5JVDB

Tubulin-tub092 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
429
structure length
425
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Antivascular and antitumor properties of the tubulin-binding chalcone TUB091.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 167
structure length 425
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jvdB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5jvdB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5jvdB01
4YJ3A 3JAKB 3RYFB 1W59A 4TUYB 3JAWB 2RHOA 5LYJB 1W581 5JQGB 5LA6B 4O4JA 4EI7A 5J2TA 4LNUB 4U3JB 5IJ0A 4TV8A 5CB4B 2XKAA 3HKCA 4I50A 5IYZA 5ITZB 3ZBQA 3RYCB 4EB6A 3JARA 5KX5B 4O4HB 3N2GB 5FNVA 4ZOLB 3CB2A 4FFBB 4IIJA 3VO8A 5BMVA 3HKDA 4HNAB 4O4LB 1Z5WA 1W5FA 3JASA 2GVIA 1FFXB 5EIBD 5JCOC 1OFUA 1RQ2A 1TUBB 4F6RB 5CA1A 3WGNA 5EYPB 5C8YA 2RHHA 3VPAA 3UT5A 5GONA 5KMGA 2R751 3HKBB 2BTQB 5JVDB 5LP6B 2R6R1 4YJ2B 3VOBA 4O2AA 4ZHQA 4U39A 5JH7B 4E6EA 5JCOA 4X1KB 4I55B 2VXYA 3RYIB 3WGKA 3WGLA 1JFFA 3HKEB 4TV9B 2RHJA 3N2KB 3HKCB 4I50B 4WBNB 4EI8A 1Z5VA 5MN6A 3ZIDA 5EZYB 4X20B 4I4TA 4EB6B 4ZI7B 5LOVA 3RYHA 4KWEA 3JATA 5M7EA 4O4IB 4O2BB 5BMVB 2RHLA 5IJ9A 4B46A 4IHJB 1SA0A 5CA0A 5CB4A 3R4VA 5J2UA 2VAPA 3JAKA 1TVKB 4X1IB 3RYFA 3V3TA 3JALB 3JAWA 4TUYA 3E22B 5LYJA 1FSZA 2Q1XA 5JQGA 5LA6A 4DRXB 4YJ3B 4LNUA 4U3JA 3C8LA 3WGMA 5EIBC 4M8IA 3M89A 1W5BA 5MN5A 5ITZA 4O4JB 3RYCA 5J2TB 5KX5A 4O4HA 5IJ0B 3N2GA 4TV8B 3VOAA 3WGJA 4ZOLA 4FFBA 5IYZB 5LP6C 2VAWA 4DXDA 5LOVB 4B45A 3JARB 4HNAA 2VAMA 4O4LA 1FFXA 5FNVB 1RLUA 1TUBA 4F6RA 4IIJB 5LXTA 2XKBA 3HKDB 5EYPA 3JASB 5CA1B 3HKBA 2BTQA 4X1YA 5JVDA 5LP6A 4YJ2A 5C8YB 3M8KA 3UT5B 5JH7A 5GONB 5KMGB 3RB8A 5MN4A 3VO9A 2BTOA 4I55A 4X1KA 3RYIA 1W5EA 3ZBPA 2Q1YA 3HKEA 4O2AB 4TV9A 4ZHQB 1RQ7A 3N2KA 4WBNA 5EZYA 4X20A 4ZI7A 1JFFB 4XCQA 4O4IA 4O2BA 4I4TB 4EI9A 4IHJA 3RYHB 1W5AA 3JATB 5LXTB 5IJ9B 1TVKA 1SA0B 4X1IA 5CA0B 3JALA 3E22A 4X1YB 4DRXA 5J2UB
chains in the Genus database with same CATH superfamily
3E2PA 1Z83A 1GUZA 2GF9A 1NX6A 2OKGA 3EWNA 4ZQCB 4OQZA 2JRIA 3CYQA 1JN0A 1GDHA 1YJCA 5CU7A 1P6QA 4GRIA 1GPJA 1MMFB 4JLJA 5LLSA 3CV3A 1U0JA 4Y0NA 2YFKA 1N3IA 3LCMA 3G5UA 2CH7A 4HGNA 5TMBA 2PT6A 4O4LF 3DBOB 3OFNA 4TYMA 1UBCA 4D57A 4KXUA 3L7LA 1NUQA 2WLKA 1E8DA 3ABIA 4DY6A 2QWOB 3MT9A 4KB5A 4E5VA 3HI6A 1UIRA 1TXGA 2YI8A 1XV2A 3S2YA 1NZJA 1RBQA 1VI2A 2PZAA 3F5QA 2BKVA 4BVRA 1XTUA 1EVQA 3JTMA 3KT6A 1PL8A 1JLHA 1EYZA 3A2MA 3O1JC 3QVSA 4BNFA 4XIYA 4LYEA 3KWFA 3NORA 3LWZA 3MFQA 4X1YB 2AJDA 5F7ZA 2YVLA 4LOLA 1U3LA 4WVFA 3TAUA 2HJWA 1TCBA 2AUMA 3TX2A 3CMCO 2DOKA 4M1KA 3W34A 3ZV5A 4OPHA 1S3IA 3L9WA 2ISQA 3WRXC 1SOAA 4UATA 3UJPA 5I7RA 1IBCA 4FLYA 1P33A 4QFBA 3VX3A 3F8WA 2GTHA 3ETJA 2XRYA 3JVEA 3ZEIA 1CQZA 3DZFA 3QKSA 2QB5A 3RKRA 4GZLA 2J5XA 4JSRA 1X25A 3VQXA 4H33A 4BAYA 3AJ8A 3M1YA 5EP4A 1VDMA 1ZLYA 2CC2A 1EZ1A 2Q0XA 4BZQA 2FX3A 5BW6B 3TCNA 2NVBA 3GI1A 1S0VA 1UDWA 1UBNA 5GW7A 4YRDA 3ETQA 4RWUA 3OTFA 1E7KA 3PC7A 3BOSA 3T5MA 4XM0A 2VGNA 5FTLA 1Q1ZA 1R8YA 2DBRA 3BMXA 4UEKA 4ABYA 4CKEA 1YA8A 2DQ3A 4HQFA 2AV6A 1UJMA 2ORYA 1G4YB 5HOQA 2J9GA 1NSYA 2YJNA 1L7OA 4KR2A 2PD4A 4PHCA 1PSZA 2F43G 1XJWA 5HVNA 4JAAA 1S77D 1FP1D 5JXIA 4LZWA 2GUZB 3QEBZ 4PICA 2HN9A 4HX9A 4JN6B 2F95B 4WBSA 1JDJA 3MAJA 1L8OA 1QRAA 3RT3C 3PEWA 1JVBA 1VPTA 1VG9B 3MHTA 4B2YA 5C1OA 4OM7A 4HOYA 3UW1A 1H2EA 3A1VA 2LBTA 5JCJD 4C21A 3K70C 2WW8A 3OSZA 1R6DA 4LDAA 3LQKA 4ENVA 1P2GA 1XL6A 1W0JD 3UUWA 2CLEB 4LHEA 2F3TA 4LVOA 1XMJA 4K6CA 3DZHA 3ELUA 2PV7A 3V4VB 2B1JA 4MEJA 5B1YA 2A5YB 5B1SA 4GVXA 2H18A 1O54A 5FBKA 1GCOA 1H2FA 1DGSA 4ETIA 4CDNA 5CK5A 3UV6A 5IG2A 3J81A 5L9AA 4NHEA 4B4OA 5FPRA 2L6LA 2BFMA 2WVGA 3A32A 4UZSA 2B2NA 4B6QA 3O8OB 4G5SA 4V38A 3TJMA 1OROA 2YOFA 3BT7A 2J0VA 2ONZA 4MKRA 4MGIR 3B1KA 4RVGA 3JQEA 2Q4RA 3NVKI 4L28A 3U5ZB 4QT4A 2QRKA 1L5SA 4K40A 1H2KA 4AMBA 3A9SA 4OQ4A 3E8SA 1DKNA 1JHVA 2NQTA 4CMHA 1EWRA 2LBPA 4V3BA 4LR3A 2RCVA 3EHEA 1NVFA 4PPQA 3K9FC 5DGXA 5I5GA 2E49A 2GTPA 4D46A 1Q7TA 2H4JA 1P4AA 4DT1A 1WA8A 3VU9A 2OTJF 5H82A 3MGCA 4PLYA 2VNIA 3P9YA 1L4YA 4JC0A 4WFBV 3F3MA 3E7FA 3PRKE 3VDQA 1ZL2A 5B6PA 3ONVA 3TR5A 2WT9A 4OUKX 2WK1A 2I65A 5CTJA 4H7KA 4ILEA 1YA6A 4KFRA 1JIKA 2WHEA 2CVFA 1B8NA 4FFBB 3IDZA 3U37A 4TKLA 1P9WA 4N0EA 5CA0F 1M34E 3DQPA 4GRDA 5J63A 1NBHA 3FZQA 1RI4A 2XVXA 1KQOA 1MU0A 2OYRA 1PD1A 5CX4A 4DLPA 1X70A 2IHVA 4UPEA 3F5DA 1Q81W 5DPMA 3AM4A 1JEYB 2JGJA 5BWBA 4LXXA 4A8JC 3WXMA 5JAQA 2G9QA 4Q93A 4LMPA 1E20A 1V7PC 3NS7A 2LFRA 4MR7A 1X7OA 4FYHA 3MRXA 1WVGA 5LU8A 4FC6A 5D00A 2V4ZA 3AVUA 2FSVC 2YQZA 5BN3B 1BDIA 4X89A 1DTWA 1E2UA 2CGOA 3ZRWB 4I55A 2Z5LA 2AR0A 4BLSA 4M2LA 1B42A 1UBGA 1ZAKA 4MS4A 1OX4A 2LCFA 4LWQA 1EA7A 1OW3B 3WKEA 1QR9A 3LL7A 3I0ZA 2H8PC 1Y0BA 4RZIA 3KXDA 3GT4A 3G79A 1R3IC 4O4JA 2PMEA 3C5WP 4F04A 4C4ZA 1E63A 4UUMA 3FPFA 2EG9A 4ZAYA 3Q2IA 1ISIA 3K8QA 4GUNA 2FE4A 4RESA 2O5CA 3BDIA 2YNMD 4X60A 3IVMA 1BZYA 3RVRA 1S3JA 4Q4CA 4JI6B 5JR3A 4TQUS 4GKKO 3A3YA 4P53A 1JKXA 1KDVA 1RA4A 3TI9A 3PXXA 4OLBA 2ZANA 5JUWA 4F4IA 2QEQA 3NDPA 1VLHA 3K8YA 1G8SA 4DANA 5FL7D 2ORVA 