5JVGL

The large ribosomal subunit from deinococcus radiodurans in complex with avilamycin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5jvgL01
3CC7N 1KQSM 1VQ7N 1YHQN 3CCUN 4WFAL 3CCRN 5H1SQ 2QA4N 3OW2M 2ZJPL 1VQKN 1VQON 1K73O 2QEXN 1YJWN 2OTLN 1M90O 5GAEP 1YJ9N 3CCMN 1KD1O 1K8AO 1YJNN 3CCEN 3DLLL 1YI2N 4WF9L 3CPWM 1Q7YO 5GADP 3PIPL 1OVYA 4WCEL 4IOAL 1S72N 5DM6L 1M1KO 1K9MO 3CCVN 1YITN 1Q82O 2ZJQL 1Q81O 3CCLN 1VQ8N 5GAHP 1VQ5N 1ILYA 1QVFM 3PIOL 5HL7L 1QVGM 4WFBL 3G6EN 3CMEN 1VQLN 3CD6N 1Q86O 5JVHL 3I55N 4UY8O 1VQ6N 3CC4N 4IO9L 1YIJN 1VQMN 3CCSN 3CF5L 3G71N 1VQNN 3G4SN 3I56N 1VQPN 2OTJN 1VQ9N 3J7ZO 4WFNL 1JJ2M 3CC2N 3CXCM 2ZJRL 4IOCL 1W2BM 1NJIO 5DM7L 1N8RO 3CCQN 5MLCQ 3CCJN 4U67L 5GAGP 1KC8O 1VQ4N 3CMAN 5JVGL
chains in the Genus database with same CATH superfamily
4BC2A 1KQSM 3SUPA 1X9MA 2VG6A 4PUOA 4BRNA 3P83D 2QA4N 4YFUA 3VQPA 4AH9A 5LMUK 5LMNK 3VQ4A 1M90O 3HVRA 3G0ZA 1KD1O 3G10A 5KGWA 4F4KA 4QOZB 4H5TA 4KH5A 1NNEA 3Q7CA 4E7KA 3KK7A 4WF9L 4OLBA 1HNZK 3CPWM 5KPZA 4DSLA 1OVYA 4LY7A 1SKWA 2Z1IA 3OS1A 1D9FA 4DTOA 1N6QA 2G8FA 4Y1CA 3RMCA 5CR4A 1GLJO 2I7NA 5KI6A 4FJJA 1VQ5N 1C1AA 4OKJA 4C8OA 1A5XA 4RG8A 5J1EA 3OS0A 3QERA 3SUQA 4BRKA 3Q7BA 3D7EO 5HLFA 1I3AA 4CHYA 1NM1A 4B08A 4NO7A 4FJLA 4HVJA 1QQOA 5E84A 2KFZA 1BQNA 1NGIA 2FSJA 2QTDA 3MK6A 4A5BA 4FLUA 2I5JA 1VQ6N 1GLCG 1VSHA 4JKGA 2YHXA 1T03A 3AO2A 3ZYYX 4BR7A 4PKGA 1NGHA 5C10A 4FJIA 4FCYA 1U49A 5BRHA 3QO9A 4OJRA 1IBMK 4J2EA 5D3GA 4O5FA 5JLHA 4C8LA 3V1RA 5DK5A 3PY8A 3BZKA 3QIOA 3G25A 3AVKA 2Y1JA 4QAGA 3ZSZA 3VQ7A 1S6QA 5AQUA 2UXCK 3SUNA 3OYIA 4CGIA 4CD1A 4PL7A 3TSUA 3SAFA 3TAEA 4E7HA 2IS3A 1JLGA 4BR0A 4MFBA 1YXQA 2HHXA 2DFHA 3O9TA 2HHUA 4DV7K 1VQ7N 5AQYA 3UKRA 1RBTA 3JYTA 3J7YP 2NRXA 2UXBK 3D2EA 1YUWA 2FSKA 2ITMA 3K57A 5AR0A 1YJWN 5GAEP 3QBWA 1C0TA 4JNEA 1A5VA 4GVEA 1KAZA 5IT9O 3SQ1A 3CETA 3O4QA 4DTPA 3DLHA 2E4LA 2ASOA 5M1QA 5HRNA 4DV6K 3A2FA 4PHTX 2PYJA 3LM9A 1RFQA 1IKWA 2O8EB 3PIPL 4C8MA 3SZ2A 3C94A 4WCEL 4YOUA 3TI0A 5AQNA 2O8FA 5FRNA 1KAYA 1X1PA 3OYHA 4DQIA 3MMVA 2BDPA 3VQQA 1NGAA 4KREA 4IOXA 2E1YA 3WNHA 4B9MA 1SZ2A 2F96A 4M3YA 4LH5A 3RWUA 2HNZA 4MO5A 3I0RA 3ENBA 1SV5A 3GDQA 4BE0A 3OBWA 3BY5A 3NDKA 5JS2A 1LAVA 3HYFA 2GEMA 2F8TA 5AQLA 4HUFA 3ZT2A 4GKKK 4HTUA 3RMBA 4UY8O 4JKDA 4YDUA 4A57A 2YI1A 4B9QA 4CJEA 1HNWK 4AM6A 3QINA 2P9LA 3HTVA 1RGIA 2G8HA 2JLEA 2GUIA 4PY5A 1IH7A 2KZZA 1W2BM 3RRGA 4YHHK 5CY4A 1K6YA 1RTDA 2VWBA 2X6SA 4BGBA 3CFRA 4FLWA 1K8KB 3H6EA 4UQGA 2P9PB 1NU0A 3QNNA 1SKRA 2DPNA 1NK9A 4CEZA 3TAQA 5K14A 3H3NO 4EHUA 1Z26A 1NGGA 4FO0A 1EXQA 3VQ8A 1MDUB 5FPNA 4ID5A 3K9KA 5KQDA 3NGZA 3DRRA 2F4VK 4JKBA 3V9XA 1TYQB 1IG8A 2BTFA 4F2RA 1TL3A 4HWIA 4O5BA 3MAQA 2QWMA 2FBXA 3D2FA 