5JVDB

Tubulin-tub092 complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
429
structure length
425
Chain Sequence
b'REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Antivascular and antitumor properties of the tubulin-binding chalcone TUB091.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 167
structure length 425
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jvdB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5jvdB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5jvdB01
4I50A 3VO9A 3RYIB 1TVKB 3N2KB 5KX5B 5EYPB 4O4JA 3RYFB 5IJ9B 2R6R1 3N2GB 3E22A 3WGLA 4HNAA 4IIJB 4X20A 5CA1B 5LOVB 2VAMA 4LNUB 5JH7A 4I4TB 4IHJB 5KMGB 2BTQB 2VAWA 3HKEA 4DRXB 4FFBA 4EB6B 5CB4A 3UT5A 4X1IB 4TV9B 4X1YB 5BMVB 3JAWB 2Q1YA 5CA0B 5LXTA 4F6RA 3JAKB 5FNVB 5LP6B 4O4HB 2RHHA 1SA0B 5C8YA 4U39A 5GONB 3JARB 4ZI7A 1JFFA 3VPAA 4O4LA 2Q1XA 1FFXA 5ITZB 5JQGA 3R4VA 4YJ3B 2VAPA 4TUYB 4ZOLA 5JCOC 3RYCB 2RHJA 5LP6C 1W5BA 2XKBA 4U3JA 5IJ0A 4I55B 5LA6B 5LYJB 4YJ2A 4X1KB 4O2BB 3JALA 3VO8A 3HKDB 4TV8B 1Z5VA 3JASA 4EI7A 3M89A 4ZHQA 5JCOA 1W581 3CB2A 1Z5WA 3JATA 3HKBA 5JVDA 4F6RB 4WBNB 5J2UB 3C8LA 3ZBQA 4O2AA 5C8YB 5EZYA 3RYHB 3RYIA 5J2TB 3HKCB 5KX5A 5EYPA 4I50B 4XCQA 3RYFA 5IJ9A 3N2GA 2GVIA 3WGNA 4IIJA 5CA1A 2R751 5LOVA 4O4JB 4LNUA 3WGMA 5MN5A 4IHJA 5KMGA 1OFUA 1RQ2A 2BTQA 3E22B 4HNAB 4X20B 4DRXA 4EB6A 5JH7B 4X1IA 4TV9A 4X1YA 3HKEB 1RLUA 3JAWA 4O4IA 4FFBB 5CA0A 5CB4B 3UT5B 5IYZA 4M8IA 3JAKA 5FNVA 5LP6A 1W5AA 1TUBA 1SA0A 3JATB 4DXDA 5EIBD 5GONA 3JARA 5LXTB 4B46A 5ITZA 3ZIDA 2RHLA 4ZI7B 4YJ3A 1JFFB 1TVKA 3N2KA 4EI8A 4O4LB 4TUYA 5MN4A 3RYCA 1W5FA 4KWEA 3VOBA 1FFXB 3V3TA 5JQGB 2BTOA 4I55A 5LA6A 5LYJA 4ZOLB 3VOAA 5MN6A 4U3JB 5IJ0B 4X1KA 4O2BA 4I4TA 2RHOA 3HKDA 4TV8A 1RQ7A 4YJ2B 4EI9A 1W59A 3ZBPA 2XKAA 3M8KA 3JALB 3WGJA 5BMVA 3JASB 1W5EA 4O4IB 1FSZA 4ZHQB 5IYZB 4WBNA 5J2UA 1TUBB 4O4HA 3HKBB 5JVDB 3RYHA 5M7EA 3RB8A 3WGKA 4B45A 5J2TA 2VXYA 3HKCA 4O2AB 5EIBC 5EZYB 4E6EA
chains in the Genus database with same CATH superfamily
1QO7A 1DO2A 1ZP6A 1RCUA 2AOTB 2YVQA 1OFVA 3MGCA 1UZAA 1F4MA 1QFYA 3BWDD 3WLNA 1E32A 5JSZA 4MQFA 2WE8A 2OZEA 5K8UA 4YQFA 4HWRA 4UU0A 1JE0A 3Q10A 3M84A 2ZB2A 5KWSA 4RZQA 3VA7A 2Z2XA 3WBJA 1EUDA 3GLTA 1NUHA 3BFPA 4D4KA 5IDVA 4O4JB 1PG0A 3WGMA 4JAAA 1M1KH 1N2HA 3WOVA 1RYZA 4TM8A 3L07A 5A9SB 5IJWA 4A5UB 3PRKE 4QC2A 4X54A 3MC1A 2J3EA 4U2DA 5HBGA 4P82A 2EEPA 1VTKA 4U1RA 3WI7A 5IF3A 4XE5A 5E1DA 4X00A 1MX3A 4GBGA 1I33A 5TV2A 3O8LA 1JD1A 5KKCA 3SLKA 3L6CA 4IFEA 4LAFA 5EN4A 4EPWA 2J31A 1KP3A 2Q5EA 3QUBA 3PYXA 1XXLA 4MX8A 1H69A 3D4PA 1FFGA 3QUAA 4KQJA 3IBSA 3P96A 4XASA 3HO6A 2FSVC 4EARA 3LSUA 3RUDA 3ANYB 3P4XA 3ESDA 4BEVA 1QX3A 3P9PA 1KDOA 2VAPA 2ORIA 4FT2A 1PDWA 2WM8A 2ZRPA 4JYAB 2GX6A 1RNLA 1IHDA 3C8MA 3FAKA 1ZISA 3QNEA 1WJGA 3S1AA 1X0VA 1GGKA 4RIHA 1OKKD 2BFBB 5F2KA 4X88A 4CKYA 3QPCA 1XZFA 3O95A 4MWZA 2CV2A 4BVRA 4WF9V 3VR4D 4KODA 4MVQA 1JSZA 5BSKA 1C50A 1TQ8A 3RYCA 3ZCCA 4FM2A 1T3TA 1M76A 3E58A 1F6BA 4R8VA 1Z6XA 1KI8A 4D6YA 1UDAA 2QE6A 1YI0A 2FEMA 2I1VB 4QT0A 5TVGA 2ZUSA 4JFRA 4DBLE 4GO1A 1WD7A 3RS8A 1J09A 3WGGA 3GL9A 1R7RA 4TYQA 3T15A 4PELA 3IDAA 4DLKA 4O33A 4PI2A 3U0ZA 1L4YA 3UJ3X 3QXSA 4MRRA 2ZE7A 3VNSA 1YA4A 1HE2A 1ZUHA 4MR7B 3A4NA 3HSYA 1YC5A 3QFCA 4TL6A 2P9TA 3A9UA 1QGDA 2NZ8A 5EZQA 4LBZA 1WTCA 3BQNB 3KSRA 2A0FA 3ZJVA 2XWJI 2FHSA 2M6SA 3AK2A 4N7MA 2PFKA 3HJFA 5KZMB 1RPOA 3HQ4O 3ICEA 1Q95A 3F8WA 2YVLA 4YXWA 3PHLA 1U81A 2NZWA 4DUYO 4FIDA 2NZXA 2O8VA 3AGQA 4KSCA 4WLNA 3GN2A 2ON6A 4GICA 1E9FA 3JWJA 3I4LA 4WXRA 5DF1A 3UB2A 4C8GA 3D8SA 1H1TA 2O0MA 3CC7V 1AHIA 4TVOA 1RAAA 4YONB 4L8FA 1WUJS 3O85A 2GD0A 3QKWA 1QYWA 2NZUG 4B45A 1JI3A 2GRAA 1CETA 1PD0A 2V7PA 4DO2A 3QENA 5ERYA 2ZBPA 5CA1B 3GGDA 3EZFA 4U7DA 5AVSA 4U63A 3TR0A 1V45E 2ZT9B 2W6ZA 4MW7A 4BBAA 3FA2A 2Y4OA 3CR7A 3EH2A 2EGUA 3ZRWB 2A7QA 5BPFA 4TVKA 2QTCA 2Z9CA 3RVNA 1EJ6A 3DMNA 3LPNA 4XRGA 4DMRA 1EH5A 4C7OA 3H8VA 4BT5A 2BFFA 1G3QA 2X42A 4J1TA 3RQIA 2A0UA 3EVZA 1QM5A 3FMPB 4DR7O 3I45A 2FJPA 3T12A 1YITV 3C5CA 3UC9A 1RDFA 1MPXA 4QIWF 3TXAA 2EJTA 3DSRA 2B8JA 4NXMB 1ZK1A 3D6JA 1KJYA 1JYSA 1RQ7A 3SFTA 3UBTA 2WMYA 2C9BA 1TXGA 4DR5B 3BKXA 4MK4A 4IX9A 5EA2A 3L8MA 4P34A 5DM6V 1Q7YH 4OAPA 2NU9A 3LX8A 4BR6A 1XU4A 3ANNA 5LMZA 3HG7A 1IULA 1I1OA 2H1LA 4F4IA 3NGMA 2DH5A 1UJBA 3NHBA 3VOTA 4FEYA 2CW4A 3TLZA 2AXNA 5FH9A 3L6EA 3ZWOA 1PS8A 5J47A 2UYCA 1L5ZA 4HGQA 1VG8A 4PS0A 3AUFA 4ASUD 4E03A 5DYYA 1U98A 3S0HA 1ZI6A 4LNHA 1L0NH 1MBZA 2CLMB 4BMXA 3VR2D 1PO7A 3IUEA 2EL7A 3V1UA 2RB4A 1PTJA 4IG9A 3SPCA 3ZN2A 4AROA 3EXHB 4ZCRA 1EMDA 4ARIA 4KHPB 2VEOA 2W5UA 2ODPA 2OLEA 3VBCA 3PXUA 1FP4A 3T5DA 4ZVLA 3WL5A 2WQZA 1X59A 1ADCA 1RMYA 3ZH9B 3H99A 4BIZA 5IZCC 1J5EO 2PRZA 3N6VA 1YULA 4R81A 4YAEA 4JNCA 3C6QA 2F1RA 2YWRA 4X63A 1D2GA 2PD4A 4GBED 2VBGA 3NH6A 1IJBA 2IH5A 3ZY5A 4XARA 4LV8B 1I7SB 1LF0A 4QTXA 4X61A 3Q88A 4A16A 1CEZA 5EKSA 5FPTA 3JY6A 3GMDA 1D1SA 3RO7A 1WCWA 2V7QD 3IBTA 2GMWA 3VYTB 1VEWA 4EBFA 1OV6A 2VH5R 3L7YA 5GM2A 1DKQA 2QN2A 1WNSA 1W4LA 1IK4A 3K2IA 3A6HA 4EG0A 9LDBA 3OPQA 1PNLA 2FWMX 1PEDA 1HTTA 