3A 5JYCA 2XQKA 1GCOA 1TAHA 3OKFA 4IVNA 2YHBA 4TKVB 4C8GA 4MYRA 3OZEA 4QC2A 3A1DA 4W6QA 1NPTO 4BFTA 2YVKA 4M2LA 4ZIRB 4DA0A 2KLHA 1M5IA 2YXBA 3RS5A 3VPSA 4O4LA 1B14A 1IWBB 2F3UA 4JJ4A 3DE6X 3OMXA 5A3SA 5FOXA 2GUZA 1MOSA 3HFGA 4AP5A 1XBLA 1IN7A 1P7BA 3DFZA 4MJ7A 2QWQB 5F2NA 1CJUC 1PLJA 2IPLA 2QY9A 2AGVA 1IBLO 5C18A 3CE9A 3RAPR 1Q2UA 1ZGCA 3MUEA 1VPVA 4EPWA 1PK9A 4QBFA 4BO1A 1D2MA 2A0YA 5KC9A 4JSYA 4JJKA 3T7JA 4NBRA 2IZ0A 2O54A 1G20B 1L5RA 1V9CA 3RT9A 1QIJA 4LDZA 2EWMA 4CM6A 1URPA 1IMOA 5EB1B 4I0WB 1NF9A 2C8JA 3N0XA 2Y1KA 4FZJA 4Z2WA 1HNWO 4IXDA 1E6KA 1P49A 3CEIA 1YD7A 3GJ7A 1EG7A 1XRLA 1CY0A 2Z04A 4UQPA 5BN5B 3LW8A 4GZ6A 3Q3IA 2BFAA 2P2NA 2H5IA 2V97A 3RJMA 2XE6A 1KETA 2N0SA 1CJMA 2XCIA 2YV4A 3AIKA 3JZMA 3VDQA 4GX1A 5EZ6B 5AHXA 3IB3A 3RKSA 1JBQA 1KNXA 3QIAA 3NTRA 4OHPA 1ETUA 4OQNA 4R9RA 4WNYA 1XF9A 1BL8A 4Y9RA 2AHOA 2ZDIC 3ENNA 4RO2A 1VJCA 4GMGA 3OQMA 3WRVA 3S40A 2QRGA 2P7HA 1AGNA 3SX2A 5BNWA 3ER8A 4QUDA 5YASA 5DLEA 4OJYA 3H16A 4LVCA 4PO8A 3CNBA 3FW1A 4KPGA 5CA0A 4PXAA 3DEYX 3E6AA 4L4RA 5CDFA 1T8TA 3CG6A 2CLFB 3EFOB 1H1DA 4H4DA 5FTJA 4NU5A 2W93A 3OFND 4XA8A 4YO7A 1VIVA 1DKPA 4DCVA 1J8VA 4GC9A 4XB2A 1G8PA 3M3DA 2FW6A 4RTMA 1O03A 1JDVA 2N9UA 2P3QA 3R5SA 3H7AA 3TD2A 4XYEA 4MVMA 3FTCA 1SQQH 4GSYA 2XASA 2QQ0A 3AB8A 1V1MB 1IIRA 2HVJC 3PJEA 1L0BA 2LCFA 5ALUA 3R7FA 4TQAA 1RPRA 3GAFA 5K51A 5MHTA 3K0BA 3T5PA 4FWTA 1T6ZA 1LPMA 2LPMA 1VKZA 3KFXA 3A2MA 3KJIA 2E21A 2Q29A 3LNTA 4FSHA 3ZHUA 1X2EA 2WJVA 1J56A 4IUYA 4NDNE 3OAAA 5EIAA 5FP0A 4B17A 3VH1A 4TZ0A 4DY6A 3GCDA 4IXMA 4YCDA 2ZJ4A 4JBHA 2HL6A 1HE2A 2ZIOA 3J7AR 1UPFA 2QMHA 3UAZA 5KKCA 3KKEA 3TSOA 4F3YA 2AYXA 1KWGA 3DVAB 1Y3DE 2O7RA 4KBFA 1QGOA 3S27A 3LT4A 3UXEA 4R7CA 5M2QA 1CY7A 3EGEA 3DULA 1P7ZA 2P68A 3H2BA 2FWRA 2IKQA 1FTQA 3G2LA 3B6JA 5BN3B 3B82A 4K5QA 1XDGA 3NNNA 1I2BA 1E1QG 1XL0A 4KXLA 2ZJAA 2QWNB 1JWAB 3JYCA 2XHBA 2WJGA 4Z0PA 1OH8A 3AVVA 5H3LA 1N25A 1GTMA 2AN3A 4GDMA 2F17A 2VHUA 1K08A 4QSHA 1E6EA 1E64A 3EIQA 3UMSA 4X66O 1BEUB 4PQYA 1TT5A 3QY0A 5SZKB 4OHFA 3UJDA 2EZ9A 3H8VA 1XZEA 2JCVA 3CISA 1SZQA 1YAHA 1X77A 3M1IA 3T4EA 1R4NA 1XJWA 4MRRA 1GL7A 1MN6A 1JI0A 2I33A 1ONPA 2WVJA 3ZZMA 4EFLA 1IZ9A 4D4GA 3OGIB 3GFTA 4PTYA 2DSNA 4OGGA 4IFTA 4XX0A 3WLQA 3CPSA 3M6IA 4HFNA 4YC7A 4NXMB 1GN6A 1K5HA 1KJNA 1ZCBA 2HX1A 2PLAA 2NR5A 3PFBA 3WPWA 4Q39A 4AMZA 4C7XA 4Q6BA 3IUQA 5CNKA 2ZZMA 3STXA 5IDXA 1XTBA 4LK2A 4XDHA 3UJAA 3K9AA 1Q0TA 1RWWA 1SVIA 1PT7A 4IXTA 4TSRA 2GSWA 3DE7X 1H69A 3FPLA 1RZRD 1JEYA 1GGVA 1DQZA 2CXTA 5HEKA 2OZLB 4BT3A 3QTYA 1NRIA 1KNQA 4N3GA 2EVWX 1X1RA 3D1JA 3GDFA 1LBQA 1NPDA 1G6KA 4DRYA 3GA7A 5IHPA 2FCAA 3FSGD 3M70A 2PTGA 4ZDKA 4FX2A 3VHLB 5L45A 2XMSA 1HF3A 2L26A 4KQEA 3UH1A 2AOWA 4EHIA 5ALXA 5AM0A 4DLSA 5DN6D 1N0IA 3LPMA 4LVOA 3K15A 2B2CA 4RFSB 3WL6A 5KUTA 1SBCA 1JAYA 3NVIB 1KVTA 1XTPA 2A5YB 2G5GX 3AEXA 4FGWA 2POQX 4KITB 1XVVA 3D6VA 5JBQA 2VQFB 1X9IA 2QGZA 3GAMA 1CY4A 4HWRA 4AJLA 3WIBA 3D6FA 3ST7A 4UHHA 2J5RA 2GD0A 4EPTA 4F72A 4RHCA 1P0IA 2ZITA 4OUDA 5FWAA 3MWLA 4ZEOA 4MQ5A 4PC6A 1XBIA 5A7GA 3TPFA 2GPWA 1K1EA 2EQAA 2GARA 4OHKA 4YQFA 1SUPA 1YMQA 3P4EA 2JI9A 2DWCA 5BVGA 1K66A 2EF1A 4PU0A 5F77A 5DCYA 3UB2A 1F2DA 4ZTUB 1QF9A 2PKYX 1UM9B 3NTUA 2ATXA 5AXDA 3PYXA 1BROA 3JYLA 5KMGA 2J6BA 3DNMA 3LZ6A 2YDYA 4ZIBA 4DW8A 4A0GA 4LOHA 5A4IS 4NKGB 5LA6A 4M1WA 2F4VO 3CRNA 3ET4A 3DDNA 1X19A 2OV8A 5A6VA 4CLOA 2C04A 3FB7C 5TQ2A 4I5DA 1BQ4A 4DNPA 3H1GA 2O59A 1PM9A 4UXJA 1IMJA 2OUKA 3PNSA 2FFHA 2G36A 1YL6A 5THQA 2N04A 1QQ6A 1UBOS 2R7LA 3Q8WA 4G4YA 5KSOA 1N8TA 3DDZX 2MSEB 1RYBA 1VG9B 2ZIMA 3IKEA 4DEYA 2R11A 3LZDA 3FOCA 1NLZA 4AF7A 4BP3A 5DWDA 3FOWA 2IH4A 4XVCA 4UNPA 1GN3A 4LRQA 1VDMA 4MLZA 3L7AA 5F78A 4E1AA 5T4FA 1AQUA 1P7PA 3I1IA 4XVHA 5ECGC 4JSRA 3HR8A 1IG3A 4I19A 4D3YA 5GVRA 4DLRA 4GX5A 1XEFA 2EHDA 3DZJA 3OCVA 4LCBA 5IDYA 4CMGA 5JHGB 2V7PA 4TKZA 4K9NA 3AI3A 4DT1A 5JG7A 3TGUH 3ZWAA 2FLWA 2H8EA 4INOA 5A4MS 5AVZA 2GO7A 2ZYGA 3C3MA 2APJA 3EXHB 3P0HA 3PR3A 3QWAA 4N39A 4PYLA 3UXYA 4YIHA 2ZUFA 4KL1A 3DKRA 1TLFA 3AR6A 3I6YA 3GCZA 1G5QA 3PX7A 2RGEA 2H1HA 1R6UA 4I50F 3K73O 4I36A 4J0GA 3N87A 1Q5PA 3IPYA 4Q9DA 2PWZA 4LMPA 5I4BA 1VG1A 3KU4A 4RK6A 5KSYA 2HWKA 1ZWZA 5DV9A 2XXAA 4MTXA 4RTKA 2OESA 3ZMUA 1Y7LA 2P7IA 3F3MA 1Q7BA 4WGFA 5F9MA 4ENVA 1ICIA 3ZC3A 4PYKA 1A8SA 1EFRG 2ZE5A 1R10A 2XUGA 4G0MA 1IUKA 1T8SA 3SF8A 3V9AA 3H9UA 5KNBA 2X42A 1W2GA 3IAS1 1IZZA 3QVKA 1FMFA 4TXMA 5E4JA 2XE7A 