4CHOA 3OYLA 2ZF5O 3RMAA 2JGUA 4JAXA 1SAZA 4CZMA 3ZSQA 4F3TA 4OX9K 2ZE2A 1SUQA 2YJEA 3HP6A 2P5GA 1X3NA 3QB0A 4A2BA 4CIGA 3VA0A 1XMOK 3M6GA 1ILYA 1U2VB 3NFAA 3CQXA 4H03B 5LJWA 4FJ8A 4E7LA 4DSJA 4CJPA 5J2NA 4BRPA 3H45C 1BCMA 3CM5A 3MCPA 4BRFA 2WTUA 4CHZA 3TPQA 1QSSA 4N56A 4PQUA 4CHPA 4HUGA 3T69A 3LANA 2X74A 3THWA 5KRTA 2YX6A 4JI0K 1GLEG 4FWNA 3BEXA 4WFNL 3EZ5A 3HPOA 4H0OA 3CC2N 3PV8A 4FLVA 1KFSA 2P9NB 2OZSA 1XI1A 1F21A 1C1CA 4JYAK 2A3ZA 1U47A 1N8RO 4RW8A 2DY4A 4FLZA 1BHLA 4FW2A 1IG9A 1XC9A 4BRMA 4B9LA 1GLDG 3D45A 5IWAK 4Z4FA 4IXCA 3K5NA 3CMAN 3BGRA 2WC9A 3K59A 1VSEA 3LAMA 4JK7A 4H0YB 3TTDA 5CYQA 4HTLA 4JKCA 4B3OA 2YKNA 3HSTB 3O3FA 4WFAL 3S9HA 2HBMA 2CH6A 2HVHA 5F0XA 4A59A 1S3XA 3NH0A 1HNVA 1SKSA 5SZTA 4PWDA 3LDNA 2IAJA 3CJ9A 2FLOA 3VA3A 3SPYA 1Z6RA 2ZWHA 3LDLA 1XHZA 1NJWA 1JLBA 2P9KB 3ATVA 4H0PA 1XQSC 3OS2A 2O8DA 4KHSA 2O8BB 1FXXA 3HPHA 4MLHA 4DU3A 4FK0A 5CZ2A 1L3VA 4CFDA 4QS7A 2D0OA 4KI6A 1BIUA 3DLBA 1ESVA 2XY8A 5C2FA 5AZIB 4CEAA 4E89A 4BREA 3U9ZA 1SQKA 4OPKA 3SQ2A 2W6KA 2VWKA 3L3UA 4CF1A 3UB5A 1WSHA 2YNHA 1J5OA 2QM1A 4C8NA 2E2QA 3G6EN 3SMSA 4HCCA 1NGJA 2LSNA 3EE8A 3GL1A 3I0SA 2RE2A 1TKDA 4RW6A 5AZJB 3ENHA 1NKEA 1VQMN 4YOTA 2PFUA 4CZHA 4X64K 1S1UA 5EU7A 2ASPA 2P9SB 1VQPN 5JLFA 4WE1A 3MN7A 1E4FT 3A5NC 1KLNA 4H8KA 3ZLJA 2A5XA 3VEOA 3CXCM 1CLQA 3DRSA 3TARA 4B3SK 1X9WA 4I6MA 3A5OC 1JXEA 4F3OA 4JD2A 4KHNA 3V9WA 4BRQA 4XH5A 4FSVA 3A5MC 2UUAK 4Z4HA 2YNIA 4AHUA 2VWJA 4PA1A 4Z4IA 2QW9A 3KJVA 4DF8A 2CGJA 2YNFA 2X78A 2O8CA 4IFVA 1DTQA 4CEQA 5AJ3K 1J5EK 2ZJPL 1BL3A 2GWKA 4FJ7A 4FLXA 3CFOA 1VRTA 3THVA 1KLMA 4B8AB 4KB1A 1REVA 1W9HA 2I7PA 3CG7A 3WXLA 3J7AP 2NRHA 3O08A 1T44A 1BA1A 1SL0A 1HQUA 1YTAA 1EP4A 4CZIA 4U7BA 2QWLA 4NXNK 3FLCO 5GIPA 3R8EA 2DFEA 4O44A 5AQOA 3WEEA 3TANA 4I2PA 1ZBHA 2G8KA 4DQQA 3UIQA 4FJNA 1HPMA 3ZX0A 3M8RA 3NHGA 4H5WA 4FWSA 3C6UA 4BDPA 4CCHA 2HMIA 1RDUA 4FOEA 3SV4A 1HYVA 4BC4A 4EP4A 1E4GT 3SCXA 4DUYK 2OPQA 3CQ8A 2VQFK 4KHUA 4CGFA 3VQEA 2Z1HA 2D0BA 4BR5A 2XY6A 4OVLA 3B6PA 4CZEA 2YJFA 5BR8K 3SBTA 2HSTA 3MXJA 1QVGM 3ZSYA 1B9DA 4GMJB 3CD6N 1A5WA 2EHGA 4TSXA 1S6PA 4FWMA 5LL6Z 4X62K 4DFKA 4DQSA 4KHPK 1RDWX 1QQCA 2F9WA 4IG3A 4J8FA 3KIOA 2Q31A 2FSNA 1U6ZA 2HHWA 2A40A 2B4JA 3OYKA 1JJ2M 4EFHA 3L2QA 3C7NA 3ZSVA 5AQGA 1BDGA 4DQPA 2FBTA 3RSEB 1RT4A 4B9UA 1R59O 5KGXA 3KK2A 3WXJA 3P5JA 3EY1A 3OYBA 1HPZA 1RT6A 3CHWA 5BPLA 3VMFB 4CESA 1MU2A 2CH5A 2GELA 1K8KA 4L3QA 3THXB 1HYZA 3AO4A 5EXWA 1YVNA 2IVPA 2E6LA 4GV6A 4DSFA 3O6WA 1C0UA 1LWEA 1WAFA 4W5OA 4O0JA 4CERA 2GX9A 4BVOA 5EY4A 4OGEA 2A1RA 4DMNA 1BWFO 2QEXN 1TYQA 1BO5O 5AQIA 4CHQA 4DU4A 1TAUA 5SWMA 4Z94A 3HOSA 2B5JA 3O1WA 2FBYA 3E9OA 3L4QA 4FJMA 2BGGA 3O4WA 4C8KA 1TK8A 1Q9XA 3U8XA 4BQZA 3J81O 