1AVTA 4D2IA 1XMQO 1T1EA 1FJXA 5HIJA 3K9NA 4BB0A 1VKNA 4AUEA 1QS0A 4MTGA 3W9YA 3CVWA 4IMRA 3IAM1 4FZJA 4RF5A 3VHQA 5IX8A 2CDRA 2ZLBA 1NT2B 2GNOA 4UBJA 1NVKA 1JVSA 5A4JA 1LB1B 1YITV 3U7RA 5DTIA 2O6LA 3UJBA 1B8UA 3LF2A 3DNPA 1EK5A 1B6GA 4ZT6A 5F9MA 5C7YA 4JLNA 1P2TA 2FTKE 5EMHA 1NRJB 4DLKA 4B3FX 2X5NA 5CURA 1YOVB 4KDCA 4PANA 4MVSA 1DT9A 3CEJA 2M98A 3C7AA 2QTHA 3FYSA 3DO8A 5KX5F 3ESDA 4OB6A 1GEEA 2IJKA 1CJVC 5A5DA 4UTVA 3IC7A 4O2BB 1A82A 3TD6A 3SSOA 4L7VA 4NCBA 4R8LA 3ER9A 3L0BA 4MLCA 5CXSA 3HFSA 3M89A 3PLNA 1PKXA 3JQGB 3UGJA 1ICIA 1I6WA 4XD2A 1I7NA 3EW7A 3DO6A 2GM5A 3VPFA 4DCCA 3L7NA 3COZA 1W94A 1E3WA 2VDJA 2FJPA 1JHQA 3DM9B 2FR0A 2LE0A 5L3SB 3HB9A 3MK31 2WU8A 4RETA 2PGIA 1WCXA 5FF9A 1A96A 4NU5A 2Q4OA 4XCXA 3CPEA 4CF7A 1H23A 3JZAA 3G6EF 2YS7A 1ZYUA 3B53X 4MKGA 1XK7A 4HNSA 2OCHA 3LD9A 1INLA 1QZ3A 1YD7A 4BAUA 5CA3A 2E7ZA 4UQOA 5AI8A 4EW6A 4B7EA 1SCUB 3C3AA 4JJGA 1MQ9A 3UG7A 2OMEA 4JBXA 4AO7A 4GWGA 2P9BA 1C1YA 2OB2A 5D87A 3NVIB 4MT8A 2A35A 3VNVA 4BNNA 3EDRA 4E5YA 2AOXA 3CZPA 4BO4A 2PGLA 1KBQA 1TGVA 3N05A 3UK0A 2PGOA 1MD9A 3ZCQA 5F12A 1KP3A 4WESA 4L8YA 2HP8A 1EQUA 3B2EA 3UFXB 2CNWA 3O73A 1FFHA 2IXAA 3HY4A 2AMFA 2W2MA 3AT1A 1XVLA 4J0HA 1F1BA 2WY2D 2WUDA 3GJ4A 3GHZA 4D9MA 4AJOA 3CVJA 1IY9A 2J5QA 3UG6A 5JSUA 1KI3A 5EZSA 1B1AA 3Q1LA 5B8FA 1XGKA 4XB6B 3OFSA 5IE9A 1SPBS 2HC9A 4KUHA 2N42A 3DG9A 3C4VA 5FTWA 3OCCA 4D4GA 1YIJF 1MN6A 3MTAA 2FEOA 1E3SA 1QOZA 2BKEA 2FK8A 2PIAA 4CHGA 4FJ2A 3GA0A 4MRNA 3CC8A 2Q5LA 2O4CA 2ZCUA 1VYTA 4DMUB 2AT1A 3IB3A 1J2UA 1KYTA 2VAPA 3EHBB 4F3YA 3ELCA 3BTOA 1KEEB 2BONA 1IIBA 3BF7A 4EG8A 3SYNA 3TOZA 2X6QA 1DWPA 3QVTA 5H3HA 4B3RB 3KQWA 4D0NA 4BASA 1C14A 1T9HA 3ZCSA 1YT5A 1WZEA 1Z4NA 1N8RH 1RYMA 2PUWA 4GLXA 2NNUA 3TQQA 3ZI0A 1ULBA 3PEUA 3RK1A 4TSKA 5DV9A 3EXAA 1N0VC 2OV4A 2O3SA 3ORFA 4PQRA 4H7EA 4E12A 4I0XB 5D6NA 4BZXA 3WNCA 3OR6C 1SKMA 5KHKA 5HJ2A 3X44A 4FTWA 3R0PA 2KBFA 2G0AA 2X9VA 5BSUA 3P4EA 2P2DA 1EKXA 1X14A 3AI2A 3EIFA 4IL6Z 2OM6A 2Z4RA 1MJNA 2FG5A 1LTKA 1WXFA 1P5HA 4HCJA 3L70H 1W5TA 2HBYA 2FJ0A 3N87A 2CWDA 3SOPA 2RQ6A 1JSCA 4G85A 4ZEWA 1U0NA 1RQRA 2QVCA 4D9CA 2QJTA 2UYCA 2ZULA 2PD6A 3C43A 1JDNA 2Z2YA 1JQ3A 4B09A 3A4MA 4L8JA 2C20A 2PTGA 1V1MB 3KCXA 4NU6A 4YEDA 3BA9A 1N33B 2IZOA 5CK4A 4KG7A 4P7JA 3PDUA 4UZEA 4CQMB 3CXCF 2X77A 2HR1A 4DV2B 3MQFA 3F47A 4JY7A 4FEGA 1ULAA 2A9VA 3AK2A 3BGWA 1DC7A 3KALA 5GGXA 2YMPA 4FEAA 3RREA 3RSCA 3VH4A 3TZQA 2JHCA 1KRHA 1N4CA 2Q7XA 4JI0O 2XMZA 1RP3B 3SEFA 1VL6A 4JYAO 2EKLA 2R2GA 1ZRNA 4Y98A 2H1CA 4PO3X 3ZX6A 3X2QB 4EFEA 1Z7WA 3WR5A 2IEYA 5A6VA 3O4GA 3P4UA 1CUXA 5FOTA 4KH0A 4EKEA 3STTA 2UXCO 4MV6A 2ZPUA 4R40B 1K4CC 3FZGA 2P27A 3PDJA 5SYAA 3GRCA 4CMJA 3V4SA 5DP1A 4YDQA 4LNUA 2F90A 3AESA 3CCSF 2EKBA 4LK2A 2XF8A 1OTYA 4CMEA 3Q9NA 4RTQA 3V7QA 5C4MA 1S9HA 2IQ5A 3AEQA 1OFIA 2ZJ5A 1M2FA 3R3YA 3ZXXA 3F1LA 1F12A 2HXYA 4KAXA 4V02A 5TS2A 3Q7SA 5L51A 4UVBA 5BSEA 3LQQA 1IXKA 4JB2A 3BWEA 4A03A 3KYCB 2IBSA 2DQZA 3VR6H 5KVQA 4L50A 3R4CA 2PH1A 2B8EA 1GZ4A 2W6CX 1YCHA 4IM7A 4LE0A 3DNFA 4NTZA 4RUEA 1U43A 3GRUA 4D26A 2G1JA 4AF8A 3KK0A 4IJ6A 4GKVA 5B1IA 3WRYA 2H11A 1Z4PX 4KK4A 4BTVA 4Q1BA 3HKCB 4QYMA 1KGDA 4YECA 1EWKA 4BW9A 1MABB 2QVXX 2V6BA 2QIOA 1I3KA 4XYGA 1ZL8B 2XUJA 1WNSA 4K9RA 3NKFA 3ETHA 5JQGA 1XZFA 1TQHA 1FFEA 4Z2AA 2HQRA 1QG6A 3J7AU 2D62A 3S68A 3WGVA 3VSDA 4MARA 1P39A 1KO8A 2POQX 4G89A 4GOXA 1O4VA 5K7SA 4WOJA 1FXSA 2W2XA 1JJBA 1F2UB 3R9XA 1VSBA 5IWAO 5EKTA 1WN7A 3EXIA 1CB7A 3GK3A 4AYWA 4HBZA 3ZHBA 1LPSA 3COVA 3ROGA 3FR8A 2W2OA 5IK2D 3F0GA 3E5NA 1KY2A 5BPHA 3VI4B 3MUOA 1P31A 2JLRA 3IAFA 2B9VA 3PGXA 5B1DA 4EVRA 2EJBA 1GQYA 1Z47A 3TNYA 2WYHA 4F4FA 1V2HE 2HFJA 2YHBA 4L8VA 1YIDA 5DZSA 2IEAA 1WUTA 1OY1A 1YFKA 4PLHA 4AY3A 2CHSA 3MZ0A 2BGRA 1QH1B 3DBHA 4HAXA 3VBEA 2CKMA 1AP5A 4UEOA 1M1XB 4QX6A 3PNSA 3ZH2A 4I99A 4MKIA 4G0YA 4C06A 4IBOA 2J85A 3SZ3A 3SJBC 5A9TA 1R8SA 4FYWA 3JQBC 2NTJA 1YL7A 1GITA 1Q0HA 3U4QB 3Q4HB 1JPVA 1YS6A 5ANRB 1JMYA 1GKKA 4BWAA 3NR2A 3D8UA 2X5XA 4MS1A 3BQ9A 3UC5A 2H6LA 4NY1A 4PA9A 1QF7A 2Q8QA 2BR5A 2EJ7A 4DW0A 2ATXA 2YUTA 2OORA 3PP8A 2OD7A 3GPDG 1NTMH 5DM6V 2QMYA 3P32A 1JNYA 4YGXB 4GP9A 4QXMA 5DM0A 3W5UA 5H68A 3I0NA 3A6JA 1T8TA 5KO2A 2J6BA 1JAZA 2NV2B 2CUZA 3FCUB 1QGUB 2RJOA 2XAAA 2GVNA 4KVAA 4WFEA 1VQOV 1VBFA 5DTRA 3T4UA 1R66A 3HA5A 5KYTA 1XBIA 1LNSA 5EWRA 1HOXA 4AX4A 4EF4A 2PY6A 1U98A 2I6QA 3BAFA 1FP7A 5JW6A 2QTSA 4ND7A 1B7GO 3AC0A 1M66A 2NXCA 1XDUA 4J0QA 2I87A 2QU8A 5HHTA 3O1IC 3C3PA 2FA9A 3R8CA 4EO7A 2FMLA 5I9BA 2ZTMA 1DAOA 2EZPA 3K20A 4D42A 5CTAA 2QE7D 3DHWC 1EBFA 2VJKA 3BQMB 1FTWA 1XUOA 4IDGA 2P5SA 3GP8A 2ORED 1WY7A 5JZVA 3A1WA 2CYBA 2PHZA 1WXHA 3IKEA 4RDIA 1QO7A 2Z3VA 1VPLA 5MN6A 4BAZA 3GNSA 2HBZA 1W96A 4DJTA 3LDHA 2X0JA 4M0MA 3LP8A 2VQSA 4EECA 1HRKA 2O8EB 5EIBC 3A9CA 4YC7A 2OILA 4OP2A 2HHLA 4RVUA 5JO9A 4ALNA 3T7CA 2W4QA 4LJ4A 1WXIA 2ZT8A 3T5CA 1JJIA 1SUDA 2ZIFA 4OU5A 2WU1A 3W8FA 1NQUA 4A7PA 2Z95A 5KHJA 2W2KB 2F93B 1HT2E 4YO7A 2DR2A 3L9XA 3HUTA 4Y0VA 2O2HA 3R1IA 4R83A 4Y2PA 2CTWA 4EJ0A 3WK7A 1U0HC 4D74A 3LPNA 1FRVA 4CL3A 3FCEA 1VCMA 1J06A 1T9AA 4EI8A 3CJHA 4OLFA 4FMCB 