1XQWA 2XOKA 3SZMA 3DVSX 3M82A 4MKGA 3TGPA 1O5IA 2Y1XA 2O0LA 4QKQA 4BMYA 4CI9A 3PXGA 3O26A 4J0KA 5KDOA 2OV2A 1ZA1A 1S2MA 3GXOA 1ZNZA 2F17A 1HMPA 3ZMVA 3SJBA 1GZ6A 3FG9A 3W7SA 2NZ2A 3K73O 2P5SA 1AO0A 4RGQA 3S2YA 9ABPA 3N70A 4K7JA 3DV2A 1F9EA 4FJ1A 3L1UA 3PUYA 2QGFA 1CIJA 1FNNA 3ZBQA 1JAIA 4O3FA 1YS7A 4HNSA 3OWOA 4FMDF 2BP7A 1NVPB 4P9OA 1XZJA 3BMQB 4LS3A 2Z98A 2UXNA 3N0WA 3SHTA 5IN5A 4NATA 3FVRA 2VAXA 1E6CA 2QTGA 4WMLA 2P3OA 3BWVA 1EM1A 4OLJA 1UC4B 4Q6GA 1JFSA 1C0IA 3QX8A 3WRWA 3OLCX 3A3KA 5BOSB 3ILHA 2VR1A 2GAFA 4LRSB 2JW5A 4MV6A 3H83A 3LDTA 3PGMA 1NBIA 3TZ6A 4CLXA 2POQX 4P33A 4ZT3A 2A5YB 3C5EA 1ZWLA 1P2GA 4XB1A 2PUHA 2ZRBA 1CRPA 3ZLBA 1PUJA 3KB1A 1XEXB 1U0BB 4JI0B 3ESAA 5AM3A 1PNKA 1I3NA 4RF4A 3IEKA 3W5SA 4YJHB 1HOTA 3WAJA 4WEQA 2ZNIA 4LE1A 3HVRA 3HVHA 5CFZA 2A1UA 4U7FA 5JFOA 1NLZA 4XCVA 3R9XA 1V4NA 1TGVA 1G7RA 5E3JA 3K20A 2E4XA 2REXB 3FCOA 5E2AA 3E22B 1C7FA 1JR2A 2C99A 5HM6A 2IYAA 2BFEB 3UJ9A 3PX3A 1OH6A 5CCEA 4RE6A 2GZRA 1RIFA 2IH1C 5A2QN 4MLPA 5EPEA 3KJGA 2G70A 2GSDA 3G8CA 5JO0A 5BUQA 1XTUA 1XAIA 3OR6C 3KDAA 2P06A 2L0XA 1L4EA 4K26A 1QBGA 2EIMC 1GPDG 5H59A 1SEPA 3ZCUA 4CUJA 2O5EA 3BX1A 3RSZA 3TNJA 5EP2A 3H2YA 4IDBA 3GNLA 4DGQA 2ZYIA 1SHUX 1BX1A 1Y81A 4QATA 4MJ7A 4QT4A 3WV5A 4RM3A 2Y2UA 1EM8B 2GPYA 1I3OA 2QRUA 3V7UA 2EIJB 2Q6KA 3PXBA 4ARVA 5LA6B 3BWYA 2ZOVA 4E70A 3ZDRA 1QGZA 3PWZA 1WLSA 1CXZA 2B4RO 4GX0A 4CL8A 3OQJA 4KKVA 2PJDA 4BIOA 2ADPA 1U0JA 4PA6A 2BGLA 2OENG 1U1CA 2CD9A 5M2QA 1YHZA 1FOEB 3AINA 3CY6A 5JYDA 3PC4A 3UOGA 2XRMA 1R8QA 4YJFB 5EQDA 2C4UA 2ZJ1A 5HPYB 3A4TA 3M9WA 2PZLA 3A6JA 4BYMA 2DG2A 2WLJA 2VK8A 4MS3B 1X25A 4G4IA 3ROXA 1XK6A 4LJLA 3HUFA 2GYUA 4RFSB 1HE4A 2G71A 5BV8A 4ASUG 1PG5A 5ANRB 3QWIA 3HP4A 3HJTA 4DLYA 4PXAA 4DNPA 1SB9A 3FDZB 2DFPA 4DB2A 1GTZA 2QPOA 3TGLA 4EPRA 2H2DA 1L7BA 1G59A 5EHIA 4BVJA 3ICXA 4DJEC 1HOXA 1NQUA 3ZQUA 4UM8B 4RPGA 1V8FA 1AKWA 4M3NA 2V0GA 2HRUA 2R751 4OSPA 2Q99A 4FDMA 4ZWNA 1UWKA 2FPXA 2R25B 2IY8A 4HXEB 1J1IA 2X4GA 1NA5A 2C2WA 1JHOA 3WP0A 1P8AA 3H9JA 3HL4A 2X2EA 1TRKA 4QWWA 2XWSA 4PRZA 2WR8A 5JQWA 4ZARA 4LBVA 2V7QG 4O1IA 3K08A 2BDUA 1SEVA 3AU9A 4K9DA 5ELMA 2ZIXA 3OZDA 1OOEA 3FZGA 3OUUA 5J59A 1H8EA 2XMQA 4JTAB 3J81k 3VZBA 1WLYA 1YOVA 1NJFA 4ZT7A 4NS1A 4JASB 1WA5A 2WW8A 5KHJA 2OP1A 3GRYA 5IPFA 4CMKA 3DOEA 4G09A 1KC8W 3VYVA 3L8FA 4KTVE 1F2UA 3E9MA 5GJCA 3VVMA 1FC0A 1MB9A 1HC7A 4LISA 1DQSA 4PQFA 1FDTA 4G9BA 3FBWA 4MMXB 2IPAB 2C7BA 3PNKA 1KB9F 3X2EA 3TCXB 2CH7A 1DUSA 3RT3C 1A8IA 2CBZA 3QPWA 2WJPA 5DK4A 1MF7A 1E1LA 1E3WA 5LZ9A 3ZDDA 2CXOA 4YMWA 3ZP4A 2JHCA 3D7MA 3E9NA 4PDRA 3IKLA 2PTHA 4GZ6A 2PBZA 2JJ1D 4IH9A 3SYCA 4PZPA 5AVWA 1GNSA 2P5OA 1YVUA 4ONEA 3TJRA 1T91A 3I01A 5C1BA 1P2FA 2O0KA 5HG0A 5ES3A 1HLDA 5FX2A 4DHEA 3I30X 4TMVA 1PR2A 2DLCX 1PZNA 1G1XB 1J99A 2AJLI 2IQQA 3HBAA 3IQEA 4DIUA 1GN9A 2JL1A 3BEOA 1DTWB 4A23A 4OU4A 5LBTA 2XXBA 5JCJA 1WSAA 4FZ5A 1Q21A 5IYDO 3EIHA 4ZHVA 2C0PA 3KWMA 1E1MA 4PGGA 1Y6FA 1A69A 4Q4AB 2JLRA 4W5TA 4JXXA 4CTKA 1GU0A 3ZY2A 1H2BA 1X2BA 4P86A 3HPLC 3G5MA 2QKCA 3I1IA 4MKZA 1RXCA 2QKSA 3KCXA 4WH0A 2NW6A 4BQEA 3L4KA 1PR9A 3ZI7A 4Z54A 4YO8A 5HJEA 5HIKA 2X0RA 2VXYA 4X8HA 1IPFA 1X1SA 4NBKA 3RSFA 1H0SA 1OBFO 4CQLA 1LTQA 3MA0A 1DAFA 2YZNA 1XCPA 3D8BA 4YMIA 4DVGA 2CSLA 2VCYA 5AHWA 3EARA 4KITB 2HOQA 3IVCA 2C2XA 3RC2A 3EBLA 1U97A 3NT2A 1JG7A 2GEDA 5F2NA 4ZT2A 2H8KA 4W63A 3Q1KA 4MA5A 3CLHA 4QFBA 1NHGA 1WF6A 3V00A 1XZQA 4MZDA 1IQ0A 2Q2WA 2I65A 2RBKA 2D5AA 5C0OE 4J1QA 3G82C 1R6DA 4ZCIA 3UGKA 1USWA 2ZYTX 2FOIA 3NLLA 4CUZA 2PVSA 4K0RA 4WJLA 1JECA 3WQSB 3ZQJA 4B2IA 2JA1A 1KY5A 1RMQA 3LY7A 3OE5A 3EAGA 4JLBA 4NU5A 2VHYA 1YTFD 3SC2B 2WUDA 1OFIA 3AJRA 4EW3A 3ER8A 4M0EA 5JAUA 4H37A 1IM2A 3KXLA 5JXJA 3NJ4A 3KSMA 4FQ5A 2CTQA 2B8WA 2B4YA 5I8WA 4R41A 5H16A 2R8XA 2KTVA 4I1RA 4G01B 1ZS9A 1KH2A 5J4LA 3B2EE 3V1LA 2DPGA 1KERA 1LRJA 1T5TA 3CBGA 3GVCA 5JS8A 2O8CB 1VPTA 1V5FA 1QU7A 2WTXA 4DNFA 1VKHA 3LT5A 1EINA 1MC5A 3VTAA 2GCPA 1E20A 3NXKA 4CC5A 1RKVA 3G2NA 2XRFA 3CD6V 3WKEA 4DF3A 3ZCVA 3T35A 5DLEA 5C34B 4GPIB 4EO4A 2BFPA 13PKA 1XDUA 4H60A 5EIAA 3QX9A 2A5JA 5AUOB 2WIGA 3NJ8A 2FDCA 1EWVA 4J7JA 5FDFA 2WMDA 1PNRA 1R0SA 2WJZB 4GI1A 2JVJA 1HZZC 3H0EA 4YP0A 3F5MA 1SXJA 4ZGBA 3ENNA 4I5GA 3MT9A 5HJ7A 4V1CB 3DDCA 2RGYA 3TNFA 2H7VA 3TIGA 5AI9A 3V1NA 1V9PA 2ZYHA 4BX0A 2GM5A 4RK5A 4F91B 2WLLB 1ODIA 2VHEA 1KVUA 4OP1A 4LJ6A 5FADA 2AQHA 2O19A 4ZO4A 3CX8A 3KQHA 4JI4O 4PSUA 1QRUA 3H4IA 2GKGA 4RTLA 3FMFA 4ZCQA 1GAJA 4M98A 3M34A 3GG9A 4P3OA 2VQEB 4X3PA 2F8TA 4JZ2A 4Q6BA 5B2EA 1ZKDA 1MC1A 1PFGA 4A4DA 1LCIA 2HFKA 4UHBA 3AVUA 2FN4A 2CL6X 4JEHA 3CE2A 2W93A 2NVBA 2ORYA 1V4BA 1B8UA 3RC9A 4CQNA 2QWOB 1OCOB 4PG7A 1FTYA 1RHMA 4WGGA 3OF3A 2BCCH 3ABMB 2C58A 3RFUA 2I91A 2WZQA 2Q07A 2Y99A 4EKDA 5DV9A 5CD1A 3VNUA 2GCOA 1P60A 3PCXA 1C7ZA 1DC5A 4DXAA 4ZHYB 4ZCTA 1Z88A 4G0UA 5E6RB 1TM3E 5BQFA 4XTRA 4DW0A 1WO8A 1UJ5A 3D3EA 3KHKA 2OXEA 5IDXA 2B4TO 3KDSE 4LX0A 1GXSB 5BSFA 3LUDA 1ZR2A 4F3CA 3WLSA 4A8JB 3SHVA 4ZYWA 1KY3A 1NBMD 2AUTA 1M90H 1Z7EA 2WK1A 4AIRA 2DHRA 2IG8A 3HU1A 3OD5A 4DQUA 3FOAA 3FYDA 4ZQBA 2YL2A 4CMGA 1OX6A 3U61B 2JJ1G 