3CCVN 1ASVA 4CEEA 1YITN 4KHWA 1TUYA 4DCHA 4B1UB 4CF2A 1TK5A 2XY7A 2P9UB 4RW9A 5LY3A 4JV5K 4DSKA 4LF6K 4H5NA 4IEEA 5AQRA 4CIEA 3AO1A 2Q0RA 5AQWA 3F9MA 3PIOL 3DOKA 4G9ZA 2F7TA 2QKKA 1XHXA 1U2VA 3J8AA 4KFBA 3F9KA 3CIPA 4B1YB 1YF5L 1RT1A 3QETA 4KBOA 3VF2A 4M41A 4H0TB 3IAYA 2HNYA 3AVAA 3CC4N 4CFBA 1RT2A 1TVRA 1VSMA 3E01A 2VGNA 4AHRA 1XMQK 2AA4A 3DMJA 4YNQA 5J2MA 2A41A 3VGMA 1HKBA 1NGCA 1SL1A 2HHVA 3O9SA 3D0PA 2E6MA 4KTZA 1S1WA 3L2VA 4KV8A 1NJYA 4BRIA 1C0GA 2Q1NA 3D6RA 3HXMA 2KKZA 3DI6A 4NXMK 4CEOA 4HHTA 4DR4K 3NGIA 4KKOA 4NYFA 2HW3A 1N36K 3CJBA 2QXLA 4DS5A 4IG0A 3DXKA 4NLBA 5BR9A 3V4IA 5C24A 4K25A 1HJOA 1P90A 5JVGL 2ZD1A 2KW4A 2G8WA 4M3ZA 3KLFA 3O3HA 2D4WA 3CQYA 3LPTA 1Q9YA 3CCRN 2P5OA 4AF1A 4WQ4A 2IGIA 4ELVA 1T3VA 1K73O 1OH8A 1WOQA 2NRWA 5I9EB 3DXMA 3P1GA 5HROA 3AAPA 3U3GA 4JLHA 3TU5A 3CCEN 3PO4A 1YAGA 1T8EA 3C6TA 4AILC 3T1AA 1GLLO 3ZETA 4CEFA 4LF8K 4I9QA 4CFAA 4IBNA 5LJVA 3VQ5A 5KPTA 5J2PA 1IO2A 3HRGA 4CZKA 4DTXA 3U4LA 3E1YA 4GY2B 4H0XB 4JRQA 1J6ZA 2O8BA 3K58A 4IWVA 4MO4A 1LCUA 5GAHP 3AO3A 3DLRA 4CJ7A 4F9OA 4BQLA 3VF6A 1WBDA 5AZIA 4LC9B 4M3XA 3EO3A 4H5VA 2A1SA 4WFBL 1NGEA 1RBRA 3RVCA 3ZT4A 4JI7K 3CI5A 2E8AA 5DMRA 1KRPA 3AVNA 2PY5A 2YKMA 4JI3K 2NRTA 3I55N 3VGLA 5B8HA 4J2AA 1LOTB 1SS6A 3G4SN 3TWHA 4DS4A 1NK7A 5JICA 2W6LA 3O8MA 3SJHA 1WNSA 2BE2A 1KVBA 4DG1A 1HKGA 1LWFA 1T05A 3THYA 3AV9A 3QMLA 4YOVA 1RTHA 5AQQA 1NG9A 4QS9A 2PYLA 4ZTJA 4ILHA 4FXDA 4WQ5A 4YDUC 4CVNE 1KSPA 3B6OA 4XIUA 3I33A 3FZFA 4JI4K 3VQBA 4B8CA 3KHYA 3AO5A 4JKFA 3TAMA 3CJCA 3AVGA 3K5LA 4BE2A 1C0FA 3UKUA 3ID8A 1QQNA 2NUBA 5AQJA 1VSKA 4ID1A 5FDLA 4BRCA 4BRHA 4CEDA 4BC5A 1CXUA 3CPEA 3ZX2A 3JAMO 1DT9A 2A42A 4BWJA 4NB4A 1HMVA 3VEWA 4E7JA 3SI6A 3A8YA 4JI1K 3WXMB 3ATUA 3AA2A 5AQSA 4K41A 3C6HA 4Y0WA 1RTIA 3T1YK 3AVMA 1KFDA 2PZSA 5I42A 4RWTA 3O9UA 1M1KO 4E1JA 5JS1A 3SAHA 4DTNA 2XY5A 1VQ8N 3HM9A 3K5OA 5AQPA 4KAZA 3VEYA 1VSFA 3UE5A 5BREA 4FPBA 3ID6A 4ISGA 1BISA 3MEDA 4CW7B 4LSLA 1ZBLA 3SNNA 1LV5A 4M42A 4B9NA 1RNHA 3AVJA 3OBYA 3GE1A 4KTWA 1I39A 1HR0K 3TAFA 4JK9A 3DAWA 1FKOA 1E3MA 3TAPA 4JI8K 4ILJA 4CGGA 3NF9A 3LZJA 3F5TA 1J54A 1JCFA 5FPDA 4PL8A 4A2AA 3M8PA 3T19A 3CYMA 5CYMA 4OKKA 1UOCA 5AQFA 4FVUA 4FWQA 1QHAA 1GLAG 4CK2A 4DV0K 2Q2RA 1VSDA 4IOCL 4E1NA 4R5PA 1KCFA 1ITGA 4IDHA 3DOLA 3FFKB 1NK6A 3SMPA 5GAGP 3RTVA 4DB3A 3OY9A 1OH5A 2D5RA 3RSEA 4EAHD 3KLGA 1LW2A 3E66A 1H1VA 5F1XA 1NJXA 4DHYA 3SK3A 3MECA 3LP2A 1O1WA 2GTDA 2RF2A 4CE9A 2HBLA 1FJGK 4QCLA 4DFMA 4JS4A 2BUPA 1BUPA 3HT3A 3OYCA 1EO1A 3SBGA 3THXA 3AA4A 3HK2A 3KLHA 2HHTA 1EWQA 4CJKA 4KB0A 4YORA 3FZMA 3IS9A 3CCMN 1GLBG 1EX4A 5TKYA 3R9PA 4FVMA 1NOYA 4M7XA 5FRMA 2XO7A 1BI4B 4JKGB 3LZIA 2NRVA 2GWJA 4FZYA 1U04A 2VG5A 4RCHA 1U4BA 4DSIA 1S72N 