1XHEA 4UTPA 5H80A 3IOMA 3USCS 3VR6D 2W6IG 4XJVA 3EQ9A 4CQMD 1I0IA 4DRXB 4QPNA 2W90A 4GI5A 2ERYA 1JG3A 3CBQA 2RG1A 3OX1A 2GHTA 3MTEA 4GR9A 1VL1A 4LFBO 1H1TA 4NDAA 4I3FA 3I2KA 3THRA 1W5EA 5A62A 3TAXA 1XCJA 1CQWA 1A8UA 1E8MA 1ZSVA 3QLVC 1GCGA 3FTEA 4LF8O 1H0SA 4D3SA 3D6FA 4OIFA 2RK3A 2RHBA 2WYIA 2QJOA 4S1TA 5FLKA 2XXAA 5E4YA 2OBLA 1YFJA 4CR8A 4ZICA 4Q1CA 3D8BA 3RVQA 5DGHA 3C3TA 3OTIA 1GXSA 4F6RB 5DOVA 1IB6A 4X92A 4EEXA 5D3QA 1G7RA 4IDPA 4W5JA 4LH7A 2JAUA 4YYZA 1W25A 1G5IA 3N4YA 3KLOA 3NONA 4G26A 3WP1B 3C6ZA 2JRCA 3TZCA 2ZT7A 5I9TA 4QPJC 4WXRA 4B31A 3CPJB 4IIJB 1TQDA 2G1KA 1XVIA 2DYRB 3BY6A 1V5IA 3DV0B 3AK1A 2KHZA 4PZCA 4NONA 3N2KA 3EWSA 4AZWA 1SQSA 1YR8A 2VZ9A 5AJYA 4KHZA 3M5CA 3LNMB 3NANA 4B3MB 4FC7A 1QLNA 2IPMA 1SU4A 5HOEA 3NWBA 1W76A 1KVRA 2IW1A 1H5UA 4ND6A 3I4LA 4EFLA 1DWQA 2GARA 1RBZA 5DIZA 5GONA 1XCMA 3GJZA 3O4RA 4EF5A 4AG6A 1KKMA 3WGLA 4HQ6A 1Y82A 1F60A 3AINA 2O5RA 3MMSA 4BZWA 3OZDA 3CCVF 3D3WA 3MC1A 4D81A 4MCIA 1T3ZA 5FADA 3R6GA 3R9WA 1M1NA 3HVKA 1I94O 1EEXB 1M6VA 3PNOA 3H5VA 4F5YA 3K92A 4DARA 1AZSC 3NPAA 2P11A 1UZLA 4HPJB 5ESDA 2NSDA 4FDVA 2NMVA 4ODIA 4BB5A 1WVIA 5DXFA 2FP4B 4XVRA 4MRMB 1UDXA 1K7DA 3I04A 3OE7A 2DMRA 2NQ2C 3NFRA 4F4LA 3BGDA 3DKRA 1NI5A 3MWDA 1PLJA 3NR7A 4EA6A 1RMQA 4U0JA 3U19A 1PJLA 4EAQA 3ZWYA 2VK4A 4FFRA 4M7WA 2F4VB 3OMNB 3NAQA 3RUFA 1P75A 1T0PA 1SJ9A 5A9SA 4QEKA 4LRUA 2P4VA 4MRSA 3VYUB 1AZLA 3PF8A 4JSTA 2MDTA 3O3OB 4J4TA 4WFAV 1QP0A 2XAHA 5JJNB 1SVOA 1Y6QA 1PZXA 3P3NA 1MT3A 2JEXA 3G5AA 1WB8A 1SCBA 3NHKA 3V33A 2X4LA 3ZDQA 2D74A 3SX4A 1NRWA 3AOEC 1U2RA 2KB0A 3ESCA 4RGYA 2QLFA 2NZUG 1M83A 3T7DA 3C85A 3T3DA 3X1DA 4P58A 5CG1A 2A9FA 3G2MA 3WKCA 3LDCA 2VJOA 4TS4A 4MVYA 1E9FA 3WQRA 2QK4A 2G1AA 1R1MA 5AM3A 4C22A 3KSZO 4M8SA 1L7MA 3GRRA 2VXOA 3JTEA 1YHZA 2CL6X 1NF2A 1LFDB 3CUUA 1CLIA 1DAGA 4NS1A 4OQMA 4K9KA 3REQA 4DR3O 1OZ0A 4ME6A 3FMPB 1PX2A 4MCJA 3HDGA 3S55A 3GT0A 1XHOA 4BJ1A 1UEIA 2EW2A 1ZRHA 2MR5A 5IJWA 2VPIA 4E6EA 2AW5A 2ZUVA 3KJGA 1Z35A 3PXGA 2VAVA 4P98A 1E0AA 1G17A 1RE0A 4H15A 3KJIA 4EO9A 3D8CA 1I3LA 2NYRA 4D9HA 2RHLA 4HDKA 1K2VN 4C7VA 3Q87B 3ETEA 4I7ZB 1T3GA 1M5TA 1XL1A 4JP8A 2YBDA 4JJ6A 4IQFA 3CHYA 4FZ3A 2IE0A 2MU1A 5FYDA 2F9MA 1P81A 3HZZA 3RGWS 1W1IA 3ZBPA 1QFYA 1TU0A 2FGJA 3FPJA 3V6LA 3JSNA 2GA9A 1B0PA 2YXHA 4F11A 4CHTA 4QEZA 4NDNE 1M34B 4J4HA 1BE3H 3MCQA 3TQRA 3THOA 2DBQA 2SICE 2IE8A 2IZ7A 1IHOA 4ZHQF 4W7HA 4OHVA 2VC2B 1O58A 1MGOA 1IE3A 1GQRA 4B1FA 2Q6KA 1SAYA 3RR2A 1MC8A 2PXHA 1X9HA 4ZOEA 2V6GA 4L9SA 3T7TA 3OF3A 1V11A 4DQ0A 4J9VA 4QPKA 2H00A 4RHXA 2QD3A 4R1SA 2XUQA 5KTTA 2AGVA 3VR5A 2JFFA 4C3ZA 1IM8A 1M72A 1SBZA 4MW9A 5H6QA 4BT7A 3IHLA 1E2MA 4OA8A 4HB2A 5K6AC 1JG2A 2TS1A 4RULA 2W8BB 2WYVA 1TL7C 3V7NA 4RO0A 4I36A 2QLJA 3AX6A 4IDOA 3KCQA 5IT0A 2GBCA 2HRCA 5KSWB 2XDQA 3QM1A 1B2LA 4F5ZA 5JISA 2QMUA 1U8UA 3IT3A 3PR1A 3R3UA 3LDEA 2XYGA 4BJ3A 4YCAA 4Y1EA 4TWKA 4KHPB 2AE1A 1G2OA 3W77A 3IGAC 4ZEXA 4DPKA 3WK4A 1XLVA 2YQ5A 1C0LA 1WP9A 2F1JA 3IR7A 4BIIA 4GXTA 2VP3A 1FXWF 3B36A 3M81A 3G17A 5E7JA 1CDDA 3ZHVA 4HYQA 1SIOA 4B81A 3JRWA 2OQIA 2VDVE 4JLDA 4C07A 1VHWA 1TGYA 3SD7A 4RMNA 3DR3A 1M6EX 4JXXA 3DZBA 3UMMA 3WQBA 4P1ZA 2R7NA 4N8DA 2RGBA 2YXYA 1H4QA 2VZLA 4XJTA 3DBRA 4BWFB 2HT6A 3GLSA 4JP2A 1V41E 2HL6A 4JYPA 3Q9LA 3L0SA 3CIFA 4KKVA 4NVRA 5F5NA 1E5DA 1UR5A 2QM8A 1W7AA 4BDSA 2PKYX 1NOIA 5G0TA 3OTOO 2HK9A 3LC0A 1H2NA 5KAIZ 4DEXA 1PVOA 4LA4A 4Y2HA 4IDDA 2VLIA 5ECDA 1DIAA 1GIAA 1U1DA 4N40A 4XH9B 1JSZA 3MBMA 2RKWA 3ASUA 3I2HA 4ICIA 1Z75A 2IV2X 4KTTE 4KLRA 5KTKA 4CMIB 1E7YA 2J3HA 4Y1RB 1Z6XA 5E3IA 1JE1A 4DSUA 1VQPF 4HF7A 5T6MA 4PBTA 3WGUA 4E4EA 2KI5A 3KZKA 4LSWA 1KR2A 4CDRA 3KJXA 1AOXA 4QSMA 2AWOA 2HH9A 4BCCA 3QOFA 4J7ZA 2G8LA 2RB5A 4J0FA 2D0OB 4Z6KA 3B2QA 1DBPA 4KODA 3CSXA 3N2EA 2Z2ZA 4OU4A 1V9PA 2X5OA 1QVAA 3MBIA 4NZZA 5JAPA 2QD2A 4EFMA 1ECJA 4NS4A 1GJRA 2HBQA 3OBIA 4R2IA 3MPOA 2AK3A 3COSA 3TE7A 1SU6A 3Q9UA 3TM4A 1I4EB 4ZVMA 4C08A 4B85A 3S1SA 1BW9A 5DT2A 1E3MA 2MTBA 1GR0A 3CEPB 3JQAD 1QF9A 1R6KA 3DGEA 1H8HD 4KXXA 3MT0A 3UK7A 3QPBA 2DTDA 2BKUA 1E1RD 3VBBA 5C34B 2JJQA 3GLHA 5KVAA 3PE6A 2C4WA 3GLUA 5DM60 1Z6PA 3EE6A 5KYGA 3ABUA 3HVUA 5LQDA 2G09A 1YTLA 2BH9A 1FDVA 4W1PA 4GLOA 1PWZA 4WIAA 1VECA 4HWGA 3KQMA 3VKUA 3R0JA 4KH1A 1XLUA 2R2AA 2M6YA 3I72A 4B82A 5LP6C 4K9DA 3SYTA 4LK3A 4MP3A 5B3SB 2RHRA 4Y2RA 1JG1A 2CVOA 5LQNA 2JHAA 2NXNA 4NBTA 2HBRA 4JT9A 2BV3A 4AL4A 2JANA 3MPUA 3LFOA 1GZ7A 3MGGA 3LQ4A 2G04A 2I4LA 4IVNA 4ZJPA 3LIIA 1NYLA 3EPJA 3D4NA 5I7VA 2C5GA 2IXGA 1YUBA 3LWQC 2HAEA 2GCOB 3ZLBA 4MSUA 3DAOA 1IAQA 4CI9A 4IQ4A 1DO8A 4IVQA 2AF4C 4EGAA 4PAQA 4UXIA 2JAQA 2Y0PA 2DKOA 3PRYA 4HMPA 1I0LA 2OCDA 3C1OA 5HGXA 1USGA 1PNOA 1B3RA 3H4MA 3S3TA 1HFWA 2P9TA 5KIAA 4JAVA 3ORQA 4UHJA 3D0OA 5JBNA 3L92A 2PUCA 3L4KA 2A58A 2K4MA 2WFMA 4CM8B 1SUFA 4K8ZA 4MSWC 3AO0B 3DVQX 3FFTA 1F5NA 4ENPA 5IVHA 1KD1H 1UKBA 4LQ4A 4YIKA 5CLLA 1EVZA 1XDZA 2I6GA 3VHRA 4EF6A 5HM6A 5T67A 2WTUA 2EJRA 4BL5A 1CE8B 2I8LA 1RFGE 4MGKR 5CDYA 3EBPA 3IQDB 4C8GA 2JGLA 4QLAA 2HSGA 3LXXA 3RWOA 2NX2A 2Z5UA 4I3HA 1QUEA 1T36B 3ORYA 2GAIA 4C30A 2IJJA 3FYUA 3D4IA 