4H7EA 1LPSA 2O3TA 2VHJA 4JP3A 5D1NA 3VVMA 1VMAA 2PMCA 2A79B 4AC9A 1T0BA 3OEED 1YZYA 4RY2A 3GRYA 1I0LA 2PYIA 3I56F 3N2EA 5IX8A 1GV0A 3E8FA 3DV0B 4LPSA 5ALMA 4YP6A 4MWTA 4MJLA 2CDBA 3LT2A 4CKBB 1N4CA 1GZUA 1E99A 4Q3CA 4UU1A 3K59A 4WXHA 1P4AA 3PC2A 3RU3A 4MVYA 3LPAA 2W42A 3U9LA 2GBCA 2P4VA 1KO1A 1OXVA 2XH8A 3OTQA 5BN1A 2GT1A 1DXQA 2ANCA 4NYJQ 3LD9A 3MTQA 1N0NA 3LQRA 3QUCA 1GPH1 1QZXA 4EG4A 3L46A 4XTCS 2FEPA 5BR8B 3LIPA 1WEHA 4JQZA 5K2OA 1P74A 2VZ8A 4G0PA 5IFKA 3EWAA 1G20E 3PF9A 3G1TA 4ZCLA 4RL4A 2C2AA 3E15A 2J32A 1XTQA 1YFZA 4MA0A 4NJMA 5FKJA 3RBXA 1OCOC 5LQUA 2QN8A 1BGWA 2VPXA 5L8VA 1YR7A 1P6XA 3RTAA 5LB2A 1W581 1AP6A 1BSMA 1CUJA 4XI9A 2K2WA 3VYVA 2O8EB 4IDGA 2XYGA 3DHNA 4HLDA 4QOIA 1HNNA 1V7QA 3S2ZA 4MDEA 4F4FA 4FDMA 1PQUA 2QDOA 1AF7A 2CLOB 3F7YC 3W7SA 4KB5A 1YFJA 4GUAA 4QUGA 1WB9A 5BMVB 4I1SA 1GZ4A 3RO7A 2QUBA 1RXUA 1QD9A 3QLTA 1JB9A 4KVZA 4BOYA 4JLWA 4C6SA 3OCXA 5DYYA 3DPIA 3PKZA 3G9ZA 3SVZA 2LP4Y 2O8BA 3EDYA 4JLJA 3E1YA 1VQOF 3UM9A 3BRQA 2P6JA 4R8VA 5E7MA 2D3TA 1P6UA 5AW2A 1D1PA 2HHHO 3C8HA 2ZR2A 4BVAA 4MO9A 3VPAA 3EVNA 2V7EA 3CPWU 4FKBA 4DJDC 1XL6A 3WJRA 4BXOA 1NMYA 2XRYA 3EZYA 1YRAA 3FJOA 3SOZA 5CDYA 1L8XA 5GADl 2KQXA 1DG1G 4AJ9A 3KQQA 2WTUA 2HYIC 1ZL2A 1VKJA 3WA7A 2X9LA 5F7ZA 2ZU6A 4GMFA 5GIOC 2BELA 4GLXA 1JJIA 2JEYA 1Y8QB 1RE0A 1RYFA 2OOSA 1T5OA 1ECPA 3EFOA 4B76A 3HP7A 1II9A 1AXGA 2RQ6A 3B4SA 2W0MA 3ZDYB 1J42A 2XCUA 2ZIXA 1VF6C 1RM1C 2XDWA 5KHHA 3C98A 3DMHA 3EZ7A 3I9JA 3KXLA 4JBYA 4R1UA 1TA9A 1Z4IA 2XAUA 1DO8A 4ZVLA 2ZAUA 1WVMA 1KHHA 1QV7A 2BFDB 4XWAA 2OORC 1C7RA 1X7HA 1X7XA 2ZJ3A 3T0GA 3STVA 2P5SA 4CZZA 1C4KA 1V48A 4CT4B 2AH5A 4IFIA 3V46A 3N6VA 4MINA 4W4TA 3WLMA 1QKJA 4JLVA 4BVJA 2PUGA 1WVIA 3HGMA 1SOWA 1N2ZA 1W75A 4LXIA 2ZXWB 5DGXA 2NSHA 4NCAA 3L1IA 2HRZA 2PKEA 3FPCA 1THZA 3EYAA 3CJQA 1G3UA 1T8YA 3FVVA 3HYNA 3L18A 2HYDA 3DMRA 3UHOA 2D3WA 4GKKB 2IX9A 2R8RA 5I7UA 5LYJA 1S4MA 3BG5A 2YMPA 3OF3A 4G1BA 1P4HA 4HBGA 1M6VA 2Q6VA 4BTVA 2BDUA 1LDMA 1OOEA 3U10A 1QFYA 1ZS9A 2YBDA 2PS1A 5BSRA 4I6JA 4D9EA 3RUDA 3U3JA 1V3TA 2VQDA 3BWVA 4KX3A 1OFUX 4RK5A 1LDGA 4XE5A 1L5KA 2COUA 3CUSA 3OM8A 3V8VA 3HYTA 1TUGA 1WZCA 4NE2A 1SZPA 4Q66C 5B8FA 1HZZA 5CFQA 4ISCA 1L7OA 1T9DA 5GAPK 4OHVA 1K6JA 3E5RA 1T5IA 2OHHA 3IC7A 2Y1XA 2E6KA 2PIAA 3SCZA 4D3XA 1W94A 1E7RA 2HJVA 2JZNA 2ZWPA 1ONIA 1ULAA 1YS2X 2FUKA 3EHEA 4X5OA 3UT6A 4NTYA 4MR9B 5LQKA 1W19A 4YV0A 2FPRA 3E1GA 3WL4A 1XTVA 2VUSA 4NCBA 2QE6A 1NU1H 3LSQA 4J2TA 1PR5A 2QI2A 1R1BA 3DQQA 4MUEA 4ZOCA 2LBXA 4HWSA 1UDXA 4MA4A 4G37A 1WB6A 1KF0A 1GK9A 1H0KA 1KVQA 2A9JA 2E6UX 2GETA 2W6MA 2FWMX 3CRZA 3OBIA 4YLGA 5FWYB 2YNMD 2C95A 2PNFA 4NESA 1VKNA 2C3OA 3D6NB 4P93A 4JYCA 1JLLA 1M57B 1VL1A 2QIOA 1INLA 4NAUA 4L7VA 4MW7A 3ZX4A 2DEUA 2QRVA 3G8AA 3I01A 2DT8A 2HLDD 5PGMA 5TC4A 4FNGA 3K06A 3Q4GA 3VYUB 4BB5A 1ZQ1A 4EKEA 5K3FA 3OMNB 3U4AA 4LS3A 4B8WA 4ESEA 2VRNA 3MB8A 1K5SA 4QPJA 3PJRA 4UM9B 1SC9A 4DREA 3MUFA 4ETWA 2B4YA 1Z0UA 2RI1A 3CLUC 3CONA 2YXZA 4MNTA 4NBTA 1Y7PA 3AUTA 3EGXB 2NXWA 1U7XA 4Q4AB 4E5YA 4E3WA 4V03A 4B3TB 5HXAA 2ODMA 1E77A 4XM2A 5AD1A 2GILA 5B2EA 2ZANA 3TGLA 4YT8A 1FMTA 2IPOA 3RVPA 1O8BA 5JMTA 1GM8A 3TQSA 5A0FA 5IK2D 1BWPA 1I1QB 4OLJA 1XP5A 2CBGA 4LDRA 3NMUF 1S9HA 3K30A 3AK4A 2VPQA 4FX5A 4O63O 4B6QA 2YMMA 1E2BA 1M90H 5FOUA 3P0EA 4AD8A 5C51B 3F4LA 3K0AB 4UXHA 1GPDG 1W0KD 3A4VA 2Q8VA 3NWEA 3DCNA 2Z58A 4JJ6A 2C4NA 1SKQA 4TSFD 4U0KA 3I6ZA 4CF5A 2YQ5A 5IZCC 3UJCA 2FVXA 3SJZA 2AOTA 4GMKA 5KOIA 3V1NA 4XVRA 2XSZD 3CF4G 4RYLA 5IM4A 1S2OA 1W4RA 2NU6A 3IR5A 3T7SA 5JROA 1ADBA 2R5NA 4WESB 2JBAA 4QBHA 2QLTA 1F4LA 3HL4A 4WN3A 1W5AA 4HGPA 3S1AB 1AGXA 3U4HA 5G1PA 1O5TA 4GGMX 5ESRA 2BGWA 3WTCA 1C4XA 2FMLA 1E8DA 3HSKA 1GSOA 2R1VB 1F4NA 3EZLA 3FYSA 1PT8A 2QN6A 4KO2S 1YQNA 1L5QA 2HJWA 3KZXA 1BMFG 1DXYA 2Y0DA 2PS0A 1GUFA 3M99B 1P19A 1PEYA 2ZATA 4UJ5A 3BGDA 4C7KA 3ZGVA 4JKOA 1XAGA 3ICVA 4M7WA 1K6IA 4U6SA 4IDEA 1HC7A 2FB5A 3VYSB 1D07A 4L3VA 1K8AW 2EIHA 3CVOA 1CXZA 3EGOA 3HQ4O 1AKWA 4LV8B 4PLFA 1ZMXA 2CDNA 4ZALA 4PPNA 5E7IA 1WHTA 1N2CA 3CLVA 5J2UA 4LJLA 4PSAA 1RR6A 3S6JA 3ZH9B 1EN5A 4NVRA 3TW8B 4BP9A 2OCDA 1UT8A 3R44A 3TG2A 1HG0A 2JS3A 1Y9AA 4BMNA 2IH5A 3I8SA 4CEJA 4INAA 1QQAA 3OE7D 1A9OA 1MABB 5HRAA 2OYSA 1KO4A 1C3OA 2P4SA 1UBNA 3CC4V 5IBQA 4PN7A 3AQ4A 3L0SA 4U00A 1FRVA 3QGMA 5EWLB 4A27A 4CKWB 4GAEA 5L6LB 1XPUA 1IBKB 2R5WA 4RFVA 2O2YA 1JHDA 4QUKA 4BZWA 1VARA 2CFTA 1BS3A 3WIVA 4B6FA 2QVYX 