3GG4A 4LH4A 2NZTA 2KLAA 4CZJA 3SAGA 3CCLN 3OTOK 4RTFD 3ULDA 2IDOA 2OANA 5HRSA 1N33K 4DV2K 4DR7K 3O3GA 4WYBA 3U3YA 1NK8A 3S41A 4CZGA 1N32K 2HB5A 2BANA 3N4QA 4GV9A 4Z4CA 4DFPA 3VQ6A 4Z4GA 4OO1J 3PX6A 5FROA 2GBZA 4FZXC 1OVQA 4CJUA 3KKRA 1CZBA 2QWPA 3AVHA 3MXIA 4CHNA 1OH7A 5E41A 3CFPA 4CI6A 4B9SA 1VQNN 1RILA 3H46O 4JI2K 4FWOA 4LFCK 4FWKA 3M1FA 2OTJN 1RTJA 3PUFA 1VQ9N 3J7ZO 1BU6O 3V1QA 3SYZA 2G8VA 4M3RA 1UA0A 1HNXK 3D2EB 2IIRA 4H4OA 3QFPA 4N41A 4DR3K 3S3OA 3LL3A 3T3FA 2X6NA 4FLTA 1VAZA 3MWPA 1N34K 2KFNA 3OA9A 4MDBA 3LPUA 4RW7A 1WUAA 2QKBA 1IBKK 1T6CA 4NCBA 5FLXO 1KTQA 5KPRA 1OKJA 3CC7N 4BVPA 3HO1A 2V7ZA 4JHDB 5AQXA 1WBBA 3SV3A 3GOIA 4JRPA 3P38A 1UA1A 4BRAA 4B3RK 3WQUA 3VEXA 2HMPA 1VQON 4FW1A 3ULEB 4E19A 5AQTA 4OKEA 2OTLN 4CJVA 3ZT3A 3HOTA 2DFFA 2JWKA 3PSIA 1DKGD 2XHBA 5ADXA 5E26A 1BQMA 4F2SA 1I94K 2F9TA 4CF9A 1JL1A 2HF3A 2IVOA 4W5TA 4LFBK 4FM1A 1HUXA 4YOYA 4CECA 1Q82O 3V9SA 3DLGA 3IDHA 3C65A 4W5QA 4FJKA 1ZXOA 1VHXA 4CJFA 4CJ5A 4HUEA 1DGKN 1NGBA 2KHOA 2JWLA 2O4GA 4ZTFA 3KWGA 2HNDA 5JMVA 1VRUA 1JCEA 2W42A 2RPIA 4MDAA 4M45A 4GV3A 3WQTA 2YNGA 4H0VB 3CERA 4O55A 3VEVA 4DTJA 1Q86O 1J9AA 2UUBK 4CJLA 2QK9A 1Q8IA 1XC3A 1NK4A 3ZCMA 2O8EA 1YIJN 2ETJA 3FFIA 4M3WA 1ZBUA 4EP5A 3QEVA 4FZZA 4I7FA 5M1FA 4BDYA 1KAXA 3L8BA 4DFJA 3MXMA 4R79A 1TKZA 3ZT0A 5MLCQ 2HOEA 3WNEA 3OYEA 3QFUA 3OYJA 1P8ZA 1NMDA 1L3TA 4DV4K 2P1JA 3NE6A 1TKTA 3R1XA 2E88A 1LW0A 3U9DA 2R7YA 4DR1K 4DLGA 3LDSA 3FE1A 3AGRA 3WUHA 3ZT1A 4DTMA 1RBVA 1D9DA 2VQEK 2E1ZA 3LAKA 1VSJA 4GVMA 1HKCA 1S5JA 3FZKA 1XNQK 3KLIA 3LALA 4BRDA 4KI4A 4A62A 3VGKA 1ZBFA 4BR9A 4NYNA 3V1OA 3MEEA 3C0BA 4JS5A 4DV3K 5FPMA 3M8SA 1K8AO 1L3UA 1C6VA 3ZSOA 4N76A 4W5NA 3HZ6A 4KO0A 1IBLK 1Y64A 4GNIA 2P9PA 5GADP 4DR5K 3U6FA 4CZFA 5KRSA 1HLUA 4O8KA 3KK3A 4B9TA 1S1XA 1HJRA 1EQYA 3ZSRA 1X3MA 2ITGA 3THWB 3PX0A 5C12A 3M8QA 4CJSA 1ZBSA 4B1ZA 1R0AA 2HVIA 5HRPA 3EN9A 4H5RA 4G1QA 2OA8A 3R6MA 4BY9C 1NMNA 3MX2A 3O4NA 3BDPA 1V4TA 4CFCA 2QI2A 3L6QA 3VPZA 3WT0A 4IFYA 3WNGA 2YHAA 1Z05A 3SPZA 3L2WA 1BIZA 1EKEA 4IO9L 1ASWA 3CF5L 1RBSA 2IOCA 2OPPA 4E1MA 3KD5E 2YHBA 2YHYA 4CBUA 3MN6A 2D0CA 4M63C 4CF8A 1O13A 1W97L 1KVCA 2ZGYA 4K43A 4CBXA 2Z1GA 1HRHA 1SL2A 3QEPA 2O8DB 4H4MA 4CIFA 1L3SA 2XRIA 4LFAK 2VG7A 1V4SA 1BG3A 2YV0X 3FZHA 4O8UA 3OYNA 4E7IA 4F8RA 5AQZA 4FJXA 3P39A 1B92A 1YHQN 4B3TK 2Y1IA 1QE1A 1QQMA 3IRXA 2E20A 3LWMA 5J2QA 3QICA 4KTQA 2Z1JA 2UXDK 3HJFA 1YVUA 1IKYA 2P9NA 1IKVA 3BZCA 4BR2A 4E0DA 3HM8A 1YJNN 2OZMA 3LP3A 3T7ZA 4FL9A 3A0IX 3EKUA 3HVTA 4JKAA 3RRHA 5C2DA 1U45A 5EOYA 3HSCA 3V9UA 2F8SA 4FK4A 4BRLA 4WQ4C 5DM6L 1K9MO 1BI4A 3B8AX 2ZGZA 4AHTA 2IC3A 3SUOA 3WXIA 1TV6A 3DYAA 4O0IA 1W0HA 4ZHRA 5AQMA 4IJAA 1DEJA 4I6MB 3ZEUB 3RMDA 4JD2B 4IDKA 