5TQ0B 4TOIA 2CNKA 3UF0A 4DIBA 5KQRA 1JIVA 1IHYA 5LYJB 3FGPA 4XGQA 3C8HA 2R8XA 3LYHA 5L3CA 4A6XA 3NNSA 1QX3A 1QVFU 1JMKC 5K99A 4W7SA 3M1LA 5K0CA 1T1SA 2VQ3A 2XB2A 1GM5A 2CXPA 2VTBA 3ROTA 4KJXA 2GPYA 2ZU0C 3V1TC 3Q7PA 4KVGA 1MC1A 3E35A 1N2GA 3H2JA 2YXNA 3OQ6A 2YJGA 4LYDA 4MQMA 2PS3A 2NYAA 4XW2A 3ONNA 5FWYB 2RGDA 1D2DA 2W6JA 1V6CA 1TM1E 1V54C 1K4YA 1LF0A 2AOUB 4LZAA 1NR5A 4XX0B 1KYXA 3D6UA 5H02A 5B53A 1F3OA 1PFWA 2ID7A 1V48A 2HSWA 1WZ2A 4AS2A 2ZXWC 1QE5A 2JIBA 4E5UA 3E3AA 4JL5A 5B3JA 4I4TB 1BCSB 4EFKA 5BWOA 3HGMA 4F8JA 1H66A 4UHCA 5CAEB 1PDOA 4V1CB 1IZ7A 4HL6A 3DYBA 3AV3A 1XYGA 1MNQA 3PPYA 3HVIA 1B1CA 2F59A 1Q3HA 1HF3A 2J0EA 3TMYA 4HNRA 5H5JA 2DY1A 4X41A 5FPYA 2PSJA 1NBAA 1PO7A 4EY6A 1P9LA 3PEYA 3OO1A 1L4HA 4LW8A 2V55B 4LXTA 2B7LA 2HADA 3R2JA 4JI2B 2ZXFA 2HJHA 3ZIAG 3H5AA 2YXEA 3PWZA 1ISMA 1R3LC 2V54A 4BKMA 2FPOA 1JAIA 2J6IA 3D6AA 2XYHA 4Y2UA 2XZTA 3PDIB 4B4KA 4Z3DA 1O8BA 1MA0A 4BATA 4AJ4A 3JQ9A 2CGEA 1CQIB 2CJWB 3D64A 3BS4A 2R68A 1ZICA 1PJQA 2F6RA 5AQ1A 1GA4A 1H2ZA 1S5JA 4QUDA 5JCPA 2XCTB 1YRLA 4BMPB 3SR3A 1RPJA 4B17A 1PJ4A 4C76A 1PK9A 3WGTA 3PI6A 2W22A 3G2JA 3J80N 3AJEA 2X6BA 2Q5IA 4GHWA 3W6OA 1G16A 2Q8NA 4ER7A 4QE7A 1UM9A 1KI6A 3TH5A 2CDAA 2WG2A 1NXPA 5ISMA 3O2QB 5EQTA 4KDFA 3B40A 3FNEA 4RD3A 3F97A 2V58A 3COJA 4QPCA 2YX1A 3DQQA 4KCGA 1P7BA 4JI4B 5GWXA 5C7OO 1Q0UA 5K0LA 2VDRB 3UK2A 2ZRLA 2XMCA 4L9RA 5BSRA 3L7IA 5U4XA 1GZDA 4HAWA 4DMFA 4CM7A 3L7BA 3COYA 1Y5RA 2E6UX 1CY0A 4PU0A 3BK1A 3CEHA 2ENUA 1X8XA 3NAMA 3HCAA 1UEJA 4YO8A 1EDEA 1LSUA 1ZWZA 3R7BA 5BWNA 3NYWA 2XNJA 5L4NA 1QH9A 1QIKA 2COEA 5BQFA 3CUWA 4U5QA 1FTQA 2BJHA 4PGGA 3T1YO 1RAAA 3MB5A 1KECA 4C3UA 2XTMA 5C4GB 4E2ZA 3SQWA 4AG5A 2JGDA 1N9KA 3NRBA 2Q3MA 2Q5ZA 4HLQB 1IEVA 1CRZA 2AXNA 5CBHA 5JVDF 3DXZA 3KJQA 2I66A 1AGYA 4HDRA 1Y67A 4MW1A 1YIOA 1JL3A 1ZUD1 1ZVVA 3P10A 1UKYA 1T6BY 2Q8VA 3THXA 4IMIB 4YUVA 4FGLA 4FFKA 5DN6D 3DCNA 1UKEA 1GKFA 1I2CA 4PAWA 5JD4A 4K2AA 3JZDA 4RPJA 1RWKA 2EWCA 3UATA 4U7GA 4M6WB 3MJTA 1Q57A 3G7NA 1KAGA 4MV0A 2DEUA 4G0ZA 3B82A 1T5TA 1FDUA 2DUNA 4WV3A 3V1NA 1UAGA 2QKYA 2BP7A 4Q1FA 1U31A 2WLTA 4NTXA 3LC2O 4YP7A 3F7YC 2PRYA 4QUAA 3FHCB 3FCSB 4RY2A 3WWEA 4PNZA 3N2IA 2Q0AA 4TYWA 2C4VA 1UBKS 4EEKA 1EBUA 2UXBO 3CXRA 4BNIA 4QULA 1O89A 3U60B 3VZCA 4CCWA 3JQRA 1OASA 1L5HB 4ZT7A 5F4BA 5BMVB 2Y69C 1II0A 2H1SA 4E09A 3ND7A 1GK9A 4F96A 1Q91A 4RABA 3TBHA 2WF6A 2VP5A 1MSDA 3MQ2A 1PFGA 4D8UA 3QXHA 2G7MC 4MAFA 5LDDC 5DRYA 2VSXA 1LS6A 1XD9A 4DSAA 1AJQA 4Z9YA 3FSJX 3IBGA 2OGZA 4DLBA 1ZWIC 1RQLA 2AMLA 2ZJ8A 4ZHVA 1M1KW 1IK4A 4KO1S 5EE1A 1DOHA 1N5MA 5EP2A 3D3EA 3OHPA 1NU1H 3EPRA 3KT8A 3BMOB 2WUVA 4A26A 1Q0TA 3WL6A 2XNDD 1R3JC 5DB4A 1P1FA 4J7XA 4URXR 1IZZA 2FHPA 5B30A 3HE3A 1LBTA 3AZPA 1THZA 3MAAC 5A3SA 2OE2A 5KPDA 1XG5A 4ZMSA 1JKJA 2VZEA 3OAAA 2Z1MA 5EWLA 5KSOA 2QA4F 3OUTA 5A9GA 1H7MA 4F21A 1NPTO 1YI2F 1BHBA 1YKGA 4B9EA 3N5KA 4MICA 4OHRA 4UBLA 3M8KA 1SELA 4AZ0B 4LJ7A 5DK6A 2AIZP 3ASVA 3R5HA 4IUBS 5AW2A 4ZIRA 1FP2A 2QW0X 2WD8A 1NQAO 5GQSA 2JAPA 3HEBA 4FPXA 1HE3A 3DS8A 3WGQA 5LHHA 5ALOA 4FXPA 2HS4A 4BNVA 3H3FA 2DQ4A 3E58A 3HXQA 3Q6MA 1K9MH 1I01A 1N8KA 3AM3A 2Y0DA 5TB5A 5M5BA 4BVHA 3COWA 5LZ4A 4D6YA 4GPBA 3FDIA 1VA5A 3O8LA 1M57C 2OHFA 1FNJA 4LOAA 1FQOA 1MIOB 4IINA 1IN6A 3FE2A 1G291 1H3FA 3H86A 3NW9A 5B2FA 1NMQA 3QKRB 3U4DA 3CZAA 1J23A 2NZXA 3G6KA 1FRQA 4EFNA 4IRMA 1IV4A 3HEAA 2BD0A 4J7KA 4OKNA 1HDEA 2J41A 1YR7A 2QWQB 2ZYVX 3DDHA 2OUIA 3QVKA 2FPMA 3RHTA 1WG8A 3VXKA 1SXJE 4G5QA 4XYMA 1HE1C 4P30A 3NBYC 4FZ1A 2F9LA 2R60A 2WFLA 3SVZA 4R1LA 4KX5A 3HUFA 3W4JA 1I5EA 3RFTA 3L7MA 1R0XA 1OC4A 1SUWA 2ZUBA 3LVBA 1FMJA 3C70A 3O21A 5J2TA 1O7JA 5KYYB 3CRMA 3PENA 4Q1VA 3RC1A 2HRYA 3VSCA 4JASB 3BWYA 1XQ8A 2O2JA 2HQBA 4G1EB 1DDIA 1HLFA 1H2BA 3C1TA 2A94A 4FMPA 3NWEA 4OG2A 1YKFA 5M04A 4YMVA 5HY0A 3HFRA 4DIFA 1DSSG 3K5OA 2FEKA 3OJFA 2AXPA 3CLVA 4Q03A 3NNDA 2YXPX 2IP1A 4HFRA 3R0IA 1ZS9A 2ZBFA 4IHJF 3APQA 4QTYA 1WUKS 5DT9A 4P4SA 3STHA 3MJCA 3MWJA 3U7QA 1MPXA 1G3MA 1RC0A 1IXRC 3ITKA 3CLRC 4L5CA 2EAUA 4BKUA 3PFFA 4RUFA 4RE6A 3JYPA 1F23A 1WBDA 4HSEA 3BRCA 2QX7A 2V5VA 4IP0A 2BFCB 2A1UB 1EFRA 3LU1A 4DRYA 1DDOA 2LO1A 1UJWB 4DREA 3S8YA 4RVSA 1FX0A 3A0UA 4ZYXA 4YAWA 1D6MA 1KOLA 4LSMA 4ZI3A 3LC1O 3HA3A 2RHJA 3FGZA 3ASNB 3T7RA 1H2WA 3SQLA 3NOXA 1CJBA 2F2TA 3D3QA 2VRNA 2X0DA 1JR3A 5BNIA 4ATNA 3N5CA 3ETLA 4GLBA 3W8RA 4MDFA 4A1FA 2Y4UA 1IDOA 4WAUA 5EC8A 4DLRA 1AUOA 3G8CA 5DGTA 2CUGA 1X7PA 3LYBA 4H9GA 4J80A 4JTCB 1PEYA 4HDCA 1NNSA 4Z4EA 3MTDA 2CLOB 2D0DA 3Q10A 1AUQA 4OJTA 3IMGA 3LYLA 4HLDA 4I6JA 2WINI 4IFIA 1Y1RA 3M7IA 4UBMA 2X9LA 5HF5A 5LSAA 3EIXA 3N59A 4RACA 4C7KA 3WSWA 1IUKA 2QA5A 1BO6A 2Q3CA 4PBRA 7MDHA 1QFZA 4LWPA 5LLTA 5IARA 1WDKA 3AFHA 3U1TA 4KQ2A 4A6EA 2W6NA 2HK7A 2X1VA 3PNBA 2UYPA 3AEKB 3LBAA 4ZI7F 2OEPA 4KXQA 1GCUA 1JDTA 4G84A 4DLZA 3PF9A 4P9PA 3KLBA 3W8EA 2IIQA 3TG8A 1YQTA 3IE1A 4WRRA 1ZGZA 3RGGA 4LZZA 4AULA 3PSHA 1IEXA 3BCUA 2E6KA 1KVUA 3RAEC 1H9AA 5JNLA 1O6FA 1D2MA 4LDJA 1Z8NA 3QA3E 4L72A 5J2UB 3EOAI 1K5DA 4OLJA 2H1IA 1VQ6V 3L0YA 4FE3A 4XIIA 1BEUB 1XRRA 2EJUA 4ZK7A 3OPXA 3O83A 1Y8AA 2Z3YA 4ZPXA 