4C0HA 2PA3A 2PLFA 4DHEA 1IBLB 2PUBA 1YMUA 3AESB 1Q74A 2G8LA 5CH8A 5KAMA 2P27A 4E07A 3AEZA 1MAHA 5EE0A 2A1IA 3B5EA 1UFOA 2E3JA 2F1OA 3D2CA 4FLTA 3LUAA 2RMKB 3D5EA 1IV3A 2WSBA 4HYOA 3IA2A 4NBUA 4L6IA 1NSYA 4RIEA 1NH2B 2CL7X 3J81N 3V4OA 4A8PA 5EMKA 1LA2A 2O3QA 2P8JA 1GYQA 4M37A 4MDFA 3Q7SA 2HJFC 1MV5A 3PSHA 2V5VA 1AROP 3EASA 1EDBA 1G5RA 3HJHA 4FCWA 3NG1A 4F9FA 2PGNA 3H9BA 4WI1A 5AUNB 4K8XA 1ENZA 2P9QA 2QP4A 3A1VA 4ZVVA 4MVOA 1PJZA 1W0KG 4TSFG 1EE2A 2BTUA 3W8DA 1IRIA 3BQNB 1AA9A 5F7OA 5HY2A 3DH0A 1U97A 2V6IA 3C6KA 1F3OA 3DM9B 3FETA 3GF4A 1RYHA 5E4FA 4JODA 5D7BA 2VNSA 2J0UA 1W25A 2JFXA 1TYDE 1B8VA 1U0OC 2OFWA 3DE2X 4WZAA 3VVLA 3W7WA 1EDOA 5E3JA 3TSCA 3P9CA 4W9NC 1L7EA 4H13B 2PX5A 2QZ9A 5JAOA 3H3FA 5B1AC 2CMKA 3L70H 3A8TA 1NU8A 2WRZA 5L3QB 1TTHA 1C9EA 1O94D 1DC8A 3RAEC 5JTUA 3ZS8C 4BT4A 2PAFA 2YIJA 2C2BA 3AJ9A 4WHMA 1N9ZA 2JD2A 5DHUA 5G4LA 4CW7A 4YCMA 3GLVA 3KQNA 4RGVA 1E3DA 4J7KA 1VQPV 3S99A 3QKTA 5KTOA 1QQ5A 2B21A 3MBOA 4MS1B 2CK3G 3RBAA 5TGZA 3P4UA 2NNLD 2PT6A 3MJDA 2Y4UA 3IMGA 2PAAA 3IO5A 2PSEA 2QX4A 4OXQA 4MROA 4TTQA 1VPEA 2P35A 1I0HA 1SPBS 2VTKA 4GPD1 4XIFA 5BQFA 2RG1A 1CRPA 5THXA 2V1XA 1KZ4A 1UBEA 4DV7B 3KL2A 1M8KA 2QUZA 3LUHA 3QXJA 1CUDA 3OOWA 4PO3X 3BHNA 3S29A 3HDHA 2A57A 2J85A 3R0IA 1SCBA 1E2DA 5CA0B 1GD1O 1DL5A 2VP5A 3GFSA 1C1HA 1WU8A 1ZJ4A 1TK2A 2SHKA 2WFLB 2CMFA 2AHRA 2FV8A 2P3LA 2PK3A 2PH7A 2UVPB 3JQ7A 3KXKA 3R41A 5EAIA 5A5GA 3H2KA 1SC5B 1UZAA 4BO6A 5JW6A 3PEYA 3H2GA 4YAOA 3E3LA 2XWBF 3TCKA 4CUJA 1GNPA 2I2XB 5B36A 1EM6A 4Q00A 3O90A 2OTJF 2P06A 3BEDA 4XRRA 2BFWA 5B1BC 1DIAA 2XWQA 1SQBH 5JAZA 1ODIA 2XHEA 3E1KA 2HF2A 1NVDA 3MPUA 3VU8A 2OBFA 4INJA 4P9PA 5DDIP 2P6RA 4KR0A 1NTZH 1GZ5A 3GQBB 2ZRCA 3O8CA 1NC3A 2KG7A 5BSKA 2P41A 3OT1B 1RHQA 4DV6B 1XA0A 2QD1A 3BQMB 1H22A 1GAJA 1TAQA 2OC9A 1XZ8A 4W1RA 3ZWBA 1GRVA 2Y0EA 4EZEA 1HR0O 2Y1EA 3FBTA 3QUTA 3LWDA 4MGKR 1G20A 2HHLA 6PFKA 4JI0O 1GPUA 1QVZA 3D8HA 5HM8A 3AVTA 2WBLC 1IM8A 5TJ9A 1CZHA 4CCYB 2DHRA 4XAQA 1FQJA 4QYTA 3P45A 3A6KA 2UVDA 3ZDQA 3U9TA 1QIMA 1ZGGA 5EJ8A 4ZT2A 1DJPA 3PLNA 2JA2A 1QP4A 2FGYA 4ZA2A 4HVCA 5HQTA 4YMIA 2JLWA 2YFQA 3O85A 3O1IC 3F0GA 2AOUA 4UV8A 2AMVA 2C7VA 2P22C 2AUMA 3HN2A 3KTAB 4ZVOA 4R3NA 1CLIA 1ZD5A 3FSGA 2HO4A 5H5JA 2DWEC 3MNFA 3TZCA 5BV1A 4IDPA 5DBHX 4BVTA 1KC8H 3E84A 4LBZA 2XBUA 1E1MA 1JDBC 3N53A 2JBHA 5DMHA 4NJMB 3P2YA 2IYYA 5IVDA 3TW4A 4GQIA 1XLUA 5JSZA 1YA6A 4I2VA 2IXTA 1AS3A 5JRZA 5CM2Z 2YS7A 3QKRB 4PLZA 5M04A 2X1HA 4NCXA 2HSDA 3BB1A 5K6AC 3NHWA 2V9ZA 4GYJA 3VGJA 3OKPA 3Q12A 4FP9A 2GVIA 3SK0A 4FLUA 3FJYA 1DHRA 3I4CA 2QWOB 4Q1VA 3RB8A 2NMVA 5KPJA 2KBEA 2H1IA 2V58A 1OHHD 5B2FA 2GV9A 1YR2A 4OKIA 1LBTA 4IIEA 4JT2A 4NYMQ 1Y1TA 2Z6VA 5B3JC 3QXHA 3WP1B 1H05A 4RWEA 1DBQA 1IK6A 2EG9A 2WA1A 5K3SA 1WE2A 1WP8A 4IQFA 3VO2A 1CRWG 1UBTS 3RC3A 4ETMA 3JW8A 1JILA 1QO7A 2JZOA 4MS2A 2ZRAA 3C8DA 3K6KA 3M4YA 4UEOA 4TKUA 3W8NA 5KYUB 2IHNA 1Y9JA 4P5PA 4D0GA 3DE1X 3P2EA 3TEFA 4H31A 4ZVRA 2XNJA 3HDYA 2XNDG 1VL5A 4ND2A 3ADDA 4YRGA 4J41A 4L28A 3L7YA 2DN9A 4ZJYA 4UOEA 1AGYA 1AA6A 3EOBI 4BVRA 3Q8MA 1YITV 1DT3A 3O8LA 3K0AA 1CJBA 4MVJF 3U4QB 3TVYA 4IJKA 3IBCA 2VS0A 1I1NA 2BCCH 1O0SA 4H17A 3C9RA 1MGPA 4TV8A 3MCQA 5FL7D 3K5LA 4IIYA 4KR7A 1ZSNA 4J4TA 4M0PA 3HUFA 4K0KB 3AJRA 4LAFA 1YKSA 4X00A 1E0AA 4P1ZA 4DMFA 4OJTA 3U48A 3C6QA 5IPFA 1RU3A 1G2QA 1RT9A 2Q21A 4B4VA 3G3EA 2C96A 1YUNA 2C20A 2X3FA 4FOPA 3J81k 2H06A 1IZ7A 4Q4AA 2JEXA 2F59A 3P9KA 3R3UA 3UK0A 4A8JC 5LVAA 2FJPA 3JSAA 2B0JA 3C6MA 1MC4A 4Q3NA 2GRJA 5L51A 2PLWA 4M22A 1YK0A 1KQSF 3B1JA 3CO5A 5EMMA 2YKGA 2CDYA 4JLMA 2C8VA 4JC4A 4LF7O 4B3JA 2A9HA 4HDOB 3G59A 1UUFA 1MX3A 2VN8A 3THWB 2C5SA 2QTAA 4R5MA 4BWGA 4PZLA 3FFMA 1IXKA 4O2BB 4EMBA 4L57A 5CTJA 4QASA 1LI5A 3FD5A 5IJ0B 2X4LA 1KHTA 2OK7A 1TPYA 2BEJA 2BGIA 4PNZA 3IALA 4WBXC 1E2IA 2R65A 4R1LA 4BNLA 3CX7A 3MJTA 3SE7A 5B1EA 2YFHA 2WW8A 2ZTSA 5CCXA 3SYPA 4DB4A 3K9WA 3NOXA 3TVTA 4YT4A 2JHPA 3LF2A 5CH5A 4MVQA 3HG7A 4KQXA 1EM8B 1GSAA 3L6BA 1Y4SA 1XQ8A 4J6EA 2VXOA 4HXFB 3BIXA 2W6ID 5E8RA 1JHAA 4JCOA 4FLXA 2DBZA 4OJQA 1G9SA 4ID9A 4UZSA 1FLVA 2IOFK 3PF8A 1Z6GA 5EJAA 1KC1A 5LMNB 1I08A 2AW5A 4OHRA 4Z2YA 2L17A 1YCIA 2EWCA 2H3OA 2UDPA 4ATNA 5CBKA 4B31A 5KNCA 1SMKA 3E9YA 1IG0A 4KBYA 3SAJA 3G4SV 1GG9A 4GOXA 1U2GC 2VYCA 5BN4B 1UPAA 2CMHA 4YAUA 5C0OE 5DFAA 1E1QD 1Z15A 2JA1A 5JFOA 1NUPA 4I9WA 3A9SA 3R2JA 1KS9A 1Q0UA 2CFCA 2R85A 3AOEC 3ETHA 4RA9B 4WN9A 1RIIA 5KLVH 4JKIA 