1JL2A 4DTUA 3K9JA 1XUPO 3ZX3A 4V19S 3DLEA 1VQLN 2O8CB 2P9KA 2D0PA 2NNWA 1RT3A 3QEXA 1GLFO 4K8ZA 4PKHA 3WNFA 4CK3A 3L2RA 4IEIA 2AP1A 3DJCA 2Q3SA 3FGUA 3L4IA 3PLAA 1JXBA 1ATSA 3E9LA 3O5BA 5GIOA 2ZJRL 5EVZA 2E2NA 4Z0UA 3NAEA 1YTUA 3WEEB 4FJ9A 4BDZA 1X9SA 4FPAA 3JSMA 5GINA 3VQCA 4CGJA 3QESA 2QWQA 1VK0A 3TTCA 2HBJA 3O1BA 2RHKA 5BRFA 1VQ4N 3NVKA 3DRPA 4JKHA 5AZJA 2HHQA 1B9FA 5AFUA 4DQRA 3O80A 1NWKA 2P9SA 3CCUN 2O4IA 5H1SQ 3L0QA 3MN9A 4WQ5C 4JHDA 3VOVA 3A5LC 1D5AA 4X65K 3VTIA 4BACA 3VF4A 2WBNA 5EX5A 5HOOA 3ISNC 3QEWA 5ADXH 3CJ1A 3ULEA 4HCBA 1MWKA 1L5UA 1YI2N 4YOXA 4AHSA 2P9IB 4B9VA 1S1TA 1DLOA 1GOBA 2E2PA 2HF4A 3ZSWA 4BGAA 3OJSA 2ZM6K 4FJGA 2G8IA 3QLHA 4DF4A 1CZAN 3OYDA 2FBVA 3ASMA 2ZJQL 4BC3A 3C7NB 3OHRA 3M5RA 3C6AA 2V52B 5AQKA 4IKFA 4FWPA 4KRFA 3FZLA 3EYZA 4M3UA 4Y1DA 3I8DA 3DWLA 4YOWA 3LDPA 1JLFA 3JXUA 3AY9A 4C23A 3O9QA 4DTRA 5CZ1A 1CZ9A 3TAGA 3OYFA 4JKEA 3KWIA 1RDAA 5F2RA 5C0YA 1Z25A 3MX5A 2CGKA 3LDOA 1NBWA 2YCHA 4CGDA 4NCGA 3QDKA 2NRZA 3KVGA 2OCEA 2BH1A 3I56N 3RR8A 2G8UA 4C1NK 2H3GX 5BN9A 4KPYA 3AGKA 4DSEA 5FPEA 1ZYQA 3PX4A 4JEPA 1BGXT 1UWBA 1FW6A 5BPNA 3NF7A 3VEZA 3IFRA 3ALYA 2IVNA 4W5RA 2FF6A 4CBWA 3VETA 1KC8O 1S9GA 1ATNA 5M1PA 4IJNA 1S1VA 4Q0BA 1N5YA 4OPHA 4Q5VA 4IZ9A 4JI5K 5HBMA 4B1XB 3OVNA 3EZWA 4EIAA 2Q0UA 2KQ2A 4M3TA 1ZBIA 4CJRA 3VQAA 2FC0A 3LM2A 3KD1E 1FKPA 2W41A 3V9ZA 3F73A 2V51B 3VN5A 1OH6A 4DUZK 3EL2A 4LF9K 4OPAA 1G99A 1YJ9N 4FM0A 3NMUA 1JLEA 3H08A 4RW4A 3VENA 3DLLL 3KTQA 4ICLA 5HRRA 3PO5A 4FK2A 1QTMA 5KQ8A 3VTHA 2DTUA 2VYPA 3MN5A 2B6AA 1RDDA 3KZBA 3LDQA 1T7PA 4IOAL 1D8YA 3K2PA 4CF0A 1BOTO 2OPRA 1NJZA 3VERA 1J53A 1BCOA 1ZC6A 4IFEA 4BR4A 3GBTA 3LP1A 4A61A 1S22A 3SJJA 3TSQA 3L3VA 4DR6K 3N4PA 4FOIA 1BA0A 5ELZA 4QS8A 4DR2K 1Y97A 1JLAA 1HNIA 3VQDA 4DU1A 5BPMA 3QNOA 3I8BA 5HL7L 3HL8A 4K0KK 1MA9B 3EKSA 3CMEN 5C25A 1WSGA 3TABA 1T6DA 3T1HK 1WSEA 2RN2A 2HHHK 3TSPA 1KVAA 2CGLA 3NBPA 3OJUA 3DXKB 3TTFA 4Z4EA 3CCSN 3V81A 1QZ5A 3H1QA 3IUCA 1ATRA 3O9RA 1CXQA 1IV0A 1VSIA 4XEIA 2KTQA 2OPSA 4I2QA 1HYSA 1QSYA 2ATQA 4J2BA 2P9UA 3AVBA 2FF3B 3AVIA 1W7AA 1WSJA 5AQVA 2QWNA 3DXMB 5DM7L 3JS6A 3S3MA 4N5SA 4OGCA 2FXUA 3ITHA 4KH6A 3R3LA 4DWIA 4LD0A 4DV1K 1D4XA 1JLCA 3ZETB 3S3NA 3ZSXA 2PAVA 4FWLA 4AM7A 4CJQA 5KTQA 4GKJK 3UKRB 1RCHA 1TUUA 3NH1A 3P4IA 4DV5K 3DLKA 1NK0A 1QHTA 1UAXA 4YY3K 3DM2A 1EWRA 5C15A 1JCGA 3OW2M 1QSLA 1VQKN 4L8RB 1NGFA 1C1BA 1S9EA 3L2UA 4KHQA 5C42A 1ASUA 3HI0A 1RT5A 4BG8A 2O8FB 3HPGA 4ISEA 3VQ9A 1Q7YO 3NF8A 3K5MA 4CJWA 3TR8A 2PBDA 3H1VX 4MLEA 2WOMA 1G15A 1TK0A 2RKIA 1NGDA 1WSIA 4KHYA 3QEIA 4JN4A 4O4GA 2QWRA 3KLEA 2D0AA 4B1VA 1Q81O 1DTTA 4ISFA 1Q18A 3QBXA 4LF5K 3THYB 1LAWA 4AQYK 4X66K 4EHTA 1KXPA 1QZ6A 4A5AA 4EZ9A 4DKWA 3WXKA 3IG1A 3OYGA 