3F8TA 4ZYTA 3EOAI 3ZBTA 2H48A 2OB2A 2QI9C 3V8BA 4G4VA 3PCRB 1XA4A 3H9EO 5KAPA 1CYEA 4ICIA 5F2VO 4C4OA 1Z7GA 1K68A 2FZGA 1DG9A 2HLDD 3D6HA 3B3JA 4QJ3A 3H01A 1SXGA 4BQFA 5E1OA 2WSSA 3U56A 2QX9A 2RHWA 4N49A 4WADA 3B3GA 4BATA 1DO0A 1BXRB 2QMZA 3FZNA 3CZ9A 3A0RA 1YZKA 3E1SA 2PLNA 4H2DA 4P7BA 4WKCA 2FWAA 1N1DA 4AJOA 4IWYA 3WOHA 3CSXA 1SCNE 5AVXA 4J91A 4WCFA 2UZ0A 2K6GA 4J0EA 1G6HA 2FF7A 1XLWA 4RL4A 1R8XA 2FPLA 1LUAA 3NYWA 4L4UA 4EKYA 1WCYA 2ZSJA 1ZEMA 4QJ4A 4N8EA 3KZNA 3AKZA 3F6SA 2TRSB 5BYBA 2CNDA 3RJMA 3OOSA 3TH5A 4NXNO 2WJHA 3BREA 4GUNA 4ZIRA 1EUZA 2GBFA 1HZJA 4XTCS 1Y5NA 4KR7A 2PQMA 3H11B 1RRKA 3P9SA 2JH9A 2OHJA 3HZHA 1GLGA 5DK6A 4NSNA 1QHGA 5JAPA 1F0KA 3DZHA 4OJKA 1SESA 1S72V 1ZOIA 3H1IH 2JIPA 5DCLA 5DXFA 1YQGA 2DUWA 4JU9A 3LCJA 4YT5A 5KKNB 3MPUA 5E3HA 5F3DA 3H6GA 3EYAA 2J5BA 5K4AA 4Q3OA 2ONCA 4K3VA 4M1EA 1WVGA 2NO7A 4IP0A 1ILWA 2PO7A 5A5GA 2PMWB 5L95A 3ZWBA 1KH1A 5KHGA 2R2GA 2XBUA 5CGZA 5I9MA 3THOA 5LQMA 4IL6Z 1ZFNA 3NI2A 4LDJA 1CUIA 5CH3A 1TF7A 1BHQ1 2FZ4A 3TZEA 4BQNA 3STHA 4PNHA 1UBMS 1KEUA 1YJWF 3RPEA 2WF5A 2VP5A 4H59A 1M6VB 2Q45A 4I6JA 4BNVA 2QTVA 2E0IA 4NJMB 2O1XA 1OC2A 2BN4A 4EYQA 1C8VB 3TO5A 3KPJA 2PWZA 2ITDC 1Z35A 4XUEA 4K3AA 2CDYA 5AKEA 3Q41A 1TPZA 5KHLB 1T9HA 3ELDA 4HWTA 4D79A 1QU9A 4OBBA 3QLUC 3ZW8A 3EE6A 5ALMA 2I8CA 1NY6A 3HPRA 3I04M 4XJTA 3AFHA 5JSQA 4WZAE 3ZDFA 1LTKA 3K0CA 4FVMA 4FCVA 1OVGA 4NMHA 4MTLA 1FVHA 3FVQA 1XBLA 5IDJA 1CULC 3LFUA 3LFOA 1F8UA 2H85A 2D54A 2G9RA 3DUFA 3QYPA 2SICE 4G8CA 2EG9A 1LSUA 2P2YA 2E4WA 3W6ZA 1PSZA 3JQFA 4XM2A 5AOAA 2FSGA 3ST7A 4RO0A 3K6RA 2PBFA 3E15A 4EAQA 1E1QD 4Q1DA 4EHLA 2EWCA 4EJ0A 1IDN1 4DG5A 3C97A 5DOZA 2P4VA 4FGUA 4LYAA 1M3SA 1EQAA 1KI1A 1G6Q1 2VTEA 4V2UA 5LLTA 5CH8A 1TPYA 3LNTA 1R5OA 1SKMA 4MWCA 1Z5NA 3PDWA 5BSTA 2WHEA 5COAA 1NIJA 1LVHA 2XYVA 3ZHOA 4E0BA 3VAYA 1Y37A 4EQZA 1VKNA 3A9TA 2HI0A 1GCGA 4IV0A 3ASOB 3LBHA 1P73A 1IN1A 2D1TA 4QPPA 4IIXA 4G0PA 4PR0A 3ZYCA 4UCOA 2HHCA 3G5AA 3TLBA 3K0AB 4AUEA 3A4VA 5A04A 5C5EA 1XALA 1YK0A 4ENQA 4PA9A 1YJQA 4MYTA 3PLRA 3RG8A 4BT3A 3AUXA 5CEEA 1EZ4A 4B7XA 2DWPA 2PYDA 4LXQA 1P77A 1I36A 5EE3A 5EJ7A 4G0YA 3ICQB 3N6XA 5J58A 1DQZA 4FFBA 1FJGO 3B9BA 4TWBA 2YH2A 3JD1A 3L82B 4FYXA 1K8XB 1GQOA 3J81M 1QAOA 4C78A 1L7XA 4C0KA 5E2IA 4FKMA 1BYIA 1UBHS 4XDYA 3ABLB 3WJAA 3NP9A 2GK7A 3GLUA 1WXGA 2MYPA 1A2QA 4N6OA 2Z4RA 1IXMA 2F00A 2C5BA 4A10A 3Q8KA 2QM0A 1XBTA 2ZSDA 4C76A 2GLZA 3UENA 1DCTA 1VQPV 1K6JA 2PKQP 5HP8A 4L9RA 1CUBA 1KJNA 4D25A 3TZLA 1T5SA 4KLNA 4P38A 4RAOA 2FX3A 3QQPA 1ZLZA 1N9ZA 2HMVA 4ZO8A 3P0FA 4FM9A 5CLJA 1USUA 2ASEA 4NBVA 1ISPA 5C5IA 2VDJA 2OT3B 2GKOA 2E1RA 3CISA 3QJGA 3CC7F 3LG2A 2A0YA 4AJEA 3PHIA 1TJYA 2EYUA 2QL7A 4I3GA 3AJEA 2P78A 2EX1A 3F74A 3UO3A 1X8XA 1HFKA 4MQBA 1Z47A 3TKLA 5AM1A 4R01A 4BPRA 1NNLA 4C22A 3KP1A 3BMNA 4RQBA 1ORIA 5F3RA 4CBCA 3MINB 2PEYA 4AZ0A 1I4LD 1FX0B 4NDNE 1DP4A 4V0OA 4ZVSA 1J2EA 1QIEA 4IUBS 1UJNA 5IAEA 5CLQA 3P0ZA 4D80A 4FYHA 4IMRA 1UFKA 3WGNA 4HNUA 3G2HA 4JAVC 4OGQB 1VL8A 1GN4A 4MQ6A 1GWNA 5CLLA 3IPAA 3X1ZA 2I5PO 5FTWA 4UPEA 4MI9A 4QQKA 1XEAA 4BLVA 3RK0A 1WXQA 3KYDA 4A36A 1XLTC 5KA6A 4AS2A 1F5NA 4DLNA 1DOZA 5AHKA 3KOZA 5CRIA 3NO4A 1E1RG 3SR0A 2M6YA 2XD4A 3FRIA 3H2GA 3QTLA 2HR3A 1ZD3A 4M7OA 3U4CA 3CW9A 1ND5A 3M3HA 3JD4A 1ZH0A 4P22A 1HNNA 4G5HA 2EIKB 5EL0A 4Q93A 3WJ1A 4P8RA 4D26A 3ZS8C 2YC4C 1BMFD 4BO0A 4O8CA 3IQHX 3R0IA 1QH0A 5DVZA 4G8DA 3AB8A 4GGMX 1U96A 1AI5A 3NOVA 2QMEA 2VK4A 2OB1A 2B6NA 5LP1A 4JC8A 2SBTA 4OK6A 1WW3A 4GR9A 4KUGA 5FNVA 2IPOA 4UHKA 5K0GA 2B7LA 2GH1A 3JQEA 2PUVA 3E1YA 3C48A 2YYSA 4B79A 4HSEA 1N7GA 4Q7KA 2EWWA 3RSCA 2ZAUA 3TZHA 1FDWA 3RA6A 3GZNB 4QBIA 2E5WA 3D8UA 2L82A 5FV7A 4JX8A 1M83A 1CJBA 2ZVJA 2QP3A 3GO4A 1EP9A 1TM2A 3F7VC 3LHDA 1HQYE 2D1YA 4R83A 1NW3A 5FORA 4H7PA 4DA4A 3KSDO 2LD4A 4FHFA 4JA2A 1F9AA 4XVQA 1THMA 2MSKA 5AI0A 5AVRA 4Z3KA 4TMFA 5IRCD 5B7NA 4HATA 3S8YA 3AILA 1N5RA 3B6MA 2BT4A 3F6CA 4F6EA 1OWLA 1QH1B 1KU0A 4G5GA 3KTOA 2Y0BA 4EX6A 4WN9B 3VU9B 1H2KA 1DRKA 4PPGA 1OXSC 3DD5A 4ZZ3A 5HE8A 4U2EA 2YDYA 3H9UA 3B8HA 1MU0A 5I9NA 2ECFA 1YD7A 4RTPA 4UUOA 4AS1A 5I7EA 3ODPA 2IV2X 2OO5A 2I33A 4LQDA 4DXWA 1U0FA 3BL5A 5IK2A 2P5TB 3G89A 3N2ZB 2N1BA 2CKDA 3CW2A 3PQ8A 1PI3A 2B3DA 4CM5A 4WY8A 5DOVA 2R6AA 2H4HA 1WB9A 1M8JA 1QYDA 1ZHOA 2ZQMA 3DDZX 5C31A 1CWUA 1IHYA 2A9PA 1U90A 2A9JA 2CAZC 5DI3A 1RZUA 3WGVA 2GHYA 1B93A 5IBQA 1JHPA 4UXHA 4IQ8A 1T6NA 2QN6A 4TMWA 1O6BA 4RD1A 1BVYF 4C2BA 2R86A 2FUEA 3L7JA 3C5HA 3QE9Y 2WFLA 3LQFA 2QXTA 3ZXXA 3UO8B 1HYQA 4JB2A 3CCMV 3VXKA 1Z12A 1O9GA 1W0JA 5K3BA 4QJIA 4B5LA 3N2KA 2V9CA 1NZDA 1XO1A 3Q7IA 4BMNA 4RMGA 5AHRA 1EFTA 3IOCA 3ACDA 2JVDA 3ZJ4A 2EQAA 5HZMA 3DFKA 2JLCA 3SIRA 3QMVA 3C6ZA 3QHAA 3K12A 3N59A 1K8AH 3OU2A 2I2WA 4HXGA 4YFVA 1Q0HA 3LU1A 4ND8B 1EFDN 3ED5A 2VDOB 3T54A 1FFXA 3PUIA 4HBZA 2XMPA 2PUFA 3IEVA 1TYBE 5J1TB 4YRMA 2OORC 2ZIUB 1X80B 4KCGA 4NBUA 2Y4NA 4AI8A 2H4FA 4DPLA 2O2EA 3PD1A 1I0ZA 2DF8A 2ACKA 2JAUA 3BTVA 1QC5A 2GN8A 1HNWO 5KQLA 3UN1A 4RHXA 4MDFA 1XP5A 1MAHA 2XUGA 3IMPA 3VI3B 2FWJA 5HQ3A 5EIBD 3BD6A 4AX8A 1D1QA 1P0PA 3BK7A 4EUKA 1Y6XA 4GT1A 3GB9A 4EMUA 