1G2IA 1GFIA 1P2TA 1NC1A 4AILC 5BSMA 2NZ2A 4UASA 1SY7A 2W58A 2OWOA 1USIA 3A04A 1OTHA 4WK6A 5BMOA 2WLMA 1ZWIC 4C4WC 1AKTA 4M9RA 1WPGA 3GUVA 1YVWA 3NOQA 1NONA 4YACA 3SN6A 4ZYXA 3MRTA 4BQNA 2CHTA 3IDQA 5CJPA 1V3UA 5G4UC 1KYTA 3N0RA 3FSJX 3E2EA 2NV6A 4GR5A 4WZZA 5IBRA 4X65B 1DHTA 3LBAA 5FDFA 4LSWA 2Q4OA 2ADPA 4IX1A 5GY7A 2FB9A 4G4IA 3G4SF 3V4SA 1UQUA 3QEOA 1IEWA 4BEVA 4TZ6A 1K89A 3PUZA 1JJ2F 1RABA 5ALLA 1RFYA 5CD9A 4C14A 5KU7A 3FYUC 3U7HB 2GCPA 5F98A 4GQBA 3DXFA 1WB4A 2Q7XA 2ZEJA 4ZVMA 1BW9A 4ZHQB 3T95A 2XKKA 4A6DA 4OG2A 3N70A 1A4UA 2EFYA 3BZBA 3HJRA 3PQCA 4KYVA 3TKLA 1KI6A 4YYEA 4AY5A 1A1SA 4JASA 1GTOA 4L5CA 1VQOV 5DHTA 1BS9A 2D8AA 4KE6A 3AR9A 2WSYB 4MS3A 2WYWA 5LYJF 4ZHYB 1ESDA 2UUCB 4EA8A 3KBOA 4DABA 4KOEC 4GLBA 1WDKA 4M36A 5JR3A 4D26A 1P62B 4EJ6A 1R5BA 1SXJD 5D5QA 1Y8RA 5TE9A 4ARUA 1U4OA 1RI1A 4D99A 1NTMH 5DBOA 1QZUA 1QFSA 4EYOA 5KVQA 2G8NA 4LPKA 1C5KA 4CI0B 3A1NA 1W1WA 1JEQB 4GM0A 3R1IA 4DR1O 4ZDJA 4OB6A 1U9CA 3N5KA 5KYKA 3DOCA 4LCEA 1PFKA 4D8YA 1LFDB 2Z2XA 4Z7QB 2FGKA 1BU5A 3CY6A 4BBZA 1RM4A 2G5TA 2WLSA 4WUTA 2Q0OC 2DY0A 2OBYA 2XVXA 2PANA 3ETLA 4KGXA 1KRXA 2NYVA 5A2QM 3VXKA 3ZDZB 3KAJA 1V5IA 4IOJA 3NWJA 1GKYA 5B2ZA 2QUAA 1A8IA 2YQ4A 4QPPA 3O8QB 3O8QA 4URVR 4ILKA 1MA3A 1VB3A 3FMVA 5EL0A 3KDSE 1L5YA 3MYRA 2J7KA 3A3OA 1Z2NX 3OUZA 4GOOD 5EE5B 1DKMA 2C2ZA 3FCCA 3V5NA 3ZW9A 1OI7A 2ZBGA 3FGPA 4N48A 4ER0A 1KDOA 2CWWA 2JJ1D 3I56V 1V2HE 3MIIA 5KAFZ 1B4DA 1ZKMA 1KE2A 3E2PA 3LJKA 3G2NA 3JQGA 2G9RA 3L7KA 2FE4A 3P2IA 4NS1A 4ZMBA 3GPLA 3I5DA 3EUWA 1NUSA 2BVNA 5GIPC 4BEBA 3HM2A 3OUFA 3G5UA 1B00A 1JI3A 2PVSA 3X1JA 1RJ9B 4UDNA 5TDHA 4J1TC 2ZQYA 4RHAA 4LKOA 2CUNA 2IL1A 1GM7A 1EJ2A 1KJJA 2X5XA 2C4KA 3BQ9A 1IOLA 2Q5LA 4AZ3A 3LO8A 2YZNA 2OSBA 4DA7A 3FXAA 3QE3A 2WM3A 4YQYA 1H8HA 1VGQA 1NUUA 1X92A 2WPDG 1YZTA 2A59A 5FTKA 1L5LA 4E03A 1ODSA 3KR2A 4QQ8A 1ISIA 5IN5A 1V25A 2FRXA 1COZA 2VH1A 4R6ZA 3G0CA 3F6MA 2H00A 3W7VA 2Z1NA 4TRNA 2EQ5A 2RDCA 4GPAA 1Y81A 3H9CA 4KQ9A 4IDAA 2R48A 2JZCA 4WKGA 3CZ5A 5LB4A 4O4HA 4KWCA 2X0FA 1VGVA 4WZAE 5D5HA 4LFBO 1XIVA 3AGPA 2I9KA 2CDRA 1FXKA 2XUDA 2WP0A 1GITA 2IGBA 3W5DA 1M1XB 4XQCA 1N2XA 1TC1A 3BH7A 3HEBA 4OHCA 1N0UA 4BFXA 5FYQA 1T9BA 3F96A 2Y4TA 2XXJA 2BFCA 4ZO7A 5AT1A 1YE8A 2HLDA 3RN4A 3OIWA 4B7XA 1N0JA 3IPRA 3JRNA 3WDLA 1Z2DA 3HFJA 5JCXA 3SPCA 2OXIA 1HW7A 3OZIA 2PRZA 4AWBA 3QX3A 5DNVA 5GWXA 1TF2A 1OXSC 4KO8A 3BZWA 4CM4B 5J1SB 3NBFA 4CKXA 1V11A 1FW8A 1JSXA 3HDTA 1XXHB 3DVSX 2VF4X 1X7ZB 3SYOA 3A3YA 1UPCA 3V7WA 3C1AA 2ARHA 3ASUA 4WNAA 3I61A 3BAZA 1WUHS 3KFVA 1N2HA 5JJJB 1YIAA 2NO5A 4WWHA 3PTLA 3U3ZA 3B70A 2O1EA 3CNOA 2O52A 1V3VA 3QG1A 3ZOKA 1ZJZA 2AQKA 4RGYA 1PV2A 4OPMA 2BP7A 4MR8A 5B3AA 1JPVA 1ZHFA 4DR5B 3LDAA 1TJYA 2W2TA 4P3KA 5AJWA 1G7RA 1VCIA 2KHZA 2RHWA 4Q6GA 3DOIA 1H2FA 2C7GA 1EGHA 4K26A 3IQWA 3TOXA 2QJFA 4RZSA 1QUEA 1GYRA 2R00A 5JXHA 3M2TA 1PSWA 2K1EA 1PJTA 2W0FC 3IEKA 3A9RA 3RS2A 1K3EA 5JY6A 1GCAA 4ASUA 1L7DA 3GFBA 2CLKB 2MSLA 2CTQA 3LRXA 5EFOA 1NH2D 2Q3HA 3RS8A 4DDHA 4BY9E 4CM9A 5CIWA 3CF2A 3HVUA 1A9TA 1ATZA 3CUTA 1P2SA 1PN3A 4KO3S 5CU7A 4LI3X 4W5NA 1G6Q1 1MD9A 2J48A 1SU6A 2H1CA 4U39A 4R51A 5E2IA 1C30B 3ZS9A 4BRWA 4FS3A 3QF7A 1YBMA 3HACA 3KSRA 2QR4A 3DYVA 3J81A 1SXPA 4DR3B 4WFHA 3O1HB 4TMTA 5FT9A 4DIUA 1T24A 4MEAA 2Q41A 4LVUA 1JN1A 1PNMA 2AZ4A 4QPNA 4D81A 5DP2A 2FMKA 1WMEA 5BYBA 5B12A 2DR0A 4Q4CA 4MPJA 4X54A 1EX6A 4MICA 1WLSA 3AHGA 1IZ3A 2DTDA 2I6DA 4BIZA 3LSSA 1WJGA 2HIMA 3B1YA 4JA2A 4JIGA 4PS1A 2IWRA 3ZPXA 3H5RA 2EAUA 3HCDA 2IYSA 2YZ7A 4F8YA 1QFXA 1ODEA 1FPMA 3DFUA 1IH8A 2F1JA 2KBFA 4KDFA 4M1SA 5DOZA 2SKDA 1NP3A 2AFHA 4B47A 4A8HA 2GTHA 2PX6A 4OXIA 4TVBA 1DOZA 3NM4A 1ZUNB 4FJ0A 4P31A 1VBFA 2VLBA 4YROA 4EYGA 5FUQA 3HWWA 4F8EA 1TZBA 2FPPB 1NXVA 2WWWA 3DHEA 5KYNA 4ENQA 1VHTA 2JGKA 2YWJA 221PA 4ZQGA 4J9UE 2I76A 5L3ZA 1YJNF 3F0DA 1U2ZA 3B48A 2OHXA 4G81A 4JOBA 3X2QC 1R0XA 3P9QA 1NZJA 2H8GA 3V7NA 4TKUB 3ORHA 4AKIA 2CLLB 3I76A 3JWHA 4L22A 1FYFA 4HF7A 4E5KA 2ENUA 4C7BA 4R69A 2WUGA 5SY9A 2OC4A 4ZVKA 3VTZA 2X6QA 3GEHA 3ILSA 2IYQA 4H1VA 2W0XA 1ENPA 4EGCB 1SJ9A 3IRUA 4UHKA 1MRZA 5F5LA 4FCCA 4YMSA 2I4MA 3BZUA 1HEUA 2C9DA 4G56A 1YZQA 2Y77A 2JCXA 1WBBA 3L5OA 1QS0A 1MNQA 2YINC 1Q83A 3ZWYA 3C3BA 2HSZA 4LHEA 1K5GA 3QKRA 5FFMA 2G9ZA 3N27A 1XN4A 4QQFA 4NJOA 3ER6A 2E4UA 1W5BA 4ND1A 2GN4A 3TFWA 3BMNB 4PLWA 2WHRA 4IDNA 3VNAA 3JWGA 3BILA 4XGKA 1FTGA 4EYSA 2ZM5A 1UJNA 1WY7A 1TA8A 5CPBA 1OWOA 5DULA 