5K0TA 4YBZA 3M34A 5K8VA 5ERGB 3ZE1B 4P4LA 4IZOA 4FGSA 1D5WA 4HN2A 2P6UA 2M6SA 1Z5OA 4JP1A 4BT2A 3L1KA 2FUEA 1K8ZB 3A0HZ 1R0CA 4GE3A 5DYTA 3SZOA 1TLLA 4YT4A 3TLJA 1J07A 1KZ1A 3T38A 2QU7A 2BZGA 5IMSA 4U2DA 3A6EA 1M90W 1NIJA 4KGVA 3IEQA 4JWTA 3E81A 2E3CA 3JSXA 3FETA 4XDZA 1X1QA 2JJ1G 5JSYA 2VQFB 4KMOA 1ZN9A 2DKNA 1VEWA 4BC1A 3U4HA 2PL3A 5K3SA 4JZYA 1M6WA 1Y1KE 5ITSA 4TPKA 3HJRA 1RSOA 4AJEA 1TEXA 2F67A 3E5RA 4ESOA 4QDUA 1M8PA 3KUDA 3RFUA 1JJFA 4ACBA 4E5NA 3RRXA 4HWKA 2O50A 1ZBDA 1X1DA 4GRAA 2XRFA 3GLFE 1YBFA 3AG1B 3C8DA 4HDOB 4TGLA 1JCHA 1LPAB 4ZCMA 1K3TA 2BOVA 3WHPA 4TLCA 3WJ1A 4L2IA 3K31A 4J1TA 3KRTA 3TMAA 1Z5UA 2ZR8A 5LP6F 1DCMA 3WGMA 2UYHA 2Z1DA 4IYRA 3X1YA 3SPXA 1J99A 1NVXQ 2WD7A 1L7AA 2UUBO 2BMVA 4ITRC 1RM0A 1WEKA 4I08A 3LCCA 4B6JA 2W6OA 4X65B 4B7AA 5F21A 5TF0A 4MQBA 6ABPA 4NC9A 3RS0A 5B4VA 3RVLA 3WYFA 1Q1AA 1YJNV 3UBMA 2OWDA 3GJRA 2CUNA 1W73A 1D7AA 3ELWA 1B0ZA 1TO2E 3MGAA 3JZMA 1OLOA 5G0VA 4OHUA 1ZM7A 1C81A 4CPDA 3I9NA 2H1FA 1P1HA 4PO9A 1D0IA 1G1MA 4M1QA 4XBFA 3BH6A 1XZLA 4PWYA 3G67A 5HP7A 1OI3A 3W3AA 4U2CA 1E69A 1GRRA 3UMCA 4IVPA 2O3TA 2CCKA 4QFCA 3CPSA 3LUKA 3G2HA 1N0JA 5CLIA 2IYLD 1IY1A 4KOAA 4OQPA 3B9PA 5CNMA 4JLSA 5FTNA 1NP3A 2EJVA 2C5LA 4OPAA 3B89A 4KYVA 1SS3A 1PG5A 1MCZA 4XB2A 2MOKA 1ODLA 3P0FA 1P44A 2J3MA 2J45A 4ZAXA 1Q0PA 1AR1B 2QXUA 1SC9A 2VSNA 2NG1A 3QFCA 5F1OA 3BABA 3QO7A 1P5ZB 4QUEA 1IC6A 4RKFA 1FXUA 1COWA 3CG4A 3QHQA 4YJ2B 4RA6A 3FY4A 3WLEA 1P3DA 3THYB 2NNLD 6REQB 3TTVA 3FPSA 1EZVH 1E7QA 3KAKA 4UQLA 2X1MA 2FSSA 1DCTA 1P8JA 2NV6A 5IS2A 1JQ0A 1WNTA 4P84A 2DWDC 1QC5A 7GPBA 4O5OA 1Q82H 3S6JA 4UZFA 5HYVA 3LCVB 4TXMA 1KEPA 1SZQA 2Z5VA 3S2ZA 4RC9A 3LWPC 4FYKA 2JGAA 5BUSA 3DHEA 1LDGA 3GJ7A 1VPEA 4CM5A 2O5VA 5L3RA 5JS1A 4GKJB 5FWXB 2XT9A 4N18A 4ZCPA 3EXG1 2OFOA 4DYVA 3UHOA 4XUGB 3ASOC 1CUAA 2R47A 5JQWA 1QONA 3G5TA 4II2A 4BLTA 2VF7A 1FXHA 2J3JA 2M9MA 3GUYA 2VS0A 4P3NA 1XQ6A 1P1BA 4TMZA 4GOMD 1AE1A 7ABPA 1VQ8F 1YAJA 1H2GA 1MC4A 3NHMA 1ZO8A 2P5OA 2XW6A 4B6PA 3QUCA 5AICA 4IJQA 4AJ2A 4DN6A 3PUIA 3EC7A 4U7FA 2A6PA 3IB6A 4EDHA 1DTOA 4RHCA 3IP8A 2L19A 3A0RB 4PELA 5C81A 4Q39A 1XRLA 1PNMA 2WHPB 2BI7A 4WFGA 1TF2A 4ZVPA 4ROTA 3CNBA 1I7FA 4MRAA 2CLHB 1Q3TA 4KBGA 1ST3A 1I1OA 3BRWD 4M9CA 5DYNA 1H3NA 4FYXA 3IP1A 2HMVA 5DASA 4LYHA 4B84A 2BDEA 1OCOC 1QHHA 1F8GA 3CS5A 1II9A 2QM7A 3A25A 4R31A 2QRPA 4XGRA 3AGKA 1RYYA 2HJDA 3CW9A 4YJFA 5JROA 4L0CA 1R4ZA 2NUTB 4OKIA 1FVFA 3AEXA 2JEZA 4DEYA 3WRVA 5E2IA 2O0LA 3PFKA 3PC2A 2A9QA 2NPIA 3E7XA 4HEQA 5FAXA 3QITA 2JCVA 1VM6A 1GPDG 2FEWB 3RYFA 2WJAA 4CV1A 1C30B 3DMTA 1XD2A 4C4OA 3ROEA 4K26A 2NACA 2ZIZA 2Y0EA 4NFSA 3MTIA 4JT2A 3HYTA 4LY3A 5F1YA 3RW9A 4UULA 3D2BA 4DO2A 3GJSA 3S5UA 3IBYA 1V7QA 1RW4A 1OF1A 1SRYA 1Y66A 5DCLA 3LF1A 4FZRA 3Q3JB 4MVJM 2HV9A 4JI1B 4I5IA 2P9ZA 3EGCA 3JVIA 1COZA 1Q50A 2LGWA 1P9NA 4MA4A 4YV7A 2QBYB 2IS4A 2OBBA 4XIGS 1TB4A 1OC2A 3LRXA 4UOEA 1TKAA 2P41A 3VPAA 3A8TA 3QNWA 4OD0A 2AS0A 5KDDA 1S2OA 4GSKA 2EIMC 1MQSA 2DUJA 1H2RS 3CLSD 2AZTA 3MCTA 2HV8A 1YJ9F 3C3CA 1IQ0A 2VKTA 2JLYA 2CMHA 4ZVNA 5KU1A 4GYKA 1BX1A 3IXQA 2YZ2A 1BMFG 4LBWA 1UXHA 4OY3A 4LUCA 4MJ7A 2IOQA 1S72V 5HIIA 2DBVO 3HQ4O 2LCIA 1OLSB 4YREA 2FMTA 3I2JA 1EPUA 1U1FA 3L02A 2NOAA 3OWOA 5DNVA 3CVXA 2VDWA 4URWR 1KI2A 1NBOA 1VCHA 1XDCA 1E89A 2J3DA 2JI7A 4NOMA 3F0FA 3RG8A 1TO6A 1BVRA 1JG7A 2XGJA 4LWOA 1LLQA 5IKXA 5FBLB 1N8SA 4QJ3A 2Q0OC 2DBYA 4X7PA 4DPLA 2KG7B 4Q05A 5BYJA 4DXWA 3EZLA 3NH6A 2IUYA 3GJ5A 3I0MA 2GCGA 2WPDG 1E2IA 4K0KB 1U2EA 1P1RA 3L4EA 1CUCA 3B1WA 4J2OA 1G60A 2V7BA 3KPUA 3D7MA 3PU6A 3VV3A 3NTVA 1TI7A 1C9KA 3PQDA 2I2BA 3QXXA 3OKFA 5FI1B 4GKAA 5C93A 2C5EA 3CCJF 2WG0A 4UNNA 4KAFA 3IUEA 3IA2A 1T2DA 4X5OA 2ZIWB 4RAOA 2H54A 2X2OA 2OECA 4QPDA 2OCBA 3P19A 3ZV6A 1GG8A 2N75A 1E9VA 4W5TA 4W5NA 3C1UA 2I3GA 3F49S 1ONNA 2OORC 1Q74A 2WYUA 3OCVA 2J3LA 4XRGA 3OEEG 1BWPA 4DUYB 3PHHA 2X7XA 3JARA 5D86A 1NG1A 1V6SA 3CNOA 4FX2A 2FWJA 1XVVA 1G7SA 4L08A 2D4HA 4AWBA 1U8TA 1A4IA 2YWDA 3WK5A 2H1OA 5EUQB 1CK4A 2A5FA 5FBWB 3PHBE 5KYWB 3HU2A 5BP7A 4TMXA 2C77A 4CN8A 1BHSA 4JVMA 4P7KA 3BERA 2X4IA 1EK0A 4MUKA 4C0SA 1SESA 3SXUB 4MULA 3E9CA 1IPHA 2RGXA 1X7GA 3FPAA 1YR6A 3ZKWB 4EO4A 4JI6O 4J49A 1ISFA 3S28A 1JEQB 1NJ5A 2HLDG 2FFJA 4A36A 3P26A 1VRVA 4UHBA 4CM9A 3MJRA 1Z63A 3S8EA 2GEDA 1WE2A 2ZSIA 3UW3A 2H7VA 4RVOA 2N46A 4DLAA 3JU3A 5CIWA 3BAAA 4GF5A 3CSUA 1JSRA 3I09A 5T4EA 4BXOB 1ZI9A 3ZG6A 1EB9A 1T5OA 5IY5C 3JQ8A 4IIXA 3S81A 5HQTA 4WADA 3PGKA 3PEFA 3UAVA 1CX9B 2CB0A 2YIBA 3JQAB 5H81A 1L5YA 1K33A 2QTVA 3H2IA 2I2WA 3JASA 4HAOA 2ZRAA 3Q5DA 3P9CA 2Y66A 4NNOA 4DDKA 1UMDB 3PNLA 2IUTA 2X3FA 1C1XA 4C7OA 2R6R1 4NTWA 3TLBA 5T64A 3CHXA 1VB3A 3WRWA 3C7KA 1MPTA 2PZGA 3D0QA 3H2BA 2X8AA 2YHUA 2QX9A 4TSFA 3KR1A 1EHIA 1M67A 3I12A 5BN5A 1GPAA 5EB1B 4QTTB 2BGNA 1B04A 4QATA 3A4VA 4FIDA 3FG9A 1LZLA 1II8B 4BLQA 2RCYA 1AY0A 2Z6QA 4H7HA 1QLEC 4KQGA 4RPGA 3CSSA 3ICEA 1GFIA 2ZTHA 5BXQC 3W2IA 4ND8A 3EVTA 1M2WA 5JJLA 1Z5GA 1T91A 2X6TA 2I9PA 1XXLA 4C7UA 3IO3A 4H60A 1H47A 4KQ1A 3VVBA 9LDTA 5CG2A 4FOLA 5IBPA 5L6MB 4RHAA 2F3SA 3D81A 2D5AA 4A15A 2V7QD 2JC3A 5LA6B 3AF1A 