4CJ3A 4LF7K 4JK8A 5BRDA 4PKIA 3ZEUA 3SQ0A 5JVHL 4CJ4A 1TGOA 3BF3A 3AVFA 4IO8A 2WFBA 3SLCA 4CEBA 5CHIA 2P9LB 1RBUA 2KZMA 2EX3A 3IKMA 4CJTA 3P31A 1JLQA 2VGMA 4ELUA 4BG9A 2GV9A 3UKUB 1U48A 2HHSA 4EZ6A 3AVLA 4C1NI 3H3OB 3HP9A 4DQ8A 1C0MA 1VSLA 2P51A 4CK1A 2AJQA 1YT3A 5M1KA 4K8XA 3EE9A 3NCIA 3W0LA 2ASMA 3AARA 1RT7A 3FR0A 5M1NA 2WUSA 3QIPA 4U67L 4FYDA 1RDCA 5CE3A 1HX1A 5TKWA 4OPJA 4N47A 3AVCA 4B3MK 2YHWA 5T7BA 2NLXA 1XNRK 5AFUH 4J2DA 3BUZB 1X9JA 3VESA 5A2QO 4BE1A 1GOAA 4M7YA 1NKCA 3AA3A 3D2FB 3LWLA 4E3SA 1WN7A 4DTSA 4ELTA 4XH1A 3NH2A 3KKSA 3BP8A 3OYMA 4JI6K 5BN8A 4BWMA 4LSNA 5AQHA 1NKBA 4XH4A 3C95A 3MCAB 1IKXA 3HBTA 2VCPA 4NLCA 3PSFA 1XWLA 2QWOA 3LP0A 2UU9K 4AHVA 2UUCK 3NVMA 3NGYA 4CD3A 2P9IA 1RDBA 3AAQA 4FM2A 3SQ4A 2E5LK 1TL1A 3E9PA 4ILGB 3M3ZA 1NOZA 1MWMA 4FLYA 2Q36A 2V7YA 2A6AA 1QVFM 2D1KA 2NRRA 1TKXA 4FJ5A 2GUPA 3CJ7A 3F2KA 2J4RA 3KK1A 2E2OA 3MEGA 4DLEA 4FWRA 2W40A 1LWCA 3EEQA 3MWTA 3CM6A 2WONA 1IJJA 1HQEA 4FJHA 3CJAA 1FK9A 4KH4A 3OYAA 1WLJA 3G71N 3ENOA 2QXFA 2HBKA 1WSFA 4NCAA 3NF6A 4MQ3A 3MDQA 2Q97A 4GW6A 5M1OA 1WB9A 1QS4A 1EETA 1WAJA 4LF4K 1TAQA 1NJIO 2OYQA 2ZQBA 1NLVA 4AHCA 4BRGA 3CCQN 3IMXA 4OLAA 4K42A 3K0SA 4BROA 4CGHA 3RR7A 2UYTA 4B1WB 3CCJN 1JKHA 3V6DA 1GOCA 3J80O 2EWSA 1NK5A 4I9LA 3BF1A 3W3DA 5HP1A 3AA5X 5I3UA 4CZLA
chains in the Genus database with same CATH topology
5AFUA 2HBLA 2GWKA 3O80A 4BC2A 1KQSM 1NWKA 2BUPA 2P9SA 1BUPA 3CCUN 1EO1A 3SBGA 4BRNA 2I7PA 5H1SQ 2QA4N 3L0QA 3MN9A 3WXLA 2NRHA 4WQ5C 4JHDA 3O08A 1T44A 1BA1A 3VOVA 3A5LC 4CZIA 4U7BA 2QWLA 3VTIA 3FLCO 1M90O 4YORA 3FZMA 3VF4A 5GIPA 2WBNA 5EX5A 5HOOA 3CCMN 1GLBG 3R8EA 1KD1O 5TKYA 3R9PA 5AQOA 3WEEA 5ADXH 3CJ1A 4H5TA 4KH5A 3ULEA 3Q7CA 4M7XA 1MWKA 3KK7A 1YI2N 4YOXA 4WF9L 2P9IB 3CPWM 5KPZA 1HPMA 4JKGB 1OVYA 3ZX0A 2HF4A 2E2PA 2NRVA 4H5WA 4BGAA 4FWSA 2GWJA 1RDUA 4FOEA 4RCHA 4BC4A 1S72N 3GG4A 1CZAN 2NZTA 2KLAA 4CZJA 1E4GT 3SAGA 5CR4A 2ZJQL 4BC3A 1GLJO 2I7NA 3CCLN 4RTFD 3C7NB 3OHRA 3M5RA 1VQ5N 2OANA 3C6AA 4BR5A 2V52B 5AQKA 4FWPA 4CZEA 3FZLA 2YJFA 4WYBA 3SBTA 3S41A 4CZGA 2HSTA 1QVGM 4BRKA 3DWLA 3N4QA 3Q7BA 3D7EO 3JXUA 3LDPA 4YOWA 4GV9A 3CD6N 4OO1J 3AY9A 1NM1A 4NO7A 4FWMA 4C23A 3O9QA 1QQOA 5E84A 2FSJA 1NGIA 2QTDA 1RDWX 3MK6A 4JKEA 3KWIA 5F2RA 4A5BA 5C0YA 2F9WA 1VQ6N 1GLCG 4J8FA 3MX5A 2QWPA 2CGKA 4JKGA 3LDOA 2YHXA 1NBWA 2YCHA 3ZYYX 4BR7A 4CI6A 2Q31A 3QDKA 2FSNA 2NRZA 3KVGA 1VQNN 1U6ZA 2BH1A 3H46O 4PKGA 1NGHA 3I56N 5C10A 4FWOA 4FWKA 2A40A 3M1FA 5BRHA 2OTJN 4C1NK 2H3GX 1VQ9N 3J7ZO 1BU6O 5BN9A 4O5FA 5JLHA 3D2EB 1JJ2M 4EFHA 3AGKA 2IIRA 5FPEA 3C7NA 5AQGA 1BDGA 3QFPA 3G25A 3LL3A 4JEPA 1VAZA 3MWPA 3RSEB 5AQUA 5BPNA 3OA9A 4MDBA 3VEZA 3IFRA 4CD1A 2IVNA 1R59O 4PL7A 1WUAA 3TSUA 3WXJA 3SAFA 