4US2R 1TW2A 3L1KA 1Y82A 2QSJA 3NDPA 1BS1A 3PRJA 4ZQEA 1SCUA 2GCIA 4U7OA 2ZTMA 1LX7A 1K68A 4BY9D 4RQOA 1A9PA 3PIIA 5AJHA 3EVEA 4LRTB 4FM2A 3EN0A 1N0HA 1YASA 4JB8A 2IJJA 1GP2A 3GGOA 4BBAA 4EL0A 3BMQB 4US1R 3MCTA 5A1TA 4OBWA 2OTLV 3D3JA 3ZO8A 1GPJA 1T36B 4JU8A 4WXPA 3K03A 2IIBA 4X1KA 3UGKA 3DZCA 2IJGX 5KYGA 5KO2A 2WOJA 2XB8A 3COZA 3KDPA 3PZBA 1JFFA 2VK8A 1XXLA 1VLJA 5HF6A 3EH1A 1OLUB 3SQDA 2GEDA 4C4RA 3HNOA 4RTPA 4CDRA 5DYWA 2ZVDA 3OR7C 5BW6B 4H7FA 1L0LH 1I0ZA 1ESMA 3H5VA 3KG2A 2OORA 4MIYA 1LJ8A 5DXFA 2GHIA 1REQB 1P8AA 1JFFB 2C7BA 2DSTA 3HU5A 3KDAA 1OV9A 4B4DA 2P91A 2I91A 3SICE 5L3EA 4QFCA 3T06B 1MQ8B 3R0JA 4KZPA 4WY5A 3UV7A 3DTYA 2I4LA 3P0IA 4O25A 5EHGA 4HADA 4Z3DA 4QBKA 2ONCA 4B4OA 2PJRA 4JJ7A 4ZJUA 3PPIA 4OGQB 4JDPA 2YXHA 4PYOA 1Z3IX 1SVOA 3G8BA 4J7UA 4JOCA 3TI7A 4B6RA 4PDLA 3T6KA 1U0HC 1FNKA 1XZLA 3N7UA 3GP8A 4OLAA 3ZKWA 3MW8A 4X8MA 5FF9A 3WNBA 5I3CA 4CI9A 1G66A 1EZ1A 4FDUA 4YRKA 5CB6A 3PD1A 4AG5A 1E89A 2CCKA 1LW6E 1IN4A 1UMKA 3IE2A 2YIDA 2FEXA 3MTDA 4NBKA 5U4XA 3QLVA 2C92A 2QORA 2Q4PA 3DAPA 3WWEA 1COMA 2UYJA 3GZTB 3H2YA 2OHGA 1EG2A 3COSA 3K09A 4X0EA 5KYVA 3PQ5A 5FPPA 1CVLA 2KMLA 4ZMSA 4UCVA 1BGVA 1YTLA 3W5BA 4PSCA 4QNNA 1S6YA 2Y69B 1Z0SA 1NKVA 2AQ8A 3Q3HA 3T4PA 3R0XA 4EJMA 2CC2A 4RD6A 2A86A 4BAUA 4HDRB 3IP5A 1NWCA 2XYHA 4IJVA 4KN9S 3WZ2A 1OBFO 1NJ8A 3OZXA 4X3PA 2VBIA 2FZKA 2NADA 2ZQMA 5ALSA 1GL6A 2BDEA 3VR5A 1TZKA 1QZ3A 1NJ2A 3T1QA 5KKNB 4J9ZB 1K8ZB 2QYTA 3TTXA 4YRMA 3GEGA 5C9ZA 4KYIB 4DIMA 3KD3A 4MW9A 1AUXA 2LKCA 1L4EA 1U6JA 3PP8A 2QUIA 4P3OA 3TNLA 5K8TA 4U7GA 1BXGA 4R7GA 1QHEA 2PRKA 1H6AA 2BEUB 5AK4A 1JDUA 1B06A 2FZVA 3P9SA 4Z0HO 4JVOA 3RSLA 1Q81W 1KKUA 3K9QO 3KKYA 3GMTA 3OW2U 1O95C 1SVNA 3FDFA 4PCAA 3EGWA 4YRFA 1KMMA 2GGSA 2IYFA 2XUJA 4N5HX 1Q22A 1ISJA 1UC4B 2HF7A 5AH0A 2W8BC 1I9GA 2JFPA 3HJTA 1ZD9A 5ELLA 2VYVD 3WYBA 4BIOA 2ITCC 1V7CA 5IYBO 2GZHA 2FKAA 4FHFA 5BT9A 4WLFA 5JSFA 2QVZX 3NJRA 1E5TA 3CH6A 4YRIA 4WK0B 1ZDMA 3EVAA 3RAGA 2RKBA 2JW5A 2WT9A 3V1MA 2CV0A 5DSXA 2PMBA 4OJNA 3WKCA 1BX1A 5B7NA 2O5RA 4LJSA 3HTXA 3L92A 1QP0A 1T8WA 2WKSA 4F5YA 1A50B 2AI3A 4P0PB 1QQCA 3THYB 1M1YE 1GH6A 4QX6A 2J3IA 2VH5R 1M2KA 4X7RA 4JGSA 3ZY2A 1G5HA 1AQYA 2P0AA 1RBYA 3EGCA 1H2NA 3K4HA 2P1ZA 3AU9A 4X6LA 5HWEA 2Z6QA 2Q6KA 5IDVA 4UNNA 1QBKC 2BOCC 4ZDWA 4E1VA 2GPNA 3OIFA 2JLZA 5FQNA 3AG4B 2DX7A 2L2QA 4MIOA 4NBSA 5C37A 1TNDA 4C29A 3SVLA 3IAXA 5JSZB 2ZIZA 4AQ7A 4OSPA 1VHQA 3AI1A 4ZZ0A 2GX6A 3K79A 4Q1FA 2I7VA 1UEIA 3O7WA 3ZWXA 4QKQA 4ZYLA 1NBME 5JEDA 4Q4JA 5FPQA 4HAMA 3VOAA 4G3XA 4CCWA 2UZ1A 1JFRA 3G1WA 1H5UA 3AR8A 3K92A 3VQVA 1OVGA 3L4BC 1S2LA 1NQ3A 1DQRA 4H7DA 3F9CA 5AI5A 5C3UA 4B83A 4YUAA 2IIVA 4Q01A 4HP8A 3ZD8A 2FDXA 2Y76A 4H6PA 4HSGA 2QSUA 2Z30A 1JE1A 2JFHA 2WUFA 5TVKA 3DB1A 4JHXA 1A76A 5JCOC 1NOKA 2G82A 3PQ8A 5D3KA 3FDZB 3IUSA 2AMYA 5AI0A 4YMHA 4F4LA 2O0LA 2ES4A 3FVTA 4C2BA 2XA2A 2UYHA 1ZXLA 3IQGX 2AC7A 5FPOA 3IIKA 1XDWA 3CW9A 2ZBRA 2OZBA 3JQEA 3DBIA 3IBFA 4Y6GB 1P84F 2A5FA 4NZ9A 1Z08A 1IM2A 3IVRA 1P4GA 1DT5A 1TPZA 1CIJA 2CNNA 1YTFB 4IEIA 1G7TA 4RZHA 4PYJA 1KI7A 4UULA 5LA6F 2XWSA 1KJ8A 4QGSA 4HXGA 2QRPA 1OJLA 3LLMA 1K7EB 4M46A 1MEOA 4PV7A 5H59A 2OB1A 2OHOA 5IDWA 5KYWB 2F43A 4QT4A 1PPJH 1FDRA 2XUZA 3PLRA 4PPFA 4H4CA 1SUIA 4WUVA 2KW5A 4BFWA 3GMDA 3ERNA 2QKCA 2NXNA 1ULSA 3WJPA 2XMQA 4HEHA 4EKDA 2FK7A 3O1LA 5U9CA 3WLTA 1D6MA 1NT2B 3FLBA 4JOQA 4CKZA 1OCCB 1S8OA 1W2HA 4TQFA 1WDTA 2YWGA 3L0CA 4HNGA 5J5VA 2C4VA 1ST3A 3HCFA 4BV2A 4UHBA 2MU1A 4UNQA 3O2JA 2EILC 2DLNA 3WS7A 4JZ2A 1SHUX 2QRNA 4QXOA 5B1YA 4DOMA 2CVOA 1EK5A 4F4HA 5AOAA 3DNPA 1EA7A 4DL9A 3C24A 1RRCA 2GAOA 2WJHA 3C3DA 5BQ5A 3UF0A 3PEVA 2VNKA 3DKVA 3L7OA 4BDSA 3RS0A 3W90A 1MB4A 1UDAA 2HF8A 4UAVA 1EEHA 1VHJA 1XJ5A 2NZWA 5BPFA 3NHAA 1KAQA 2XJ4A 3MG9A 1NBEA 5DNDA 4QGFA 3N2YA 5EA2A 1Q7YW 1CZUA 3O03A 3UYKA 5IDJA 1C3LA 1RJWA 1IXYA 4ZD6A 4U7HA 3HGTA 4JT8A 4CQMA 2BC9A 2NSJA 3UJ7A 3GLGE 2J0VA 2V7QG 2CXPA 5HFJA 3WGHA 1LQUA 2A7QA 4NPAA 4KPEC 3SC2A 3P9PA 1IUPA 4D5EA 1BQEA 1GNVA 2YEVB 2R6JA 3EW7A 1Z6AA 4YBRA 1LI4A 1WD5A 1G6HA 2PKRA 3QKSB 1BDMA 5CVUA 1ZIPA 1KFKB 3RT1A 3TLGA 2JVDA 1PL8A 3FB4A 4ZVQA 1KBOA 1PUJA 4XLZA 1OKKA 1QBZA 4S0ZA 4EUSA 5JWOA 1U7TA 3JQAA 5K0JA 3KQUA 4PDRA 4UNIA 2A58A 2EBFX 4OA8A 3NV7A 1FXKC 1MB2A 1RM5A 4UBIA 4LIPD 5BURA 2KG4A 3L06A 1EUDB 1H2GA 1CQWA 2HCRA 4LDPA 5G53C 2WAYA 4ZOEA 1U8FO 1IZ0A 2ZRDA 3B36A 1OLSA 5KHJA 4HEJA 1VKOA 5KOHA 2P9GA 3HZRA 5T7BA 5LBUA 