4S0XA 4CNQA 5H4HA 5C46F 3FI0A 4MQFB 1FQWA 1S76D 4OCZA 4Z49A 1O94A 1U3TA 4F9GA 1U1EA 4BFSA 3JQPA 4OL9A 4FNGA 3A1DA 4U02A 1ODKA 2CLKB 2NU7A 3WMFA 2E21A 2G3YA 3LUGA 3H9BA 3GLIE 3EX7C 1QDEA 1ISHA 4C3VA 1ECPA 4MGZR 2F00A 2OBMA 5FJIA 1S2IA 3GLGE 5FKJA 1X80B 2ZJZA 2J4FA 5EIHA 1U8XX 3ML0A 4JKYA 3IDQA 4XR9A 4CIAA 1X86B 2IY7A 1WPBA 5EO3A 3JS5A 2JVJA 3W79A 4ASUG 1ZJJA 2C9YA 3U0VA 3LHDA 5EXPA 3IPXA 4NKGB 2Q4DA 3W7XA 1N32B 3TIXB 1L5GB 4WXMA 2XCLA 5EE3A 4PYRA 5GM2A 2HF8A 3B5JA 4Q01A 3AETB 4OHMA 3ROKA 4UFOA 1VQLV 5BYBA 3WB9A 2Z08A 1XA4A 3SX0A 3BD6A 1NYRA 3OE5A 3ST7A 1AO3A 5D3KA 3UO8B 1G1XB 5CT4A 4C2BA 4AP9A 5AQEA 4NCAA 3I52A 3IUJA 1DXOA 2OCAA 2JPDA 4PDMA 2PBLA 1BOFA 4HJXA 5CB6A 1ST2A 3OFJA 1P0IA 1H48A 2NO6A 1B0AA 2EF0A 4NE9A 4ABTA 3OTGA 3L40A 2CHUA 2XMGA 2FFHA 2FZKA 4HGQA 2G6TA 2IEGA 2O57A 1KTIA 2BZ0A 1WRBA 1DK1A 3BHNA 4RIFA 1E5VA 3AR5A 3TRFA 2Q1SA 2D5IA 2JFHA 1VCNA 1XL0A 1CC1S 4URHA 2VSOA 4B3RO 1SC1A 1EK1A 5KTYA 2G5TA 2PQ2A 4GEKA 2CT8A 4RH0A 4DIKA 1H2YA 2CUTA 3D8SA 1B0UA 3ROMA 4UB8Z 4UCFA 3L8EA 4US2R 5JECA 5B1AC 1YQWA 5GOZA 2FKNA 4EDFA 2IHBA 5HW0A 1CR2A 1FFXB 1T2CA 1KI7A 4AJ9A 2BTQB 4GCZA 5KNBH 3OP4A 2RHWA 3HI4A 3FFWA 4Q6WA 1BGYH 3IVGA 4TRRA 5LQRA 1H1DA 4EHLA 4AY6A 1NW9B 3I8OA 4DA6A 3EEBA 1SXJB 2TECE 4Z5XA 3N3AC 5F2KA 1OHHA 5AK3A 1E5QA 4OA5A 4YALA 4I55F 4JOSA 1U3GA 2V7GA 1MT0A 1YDXA 5DEIA 5REQB 5EMNA 2IRWA 2NP6A 1KARA 2IYAA 5HRUA 3ADBA 1JPXA 1CZKA 2V8BA 2XX3A 3IOBA 4JBHA 3QLTA 4O4JF 2C9OA 4MIEA 4XUEA 5JRDS 1N33O 2WA1A 1OD6A 1VI5A 2DH5A 2NUPA 5KNCA 1FJGB 4TLAA 1ISJA 3STXA 3OURA 4DV2O 3DBLA 4PG8A 3MA0A 1KKUA 4G4ZA 4BLUA 3L75H 1M0SA 4KMRA 1L5VA 4HEA6 1ZIPA 4CKZA 1U0EA 1WSDA 1JU4A 2C42A 3WIBA 3D4OA 4N01A 2ZDHA 3BIWA 3F5TA 1RI2A 3IP3A 1P0CA 1C7JA 1X7ZB 3SX2A 5DNCA 1HTTA 2D2VA 2Y1DA 5JNUA 2RI1A 5IFKA 4UC0A 1HDIA 3AWIA 4URVR 1QNLA 3HR0A 3PFIA 5DGIA 2GILA 1Z7EA 1TEHA 5E1BA 2OC9A 2QPAA 4OXKA 3ZE6A 3V4OA 1AN0A 3QNUA 3W7BA 2PANA 1HT1E 3ZD7A 2XT6A 1FSGA 4QPZA 2IYTA 1NW5A 3RWBA 1MRNA 1VFNA 4YAKA 1GA6A 5C37A 2I6DA 2BGUA 5EJEA 4FEYA 2XY4A 2OCLA 1XXHE 4U7HA 3W1EA 4G5XA 3KAJA 1V71A 4CH5A 1FVOA 2Y76A 3G3EA 3C6YA 3FMOB 3SJAA 1IQPA 5FWNA 3GT7A 2WBLC 4OQYA 1IL0A 1VPVA 1NNUA 3MMPA 1LWNA 1OFUX 4YGYA 4NFYA 4BO1A 5KYVA 2BM8A 3AKYA 4BT3A 1Y4MA 1C0PA 4X1OA 4JOBA 3LOPA 3RPEA 4ESVA 1JVNA 3RRJA 2PPVA 4MUXA 1YA4A 1PR1A 3PR2B 2ZCJA 1OXUA 4AUMA 2C8LA 1T4CB 2ZBEA 3PEVA 3DZDA 4UUOA 5JZSA 2UXXA 4NJMA 3DOCA 2VP4A 2WLLA 4IGEA 3TM5A 4ZVLA 5FHQA 3DUFB 3TB4A 5AK6A 2DAPA 5EE9A 5LD2C 3PNQA 1HA3A 2B78A 2L18A 2XA9A 4F71A 2WQ7A 2GCEA 2FI1A 3V1MA 1NJ8A 3IEKA 2YV1A 1W0KA 2ALEA 2AFHE 2D3OW 2R7LA 3MMXA 3NCTA 1E2JA 2HA2A 3UVEA 2O2EA 4BO7A 4LC0A 1JU3A 2IX3A 4HTFB 2FPGB 2DVMA 4D7AA 1IY8A 3WISA 3QEAZ 1T9GS 2HO5A 3UB4A 1I6MA 3CCMF 2R6ZA 3EQZA 1JDBC 4FMTA 4WLOA 4AMYA 3GUVA 1B93A 2R44A 3GNQA 4FSDA 5FBRB 1FFGA 2XLBA 1F6BA 2OHOA 3MUEA 3V4RA 3TZ6A 4YT5A 1KZGB 5EIOA 1GTL1 4P4NA 4MOWA 4OJQA 2Q3HA 4FBGA 1A50B 1H2LA 4RK5A 5DF1A 3ESJA 4WCFB 5P8WA 2TMYA 1K8XB 3KTAB 3WYCA 3PVCA 3VYWA 3DA8A 4FFLA 2ON6A 1P7ZA 2XPCA 1Z0DA 4NL4H 4LRTB 5CX1A 1QYCA 3PPXA 4XFDA 2Q3JA 1TC1A 2Q28A 4JELA 5JSZA 3RTAA 4BQRA 3S1AB 2XA2A 1PSDA 3TLMA 1PEDA 1TVMA 4ARZB 5EGNA 2Y0IA 4AD8A 2GD6A 5KS2A 1V7ZA 4FLEA 1U97A 1ZW1A 4Z2YA 3BXOA 3GEBA 3QSYA 4HV4A 4BLWA 3R7DA 4BNZA 2WU3A 1ZNWA 1SD2A 2L2QA 3TW8B 1U2ZA 2C7RA 4LS3A 2N9UA 2VK2A 2NQ8A 3GYQA 3A2KA 4E51A 1PEAA 3V8RA 4PHHA 1FSZA 2IH2A 4O8ZA 4GPEA 2W11A 2KLBA 4UTRA 5GP1A 2FPKA 1PJAA 3OP1A 2I1WA 1E0KA 2WSMA 1P9OA 2RARA 3P9NA 4JU8A 4CT5A 3JRXA 2FG7C 1L7BA 1RCFA 4IX1A 3KSMA 3R7LA 5CT8A 3PUVA 1Y8QB 4YJHB 1WXQA 3ZDAA 1ZK2A 1UBUS 4ZGBA 1HWYA 1A7JA 4TTIA 3ZY2A 1XZGA 1R3DA 4QM7A 4EUEA 1TVKA 3ZXUB 2PZSA 3GLFB 2XUAA 5AYVA 3CW8X 1P2VA 4HH0A 3CH6A 2CEAA 3DZ8A 4IMJB 1O1YA 1QHTA 4DLYA 4HFJA 2PXCA 1LH0A 3WGIA 3FD5A 1OI7A 4U7PB 3UOWA 3IJEB 2QEXV 4CF3A 3DXFA 3TKYA 4LZJA 2VR1A 4NZPA 2O7VA 4GYJA 5TARA 1N6LA 4NWIA 4X95A 1VLJA 2BFAA 3MJDA 2XBLA 2WILA 1RM5A 4RZUA 4KITB 3PTLA 5DYWA 1IOZA 4DTCA 4R2JA 1TE2A 4F1JA 2FOXA 5DNAA 1VGQA 1KVTA 4UVCA 2C88A 3HN7A 4UUJC 1IBSA 1GT91 2EEZA 1Z08A 4GDMA 3CF4A 4G56A 2DSTA 3PNVA 2WM9B 1RADA 4CV3A 4X3OA 3ROFA 4TQDA 2WIKA 2IYZA 3DGEC 4W8OA 4PM4A 3O8QA 4HLUA 3LHSA 4FR5A 3BFPA 4BIMA 1YR9A 4FLMA 1W2BF 2XWBF 3WIDA 2EL7A 4JUBA 4Z86A 4FFVA 3DEJA 5J1SB 1SXJD 1K7XB 1H3EA 3GFQA 3U3RA 4ABMA 3JD1A 2PMCA 3LUCA 3ZQ4A 3QX3A 4HLNA 3B6ZA 2AI2A 4I66A 3AGPA 1V3QE 4RWEA 1N7IA 3EYAA 3ZZ0A 3QPAA 3EUEA 3HVHA 3KC2A 4EJ2A 5CVJA 5K4GA 1KYVA 2BFDB 3ETCA 4KTVE 3NMUC 1TQ4A 5CFZA 2QTZA 3FTDA 3TYXA 5K1ZA 2FPWA 5A2QM 1EGVB 3DEZA 2GLTA 4KQ6A 1ZVMA 3RTDA 3W7WA 2BJVA 3HYCA 2BR4A 3CR7A 2XQGA 2WWRA 1ZUNA 2RSLA 2PT5A 5AW8A 4DE5A 2ZF8A 1WHSB 1H4TA 5AUNB 2PV0A 3AM1A 3FVTA 1VC2A 3FB5C 3KZVA 4GX0A 4X1IA 3GHYA 3V97A 3PDWA 1QFSA 2N74A 3C90A 5IYZA 4IZ6A 3N86A 4JAVC 5AK4A 4TKVA 4C4PA 3RAJA 4CIDA 4E4TA 1E4EB 4CLEA 1VIBA 1P4HA 2XUKA 1VQ7V 5JQGF 4BE9A 3D31A 2BM9A 1EIWA 2OBYA 2ZJ6A 5EZYB 2PX6A 1QK4A 4DY4A 1KDRA 1LR1A 3HCEA 2GAOA 3S70A 2C04A 4JJAA 2REXB 4E13A 1HFJA 4AIRA 5KBYA 3KT3A 4TN1A 3ET5A 1PPJH 4RIEA 5D3ZA 1EUYA 1LW6E 