4RLQA 1IMJA 4HQRA 2A3RA 3SGLA 3DO5A 1ZESA 3PQ4A 3L04A 4J11A 1F2TB 1IQPA 1GT6A 1M67A 3O65A 4Q02A 1Q91A 3T5TA 2X5OA 3L93A 4F92B 1T2AA 4ZQFA 5KDDA 2VWQA 3TSZA 1DCFA 5GGYA 5EFOA 1S0VA 3GAAA 1K7XB 7AT1A 2IZ1A 4PZYA 3MOGA 5DWDA 1DKNA 4BVAA 5IVPA 1R2QA 4XFJA 3I0MA 5FR2A 3EWAA 1AO3A 4O25A 4GKKO 4HLCA 4ENPA 4IIJA 1FUEA 3VYSC 3CNHA 3Q3GE 3LUKA 1PZXA 1W46A 2M1ZA 3M8AA 3DLAA 3QLTA 3CN7A 1RKQA 2GILA 3JQGA 4LXGA 4BFTA 3DBLB 1GR1A 1BMFG 4MGYR 2A3QA 3GLFA 2E3JA 3MS2A 2AJBA 3C5WP 2O23A 4RQEA 1P5JA 5L3VA 3OTFA 2D2CB 1NI8A 4PG5A 2G88A 2LRHA 1I0HA 2QUHA 4AILC 2EOAA 3FCEA 2Z6VA 4DUGD 3IA2A 3U3XA 2CJWA 2C4TA 3MXTA 1QHHA 3DE7X 1TKBA 2HDHA 4RF2A 3SI7A 4CWAA 5ALPA 3NBAA 1ULSA 3VVBA 3RVPA 5JD4A 1XREA 1WXFA 4K6KA 1SIBE 1I0LA 3OG9A 2GERA 3CONA 3HAXD 3HKDB 5IP5A 2OCGA 2PSFA 1GYRA 2HMSA 2HLPA 4UVGA 3CXHF 1BCRA 1L7OA 4ZK2A 1FS0G 4D5GA 1EFRA 4Q7LA 4KO3S 4OHFA 1J8MF 3L0PA 3F5DA 2R2AA 2KSDA 5KKAA 2Z8YM 3WLRA 3QF7A 4HD8A 1NN0A 3KTFA 2OGSA 1Y4UA 3ABSB 3D3NA 1Z8NA 3LZDA 4LGCA 5CK4A 2M6RA 1O95A 1HE3A 4J16C 3ELCA 3RREA 3W2GA 2J85A 4Q0MA 3VUEA 4ABMA 4MW5A 4OHKA 3PJGA 1KSJA 3ES9A 1U4NA 2H1FA 1VE9A 4PYJA 3DBHA 4LHEA 5EJGA 1XTIA 4KIFA 4MCHA 3UW3A 3LVQE 1NNSA 4WI1A 1CJTC 2XSZA 4KYTA 3AWDA 2PUAA 3G2QA 2IRWA 1U2ZA 3B53X 2WDPA 2WSLA 1UK7A 4RQAA 3SJAC 1Y80A 5JYEA 1FVFA 3NEYA 2VHZA 4ALJA 2JRLA 4U7GA 3QSGA 1YFKA 3M4ZA 4K5QA 1NZ6A 1JQKA 2XTAA 2HBZA 3Q6NA 5BVGB 2F4NA 2P40A 4QEZA 3O8QB 5AW3A 2L35A 4Z2WA 3ONVA 4JYZA 3BRWA 1LUVA 4QODA 1W5FA 3CJQA 3OAAD 4Z3DA 4BGDA 5LQDA 3QLEA 5BR8O 1EVZA 3NZEA 4Q9LA 3SYKA 4I81A 3L1KA 3AG1C 3IXQA 5EWMA 2LUOA 4YP7A 4G4SO 1J7KA 1U11A 5BWCA 1QLHA 3A4MA 4EEKA 1RLTA 5EJ2A 5JYBA 3W6UA 4IDNA 1RS0A 1P1RA 2WTAA 3DNFA 3AKEA 1ZNXA 2BONA 3RJZA 1NFFA 3LWPC 4IYHA 2FEOA 4LRUA 2NUAB 2J41A 4KO1S 4TTJA 1TQ4A 1QOQB 3VNAA 3A2FA 4KGZA 1SBNE 2GA8A 2FP4A 5B58T 5EWLA 4TYWA 3RAGA 2AWNA 4NK5A 1BU8A 3TZQA 1N34O 1UMBB 4BVEA 1R5NA 5SZKB 3QXGA 1QYIA 4LZOA 1NV9A 3E18A 1UMDA 1NUSA 2O4UX 4JI8B 5IF9A 3ZDXB 3DBRA 4EJ6A 1IYZA 3QXXA 1VMGA 4YR7A 2XIJA 1P7GA 4HGPA 4QTZA 4BQQA 4FC7A 1Z82A 3UPDA 3ZGXA 4RVUA 3U7QB 1D6NA 3C3YA 2EZOA 1E77A 2FZWA 4EHAA 1KQSF 4CLDA 3TRJA 3T3DA 1PPJH 3DPIA 4FPXA 2GBGA 3THXB 3IEMA 4IDHA 3SIWA 4L16A 4CU2A 1WPBA 4MTCA 1K6XA 4IDOA 4EEQA 2FKXA 1QIJA 3HVJA 1WOYA 3MILA 3R0XA 4G0QA 1AKVA 1IATA 3EMBA 1PJTA 2KM1A 4AN0A 3BH0A 3IVRA 4I2NA 1MDFA 5HFLA 3KX2A 1HG0A 2CNNA 4PAGA 3LS2A 4HUJA 1YUNA 1N36B 3IV7A 1T8UA 3HABA 3QY9A 3ZMTA 3HDVA 1M6HA 3QI2A 3HA3A 4BMVA 4AI6A 1ZD4A 4X7RA 3E86A 4CH6A 1YVPA 2AN5A 4FFMA 4OM7A 1KA9H 1M8PA 3CYQA 1YMUA 5T4BA 3R0ZA 1Y0BA 2GWRA 1ZGAA 2QVGA 5NLLA 3RRBA 3SDLA 1Y8RA 4BV8A 2I4RA 5AVOA 3JQDA 1X7YA 2WSIA 4GL2A 4GKJB 3D8NA 2PQ2A 5A03A 3UB4A 4A2QA 2UXBB 4R2LA 4OL9A 3MRVA 4PRLA 4BKUA 2AC4A 3M1XA 1WRBA 2HQSA 2PFSA 2P4KA 3TD4A 4X8MA 4YV2A 3P32A 1QR2A 3WHIA 1FEZA 1N2IA 3WQRA 3SPIA 2YIDA 1W41A 1PGOA 4O4LA 5L4NA 2L19A 5EUBA 3I73A 4QULA 2H11A 4HJXA 3TD3A 3QBEA 4NCXA 4RTRA 1PLJA 5B7GA 3FGOA 2X2PA 2HQ1A 1RWPA 2DTDA 3BULA 4P2GA 3OQPA 1RC8A 2G5CA 1Z4PX 3RRNA 4XYGA 2XNJA 2NX2A 3QF4B 3QEAZ 2EP8A 1GPMA 2F3TA 2BF7A 2QNIA 1U3PA 5H5NA 4PEVA 2DPMA 5BRJA 2WIDA 5EP3A 1W42A 5A5DA 2C00A 1CR2A 4FS8A 1T3HA 5JXWA 5KYXB 3FNQA 4EYEA 4B44A 2YEVB 3U4QA 3GFOA 3HVKA 5B1AB 5JVDB 4PAMA 3L0BA 5ESDA 1COWD 1YIAA 2B2CA 3ELWA 1DF4A 2V96A 4RIIA 5EEHA 3LCCA 4P31A 1IV3A 4OSEA 1X8KA 2IFTA 3STWA 2I2AA 1LLFA 2AMTA 2IZ0A 1E0JA 4DR3O 3B78A 4NICA 3STLC 1U43A 3TXSA 1J5PA 4TSRA 3FHTA 3DKKA 3T95A 1U2EA 4W82A 4GMHA 1Y9EA 1T2DA 3EZGA 4CMIB 5A06A 3GELA 5SY4A 3KT6A 2B4AA 3QKUA 4HJRA 2RBGA 5B4VA 1AURA 3HZZA 3U10A 1T9CA 2ZR2A 4C08A 4DRXA 2C5GA 4NV0A 5EC2C 3K79A 1QGUB 5BRAA 1BEUB 4OI1A 3TGWA 2E21A 2VO1A 4EA8A 5HRAA 2ZJ5A 2GZSA 2ZVQX 3A2KA 3KEGA 3IT0A 3DO6A 4EGQA 2R8EA 1U1FA 1R0WA 2QLJA 4DMGA 4KR2A 1FNBA 3WNBA 1UBTS 1ZN8A 1JP7A 5D1NA 3Q3CA 1EZZA 3V3KA 3OT1A 4GMKA 1VMAA 3PX2A 2EZUA 3G85A 2ILVA 2NUBA 1U28C 2ZPTX 5DGCA 4GEGA 5LD2B 3ZZMA 1O4WA 4E5KA 3I9FA 1FFSA 1CTQA 5EB0A 1FYWA 2AC2A 4J0FA 3TIXB 3OAAG 5AK3A 2ZDQA 5IARA 1J33A 3SY8A 1KYVA 2KB1A 2FPIA 1ZMOA 3UWKA 4MXDA 3SX2A 2J9FA 2JCXA 3OGIB 1GZHB 3WKCA 1OAAA 1WU8A 1GDTA 1QAMA 1CZOA 2Y6VA 4MAFA 2C2AA 1CUJA 1RM4A 1VKJA 1OX4A 1R10A 5CW2A 2FRVA 4K6GA 4QOGA 2PJZA 1N57A 1DZ3A 3G2LA 3CRVA 3KQQA 3OEWA 5JS7A 4TRMA 1HFJA 1LB1B 1S3JA 3NFYA 3I9V6 1FXKC 4XWAA 3PE6A 3PTAA 5EKDA 3RSHA 1MOSA 5IEJA 4LFBO 4QM6A 5KX5B 3I32A 5EJIA 2FCAA 3ELBA 3M99B 2Y76A 1TM7E 1AROP 5KB3A 4CMAA 2N46A 1T8TA 3JAKB 1KNKA 1LNQA 1L7AA 2HBRA 2H08A 3R40A 4BASA 3STXA 3OBIA 4FGLA 5L3FA 5I7WA 3HRHA 1VF6C 5ALHA 3OZRA 3AI1A 4NS4A 3RRZA 1YR6A 1ZC3A 5CT5A 3OZCA 1T36A 3P4YA 4FHEA 1DX6A 3TOSA 1CD5A 4C7VA 2Q7GA 4RA6B 2BH9A 4BO5A 3IJ4A 2Q28A 3ROQA 1XAJA 4WFKA 4GZ3A 3CZ5A 1VIYA 2DUMA 1MORA 2O48X 5DTJA 4CRWB 3GRZA 3AL3A 3LSQA 3V4FA 1PR6A 3F8SA 2QLLA 3N6RA 2IUEA 1HFEL 5LIPA 2O7SA 1GGHA 5KJ6A 1UADA 3SE0A 1HDGO 1XDGA 4DJDC 5FAXA 3T1TA 3FWKA 3Q4GA 3B4SA 3K8OE 1Y4MA 4DSTA 1R00A 3KZIZ 4W5QA 5JARA 4GUDA 5IC6A 3MCZA 2J0SA 4PZ9A 4X95A 3PQEA 3L75H 5IE9A 3QZUA 2F1KA 3SX0A 4U9IS 1IRXA 4QQNA 5BW8A 1UFRA 3UM9A 1XMJA 2FUNB 