2FF6A 4CBWA 3VETA 1KC8O 1T6CA 3CHWA 5BPLA 3VMFB 4BR0A 1ATNA 2CH5A 2GELA 1K8KA 4L3QA 5M1PA 4IJNA 5KPRA 1OKJA 3CC7N 5EXWA 4BVPA 1YVNA 2IVPA 2V7ZA 1YXQA 4JHDB 4OPHA 3O9TA 4IZ9A 1VQ7N 5AQXA 5AQYA 4B1XB 4GV6A 3GOIA 3EZWA 3UKRA 4EIAA 2Q0UA 3O6WA 3P38A 2GX9A 3LM2A 4BRAA 2NRXA 4BVOA 5EY4A 3WQUA 3D2EA 2W41A 2HMPA 3VEXA 1VQON 1YUWA 2FSKA 2V51B 2ITMA 1BWFO 5AQTA 3ULEB 5AR0A 3EL2A 1TYQA 1YJWN 1BO5O 2QEXN 4OPAA 2OTLN 1G99A 5AQIA 5GAEP 3QBWA 1YJ9N 4JNEA 3NMUA 4Z94A 3HOSA 3HOTA 4GVEA 1KAZA 2JWKA 1DKGD 3O1WA 3CETA 3VENA 5ADXA 5E26A 3DLLL 2ASOA 3E9OA 3L4QA 5M1QA 4PHTX 3LM9A 1RFQA 5KQ8A 3O4WA 3PIPL 3VTHA 2F9TA 2VYPA 3MN5A 2HF3A 2IVOA 3KZBA 3LDQA 4YOUA 3U8XA 4WCEL 4IOAL 5AQNA 4BQZA 1BOTO 1KAYA 3VERA 1ZC6A 1HUXA 3MMVA 4YOYA 4IFEA 4BR4A 3CCVN 1YITN 1NGAA 1TUYA 1Q82O 4IOXA 2E1YA 4DCHA 4B1UB 3GBTA 4A61A 1S22A 2P9UB 3IDHA 3C65A 3TSQA 5LY3A 1SZ2A 1ZXOA 3N4PA 4FOIA 4H5NA 4IEEA 1BA0A 5AQRA 1DGKN 5ELZA 1NGBA 4MO5A 4QS8A 2KHOA 2JWLA 2Q0RA 3ENBA 3KWGA 3F9MA 5AQWA 5JMVA 3PIOL 5BPMA 4G9ZA 2F7TA 1JCEA 3GDQA 3I8BA 3OBWA 5HL7L 4MDAA 4GV3A 1MA9B 3EKSA 1U2VA 3WQTA 3J8AA 3CMEN 4H0VB 2GEMA 3CERA 1T6DA 3VEVA 3TSPA 3CIPA 1Q86O 2CGLA 5AQLA 3T7ZA 1YF5L 4B1YB 3DXKB 4KBOA 3TTFA 3VF2A 1XC3A 4H0TB 4UY8O 4JKDA 3CC4N 4YDUA 1YIJN 3CCSN 1QZ5A 2VGNA 3H1QA 2YI1A 3IUCA 4A57A 4B9QA 1ATRA 3O9RA 2AA4A 4XEIA 4AM6A 2P9LA 3HTVA 1RGIA 2A41A 3VGMA 5M1FA 1HKBA 1NGCA 1KAXA 2P9UA 2FF3B 3O9SA 1W2BM 5AQVA 2QWNA 4R79A 3DXMB 5DM7L 3JS6A 4BRIA 1C0GA 2Q1NA 3D6RA 5MLCQ 2FXUA 2VWBA 4BGBA 2HOEA 4KH6A 3R3LA 2KKZA 1K8KB 1D4XA 1NMDA 1P8ZA 3H6EA 3QFUA 3ZETB 2P9PB 2DPNA 2PAVA 4FWLA 3CJBA 2E88A 3R1XA 3H3NO 3U9DA 2QXLA 4AM7A 4NLBA 3DXKA 5BR9A 4EHUA 3UKRB 1NGGA 4FO0A 1TUUA 1P90A 1HJOA 3FE1A 4K25A 3AGRA 3WUHA 5JVGL 1MDUB 5FPNA 3K9KA 3P4IA 5KQDA 4JKBA 2E1ZA 1TYQB 1HKCA 1IG8A 2D4WA 3CQYA 2BTFA 3CCRN 4HWIA 3FZKA 5C15A 1JCGA 4AF1A 3OW2M 4WQ4A 4BRDA 1VQKN 1T3VA 4A62A 3VGKA 1NGFA 1K73O 2QWMA 3D2FA 1WOQA 4BR9A 2NRWA 2ZF5O 5I9EB 3DXMA 3C0BA 5FPMA 1K8AO 3AAPA 3TU5A 3CCEN 1YAGA 4JAXA 3HI0A 4BG8A 3HZ6A 1SAZA 1Y64A 4CZMA 1GLLO 4GNIA 2P9PA 4ISEA 3ZETA 5GADP 1Q7YO 2PBDA 4CZFA 1HLUA 4O8KA 3H1VX 4MLEA 5LJVA 1NGDA 1EQYA 2YJEA 5KPTA 3HRGA 1X3MA 4CZKA 4JN4A 3U4LA 3E1YA 1X3NA 3QB0A 4GY2B 1J6ZA 2QWRA 4H0XB 4A2BA 4B1VA 4IWVA 1Q81O 4ISFA 4MO4A 1Q18A 1LCUA 3QBXA 5C12A 5GAHP 3M6GA 1ZBSA 1ILYA 4B1ZA 4CJ7A 1U2VB 3CQXA 4EHTA 4F9OA 1KXPA 3EN9A 4BQLA 1QZ6A 4H03B 4H5RA 3VF6A 4A5AA 5LJWA 5AZIA 3R6MA 4BY9C 4LC9B 4DKWA 3EO3A 3WXKA 4H5VA 3MX2A 4WFBL 1NGEA 4JK8A 3RVCA 5BRDA 4PKIA 3ZEUA 3CI5A 2E8AA 1V4TA 4BRPA 5JVHL 3H45C 2QI2A 3L6QA 3BF3A 3VPZA 3WT0A 4IO8A 3SLCA 2WFBA 5CHIA 2NRTA 1Z05A 3I55N 2P9LB 3VGLA 5B8HA 4IO9L 3MCPA 4BRFA 1LOTB 3IKMA 3TPQA 