2LW1A 1JI3A 1PM9A 4Y30A 1PV1A 3HB0A 2IQQA 4E21A 1A9QA 1SQGA 1LI7A 3UH1A 3KSBC 3P9XA 2ZAOA 5DI3B 1GM9A 3SZGA 4GX2A 1O03A 2IIVA 3N8GA 2Z0MA 4TLDA 4TZKA 1A95A 2VJMA 1DRWA 3GVCA 3FKSD 4S1NA 2VBIA 5BXYA 5B1BB 3GBSA 4BNGA 4O33A 1WXWA 4U1RA 4V2UA 1QQ7A 2VJDA 2PYLA 4B3MO 1IZ8A 4KC0A 3KX2A 3AFNA 3X0DA 4YCJA 3TD5A 1ILWA 4JTAB 3IE0A 2G80A 1L5LA 4XYLA 3OTWA 5LYYA 1R0ZA 2JDID 3VQWA 2AN9A 4Z0NA 2VF2A 2OYCA 3I9MA 1AKEA 4BFLA 3B6JA 1G4UR 1JDSA 3PGJA 5HKLA 1WTAA 4R50A 3WMRA 5H3CA 1RJGA 3Q2OA 1MJGM 1SOUA 3GR6A 3IE2A 3O8CA 2EBHX 4BQIA 1X7XA 2E76B 5A4MS 3TLGA 4X97A 4KWCA 3QF7A 3L8YA 2MSNA 1J0CA 2R7KA 2BEWB 1E0DA 2RMKA 1NHGA 5ER6A 1GAJA 2P4UA 3C7DB 3AZOA 5E4FA 1DKMA 2ORWA 4JLVA 1ZD2P 1SZJG 2WT8A 3K0CA 4Q3LA 2JEUA 3VMFB 4XPZA 5EAZA 1FX1A 4G9GA 3OBYA 3AERB 3CR8A 2O1XA 4HXEB 1YQQA 3AF2A 4KYIB 2F4VO 4CFYA 2EARA 4Q7KA 1Z4MA 1R6BX 5HMMA 4JI7B 2J9ZB 3S8MA 4IGIA 1OILA 4GEGA 3DC2A 1J42A 1EXNA 3SCZA 4F3KA 3ZH9B 4MV4A 2OZLA 1DG1G 1N0HA 4N03A 5IDVA 3PL5A 5EWMB 3JALB 3L0PA 5EY5B 4UTNA 3S4YA 1TW2A 3OU2A 4KE9A 1EJ0A 1ZSPA 3WGJA 3GFTA 3O85A 2F8LA 4XLZA 4PBSA 3GTZA 2GZ1A 2QJWA 2FZ4A 1PGPA 2YHSA 3DWFA 2ATCA 4CT4B 5KWJA 4PLCA 3OZTA 4WZZA 3LC7O 3BRSA 3I4CA 3VPCA 1W3EX 4EOGA 1UMBB 4X8LA 3L73H 3IP6A 2PX0A 4K3VA 1Q0SA 4QG3A 3V8EA 1T9DA 1Q90D 4TKUB 5TMPA 4LF4B 1SCJA 1OXBB 1HQYE 3FNHA 5ES4B 4BNKA 1ESEA 3ETGA 1XNJA 1WUJS 4TTQA 3WPWA 2GBFA 1T5BA 1Z4LA 5G1OA 3NVMB 3IERA 3U4GA 3UMFA 4HS4A 1PWYE 4UCSA 5EHXA 3U16A 2HQSA 2QWNB 1J7KA 1IOVA 2BFBA 3EIEA 4HYOA 5JOQA 4EX6A 1N6HA 4DA7A 5NULA 1V96A 4FW9A 3TDMA 2XD9A 5ALUA 1I10A 5HGJA 1IH8A 1F7VA 2GI4A 2HHCA 1JQKA 2Q2OA 1BH6A 3T0IA 5LL6P 1QTIA 1SEPA 1KMHB 3TRDA 1VIYA 4PSVA 4NCIA 2VYNA 1JG4A 5FDFA 4JSYA 1CUVA 5BUZA 1UKZA 2IOFA 5JC1A 3IIKA 1G20E 2OG1A 2R6AA 3CX8A 5FBQB 3R7AA 4XD7A 1R5JA 1KL7A 2AC7A 3EASA 2IHJA 3R3HA 4QGGA 2ZBGA 4WCDA 1F1JA 4ZEOA 2PJRA 5FA6A 1X42A 4HEJA 2F8SA 3IEVA 3SOZA 2VWGA 1C3EA 5DO9A 2ZNJA 4KFTA 4MKFA 1NH2B 3C3BA 1AJEA 4UJ5A 1AMOA 1E2KA 2GK7A 2VP6A 2XYVA 3F7VC 2AQ8A 1WEHA 1F0KA 2OT5A 4M98A 3OQIA 4DBLC 3KR2A 3GRZA 1AQUA 3FXAA 4FKMA 4EB6B 1RWVA 2IOYA 3HC7A 2H29A 4LE1A 4CLRB 5JWPA 3K0FB 3OFVA 1NU6A 4II3A 2YQ4A 3LAWA 1UQUA 4IDHA 4A0GA 2CSXA 2OCYC 3ND6A 1M6NA 3OT1B 2XUPA 3BM5A 2YEVA 1AQLA 4WXYB 3TLYA 1SQQH 3R24A 1Q17A 1Z9BA 2XJ4A 3OQVA 5L95A 2YDEA 1UPAA 3ZWNA 2VN8A 1X87A 1U9YA 3HDTA 3CLUC 4RSHA 3H16A 2R6JA 4XQEA 4E15A 4ZOBA 2EQ5A 1EGQA 2RAPA 3BGVA 3KL4A 1VG1A 2CV1A 3F4BA 2FN7A 4KHPO 1PZNA 1XHLA 3NHJA 2OTCA 4KL8S 2ZBDA 3H2ZA 3G9TA 5HFNA 1RXUA 3UB2A 2IFTA 3UKOA 4HUQB 5KYXB 1KJ9A 3EVDA 3WYGA 4BFVA 4OGLA 2HCBA 4YP0A 2OMKA 1N6KA 3H1EA 2PT9A 3P94A 1RC8A 3AH8A 2P5TB 3COPA 4WT7A 3MEQA 4HN9A 3ZD8A 3VNAA 5IZ4A 1ZTEA 1N1DA 1GNQA 5J59A 3TMKA 3HYSA 4CMKA 4HRVA 3BJRA 4RM3A 3GNTA 3CD6V 1QMPA 2FPIB 1JI0A 1FFCA 1J0EA 1NW3A 4WNAB 4OGFA 1X94A 5GONF 3CTMA 3G9ZA 4PGAA 5ADHA 2BMJA 4DG9A 2AW3A 3ILVA 1AD2A 5LJLA 5E95A 1PP9H 3KLPX 3UYLA 3A1CA 4D9JA 1JYFA 1D2AA 1V8BA 2XOKA 4S0ZA 1GQQA 4G0QA 3HY3A 5EHIA 3RYIB 3OUSA 4V1CI 3AG6A 4EQ6A 4N54A 1OYYA 1YZUA 1G4HA 4BBPA 3HXOA 4O5AA 2RC5A 1DV1A 5GAPK 3FHLA 1YK1A 2ZRMA 4BMNA 2ST1A 4IICA 4H35A 3Q4GA 4YRCA 5FLXA 1A32A 2H85A 3LDDA 1UI9A 4MB2A 4RY8A 4GOLD 5K2MA 4BMDA 4ZV7A 2WNIA 2QYTA 4OGKA 3G0DA 4JQSA 4DV5B 3ZVRA 1Y76A 1PNLA 1HGXA 1OA1A 2YJTD 4E1VA 2HZBA 2EZTA 4UVDA 4WFIA 1AMNA 2WV7A 5FX2A 2ADMA 2FJUA 1CDOA 3IAUA 5IVIA 1S8FA 3D8NA 4ALKA 1HNWB 3ELBA 4J9ZB 2HVJC 5IH3A 3QUWA 3GLIB 1LQUA 3G9QA 4X6LA 4ZOLB 1TZBA 1Y6FA 1HNZB 2J7PA 1L7RA 1E2PA 5CT6A 2JLXA 1VARA 621PA 2A14A 5JH7B 4EPVA 3Q7TA 3GLGB 1QIJA 3ZDYB 2O7SA 1NBMA 1SCDA 1OV6A 4KIJA 3AG2B 4F72A 3ZX5A 2XB8A 2VP0A 1ZD5A 3CW2A 1GD1O 4ID3A 1SOWA 4M1OA 2AN1A 1XZHA 3DEHA 4AG3A 1NFQA 1Y3DE 1PQ4A 5AO9A 4NOLA 3U26A 4DHWA 5AVKA 2PSSA 1YJWV 3C5CA 3LUPA 2OSBA 3FD6A 3DBVO 2QN1A 2XNKA 1E79A 2EDAA 2JCXA 4XCQA 3E9EA 4KXYA 1FP4B 4JITA 4J41A 3EYWA 3ZU2A 4AUKA 5FPHA 1ZZGA 1P5RA 1JLRA 4CQNA 4QGSA 4LX0A 2R6GA 1PYGA 2P5UA 3VTAA 1XZ8A 3ACDA 4QICA 1F8UA 1TNDA 3T35A 1R88A 1J2JA 1O9BA 4YRIA 3SC2A 2F1IA 2ENWA 1D8TA 4LXYA 1MB4A 1MO3A 3GGJA 3TXXA 1K0FA 2I4TA 4FM9A 4KFCA 2VHVA 4L73A 121PA 2QUZA 2X8LA 1Y80A 1EIZA 1GA1A 3BDVA 3UA3A 1T9CA 3S27A 3T1QA 4A27A 4RM2A 2ZDIA 2XEDA 2XQIA 2E89A 3GVPA 2JK0A 2PJUA 4M1ZA 2X0IA 1TUEA 1SKQA 2DWUA 4RH3A 3DEFA 4DCMA 1G6OA 4JLKA 3QKUA 4EQZA 4JNKA 2H1HA 1JEEA 4BLPA 3PNMA 2P4QA 3AXSA 3OIVA 3EDQA 1ZHHA 2QMHA 1DOAA 1DXYA 4RHTA 2GO7A 5FOQA 3JYQA 3OM3B 1US8A 2GVIA 1XDGA 4TWAA 4CE6A 4AZ3A 3ELDA 2BFNA 3DB1A 3CLHA 4DMGA 4V0LA 5TF4A 3E7DA 1L1EA 2D54A 3EIUA 2VUSA 1PJZA 3S0JA 4RK7A 4TTVA 2ZRHA 2OHXA 3MT8A 3TD2A 4M9QA 2WVJA 2CVHA 4M1YA 4G4SO 2BEVA 2RAVA 4Z9BA 5EJ9A 3RTEA 4KE8A 1D07A 4E11A 2VXCA 3EGWA 4FM0A 4CL0A 3LUFA 1B6RA 1T13A 2F8MA 4B5KA 1NH2D 2BEUB 1Z0SA 1MZPA 1NQOA 2FGKA 5GIPC 1O08A 1CLEA 2QWXA 4N9QA 2QL6A 4TT3G 5CLGA 5CFRA 4LDQA 3SBEA 4DIEA 1QO9A 4N48A 1PR3A 1YI8A 3ANYB 1NN0A 4EJMA 3QHDA 2ODPA 3MSXA 3D02A 4G86A 4ZVUA 3U7FB 1THMA 3I9V6 3L5KA 3UWPA 4KBFA 1DRJA 1M56B 1ZIYA 4H4DA 3UIEA 2I4MA 1XKQA 4LMRA 1JJ7A 1AS3A 4UAGA 4RMHA 3FBAA 2Y99A 1XTTA 4B7ZA 2I6FA 