3T1QA 1P0CA 3EVAA 2P0EA 4FLTA 4DDHA 1ZW6A 5LM3A 2B36A 3KVNA 4GFDA 4AJ4A 5LHIA 3UWOA 4AKHA 4EDHA 4CKWB 3V97A 4FE4A 4JBWA 4FYVA 1SBIA 2PG3A 3P2IA 1OLXA 3OEYA 2F9FA 3FM9A 2QVZX 1NT4A 3EXHC 5AOCA 1F8FA 1RYNA 3KWLA 2NIPA 4ZT5A 1NVTA 3IPCA 1L4LA 4H7EA 2YIMA 2P2DA 3OIWA 2COEA 5GGXA 3L7LA 5AJWA 3N2EA 4DQKA 4I0WB 3EFOA 1OBOA 1ZVKA 2IPMA 3L46A 1MGPA 4ID3A 5A3QA 1HYHA 2R11A 1VJCA 1YAHA 2RI0A 1XVLA 3KT8A 4MITA 1RQ2A 4EJMA 1DELA 3BERA 4OFWA 4YMGA 4OX9Y 3NMUC 2B98A 5CT9A 2A0LA 3CLKA 3CUUA 1YF3A 4UTNA 4WXMA 1SQVH 3THRA 4LJ9A 1NBAA 4YMLA 1YQUA 3Q9UA 3VYTC 1N5KA 3G23A 3A0HZ 5JSKA 1S1MA 4GZRB 4Y2YA 1IZYA 2AMLA 4QFCA 2RG1A 4EPTA 3L4JA 3EA4A 1JGTA 1R3KC 3CZQA 1YC2A 3HWX1 1GZUA 2VN8A 1S5JA 1RXSA 4ZRMA 1E60A 1KJZA 2ZWVA 6AT1A 3HB4X 3EDYA 1VZ3A 2NQ2C 4NBNA 2C5AA 5DNUA 1FPMA 2C8JA 1X7PA 4IDEA 1JPXA 1Y5MA 1WZIA 1E4YA 2QENA 2UUAB 3WRXA 1XKXA 3U4GA 3N74A 2OZPA 4R9NA 2XPCA 5E6SB 5KEIA 4XYMA 1ESNA 2G6TA 1RXWA 3K96A 1RLUA 3V5NA 1JXOA 4BY9E 1QTIA 4Q24A 2EP7A 5AW9A 2G0AA 1RXIA 4RPIA 1GN8A 1VJ0A 4HMPA 4CHTA 2GSMB 2QD2A 4YXFA 4ENWA 4ZHQB 2ABWA 1TAGA 4FB5A 1SKAA 4KSBA 2WFZA 3D8TA 2CFIA 5JJJB 4D9JA 5JNTA 2HG5C 4OH7A 4TQGA 5EBMC 2WZCA 5D8DA 5BSUA 4BJ5A 4X1IB 3HB9A 5HOQA 1U7TA 1E2FA 1SVUA 1IIBA 1GRNA 3WDKA 3ZLJA 3KCQA 1W9MA 4B8WA 4XLLA 3ENZA 1W1UA 1M6EX 5K09A 4DSNA 3SG0A 1YJ9F 4EHIA 2GZAA 3ZZUA 1V95A 4RUKA 1NXVA 1FXWA 3H3JA 3U44A 3U1VA 3V9AA 4XJVA 4WUVA 4J9ZB 3H7IA 4R40B 4ZVTA 1X13A 2HUPA 2YY5A 5KDLA 5CX1B 1GNTA 3SYMA 1K9VF 5FBZA 4JP2A 2HA3A 4IDAA 1ZAKA 5A3JA 3CMAV 4US1R 1Z16A 2WA2A 4HDMB 3CRRA 4G0WA 1DHRA 2NO0A 1M6YA 3UJNA 5KJEA 3BDAA 4PTYA 4CF6A 2P75A 1NR7A 3V2UA 1KEEB 2WTUA 4E31A 3ESYA 2GPWA 3H0CA 2V9ZA 1YJCA 4QRHA 2XASA 3Q40A 4EB6B 4C7XA 2GO1A 3STZC 2CLLB 2DWDC 2O2HA 1K34A 2GR9A 2YI9A 4TMYA 5LL6Y 2FPPB 1T3GA 1HP8A 3HFJA 1Z73A 1NMYA 2CFOA 2GN0A 3CJHB 2WUGA 4JBXA 2ZSUA 3OCVA 2FCRA 2I4LA 5KWIA 4UBLA 4TWRA 2G67A 3Q9LA 1PV2A 3IUPA 4PNPA 4PZUA 1Q0QA 5AW1A 3AESB 5FLXN 3PITA 3FMIA 1WPQA 4FQ8A 1DC4A 4J49A 4K46A 5FNVF 4BVSA 2QR5A 2GQ0A 2EIJC 4RXUA 4N5HX 3JATB 1GGMA 5JISA 4QUAA 2W00A 4RMIA 4Z1VA 1Y6GA 1TGOA 2W8BB 1G5QA 3I3SR 4RCVA 3CLRC 1RC0A 2Y1GA 5TQ2B 4MQMA 2PWAA 2WHQA 2P0YA 3C85A 1VQMV 1UUFA 2WA1A 3I4FA 2OESA 1GZ3A 4O2AB 5LCXA 4B34A 3DFZA 4LRYA 4RO2A 1T0IA 1M2NA 4MQ4A 3JYNA 1M7BA 1N2CB 3SFZA 3DL4A 4FOTA 2RMKA 1JB9A 1GGFA 3RVBA 2V58A 1CR0A 2CNOA 2JIDA 2XOKD 4ZJZA 3FROA 4U2KA 3N86A 2G1JA 3OESA 5LGUA 2C94A 4KL8S 1DS6A 1JWBB 5EJEA 1M54A 3JR3A 1O2DA 1QMPA 2AJTA 2VT6A 2ODWA 4IJ5A 1T5EA 4PDVA 3T4DA 4JZKA 2YW2A 3LX4A 4F97A 1R6KA 5BVHA 3K71B 4DCSA 4Y9RA 3ZWWA 2QTRA 1H2RS 1OAOC 4QDJA 4QU8A 2FVYA 1ZC4A 2P8JA 4IOKA 1IBKO 4NMMA 4HUQA 4DLSA 4C2TA 2PI5A 2QX6A 1AXEA 1K92A 2JIQA 4HRYA 2EKZA 2NM0A 3ED1A 2PHZA 4YFYA 2V03A 1F6WA 2Q1YA 3FJOA 4P0PB 5LP6B 3D3QA 3DXZA 1AJQA 3E8BA 3BXFA 5IASA 1QRDA 4HNVA 3BZUA 2UKDA 1GHTA 3SC6A 4YT8A 3ENVA 2EZ9A 3H1BA 3TSWA 1ZAYA 5HDBB 3LQKA 1CF4A 2VF4X 4Y6GB 3FHJA 4CMHA 3L7AA 4TKVB 2IEYA 2QVLA 4NJOA 3NCHA 1WEKA 3H7AA 4BNHA 3Q2OA 4MUHA 2J09A 1LV8A 1H0RA 4P7JA 4YJ3A 3CCMF 1L6RA 1KC3A 1LKZA 3JU3A 5KWJA 3W2IA 4PR3A 4OIMA 1ZL8B 2J7PA 1V9CA 3CUYA 3WGYA 4IXTA 1A04A 1TVCA 4RL6A 3I55F 2ZLBA 3GROA 3I53A 1LZKA 2FMKA 1K1EA 3VDQA 3OC6A 3TL2A 2UUCO 2QWXA 1PGQA 4CIAA 1XKLA 1XZDA 4G0NA 1VJ5A 3HR7A 3MS4A 4RHFA 4XDHA 1NMQA 4NG5A 4IYJA 4QUBA 2QN7A 1DJQA 4FU0A 3REFA 3VQVA 3C15C 5DRTA 4WZAB 4OHBA 1I51A 4J8PA 4BLOA 4H4DA 4L85A 2VF7A 3HO8A 2Q6AA 2UYNB 1JB1A 2VK1A 1WP4A 2JCBA 2IJJA 2Z1DA 3QU4A 3CG0A 2LWIA 2PD6A 1PK7A 1UKBA 4X6LA 1E62A 4JC0A 5D7NA 4EG7A 2R7NA 2GAOA 2R9IA 1G291 5GIPE 1NYLA 4BO9A 2QD5A 5JD5A 1OQAA 3CG4A 2NOAA 3I09A 2NUTA 3LVRE 2O14A 4ZT6A 4Z9BA 2VWJA 1Y4AE 4EFDA 5EUCA 1R37A 1HT2E 1A9QA 2XE6A 4OXXA 2HTEA 2AXEA 3EXG2 2HM7A 2I78A 5JMWA 4MUYA 1P2DA 1WAMA 1GL7A 2ILMA 4K40A 4H16A 3AERB 4E7OA 4E5SA 2IUSA 4I1IA 3O8DA 3IBCA 1I14A 3QVGA 4LVCA 2OV4A 3CUVA 1PNVA 1BFKA 1N2CE 3PL5A 3OCUA 3VV3A 1UAYA 1JR3A 4IIJF 4RLFA 3FOBA 3QQ5A 4NH0A 5AKLA 2VSQA 5KYKA 4GZMA 4QYWA 3CEAA 1PEYA 4LR3A 3KFXA 3SHWA 3CFYA 3ID6C 3SSAA 2YXDA 1KWGA 2HJSA 5ITSA 1JN0A 2X9LA 4B3FX 2D0PB 3P9YA 1EK5A 3TINA 3VRHA 4KKXB 2XCTB 3ISTA 3MIZA 3RYHA 3FVVA 1AJEA 5A4DA 1XF1A 4FN4A 4Y2QA 1O94A 4MSUA 3BSFA 2Q5CA 1NDHA 1MUUA 4C6TA 3NDBB 3WWEA 4DLBA 2YMPA 5TPZA 2PX6A 1DKLA 3LTEA 2LGWA 1M34A 3PGKA 4BLWA 1J49A 3BVOA 4Q3EA 1Q74A 4KQ1A 1MFZA 2NV0A 1XGKA 2F1OA 5AM2A 4IH1A 4URZR 2HEPA 3QKSB 5JJLA 3CRQA 1ULUA 4B9EA 3VSEA 4I4CA 4PFQA 4RK0A 1CRLA 4DDKA 2I87A 4I5SA 3Q7PA 5GINE 2E82A 4CR6A 3OSUA 4AYXA 1MKYA 2K1SA 2D74A 1PJ2A 3L6BA 1Q0TA 1H8ED 3ZIDA 1DJMA 1L5LA 1P61B 4KX5A 3R8FA 4YJGB 3E4CA 2HF9A 2I7CA 2RGAA 3H2ZA 4D4IA 1EA5A 4YDRA 2XUPA 3S2FA 2P2NA 1W76A 3WIEA 1ZIOA 4RWUA 4DSAA 1YTLA 2ECQA 3QV1A 3W5BA 4LWQA 4RK6A 2WY2D 2OILA 4MVWA 4KPUA 1N6PA 1E59A 1AILA 2MYUA 3WYCA 1HDXA 2XEXA 4YT2A 2WV9A 5EKUA 2GZHA 5FWXB 4FYYA 3K94A 4R71A 1JLSA 3ZOZA 1QLNA 3OO1A 4ETIA 1O1YA 1K4YA 1KZYC 2NU6B 1P7VA 2Z2KA 3QPBA 3LBNA 1R74A 1EGHA 1DV2A 4KXNA 2C5HA 3NHJA 3PFGA 5A3SA 3EZ9A 2B7BA 4C0HA 3S5JA 1QQ5A 1W5AA 3BB1A 1WMDA 1YGPA 3RJTA 4FZ1A 1C8LA 4DCGA 