2C5LA 2BEWA 1YQ9A 1KEVA 2DQSA 3CZRA 3D3EA 3EXIA 3CYQA 1X13A 2CBXA 2IY7A 3RRBA 1G9TA 2HX0A 2QLNA 4WE3A 3R9IA 2OCCC 2N1MA 3CUEF 4ND8B 4YR9A 4RULA 4HRAA 5LLDA 1SUBA 5JOQA 5IANA 4D9HA 3TRDA 2V8OA 1DAPA 3I4FA 1BC5A 1OLXB 1K88A 3FMPB 3GLUA 4ER3A 4EUFA 4OX9Y 2MK3A 2DG2A 2V03A 5GQSA 2PMPA 1L4NA 5HF9A 2MMGA 3AF0A 1Q0SA 1TO2E 3F5FA 4PINA 3TX2A 1U9IA 3UW3A 3ZJUA 4XJVA 5JXJA 1OLXA 2GXSA 3V33A 5JS1A 3VV3A 4M9ZA 1PK8A 1Z0JA 2Y1LA 3EG9A 3DEHA 3W9UA 1F0KA 1O08A 1ZNWA 1IFXA 3HFRA 4O4JF 2DUJA 2M6YA 2N75A 2VDQB 1WL8A 3H0CA 4L08A 4URZR 4W1PA 1Q0QA 1P9RA 1U8AA 3COWA 1OC4A 3HU3A 3KPWA 4WOKA 3TQCA 3NYWA 2OKCA 4BJ1A 2G1KA 3PEWA 1F4MA 1VPWA 1EZ4A 1RMYA 1DTSA 1T5LA 2Y9PB 2AFHE 3KJNA 4I9FA 1UBUS 5DYGA 4E5DA 1KI6B 2CNDA 3OICA 3TBFA 1FSZA 4U9IS 4TYNA 4PFJA 4CC5A 4QQNA 3I32A 1LS6A 2IYVA 1A2QA 1D2GA 1UFQA 3B6IA 1ZL8A 4N18A 4TLAA 2F3TA 3ENZA 4LQCA 5E1BA 4B6EA 1Y9DA 4DCOA 2CXUA 2PQMA 2TMKA 3DFIA 1EDZA 3OPQA 3S7TA 5F33A 1IBMO 3NP9A 3LECA 3TLBA 4DV4O 1E4OA 3S44A 3NH6A 4PFSA 4ESVA 4Y2XA 4BC1A 4O8ZA 4R7TA 3S81A 4PDVA 1AHHA 5AM5A 3T99A 3U2QA 3C5CA 4O4LF 5L6MB 2HQSA 4JJFA 3Q6MA 4BXOB 3JWEA 3LX6A 5ARCA 1BWQA 5JAUA 1E2PA 1ZUIA 2JGRA 1VP7A 3AKCA 3N59A 3P9IA 3NHLA 1VZ2A 1H6BA 3T3NA 4PHCA 2I3DA 2VFAA 1U28C 2HBQA 4P7FA 5K0ZA 4Q9IA 1ZRMA 2A4KA 5CM9C 1QIKA 1QB8A 2J30A 3DJFA 3PFKA 1NU6A 5GVSA 2PG3A 2WLIB 5JALA 4D9BA 1L5OA 4WZBB 4AZWA 4IF6A 1MO5A 4RK4A 4D96A 3Q88A 5FI3A 4GE0A 4H60A 1XMOB 2PI5A 2LBTA 3ZJVA 1DPFA 1CR4A 4UOQA 3MVEA 3CCMF 2IOHA 4JD5A 2Q7DA 1IU9A 3AG2C 3E9DA 3I3SR 1XPJA 4MUHA 3ZY4A 3ZWPA 4AP9A 1JPNA 3L6UA 5LOVA 4DFDA 1IWPB 3TAXA 3ZD6A 4TT3D 1XQWA 1VQ9F 2YYYA 4JBGA 2Z8ZA 4QYSA 4R2LA 1QAMA 3JD3A 4TUYF 3U26A 3V7YA 1A8QA 2W6IA 2NU7B 3LDCA 2XNCA 2GZDA 2SKCA 3AP3A 1NAIA 4G26A 5C80A 3EIXA 1IURA 3MS4A 4QDTA 5D3ZA 3KJJA 3ZDCA 1ECCA 1Y6RA 2BZSA 4X7BA 2XMRA 3I55V 2CDAA 4IFBA 2UZ3A 5FULA 5BSUA 5JZVA 2PMWB 3EXFA 3FNIA 4LI0A 2XZDA 4FDAA 4YXWA 2YDEA 1PNVA 4HX5A 1VQ4V 3IEWA 2AXEA 4TS1A 1KI9A 3D0KA 5ICFA 4KQ6A 1PJAA 1J2EA 2PGJA 2V7BA 3CCCA 3BD6A 5DHRA 1B1AA 1JR4A 1RPAA 5EERA 4MRNA 1C7ZA 4YJ2B 4FYJA 1EFPA 2DTXA 1NYLA 4R3UC 3VH2A 1C0EA 4CU2A 5JPCA 3UB3A 2L18A 3F67A 3O82A 2Q1WA 1N7IA 3KXPA 4GHWA 2NOAA 4QJ5A 3RSQA 3TSWA 1UDBA 2WLKA 3WYGA 2JFZA 3W4JA 4C4XA 1KJQA 1USKA 4J7CA 1CQZA 3DV9A 4AS2A 5BNIA 1LDBA 2ID8A 4RELA 3NIFB 4UHCA 3SQLA 3A2NA 4HQ0A 3U1VA 3AG2B 5ALNA 3TMYA 2O8FB 2ZM6B 2ZDIA 3OZAA 4IGEA 3REQB 1WPBA 1JHMA 2BCEA 2YJ5A 1FRQA 2O2SA 2H2FA 4DV7O 1V41E 1Z2OX 2ZJFA 3A31A 1P77A 3EZXA 3KAKA 3KCYA 4L8FA 4NI5A 5GGXA 3B5JA 1S3GA 4CS3A 4PSDA 3I9LA 2CJYA 4MH0R 3REQA 1ES9A 4M6WA 3C4QA 5B64A 5LHHA 3TLEA 3UWMA 4DEVA 5DXAA 2CHVA 2GZMA 4Q7KA 1WS6A 3ZN0A 2LE0A 1R73A 4HNSA 1HNXB 1T3SA 4J2OA 4DC1A 3MLAA 1G7CA 3I5YA 1MRNA 1QNFA 3P10A 3C7AA 5BVGB 1C3EA 1E2FA 2JFUA 3S1LA 2HKOA 3ABOB 3LXRA 1PWXA 5TQ0B 1KTIA 3LPDA 4KQJA 4CM4A 3PHLA 2O0JA 3OIVA 2MYTA 5CVDA 4EW6A 2QJOA 4NQ3A 3G1UA 1UJMA 4LSMA 3VGPA 3AEQA 2OYQA 2WIDA 1YDWA 3ISJA 4MGZR 4PR3A 3V34A 3SEZA 3A4MA 1RADA 4DQUA 9LDTA 4MQEB 2F4NA 5H4HA 1I2DA 1Z5GA 5E9WA 2NVWA 3FD6A 3JYOA 4CL8A 3SS8A 1KMQA 5EEHA 4KXUA 4EVSA 3BXGA 1B6GA 3CLTD 1DUSA 1NW5A 2CGNA 2PUVA 2IUYA 3UPDA 3B3FA 1JBKA 1TCVA 4J76A 3VKUA 5CFNA 4KHPB 5LKAA 1OJ7A 1NF3A 1E7YA 4QPZA 1IN8A 4ENPA 1Q44A 2FWAA 3PTZA 4IP0A 1FXKB 5C4GB 3C85A 1FVXA 5I8PA 4Q4HB 4E2XA 3H2SA 1QHTA 2V7VA 1P5RA 3A1UA 4KKXB 2VXYA 3UJ9A 1TYZA 4WJZA 1N7GA 3B6KA 1FQWA 1WPXA 1NG1A 1SZCA 2BHRA 3BEOA 3N58A 2J3JA 2WJPA 3GMIA 4QVKA 2WB2A 2WYHA 4JR2A 3ESQA 1R8JA 1YBFA 1V7PC 4HH4A 3IPAA 2GM4A 3DDCA 3ZNNA 1SQXH 1PF5A 1I13A 1UODA 3JALA 1WW3A 1SGWA 1EIZA 1ONOA 2IEAA 2VQSA 3N39C 1G19A 3UMFA 1XNGA 3A1FA 3VZPA 3CCSV 1M2JA 4F2WA 1Y66A 2C8KA 1SU8A 3VAYA 4FB5A 2ZLBA 1ENVA 3S3WA 3GUYA 5F35A 4N01A 3HKBA 4X24A 5DX8A 4TL9A 4Z9XA 3EFFK 3WE7A 2D0IA 4DTIA 1N6KA 4HUQB 5DI9A 3TRJA 5ITZA 2HXSA 3NHZA 1GPBA 2ZB2A 2I2FA 4DJEC 5A9GA 1LX6A 4FGJA 4C7VA 2OHWA 3AERA 3JQGB 1E63A 5FEUA 1JG6A 1Z35A 2ZKLA 2ZVQX 1I3CA 1M6VB 2O5VA 2QJTA 2BFMA 5AI9A 3UFXA 4M55A 1ADGA 1JEJA 1TFRA 5B4UA 1RM1B 1JTFA 3I9NA 1PL7A 3WFIA 4AL4A 1C8VB 1OAKA 1OU4A 4B3BA 2AHZA 3OMIB 2HMVA 1FW6A 4H7HA 1SK8A 1W40A 2X58A 4C87A 4ZEMA 1CT9A 1ZX3A 1O9BA 3LYBA 2QG9A 2WMDA 4IWNA 4KIJA 4MQ4A 4NONA 4RKRA 1IULA 2WPDD 1XLWA 3A6GA 1CLEA 3CXCF 4NDZA 1FXVA 1IOZA 2R9RB 1RAIA 1AOXA 1JFLA 1ODTC 1ZM2A 3AU8A 4L0QA 3JVVA 3ADCA 1G59A 4YUYA 3QYPA 2JIZD 2ZUWA 4DADA 3C3TA 1OE0A 1YJAA 