4QUKA 2A78A 1OWPA 1M7HA 2Q5EA 2OFPA 4GX1A 4JI2O 4WDRA 1EVIA 4YAIA 3DDCA 3AUXA 4QGBA 4O3MA 1XXHB 4J2HA 2W7TA 5GTIZ 2JIZA 4DQDA 3A4YA 1U7UA 3FUVA 1EDZA 3KEQA 4XOUA 2QIPA 2AMYA 1TYDE 5AHWA 4H59A 1XEXA 4B62A 3A4TA 1ZMRA 1U2PA 2HF9A 1BQZA 2J6HA 4DR6B 3HBNA 5CM8B 1H8ED 3TE6A 2NVUB 4NZYA 2ITCC 2MMGA 2JGEA 2F55A 4CL8A 2OA0A 3DYIA 5IAEA 1PZEA 3RUCA 1ZH4A 4F60A 2ZINA 3WKAA 5G4LA 4HDQB 1IIRA 2N1BA 4IH4A 4MVQA 2GZMA 3BD7A 3CCLF 1UBOS 2NU8A 2SHKA 3HYLA 3I4FA 4JLAA 3FFBA 2QYOA 5TMDA 1YHQF 4Z53A 3TVYA 3T3HA 3LK6A 1TOAA 4JGBA 3OEHA 1GGVA 4DWVA 4J29A 3S02A 3JVUA 4IL5A 3SYOA 3BFVA 2E5LB 1UK9A 2AFHB 3M4NA 1JKFA 4BRWA 1BGWA 2BMWA 2VEDA 4G4SP 5DNYB 2P4EA 3QPVA 2OTMA 4JI4O 1E59A 3JSAA 5TEWA 5T7BA 1RYDA 1M1YE 2JD1A 1NJGA 1A9TA 1QZZA 1YB5A 2FNAA 2ZJ4A 2H51A 4QUBA 2X3YA 4ISCA 4ZHYB 1NMZA 4Z3KA 2NZ8A 2QTGA 1QR6A 1VJ1A 3QXJA 2NXEA 2RFLA 4IZHA 1DC6A 3JV7A 4AZSA 1P2BA 1ZINA 4MVMA 1JG6A 3UT5A 4LCUC 4ZJZA 1PRYA 1NIPA 4S1VA 1X1TA 1EX7A 3WAJA 2OCIA 1XDDA 3AY0A 3M3PA 3NMUF 2PGNA 2VSFA 4J3JA 3CUYA 1I6LA 2JZCA 1K3FA 3MXTA 4RZXA 4PFKA 3IOYA 5BQXA 1FSPA 1OZHA 1U0FA 5JXJA 3ABMC 1DVRA 3V5NA 3OC6A 1MX9A 4QWMA 4QOHA 4YUYA 4GNRA 3VBCA 1W85A 1GRVA 3OBWA 3GJTA 1MB3A 2GOYA 3H3XA 5L4SA 1BWSA 1ZGJA 3BFXA 1ARZA 2H2AA 4ND4A 4OK6A 1PZHA 5E8RA 2AN4A 1WMSA 1NVVQ 4MVJH 2I99A 4EGFA 5JSHA 1EZZA 3QZUA 1OE0A 3L7KA 1QB7A 3F6EX 4A5OA 1R4MB 2Q4BA 1TT7A 3IUBA 4L6AA 1Z4JA 3TRHA 3AG3B 3TCUA 1TD9A 5EJ8A 2Q46A 2Z2XA 2PI5A 5CLQA 1SXIA 2JI9A 3G0GA 4CMEC 3TGLA 1Z22A 2P0EA 5CT9A 3RT9A 3MS4A 1KYWA 4HZGA 4BE4A 4WZBA 4OUDB 4FCWA 1S2NA 2VJBA 3VQYA 4IDAA 4B8ZA 4YMUA 1Z18A 1U99A 2CY0A 3A58B 2W6JG 2I2DA 5A4IS 2JVIA 5IFLA 1DQYA 4IW3B 8AT1A 1ZIDA 2PGXA 2YWBA 3B5IA 1BA2A 2OOSA 3F5FA 1FMFA 3R77A 4BFZA 2WKPA 3DLTA 2B3DA 4FYPA 1NV8A 1IMJA 3WRYC 3N0TA 2I4RA 5L3QA 5CVEA 3GLTA 1DAHA 2G88A 3SDZA 4EBFA 4EYOA 2JFBA 5IAJA 5CB4B 4JQZA 4L8GA 5B2ZA 2BZSA 5A04A 1X7YB 4N8SA 4B44A 3S40A 5I9LA 4BAGA 4K28A 1DAIA 1KH2A 4NJEA 1WOMA 2W4IA 4URFA 1S1CA 3FGOA 4ZT4A 5C8YA 4DL9A 4D6TH 2AD1A 1JAYA 2KYRA 1Y1QA 3KDAA 3I2YX 3R65A 1RRMA 2PWZA 2PU5A 1GO2A 4OYYA 4RSGA 4XIFA 2H3OA 1JLMA 3T5PA 1ZWLA 4WN9A 3U10A 2VVTA 3QFFA 3FWHA 1O3YA 3L06A 2EIJB 4YPFA 5ALZA 3DC6A 5CFPA 1R8JA 1OT3A 1T0KB 2IS2A 1ZOPA 3O5AA 4UBNA 1F7UA 4ZI2A 5G4UC 3EIQA 4IIFA 3T7SA 2Y1CA 4QTUB 4U2FA 4DDTA 5D3MA 4YHHB 1LSJA 4F92B 1ID8A 5D6OA 5LQMA 1USIA 4UU7A 4DCOA 4U3FH 1FK8A 4G4GA 3BH0A 4FJ1A 1QPZA 4G9BA 2R9VA 5H9VA 5I01A 1CNMA 3EVNA 1KC1A 3ZY3A 4H6VA 4MLPA 5JDIA 2Q0SA 3OFNG 3LLMA 1ORQC 1GYQA 3VU0A 3F3YA 3K5WA 2NU6B 5FH9A 4BFUA 2O8DB 3L0DA 1NXVA 4ZCIA 3HJGA 4L7QA 1QORA 2DN9A 3HRHA 4HADA 1D2GA 1OLXB 1IZYA 1YGPA 3I6BA 3ACBA 3EEYA 3H0EA 4DV7B 2XHEA 3ZCCA 1TCUA 2HK8A 3CZRA 2R70A 1RAHA 3FWNA 3ZE7A 3JQQA 3W04A 3KYIB 1K2WA 3D6HA 1TTQB 3M6LA 3JW8A 4AJLA 1VK3A 4HNGA 1E2DA 4YXWA 1SKUA 2R8EA 5TPZD 2KQXA 5G02A 4AY4A 4EHDA 5E1MA 2QQGA 3IHWA 1OAKA 1BVYF 4GL4A 3VVCA 4M7OA 3GCDA 2ZQMA 4ALJA 3GU3A 2PYIA 3F5WC 4J43A 5G4KA 1S3SA 2J08A 1EINA 4FMBB 5FPTA 4RCVA 3UHJA 3EGXA 1RKXA 2QRGA 1K1EA 2GSWA 1GADO 2E87A 5EJ7A 2PNJA 3GN2A 2ZYDA 1DC5A 2H2HA 2ZSJA 2P9EA 3C9RA 1TT5A 5C35A 1CEQA 2VGMA 2Q99A 3UCSC 3R7NA 1U7TA 4WUTA 3UC9A 2CDCA 3QVGA 2WALA 3K73O 3HZRA 1JPUA 1YAHA 2RNBA 1S7CA 3IAS1 1W1UA 4PGFA 5A06A 3NI2A 3WWPA 1Z3IX 4R2HA 3VH1A 2VTVA 3ZWCA 3MDOA 2FFQA 4RVNA 2QP4A 4RBNA 2DH6A 1V9CA 2ZREA 4YRTA 1A04A 3H11A 1UFKA 1NF3A 2WIGA 5TIIA 1OXSC 1OIVA 5BWMA 4MWDA 3LY8A 2OZBA 3AI7A 3HZOA 4G5RA 1ZMBA 2ZSAA 3WIEA 1X1RA 4G4XA 2FUG6 4BVJA 4YJ3A 3I92A 4RA9A 3RASA 4RO2A 5HP8A 1JXAA 3Q15C 4UU1A 3NK7A 2WWHA 2Q1WA 3GFBA 3BYZA 5HXUA 5CGQB 2BE9A 1NVAA 1G1AA 4KAAA 2M1ZA 2OUKA 1DFGA 1L5ZA 3QE2A 1WCIB 4MV1A 3FTFA 3L8MA 3RYHA 1G8FA 2Y6UA 4MVJD 4R6ZA 1GYRA 3T3IA 1W88A 2HXGA 1DX6A 2B83A 4TLBA 2ZU6A 3VU1A 3W90A 1WW2A 2ID8A 1KO7A 2A84A 1ODIA 3FI9A 1V25A 2X5KO 3CNEA 2EJWA 1NULA 3UXHA 3N9IA 4R1OA 1QWSA 3FUTA 1L5RA 3ZDXB 4CGZA 4KQHA 2ONJA 2PR7A 1Q0QA 4HNQA 2VJQA 3WTCA 4WBNA 4W1SA 2PA0A 2B7BA 4F2GA 4IV8A 4FLWA 1E1LA 2J9FB 4ZI5A 1UANA 4NR1A 2HNBA 4MPDA 3WGOA 3CUTA 721PA 5IJ9B 3FKJA 3M4ZA 2WU4A 3IDOA 2PLRA 1LUVA 4TVKA 1LLUA 2GBLA 1XVAA 5B58T 1EXVA 13PKA 1FY2A 2O8FB 3ONDA 5E6SA 1PFKA 4QU9A 1OCZB 3KU4A 5GZ3A 1MX5A 1XPRA 4Q9KA 3ZE8A 3DFKA 4ILKA 1MOFA 2XAFA 2C3PA 4Z7NB 3HDVA 5F35A 4Q4LA 4F0JA 2AJTA 2H2WA 4OXXA 3JYNA 4R01A 2MIIA 1JEDA 3NHSA 3CYFA 2Q9BA 4NULA 2DYSB 1ZH2A 1K89A 4OGQB 4Q7LA 1BE0A 2NSHA 4KMMA 5LCXA 5FLEX 1VSTA 1ULZA 3AEUA 1LI4A 1Y5MA 5LZ5A 2FWAA 3O8RA 5JZMA 2MQEA 2DHQA 3S2GA 3ZHZA 2FW9A 2HSZA 3L0OA 3KVOA 3U3KA 3IMKA 2J67A 4II7A 2J59A 5IVDA 2C7BA 4Z4GA 3OVMA 3T6KA 1KVQA 3L9DA 1N8TA 2VQEB 2H8EA 4J3NA 1FS6A 2ADFA 4OJYA 5EG5A 4CEIA 3IP7A 2XGMA 1GKIA 3R40A 1DELA 1KI4A 4FFSA 3ZX4A 3PUJA 2WMYA 4A0RA 2E48A 5CN0A 1N78A 1KJ8A 3KOUA 4DVJA 1ORWA 3Q8KA 1K5GA 4OB7A 1IHUA 2XVYA 2UUPA 3V3TA 3FSRA 4QDOA 3PQ6A 4WFQA 4YVFA 5CVUA 2QTAA 1G20B 3SKVA 2Z57A 3KBOA 1SB9A 3LGXA 1GCAA 2ZG6A 1O4WA 5KJCA 1UOQA 1ZG3A 4B3DA 1TAQA 2P6OA 3DE3X 3OCUA 5KQMA 2GO1A 3EAFA 3RTCA 3U7EB 2GJSA 1FXKB 1UBMS 2IZ6A 1MOZA 4YK7A 1RXWA 2OCKA 2P79A 3HJBA 4HVAA 3G23A