2H94A 1A4RA 2X19A 4MO2A 4A6XA 1SZPA 2YFQA 5BXZA 5K3FB 1D6JA 3HCEA 1UBFA 3QU2A 4ENUA 2H17A 3UA4A 1ZVMA 2CZCA 1T8YA 4IMPA 4JROA 1XK7A 2QGNA 4P3NA 2HZ7A 5ALLA 2Q4EA 3EAQA 3ABMC 2V7GA 4FNGA 2BGIA 1BDJA 5ALXA 3S02A 3ROMA 1PZHA 5T64A 5AJVB 4IXNA 3I5MA 3PXXA 1N3BA 2VOEA 2ACVA 5JJKA 4ZOLA 4PLFA 4I6GA 4F12A 4AJNA 2JEZA 4C4TA 3FPBA 3PUVA 3R7LA 2V7EA 2ZTMA 3EN0A 4NENA 1P9WA 3DWFA 1Q7CA 5BW4A 1ZCBA 4A8JC 3PXCX 2YY6A 3GQBA 1ODJA 2WMOB 3Q8XB 3H9VA 4YRJA 4MRSA 4DUYB 4MVJE 2IHNA 4EB0A 4L87A 3FW1A 1PQPA 1TQ2A 4BNJA 3IHKA 3SQXA 1DJPA 3VOAA 2IVFA 2QSUA 4ZQHA 4QGBA 1N0VC 1PT9A 4N12A 1FUIA 2ZR3A 3OR7C 1H48A 2CXSA 3BJMA 5T3YA 1E9CA 2VQDA 3KT0A 4CV2A 1G5RA 3S27A 4PAQA 4HTFA 4BNUA 3KE8A 2ZAGA 2LIPA 2IEGA 3HFGA 4K6CA 1CRZA 3A9RA 4MEJA 2VATA 2B5OA 2ILTA 2Y1LA 1W0CA 1YVWA 3TEMA 3LHSA 1GQFA 1B15A 1TT5B 2DU8A 3UHAA 3VISA 2XUOA 1FP1D 5EY5B 4A0FA 5K4HA 4BZWA 5CEFA 1IBLO 4V3CA 4BZZA 5HXAA 1H94A 2YWGA 2IF2A 2IITA 2W7TA 4RHEA 3CZPA 1NBMG 1YOBA 2ZSHA 5IHXA 1OLSB 5CHEA 3GUZA 1DSSG 4FI3C 1IN8A 7MHTA 5BNFA 4DR7B 4YMHA 3ZNNA 4FK5C 1V1RB 4UE6A 1JPUA 1TD1A 1C9KA 1VQ7V 4IILA 5F1YA 2IU3A 1YFJA 4L6IA 5J4VA 1FQKA 4NOJA 1V71A 4I36A 2B1QA 2R8BA 4C89A 5EE1A 3H3FA 1B76A 4CODB 2PGXA 2GLUA 3BWMA 4GOMD 2C59A 2HLDG 2DPLA 4F72A 3B7PA 1DINA 4ITRC 1PJSA 5CBPB 4O4LF 2IYTA 1T2UA 2ZGVA 3TYXA 1AB3A 5K2MA 1W30A 5IZCA 1YITF 5DT9A 4L5JA 4EKWA 4G41A 3LBIA 3N58A 3MAGA 3IOEA 1VL6A 2B99A 4AO7A 3K72B 3OTHA 3EUAA 4FPPA 1CVRA 2B9ZA 5EAZA 3VKUA 2F93B 3THYA 4EG1A 3D59A 2C7QA 4D6TH 3ND9A 2B1RA 1MHPA 4Z1OA 5C37A 5GW7A 3MCAA 4D0RA 2PJUA 2JD2A 1AT1A 1IVYA 2PX3A 2IPLA 3KJQA 4EATA 4G26A 1LPBB 3IXLA 3KTAB 1ADGA 2EZPA 1A5SB 1Y9AA 1WHSB 4U5XA 5B1BB 1E2MA 3D00A 5KLVH 3RW0A 4J9VA 1RWVA 2R1VA 1J5EB 2P4UA 1EWRA 2WKQA 3QEMA 3B7WA 2PNJA 2LFSA 4ZTBA 1ZITA 1H0KA 5HIIA 2LP4Y 2CMHA 1ZVJA 3CUEF 1PVVA 3EQ9A 2FK7A 4NQRA 5EJ9A 3O3CA 1VFPA 1X9GA 4LW8A 2CZQA 2HRZA 4US2R 3VPCA 4BL5A 1VP9A 1QIKA 3IV9A 4XAQA 1PJ8A 3L40A 3S99A 4QSHA 4IHJA 2TMDA 2Z4TA 3S28A 2W71A 3BGIA 5ICFA 2A06H 4B87A 2NVUB 1PFQA 1Q83A 2W0MA 3EIXA 4EITA 4POAA 3GT3A 3OX1A 2X6CA 5IJ0B 3R9WA 3CWQA 3SBDA 5THQA 1C41A 1UKEA 4O4IB 2EGHA 3O94A 3RFTA 3FOWA 3GPDG 3FYCA 4Q7MB 1HQDA 1FIUA 4LWSA 3ASOC 4ZCMA 2KQXA 3LLSA 3RI3A 2G9NA 1AC5A 4CKBA 1OXMA 3RVQA 5COBA 2VGNA 2D5IA 3H1LH 3V4RA 2FMHA 2RHCA 1KEPA 1T1RA 4BJ3A 1JEYB 5CT8A 1KIFA 4H0LB 4YBRA 1BA3A 5DHPA 2HHHO 1BMQA 4OATA 1XOUA 1NBWB 1NURA 2VUUA 5TVKA 2FSSA 3RC1A 2X5JO 5CP8A 5E95A 2XYPA 2PRJA 1BKYA 5LQCA 1E1QG 4FT4A 3G7NA 1NDQA 3OZFA 5JC1A 2ID9A 4TXJA 5DWQA 3HKEB 4J75A 1OXVA 3VZRA 1QHFA 4I08A 4EY6A 1GUDA 4M0DA 3ABLC 1B0UA 5K9ZA 2JK0A 3A3OA 3FFMA 2MT9A 2PZFA 3DZDA 4TTVA 1VBMA 3RUIA 2PCLA 1UBLS 2WU8A 2XH8A 5G53C 4LXHA 1KBOA 3KB6A 5AH0A 5JNLA 3IQZA 3B8MA 2QG4A 2XBMA 3EASA 5I3ZA 1ADBA 2P6JA 1ORTA 5CCBA 1TLTA 2F66C 2OV8A 2PQ0A 2IIVA 3X1MA 4RW0A 4MHTA 4LNUB 5LB2A 1MB3A 2P68A 3M5CA 4DV2O 3N8GA 3K06A 2P9JA 4ZHWA 3DE0X 5DNVA 4IZHA 4H18A 1U7PA 2Q29A 4PC3A 4WTOA 4G1VA 2WZDA 3B20A 2B61A 3HNRA 2FTKE 4TQUS 2H18A 1MIHA 2XVYA 1Q81W 3BHIA 4Q20A 4S2EA 3RVSA 3AXTA 1V7QA 5EYPA 3EQZA 3I01M 3SVZA 2GK6A 2G5GX 3EIFA 2HAEA 5DCYA 1NIPA 4EG6A 4RGYA 2CNWD 4ZVPA 4TKUB 3F4LA 4RIEA 2VJCA 4OHMA 4GOJA 3MRSA 1NX9A 4HZUB 1I94O 3ZU2A 2WJ3A 1I5XA 4B4VA 3QNWA 1YZTA 3MHTA 1YIDA 4UHEA 5C5CA 4KOEC 3OP4A 1H9CA 2UU9O 5TMBA 1FRZA 5ITVA 1KKCA 3R5TA 2ZU6A 5BWLA 3I34X 3QA3E 3EWNA 3FDFA 4CQJA 4X9QA 3U3OA 5FOTA 1E64A 3TBFA 3F49S 2V45A 4ESOA 2ZANA 2I1QA 1V7CA 2WWWA 3A1DA 3LCRA 1R73A 3WMGA 4KPFC 4WBXC 5G4VC 2BTUA 3NBFA 1QH8B 3K0SA 3K9LA 2QYOA 3CU5A 2OCKA 3WV4A 2EIKC 5H4GA 1KPGA 2BE7A 2F3SA 3KLBA 1H23A 4KGVA 1YONA 4OJNA 3ONEA 2I4IA 2SHKA 3RJ9A 2BBOA 2JGEA 3OOYA 1VJGA 4EAAA 3A3YA 3UUGA 1CQWA 5F1OA 5BN5A 3HJBA 1EFKA 1H65A 2C9CA 2PVCA 3C6MA 4X8LA 3L5OA 2YWDA 1ISMA 3EODA 3OUFA 4FJCC 1R6UA 1W3EX 2R5NA 2I3AA 2LPMA 3VU0A 1OWMA 3UANA 1ATIA 1OI7A 4MA0A 2LIVA 3N76A 3IIEA 1IG0A 1C30A 1F3OA 2FSHA 3GJ6A 2QZ9A 2QSJA 4NAVA 1AQUA 2JAHA 1AM4D 5DRYA 3SJCA 1CZHA 2EQ5A 1MA0A 1C5KA 4JXJA 1ODEA 2I9PA 2QUZA 3IMFA 1JHQA 2YHBA 3I2KA 4AMZA 2CF6A 2B21A 1EWTA 1WD5A 4BN4A 4MRNA 3SR4A 3ZV4A 2FP3A 4DXDA 4CM4A 1H9BA 4WKPA 3MTAA 4MUNA 2C5SA 3T6KA 4W5RA 1VE7A 4JH0A 4TXLA 1QZ3A 3TFQA 1QCCA 2Q4RA 3DC5A 3OM1A 1TZJA 3GJSA 4NCBA 3G5UA 4P92A 2F3UA 3H1TA 3PQ7A 4MW2A 3AHGA 4GI2A 3B48A 5HGJA 3DBVO 3T99A 521PA 2DY0A 4FXOA 3A7EA 1XD2A 4JBYA 1S7GA 4MYCA 1ABFA 3MJ4A 4XB6B 2AHRA 1QK5A 4TXHA 1FP2A 4GR4A 1DE0A 3OTGA 3ZV3A 4ABYA 2XLCA 1KIMA 2JEOA 1JFFA 3USCS 3L4BA 3R4VA 2R66A 4Z7JA 1PF5A 2ZSFA 1YJAA 5LIRA 1QYCA 2WLTA 3WDMA 3TECE 4YRSA 1NI4B 1WUHS 2Q8NA 5D00A 4XFKA 1EXDA 1KYTA 3MK31 2XMCA 3CEMA 4MI6A 4JYMA 3TLCA 2BM9A 1NU8A 4CMEA 3RVZA 2X22A 4DCUA 2Y92A 1SHKA 2WIFA 2N9UA 4NIMA 2FN3A 4AJJA 1UINA 1Z6GA 2ZRQA 1RZRA 4ZEOA 2PX0A 4JBHA 4MVMA 1ZH2A 4M55A 3TSOA 1RQRA 1OU4A 1KSFX 2V97A 2C0QA 1G8GA 1WIWA 3TEFA 2IIQA 1K4CC 5LU9A 1K3FA 1UMCA 4BMCA 3QXJA 4DMFA 4FMTA 3AVOA 4Y2PA 3SYAA 1M2OB 1SPBS 1JKIA 1KI7A 4LIPD 2F6RA 2W2KB 1AS3A 4Z0TA 4F0JA 4ZVKA 1O89A 1TD9A 4HQLA 3T4XA 2QM8A 1KQ3A 1NLYA 2K7ZA 1P7CA 4S35A 4QDZA 4UCFA 1FXWF 