3PIRA 3ZDFA 4YHBA 5KTTA 4HB2A 1WA8A 1RWVA 4LBVA 5JEEA 1VQ8V 2H7VA 4MQMA 3ROMA 5B58T 5H3HA 3HP4A 5JUWA 4UDXX 3RVNA 3E22B 3CZMA 1A0OA 1J70A 1W0JG 2AJTA 3BS4A 2XZOA 1K86A 1GNSA 4BMXA 4DLZA 2CJWB 2C2WA 2IVFA 2R86A 4OV6B 1AV7A 3I2FA 3AJEA 1TQDA 5DSZA 5TPZA 1XYYA 3R75A 3T4XA 1G3IA 3RRZA 3CXUA 2DT4A 2RHHA 2NQ2C 1P2GA 1UJ5A 1OGIA 2PBLA 3HB0A 4TWIA 2BGGA 4NUTA 5IJ9A 1NP7A 4CG3A 4LFAB 1GPYA 1GXSA 2I7CA 5KEIA 5IASA 3BMOB 4Q3DA 4JZKA 3ZTYA 4NULA 4U7DA 2HF9A 2H0RA 2YUAA 1U31A 3Q41A 4ACAA 1W76A 2FY8A 1GQFA 2GA8A 1STOA 1QTNA 2QT0A 3OKAA 4P2BA 1SBNE 1NUAA 4TN5A 1T3ZA 5DKFA 4AJPA 5CH3A 4WJKB 4KP4A 5KA5A 1HY3A 3GVIA 1U8ZA 1YJXA 2IY9A 4PNHA 1E59A 2DZDA 2CXRA 2UZIR 1RP3B 3PFWO 4PHHA 2HR1A 1NVAA 4O2RA 4ETIA 1UM8A 4TYYA 3DZKA 5EJ5A 2DBQA 2EZPA 1LPBB 1X1CA 3DAFA 1RRFA 4XGQA 4D3DA 3S3XA 2XSZA 2O7VA 1EWVA 3QV1A 3I9KA 1U9IC 2IU6A 1X52A 4KCGA 4U02A 1FMCA 1BGXT 2ZRGA 3EEBA 1CJVC 4JT4A 5HDBB 5KTPA 1D2EA 1R64A 1SCIA 1ZNZA 2GDZA 2ROQA 2WZQA 5LQDA 5EP2A 4BGDA 3FCOA 4X8HA 3SC2B 2XA9A 3HNRA 1VIAA 2L42A 2EARA 1EBOA 3CG4A 4AM8A 1O94A 3KJZA 1H85A 4BMYA 1EBFA 3C3XA 1G42A 3D6HA 2LCAA 4OL0A 4L6CA 4TKMA 4E11A 4RTQA 4RZQA 4LNUB 3HLYA 4M9QA 1OCZC 2EINB 3CC4F 1QHNA 1VI2A 2NU9A 3EF0A 3K1AB 3ZWQA 4A7PA 5G0WA 3FCXA 1YS4A 1UK9A 3GT7A 1RC1A 1LR1A 3Q9SA 3WIOA 1Y5LA 2P1RA 3PC3A 4YRPA 4NXMO 3ENVA 2M98A 3AXTA 4D42A 2OPBA 2P0YA 4QARA 4KRYA 5ILOA 3VKGA 2ASVA 4DIEA 1LQTA 1P2UA 3ZOZA 1F0PA 4EGQA 4EA7A 1K97A 1MLDA 4I81A 2Q69A 4YB8A 3BAFA 1FFWA 5DW0A 1ZSPA 2L35A 4PBSA 4EA9A 4YUZA 2ONYA 2X8AA 3A1EA 3DDWA 3LSYA 1QP8A 2YIBA 2XKBA 4BT6A 2OK8A 4RMIA 1YJ9V 3Q7PA 5J4HA 5JNRA 1EM8A 4OLFA 3AF6A 3JD1A 1YK1A 3V1UA 1IJBA 3CGWA 4YXWD 2J09A 4CMIA 4D9NA 1FNCA 3LLCA 1PVOA 2HCTA 3EZ2A 1E1RA 1XTJA 4LBYA 3A9CA 2YRFA 4J0IA 5J59A 4R0NA 4NBVA 3PENA 4WQMA 3TIFA 3AUUA 2BR3A 4HEQA 3T34A 4WZBE 4A0HA 4PZUA 4I55B 3RC2A 3FZGA 1N8RW 3JQFA 3I2KA 3L0BA 3V9PA 2X7RB 4KE9A 3CJHA 5I7SA 1IJEA 1E2KA 4KL8S 2HEPA 5CB4A 2AW9A 1QANA 3EF3A 4C6TA 1N1GA 5IABA 4YJ3B 2R96A 4DR2B 1UBMS 3GJXC 2AXTZ 2EFHB 3W4KA 4B80A 3NAZA 5JZSA 3OIGA 4CLDA 3HBNA 4LZAA 3S0JA 5K8JB 1DFIA 2H51A 1AQIA 3VIUA 1E4YA 2ZRJA 1U1CA 1UXJA 2QZ4A 3CHYA 3OZUA 3FM9A 4KJXA 3LS2A 4B74A 3ZRXA 1C8KA 1KJIA 2GN1A 4YJDA 1G8GA 1OPRA 3K5HA 5GINC 3WI7A 4K6KA 5J9PC 1DO2A 3CNQS 2ZPAA 3OX3A 4P53A 1NZDA 1XPRA 3K6JA 1U3FA 2YFKA 2A14A 2Z57A 4TV9F 4D6YA 1P4SA 4LJ8A 1JL3A 4BGUA 3KYBA 1IVYA 3I30X 2I6SA 3UKMA 3QELB 2D06A 4BLWA 3B8NA 2YNMC 2WUVA 2NN4A 3DZFA 1BQ0A 4JLKA 3UJBA 1EWTA 1E7QA 2OA0A 4PAOA 2QE7D 5DM6V 1CE8A 1K6XA 4IEFB 3IXQA 4IY1A 3OFVA 3TAHA 1R6DA 5EMLA 2BYTA 2IDJA 1DXOA 1EHIA 2DYKA 1TVKB 2VAWA 1MZVA 3K14A 3FVRA 1U0SY 5WRFA 2EFJA 4RVGA 5HIJA 4HGZA 1TD9A 2GPYA 4O08A 3JRXA 5BUSA 2IU4A 4IRUB 4L7QA 3SSAA 3X1MA 3BKWA 1UM9A 3S2GA 4XWOA 4C4PA 4A2WA 1EFPB 1TM3E 4TLLB 4B3DA 2CK3A 3AW9A 3RYIA 3LKBA 1OYVA 4JFAA 4UFNA 5HF5A 1WXWA 1Z29A 2E0IA 1PWYE 3TUJC 5HDQA 3RS7A 2QP3A 2DYYA 2QL9A 3DT9A 3FLEA 1VZ3A 3JTEA 5E6RB 5IAEA 1D2RA 3EMBA 1NNUA 2PQ0A 3ETDA 1YCFA 2OL4A 1JA1A 4IR7A 5EINA 3ZMVA 3PS9A 2I6QA 4AROA 4DCJA 3AK3A 1P39A 4N5IX 1RYZA 3GHYA 2PM8A 1GOTA 4WZ6A 3MBIA 4WOBA 4BNFA 5B1SA 3D4LA 5FAKA 4N49A 1LF0A 3ZJZA 3MMXA 3PGA1 1PZHA 2BW0A 1HO3A 4EGFA 1M2HA 4NCJA 5BVHA 1L5WA 4HKTA 1V8FA 3IX7A 2X2FA 5EMNA 4B2PA 1F2UA 2YIMA 1Q7YH 3L6RA 4HDSB 1CNFA 1VOTA 4OYLA 3TR0A 5C1DA 5KNDA 4EUHA 1ISPA 1BXGB 2M6SA 4POAA 1COWD 2EILB 1IDSA 1RD4A 1J5EO 1U2DA 2HMYB 4WT7A 3AFIA 5JJEB 1JX9A 1MG5A 3Q1LA 3VFDA 4AJ4A 4OQMA 4C4SA 4DTCA 3MGGA 2O8FA 4HC4A 1NSTA 2G4VA 5KDDA 5H8WA 4MSWC 1RPNA 4EB6A 2FTKE 2ZWAA 3GLHE 5GOTA 3TNFA 2X41A 3ROQA 3OD4A 4FVMA 1S8NA 1EZVH 1PNKA 3K58A 1YIJV 1T5DX 4L5JA 2B78A 4A10A 2RGWA 4PIMA 1JVMA 1KZ9A 2A84A 1KE1A 2WQ7A 3T5AA 2J3KA 1UBKS 4FMPA 4NPCA 5ALWA 4N82A 4F5WA 4F11A 1Y42X 1JLMA 2UYQA 3D8BA 4ZOQI 2VHYA 4IHJF 5J9FA 4BO2A 1XJCA 3K2IA 3VOSA 3N9IA 3BWDD 2NPOA 2R1TA 1OC2A 1R4MA 2Q2NA 2MSCB 1I4LD 1AJNA 3AF3A 4YREA 3LY8A 1Q3EA 2GI4A 4P9OA 2H9IA 5CUQA 4DARA 2Q7OE 1PT5A 2HQSC 3E9ZA 5LU9A 3LCUA 3M9LA 4QGBA 4QA9A 1HFJA 3UWPA 2UYPA 1LLQA 2EGHA 1GO3F 2WFLA 3Q3JB 4X94A 3ISTA 3SR3A 2WLHA 2FU5C 5LM3A 3RTDA 1JBEA 3JZIA 4WXEA 3QFHA 2QW1A 2PMKA 2PMEA 1EK1A 4K2HA 1Z4PX 3PVSA 1O96A 4NXNB 5JC1A 4KG7A 1DJMA 2AKAB 5KZMB 3BX1A 4NE9A 1NAHA 3QNMA 2AJBA 2B6HA 1JD1A 3U13A 1V5EA 5EWMB 1QU7A 4JAUA 2COKA 3ZMSA 1OX6A 4OMDA 4UM5A 4I3HA 4YJ2F 3IKLA 5BYAA 1YB6A 3VBCA 3NM5A 4Y3UA 4MR7B 1NMSA 1AI4A 3H4VA 5F1OA 2KS6A 4W4KA 3UUEA 4ENWA 4D0SA 5HP7A 1JEOA 2P4KA 3DOEA 4IBOA 4DY4A 3PGXA 3K08A 3G2JA 1JXAA 3HJBA 1KAHA 5EWJB 4F7WA 2EX1A 4L07A 1VJ0A 2AUNA 2DYSB 1GXSB 5FI5A 2SECE 2GFIA 3QPBA 4D4KA 4HY3A 2X4IA 2IQIA 4G1CA 2IPMA 5BMVF 1FDTA 1T9CA 3AC0A 4OSEA 3SSMA 4DQVA 1TRKA 1XCBA 2FMIA 3IV9A 3DBLB 4RIHA 4UBJA 3SLKA 1NW8A 2O8BB 3W7AA 1ESEA 2HTFA 4WZAB 1BYIA 2BDTA 3I3FA 1JYEA 1PI3A 2V1DA 3ZMZA 2EP7A 3LUJA 3O26A 1JIJA 3DPUA 3P19A 5FA5A 4HAUA 1FEZA 3KYCA 1B42A 2A0XA 5HIAA 2A8YA 2HADA 4REOA 3G49A 2A0LA 1F51A 4O4JA 2ID7A 3NOOA 4BMVA 3NCTA 1M2VA 1AG9A 4KR9A 3GJ8A 1BCRB 2QI9F 3ABLC 5BUCA 2PXXA 3TLGB 1XQXA 1TJNA 2REQB 3CRRA 1QHHA 1YUMA 3H1TA 3DVQX 5JVDA 4BFYA 5AESA 3A14A 3GYBA 5DF1A 2WG1A 1M0SA 3LA8A 1U9JA 2WM2A 4KQMA 5CTAA 3TB4A 4XIYA 1K3TA 1JIVA 1XEAA 1XMOO 1RZVA 2J1LA 4JQOA 1ZEJA 2OCKA 1OIVA 1B0PA 1VJRA 3O4HA 1C4WA 3PJGA 5CIQA 1U2TA 4ICGA 5ILGA 4UV9A 1UJ2A 1NI8A 2GM3A 1AKYA 3ESYA 3F9IA 1YULA 2QTGA 4I3FA 3EWIA 4DBLE 3UOAB 3IL2A 4F2PA 1MQ9A 5LP6F 3NDJA 4QOFA 2X7XA 4PG8A 4J0CA 2PU7A 4ND8A 3OQ1A 2QV7A 1XQVA 4L2IB 3HZZA 2CF5A 4BE9A 1T2CA 1SCKA 5BY2A 1IUOA 3CRMA 2ITDC 2PWYA 1XDDA 5FWXA 5C4MA 9ATCA 3ODGA 4Q82A 3IMPA 3CVYA 2VVTA 2C78A 3I04A 1PNLA 7AT1A 5IC4A 2C2OA 2WF5A 4TV8F 4M99A 1Z8NA 2HBZA 2XMDA 4N3AA 2YHSA 4WIAA 4B3RO 3KELA 1EFLA 5DM4A 5H6RA 1CG6A 4XD2A 2EZUA 2PDAA 2GRUA 2YHIB 2W71A 1IB6A 1IBMB 1PGNA 4JI6O 4DNOA 2AHYA 4JKYA 3CRW1 1KH2A 3PNPA 5IT0A 4DXDA 1RHKA 5DHAA 4BNDA 3JQAB 4CMEA 1H3NA 4UUPA 3Q2OA 4C05A 1GARA 3OE7A 3EPHA 2IT1A 1KQSU 4Y2HA 4E08A 1NV8A 1XNQB 4MK4A 5DTIA 3WLEA 4BKUA 1BVHA 4I7ZB 1U7ZA 2JLXA 3DW3X 1QLJA 1NNSA 2ZB4A 1RYEA 3CR7A 2ZKOA 1P45A 2NX2A 2Y1WA 4ABYA 2CD7A 3Q8LA 3ZNQA 3ANLA 3C3CA 4V0MA 3MCUA 5L7WA 4YCBA 3ZZ1A 4EECA 1Q43A 4DDUA 5J2TB 4G25A 4XDZA 3BORA 2G9QA 1IC6A 3UAGA 2YC0A 4LY9A 1G7SA 1Z39A 1KGDA 1Z6YA 2FFBA 4BFUA 5LPNA 3ZI7A 3W4IA 3N2LA 4IYIA 3FWZA 1U0LA 1Z3CA 2JIOA 4NENA 2VHQA 5KIAA 1RZUA 3EA4A 1C9MA 1C2TA 1SU4A 2X0EA 1J00A 2BMAA 1XROA 5CVEA 1EFTA 4E6EA 3ZE9A 1HPLA 2F2TA 2OV4A 1TQHA 3VKHA 2C7PA 4BCDA 1F6BA 1GNQA 1GR1A 1SB9A 2FW9A 1Y3HA 2E5LO 3KNZA 3HABA 5FD8A 1SQ6A 2HA4A 3UWDA 3QU2A 4RUFA 2XMBA 3GWGA 5TF4A 1U2RA 4GMXA 1P5JA 4FM1A 1Q1GA 1C50A 1L1RA 3IAEA 4KLZA 4WOPA 3ZBPA 7ABPA 3DBVO 4LW8A 1DDIA 1CUVA 2F00A 5AI8A 5T4EA 3MWEA 2GD1O 1N5OX 5LNK6 3ICEA 3BJMA 3Q1KA 1I14A 2NU8A 1NULA 2ACWA 1MGOA 3BSYA 3DKKA 3WK8A 4WFQA 5F4BA 1XVAA 4NNOA 5ES3A 4PY2A 5IT5A 1EXDA 3VR2D 1U63A 3F5SA 5DIFA 4DLTA 1Q84A 3G9XA 3H9GA 1OBOA 2H1SA 4UU7A 3PG5A 1MNGA 4KV9A 5A6SA 5KINB 1SXQA 3BBPA 3FCYA 4OD0A 2EKQA 1QLEB 3SX0A 4RPIA 2WU0A 3AHCA 5SYAA 5IXJA 4EEZA 4IGAA 3H11B 4YI3A 3WK9A 4NEHB 4GKAA 3GN2A 4RZ3A 4CL3A 2BGRA 4D8VA 3ZIAD 2XWJI 5LDDC 2FSFA 2NP6A 1N2JA 1QKIA 3FRIA 4I66A 4L3OA 1V54B 4R40B 1W73A 2HA6A 2JRCA 2WVHA 3L73H 3BE6A 3DO6A 2VHXA 3C9UA 2IBMA 4J94A 4EZBA 3ZH2A 2RAPA 4N0PA 4CNQA 4YTEA 4ZGWA 2F1MA 2XGJA 3GLHB 2AFVA 3K4QA 4NCKA 5HW0A 1XNRO 2PJUA 5FBVB 3RKUA 1C2YA 1I8TA 5CJJA 2OB2A 4NICA 4JC5A 3EDMA 2EP5A 4JU9A 4CMAA 1J49A 2EBOA 3BF8A 1MA0A 3U7GA 3QO5A 3K1TA 1J1IA 3BN3A 5E4YA 4DA9A 2C2YA 4YEDA 3VNVA 3VX4A 4F21A 1NJFA 2W4IA 1VXRA 4I6GA 2PH5A 4LCKA 3E5HA 1I5YA 2BFEA 2CL5A 3P9RA 5BR4A 2O2CA 1RPZA 1FAFA 1SKAA 1TB4A 2KI5A 2QNBA 3C43A 3IV6A 3KSMA 3KYDA 1QNLA 3FAVB 3EZ6A 4C8EA 4GE3A 3UM7A 1FTWA 2BSAA 5GV7A 4CV3A 1KYQA 4RNDB 4U63A 4C30A 4E14A 4F91B 2REOA 5EUBA 3SPJA 1TEVA 3TIGA 2QS9A 4Z4HA 4EELA 2AFIB 2DT5A 1JIKA 1V47A 3HDVA 3PRKE 3BIJA 4Y30A 3U44A 1M1NB 4JYAO 1E0JA 1W36D 3EIFA 2HNBA 4FM9A 4A5OA 5K5EA 4EDFA 5KQPA 4EKWA 1F20A 1K75A 2XDQB 8ATCA 1DX4A 3BDVA 1L4BA 1OCEA 2RKOA 1ARZA 4HDAA 5G02A 4K6MA 4FPXA 2Y4OA 2Z4SA 1QU2A 4HMPA 2C9BA 4PELA 5AK5A 2I4TA 3U0VA 5HJEA 5KNCH 5IHXA 5REQB 2HXGA 2NZJA 3DWGA 3ZG6A 2YXPX 4TS4A 4ZP1A 5IXYA 3ZKWB 3EGDA 2IDKA 1ZJJA 3WGYA 3Q87B 3GEDA 4C0XA 4UCQA 3DNFA 4B62A 2Q1SA 3UCSC 2YZGA 3D3KA 1ECGA 4CTNA 2LBWA 2XUMA 5FJIA 4QG7A 3SS7X 5IVPA 2NQTA 2ZE7A 1M2OB 2VEDA 3GCGA 3DF9A 4EHKA 1YS1X 4MQLA 1SKMA 1K9VF 1S7GA 2QJRA 3WYCA 2ZAOA 2ZSKA 4JLSA 3GPDG 5A04A 5EY5B 3IURA 2UAGA 1X42A 2XCRB 3PDWA 2XCOA 5EP3A 1YS9A 5EMJA 1N92A 4A8JB 3LCVB 4ND4A 4EUNA 3B7PA 1F6WA 2AF3C 5TPWA 5LQCA 2O05A 2XV1A 2B30A 1C9NA 3DUFB 2YV5A 3OTIA 3QVMA 4QTZA 5IEJA 4NFHA 4ASUD 5KWEA 3NAMA 1NM5C 4MVWA 2JVKA 1J99A 2GASA 4K0RA 4Y98A 3BIFA 3HDQA 3M1LA 4EJ0A 1YRYE 4ARIA 2H48A 4LRYA 1X9HA 4TMVA 4B3XA 1BIFA 1RHUA 2G67A 2A9OA 4XXHA 1M1KH