3A1EA 4LFAO 4L4ZA 3VDXA 4IMIB 1TA8A 2RCNA 3MYYA 4IFTA 1RHKA 3WFJA 3G71V 1WXWA 2CDAA 4OY3A 1VSTA 5KINB 3ZC3A 4B7EA 2HJVA 5JC8A 4ZMSA 2VJPA 2FZLA 3CRAA 1Q0ZA 3Q2KA 2GD2A 3ZD8A 1YIJV 1EXMA 3PJFA 2Q6LA 1J21A 3CMAF 3UJDA 4UV8A 4AP5A 2VJBA 1QIFA 4EFKA 3ONNA 2DLDA 4UCWA 1T4DA 3OKAA 3NYQA 4R7GA 3AXSA 1C9NA 3C14C 1JG3A 1NAHA 3TVYA 2F43A 2O7QA 3MFQA 1W1WA 3KQTA 4OYYA 3ABIA 2ZAIA 1VOTA 2CHUA 1UODA 1LJ8A 1KKDA 2B8NA 1SUCA 1BQ0A 3P9KA 1BJRE 1C1DA 1W19A 4NZZA 4BNLA 1CK2A 4X84A 4ESVA 4GUAA 5EIOA 1YDHA 4BFUA 2H1SA 2RHRA 2FPRA 5HUQA 1EFPA 1CJUC 4EENA 2W90A 3O1JC 2AT1A 1UXJA 2QTPA 4XD7A 2VTDA 1DKUA 1PN3A 5REQB 3GDHA 2CGOA 3HBMA 3L8HA 5DIZA 1W93A 3JQCA 2ZUFA 1TX4B 1Y6JA 1CUGA 3BMCA 4ON9A 4IGIA 4AF8A 3N8NA 4MKFA 2K2QB 1TJ5A 3DCJA 2EDCA 1N2EA 2RGNC 2XDWA 3ZMSA 5FFFA 3FAZA 4JJ6A 1D2EA 4DBLC 1MPTA 1KFJB 3BIXA 2WU4A 2IQIA 4DN6A 4Z1MA 4JQZA 4E33A 3N7AA 4DLUA 4PXSA 3U62A 3FR7A 4JQCA 5I45A 4NEQA 4BRSA 3PNYA 3F9CA 1NSFA 4WNAA 1HNZO 4KQFA 5AESA 1HZZA 4KXFB 1NSTA 3MD9A 3FYUB 3WA6A 3K4QA 3KPUA 4ZCPA 1ZJWA 3GH1A 1E2NA 3ZJYA 4DDWA 3GJ4A 3SHQA 1M0EA 4JYYA 4XBFA 1RRPA 3LWRC 4FINA 5IK2D 1HO3A 1VBNA 4LHZA 4DUZB 4OH1A 5I48A 4DSOA 4KDCA 4CCYB 4UREA 4DABA 1K98A 3M1YA 2DWUA 4QDOA 4GMFA 1IWBB 1XZLA 4CNBA 5KUTA 1B6SA 3F6EX 2PXCA 3V7FA 2KQUA 1MW8X 2BGTA 1U9CA 1AU9A 4RTMA 3IIJA 3MXOA 3Q8HA 3AETA 1G41A 4LUCA 1FMLA 1E8NA 1ADJA 5DXJA 2NMUA 4DJFC 4LTNA 1UPBA 3V8RA 2YQ4A 4I1UA 4D2IA 3DNMA 4EECA 4G07A 5BRNA 4MWOA 3E7PA 1D5WA 5CXQA 4KNWA 1WA8B 3AMVA 2MWMA 3CD6F 4G1MB 1Z4KA 2CVZA 1U40A 4PIMA 1M1KW 1MW9X 3LFTA 1I9GA 4YY3O 1H05A 1RJ9A 5G1PA 4JI4B 1SJ9A 4G0OA 4KJXA 5AI4A 1IUPA 1KD1H 4PN7A 4RVSA 2OQIA 3D4BA 4YIHA 1RYFA 3B12A 3GUHA 1ISIA 1ZUQA 4QGAA 1XRPA 2EFEB 2GM3A 2XDAA 1ZR4A 3DVAB 4HNAB 1KY2A 3HM9A 3QU7A 3AC0A 1ZIXA 2K5UA 4X45A 4YJ3F 1EGVB 1XPUA 2FWIA 2AN9A 4CV3A 2XAGA 3UC5A 4W6ZA 3AVXA 5ERGB 4HX5A 4PJ0Z 3C16C 1FXUA 5FLYA 5EC1C 3C7DB 4W1SA 2W6OA 2HXSA 3W9UA 4OGKA 3IAUA 1RRMA 4N5MA 5L3SB 3MRXA 4Y67A 1LGYA 1GZDA 5LBQA 1I10A 2HZBA 3AGKA 2HADA 3RJ5A 4UULA 3V33A 2FWNA 2J9XB 1EBOA 5FPQA 5CLGA 1MABG 1EBBA 1JG1A 5JLJA 4PX3A 4WOCA 1JWLA 1HX7A 2V3VA 2Q3JA 4YO7A 2CLFB 4H4CA 2DHDA 3BHMA 3PC8A 4KDFA 4AO6A 3SOZA 2I7XA 1V41E 3ESZA 5A7GA 3L7KA 1QVGU 3AB3A 4KQIA 1B14A 4BVFA 1DIRA 1I2DA 3NOXA 1ZJJA 3P94A 1DRJA 4UE2A 1B00A 2Y48A 2G04A 5AM5A 1H22A 3GWZA 2D2FA 4K8RB 4O5OA 3K8ZA 3T1NA 4FZ0A 3SQNA 2J3JA 2C7PA 2X2FA 1NWCA 3F7NA 3AF1A 4EB3A 1E4VA 5E0KB 4EJSB 3K5HA 3A1UA 3TX2A 1V8BA 4YREA 4JUCA 4BQPA 4DG9A 2BUAA 4FOLA 1MH1A 3FUCA 4I19A 2H9YA 5FPYA 1PIWA 1GM8A 1IU9A 1NC3A 4BVLA 3WLPA 2PX2A 1IV2A 1ZLYA 1REQA 2E75B 4X44A 8ATCA 2YYZA 5SZIA 5KUKA 1A4XA 4FNOA 3LC1O 4LZNA 3ZGNA 4HYOA 2AOXA 1Z45A 2LDXA 1KMNA 4J42A 3D54A 4YCMA 3J80N 5D7BA 4I50B 5CIQA 4FMCB 2VSOA 4NXNB 1CQJA 5AI6A 1DKOA 1WHTB 1A7AA 4BP3A 1G6UA 1DKMA 4XQCA 2DQ3A 3IHLA 4BXOB 2X0IA 1N7IA 3L0CA 4ZI7B 1UFOA 2OKGA 4DTCA 3L5KA 4ALNA 4EI9A 3F3YA 5BMVA 4AKTA 4MULA 2BEVA 3QH4A 3AG4B 2C5FA 1UDWA 1POXA 3S1SA 1HL7A 4R5HA 1WM1A 4LRXA 2P3LA 1ORRA 2RH4A 4R3WA 3WJ2A 1PW7A 4GLLA 3BHNA 3B1VA 3QLUA 5MFPA 1HV8A 3LO5A 2YWBA 3CP1A 3RGGA 4FDAA 4FGKA 3B52X 1Q86H 2DRIA 4Y7DA 2H3OA 3VQYA 2H1WA 5DGDA 1HDCA 1Z0KA 3EGXB 3GNSA 2X7JA 4M1OA 1V37A 3NBMA 4P32A 3JAMA 1V43A 2E4UA 3W77A 3WK6A 4FDVA 5A0TA 1KP9A 5K0EA 3KYCA 2RAFA 5HK8A 5C51B 1E2LA 1S72F 1I3MA 4ACBA 2HWKA 5AO9A 1L5SA 2PKYX 1OAKA 3SLRA 4URXR 3WQBA 1Q7YW 3KXKA 5CPBA 4I9WA 3N0TA 4DRYA 2XSZD 3LWDA 4WCEV 1PNOA 2BRUA 2Q6TA 2P62A 3ENQA 3U3MA 1YVDA 2A9QA 3VH3A 4OUDA 3BF7A 2GLTA 3KQMA 3RRYA 1Z0UA 3HKBB 5B55A 3R3JA 3SJQC 2EKLA 3BC1A 2ICAA 1DK1A 4AM8A 4MR8B 1T9BA 5C46F 4Q4JA 3C8UA 1LBQA 2CE7A 4BKOA 4M7PA 5HGXA 3W06A 3E0QA 4U9HS 4EVQA 4CZZA 5K3EA 1T13A 1T26A 5FOWA 2Q5FA 1DQRA 1L7VC 3QHQA 3BRWD 3NNSA 3O9OA 4O2BB 4KVAA 4WQMA 2YN2A 3M9LA 1P39A 3DLPX 4RY8A 2QT9A 1SULA 4BJ6A 3O9ZA 3V1TC 2VPXA 5IVKA 4N1AA 5HBRA 5L7WA 2APJA 5F52A 2JJ8A 1JEQA 1VJDA 4C6RA 2VXCA 3OQNA 3OTWA 2WLIA 3G9TA 4HP8A 3WLEA 4AJPA 5J9PC 1N9GA 1A9RA 4LJAA 2O7NA 4LNAA 1T2VA 4RTNA 2CCJA 3QRWA 2NACA 1GNQA 4Z5XA 3QKRB 5B6PA 1JBEA 3IVMA 3OP1A 4LE2A 3G6EV 2X7RB 2PS3A 3AT1A 1RSOB 3CCEV 2UYYA 5BSMA 4PC1A 1KYZA 4KE8A 1JRLA 2H1OA 3DAPA 4H15A 4OL0A 1SUIA 5I7SA 1OYYA 3SK0A 3PPVA 1QKKA 4H17A 1FJGB 5CNJA 1XQ8A 4ZOLF 2IP2A 5CBKA 1NUTA 1OIWA 1COWG 3EG9A 4DLTA 2PH5A 3B6NA 2XF8A 1POWA 2J3IA 3WBFA 3WLOA 3ILYA 4KGXA 2FU5C 3K6KA 5DEOA 4Q1FA 4H7DA 1QZTA 2Y2VA 2CVOA 1LPOA 4QSMA 6REQA 5LD2C 4YDSA 5KTMA 1SBCA 4ZZ1A 3G0OA 5CJJA 5E6UA 3L79A 3REOA 1VQLV 1PT5A 1MG0A 4X1KA 2PMCA 4Y1EA 3C8DA 2PSDA 4YXWD 2AD1A 2XB4A 5IMBA 1H9AA 4D3XA 4DQDA 1YA6A 3OLVA 1PHRA 3NVKI 3GT0A 3GJTA 2YR0A 5F76A 1Q50A 4Q82A 1VLVA 4ZO7A 3EH1A 4LVUA 3ND5A 2IIPA 5L3ZA 1ZSVA 3T7RA 1ENOA 3ZQ4A 2BM1A 5JCZA 1XLTA 5AHXA 3EHDA 4OB7A 2QW1A 1D5NA 1SRQA 4D74A 3PGXA 3GEIA 4QOHA 2OC4A 3U3ZA 2X6TA 1S4QA 1G20E 3EYWA 2OBBA 1NLUA 2O3QA 2D59A 1VQPF 1T25A 1SXHA 5J2TB 5ESXA 4QJ5A 4ZZ2A 2M1XA 3RYFA 2BTQA 3O38A 5JZBA 3ZS8A 4M8IA 2DM6A 4UM7A 4A27A 1XZGA 2A59A 1WZCA 1Z74A 4A2WA 1Z13A 5AW6A 1NW7A 4TXNA 1VB5A 5THXA 2EATA 5FPSA 3CPEA 4XX0B 3VZDA 3AR7A 3Q11A 5C7LO 1QHYA 4HK4A 1JOYA 3DEAA 2OLKA 4E4RA 1DMSA 2WVGA 2GM4A 3N9IA 2OWOA 1JHZA 2B9VA 3HB1A 4Q3BA 4KJZA 2HMTA 4IYIA 2B92A 1SIWA 4UCXA 2Q68A 2QS9A 1AZSC 4FCCA 3KKPA 2B94A 2Z43A 5DGIA 1DTOA 1W1IA 3G1UA 5LBIA 5I51A 4C9BA 1UL1X 3KUCA 1WUIS 2AI3A 3NDIA 1JHAA 3P9XA 2XOEA 2PIAA 2QJ1A 3OKCA 4Z8XA 3I2FA 2X14A 2JIRA 3VMFA 2X8JB 4GLBA 2ZROA 1E2DA 3LUFA 5FQOA 3EJ6A 1UJ6A 2J32A 1PLLA 4O02B 4O1MA 1BU5A 2LR0A 3WHKA 2WA3A 3A05A 2ZTHA 1XXHB 5E1AC 1NY5A 2P8SA 2A7XA 1UBCA 1D2AA 2FYTA 3NORA 3VO9A 5KYTA 3PC7A 2IAFA 2H9IA 1D7OA 1AA9A 3RVOA 3R7BA 2RGWA 2I3ZA 4F7WA 5I4KA 3PB3A 1UJ2A 2X3UA 4GKBA 5HMLA 4DLZA 2IYOA 4QUHA 2XYRA 1E2PA 2GVDC 3IV6A 1PFWA 4K9KA 2B33A 2CXHA 4GS5A 3QG5A 5CA3A 2XKKA 4ARUA 4IHJF 5IAJA 2JAPA 3KD3A 2DQKA 5CYOA 4RSGA 3QW2A 5K51A 3AR4A 1NBEA 1ETUA 5GTIZ 2PY6A 3Q12A 3GRVA 4XPIA 3IP5A 4RKFA 2CFTA 1Q43A 3FZEA 1JBKA 2YHIB 1EHYA 3B2NA 4KBFA 5JASA 4E2LA 1E2UA 1RXUA 3BCRA 3SYRA 4R9SA 4EG5A 2ORVA 2HC9A 1COZA 1B2LA 4IOLA 5DB4A 3H1HH 1CQIB 2XMBA 4B2PA 2C2BA 5D6NA 3A1CA 1QHIA 5IH7A 5JH7A 1OJ7A 3RTEA 3CX7A 1JR6A 1Q19A 1ZXXA 2NV6A 1PJRA 1XTSA 2JHGA 2ZITA 5E4YA 1RRVA 2YJNA 3PYLA 3D6UA 3E70C 2MMGA 3X1JA 3TQTA 5L3DA 1J9ZA 1TDJA 5HFMA 3RGBA 4G8JA 3KZVA 2NMVA 3NBYC 1QZUA 4DWOA 4ND3A 3UMMA 3PE3A 4LMRA 4LHXA 4XQEA 2F23A 1FDSA 4Z9AA 1J39A 1GPJA 1SUEA 3FMGA 3STYA 4V0ME 5JROA 4Q05A 1JTFA 2C3MA 4AZVA 3I92A 4Z3OA 3DGEC 4WZBA 4N0PA 4EUHA 5TNXA 2YWJA 1NFQA 3T7JA 2PS1A 3IPXA 1NX6A 2CTWA 4KLZA 3V34A 3QOYA 3FNIA 2PT9A 1XRNA 1GNLA 4HFMA 5AXBA 5K0TA 2FX5A 4YMTA 2HA7A 4I9FA 5K99A 3RRMA 2XMDA 3ZOKA 2O8DA 1PUXA 2Q0QA 1UWVA 3CLTD 4M9ZA 4J0QA 1KKMA 2YWCA 3I61A 2C2YA 3N8HA 2PA3A 3KO8A 1BEZA 3ZE6A 2QLNA 2K7FA 1Y8CA 4OMFG 5TPWA 1U5BA 5AKZA 4BWYA 3RE3A 5I4IA 1HNWB 1GN3A 3Q3EA 4LFCO 3GFBA 4UFZA 2YZ2A 3VO2A 4HDRA 4ILKA 5D6OA 2QTFA 4CS4A 3JALB 3D2BA 1UF9A 2QTZA 1D4ZA 5E8JA 4MR9A 4J4BA 3E7XA 3RVDA 3HYNA 3I52A 1XXHE 4R6XA 1XL0A 3BZBA 5I01A 1KJ9A 4ZANA 3RROA 3JAWB 3LMEA 4F3RA 1AVMA 2VF5X 1U31A 3QU5A 4M1KA 5KWVA 4MO9A 1D8AA 3W05A 4W4KA 4BFYA 4JCCA 5JD6A 3OOWA 1G19A 3ZE9A 3T5PA 3C41J 5TXGA 3IMEA 3SYQA 2X8AA 3SHFA 4R2WA 2NLJC 2XTJA 3FCXA 3JQ8A 4FLWA 4K9OA 3K1AB 3AOGA 4HQ6A 1S3IA 1P18A 2EFYA 2IE8A 3WKAA 4GKKB 3AG6A 4X20B 5F7JA 2XUMA 2XNDA 1O6ZA 1RYMA 1P62B 1OY1A 2XE7A 4F9FA 4D4LA 3JQAA 4YAWA 4JMPA 5C1PA 3SNKA 3C90A 4MKXA 3QVXA 3DE4X 2IP4A 3SEFA 2CCKA 2I71A 1QU3A 4E5VA 1USKA 4U3FH 4BX8A 5ED4A 3CPHA 2BH2A 4L8GA 4QGGA 3V55A 2Q4TA 1CUYA 4GF5A 1AUXA 1VSBA 3LYBA 4PSVA 1N5JA 1R6NA 1NQWA 5F1PA 2WG0A 3T4PA 4RD4A 3BT7A 4JGGA 1R4MB 3EVCA 2OGWA 3RVJA 5J63A 1UJ4A 4R1MA 4PDLA 2PCJA 4L95C 1K3EA 2XGSA 4R1NA 5DNYB 3WK8A 4MV0A 1Y76A 1O77A 2CFCA 1QQBA 3BGDA 3C6XA 5TLSA 4N5IX 3ZWDA 1QBZA 2EWMA 3V4VB 1RWNA 2ISQA 1NVEA 2YSUB 1YZVA 2HRBA 3K2EA 1Z28A 2BAGA 3FSJX 4C06A 5TMPA 2W9XA 5JEEA 4BU0A 3QWBA 2VUSA 4BV3A 2LGQA 2VPIA 3AJ8A 3CIFA 2I7VA 4MV3A 4I4TA 4BRUA 3W3ZB 5TEVA 3K92A 2V8BA 3UMBA 4FE3A 4YRPA 3R74A 2QW0X 3W04A 2WM3A 3TLGA 4IMJB 4UHHA 4QQ8A 5EIWA 2KBFA 2C9DA 2VJQA 4M1MA 4A2CA 2GHQA 1OZGA 2GBPA 3NVAA 3N3BC 5T8KC 1QIHA 5CA0B 2BMFA 2UUOA 4BBPA 2O3RA 1MNGA 4RTQA 3G0IA 4PLTA 4M8LA 2OGZA 2FSVA 1JHXA 1RWBA 2O8BB 3PZRA 5B5EZ 1NKVA 3PFHA 3OQMA 2LV8A 1SPXA 2C9ZA 4FW8A 2P3SA 3LSTA 1SUWA 4XZ3A 1UJWB 2GN1A 4B48A 4DG8A 1ZGZA 5FBKA 1U8UA 4LJ7A 4B83A 3ZGZA 2VS0A 3OOEA 3V4ZA 1MV5A 5C1IA 1O5OA 4UMEA 5ALFA 2PS9A 1SZJG 1WQ3A 3F7TA 2G72A 5K4GA 4RNCA 2XOKG 4JB8A 3VC7A 1E2EA 5EXPA 5ULLA 4JEIA 3C3MA 3ICCA 4JI3O 1MAWA 3PV0A 4JITA 1NQAO 2VDVE 4F9EA 1CQPA 4GVLA 1Y7IA 3HTXA 3WG9A 1M0WA 3G1TA 1HLPA 2QLBA 5PNTA 5E3IA 1B3QA 5BR8B 1FD9A 2ZSKA 3AUAA 3WWYA 3OW2U 1MC4A 2IZOA 3ZTTA 2EBHX 1H93A 1ESMA 5BN3A 1K88A 3FHOA 3INGA 4EF4A 2FFHA 4LOHA 2FL4A 1T3SA 2JFPA 1U2TA 1NJ8A 2BGNA 1G98A 4ZEMA 3II6X 1D0IA 1N8KA 1LW6E 5CVUA 1UEXC 1KQFA 2OD7A 2Q1XA 3EF3A 2RB9A 4LY9A 5HQTA 5DW0A 2YWFA 1W5TA 1ZI8A 4QE7A 3WICA 5BO5A 2A92A 4EOGA 3DMTC 4DB4A 1N34B 2R3SA 2BHNA 4HT3B 1GPUA 1OPRA 4QHYA 5HE9A 2LKDA 4WOBA 1BMTA 2I1LA 2CHEA 1GY8A 5GTDA 3IKTA 3JZIA 2XB6A 3SF8A 2VJMA 5JCJD 3AY7A 5IY5B 5I7OA 3OIGA 4M4SA 1OCOC 1FFYA 3OONA 3D0KA 4E13A 5FFNA 5L53A 1P7BA 4TWAA 1EVJA 5A62A 1M90W 3E2EA 2HFJA 3KQPA 4FZ3A 1F51A 3IL2A 5CDUA 4PYNA 4MI3A 3HDYA 5COQA 4NJEB 1BDBA 1BRTA 5CBGA 2H5IA 5MHTA 4B3CA 4JGBA 1J0AA 1FS5A 3WNDA 4E22A 4MDEA 3VSDA 1E6KA 4RSMA 2C95A 4DIEA 1ZN9A 4LXIA 4JB0A 4PQGA 3F5TA 1EDEA 1FYXA 4GP9A 3LHFA 3JRNA 4TQFA 3JWPA 3DE3X 3CHXA 2XNKA 2R5WA 2L69A 3K1ZA 2H8PC 2C4MA 2FLKA 1CB7A 4IKOA 4XGRA 3WWZA 1H1LB 3IO5A 1OFHA 1JI0A 5I9BA 3QP9A 4KIUA 2HU7A 2YV3A 1G7TA 3O4VA 2GHTA 3CCCA 3TL6A 1QR9A 3IMCA 4DQVA 2OCPA 3ZNOA 2O2ZA 3PN1A 4ZN6A 4YRBA 1Q2XA 5CDGA 2GZLA 4HEA1 2HP0A 3Q0TA 2D5LA 4XLZA 5LKRA 2F59A 4CIXA 3SZGA 2O59A 4B6JA 5AUNB 2RONA 3W5IA 3CUWA 4CM6A 4NYJR 1B1CA 2KG7A 1QKIA 1TYEB 2JD0A 3RS0A 4CE6A 3JD0A 5K8LA 2NUPB 3MTDA 2AN3A 5CG2A 1K6IA 3BF8A 2DBYA 3PDJA 3P52A 5FI5A 4EI7A 3TIFA 3QUQA 3FZQA 1A2BA 1EESA 1E8DA 1UIMA 2JKZA 1GVHA 2NQTA 1QQTA 2ZIVB 1KMCA 5JANA 1YB2A 5ALRA 3HS3A 2OZVA 3ROKA 4WSOA 4BUCA 2Q3BA 2CVQA 4YRTA 5T4EA 4X64O 1TF2A 3RH0A 4W7IA 2BMJA