1SS6A 3CF5L 3P31A 3G4SN 2VGMA 3T69A 4BG9A 2YHYA 5JICA 4CBUA 3MN6A 3UKUB 3O8MA 2YX6A 3SJHA 1GLEG 4M63C 4FWNA 3BEXA 4C1NI 4WFNL 1O13A 1W97L 1HKGA 3H3OB 4H0OA 3CC2N 4DQ8A 2P9NB 3QMLA 2ZGYA 5M1KA 4K43A 2A3ZA 1N8RO 3EE9A 4YOVA 5AQQA 4QS9A 4CBXA 3W0LA 2ASMA 4ILHA 4WQ5A 3AARA 4YDUC 3FR0A 5M1NA 2WUSA 4BRMA 4U67L 5CE3A 1HX1A 5TKWA 1GLDG 3I33A 2YHWA 4IXCA 3CMAN 3FZFA 2NLXA 1V4SA 1BG3A 2WC9A 5AFUH 3BUZB 1X9JA 3KHYA 3FZHA 4O8UA 3VESA 4JK7A 4H0YB 3TTDA 5AQZA 4HTLA 4JKCA 4M7YA 3P39A 4JKFA 3D2FB 1YHQN 3CJCA 1C0FA 4WFAL 1QQMA 3UKUA 2E20A 2HBMA 3ID8A 2CH6A 1QQNA 5AQJA 4BRCA 5F0XA 4XH1A 3QICA 4BRHA 4A59A 4BC5A 3CPEA 1S3XA 3BP8A 3ZX2A 5BN8A 1DT9A 2P9NA 2A42A 3LDNA 4NB4A 4BR2A 3HM8A 5AQHA 3CJ9A 2FLOA 3VEWA 4XH4A 3MCAB 3A8YA 1Z6RA 1YJNN 2ZWHA 3LDLA 3WXMB 2P9KB 3HBTA 3ATVA 4FL9A 3A0IX 3ATUA 2VCPA 4H0PA 1XQSC 3EKUA 3C6HA 4K41A 5AQSA 4NLCA 4Y0WA 4JKAA 2QWOA 4MLHA 5C2DA 5EOYA 3NVMA 3HSCA 4RWTA 3O9UA 2D0OA 4QS7A 4BRLA 4WQ4C 4CD3A 2P9IA 5DM6L 3AAQA 1M1KO 1ESVA 4E1JA 1K9MO 3B8AX 5C2FA 2ZGZA 5AZIB 3SAHA 3WXIA 1VQ8N 4BREA 3U9ZA 3E9PA 1SQKA 4ILGB 5AQPA 3M3ZA 5AQMA 4IJAA 1DEJA 3VEYA 3UE5A 1MWMA 5BREA 4I6MB 4FPBA 3ZEUB 3ID6A 2Q36A 2V7YA 4ISGA 3UB5A 2A6AA 4JD2B 1QVFM 2QM1A 2D1KA 3K9JA 2NRRA 1XUPO 3ZX3A 2E2QA 3G6EN 3SMSA 1VQLN 1NGJA 3EE8A 2GUPA 3CJ7A 3F2KA 2J4RA 3GL1A 2E2OA 2P9KA 2RE2A 3GE1A 3OBYA 4FWRA 2W40A 2D0PA 5AZJB 2NNWA 4JK9A 3DAWA 3MWTA 3ENHA 1IJJA 4ILJA 1VQMN 3CJAA 4YOTA 2PFUA 4KH4A 1GLFO 3F5TA 4CZHA 1JCFA 4PKHA 3G71N 5FPDA 4PL8A 2ASPA 3ENOA 2P9SB 2HBKA 4A2AA 5JLFA 1VQPN 4IEIA 2AP1A 3DJCA 3L4IA 3FGUA 3MDQA 2Q97A 3MN7A 5AQFA 4FVUA 3PLAA 4FWQA 1ATSA 1GLAG 1E4FT 1QHAA 3A5NC 3E9LA 2A5XA 3O5BA 5M1OA 2Q2RA 3VEOA 5GIOA 3CXCM 2ZJRL 5EVZA 4IOCL 2E2NA 4I6MA 1NJIO 3A5OC 1NLVA 4BRGA 3CCQN 4JD2A 3IMXA 3WEEB 4K42A 4FPAA 4IDHA 4BROA 5GINA 2UYTA 4B1WB 4BRQA 3CCJN 4XH5A 4FSVA 3FFKB 3A5MC 2QWQA 3SMPA 3TTCA 5GAGP 2HBJA 4DB3A 2EWSA 3O1BA 2RHKA 2QW9A 3BF1A 3RSEA 2CGJA 4EAHD 3E66A 1H1VA 5F1XA 4DHYA 3SK3A 5BRFA 3W3DA 1VQ4N 3NVKA 4JKHA 5AZJA 4CZLA 2GTDA 2ZJPL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 N;  1KQS M;  1VQ7 N;  1YHQ N;  3CCU N;  4WFA L;  3CCR N;  5H1S Q;  2QA4 N;  3OW2 M;  2ZJP L;  1VQK N;  1VQO N;  1K73 O;  2QEX N;  1YJW N;  2OTL N;  1M90 O;  5GAE P;  1YJ9 N;  3CCM N;  1KD1 O;  1K8A O;  1YJN N;  3CCE N;  3DLL L;  1YI2 N;  4WF9 L;  3CPW M;  1Q7Y O;  5GAD P;  3PIP L;  1OVY A;  4WCE L;  4IOA L;  1S72 N;  5DM6 L;  1M1K O;  1K9M O;  3CCV N;  1YIT N;  1Q82 O;  2ZJQ L;  1Q81 O;  3CCL N;  1VQ8 N;  5GAH P;  1VQ5 N;  1ILY A;  1QVF M;  3PIO L;  5HL7 L;  1QVG M;  4WFB L;  3G6E N;  3CME N;  1VQL N;  3CD6 N;  1Q86 O;  5JVH L;  3I55 N;  4UY8 O;  1VQ6 N;  3CC4 N;  4IO9 L;  1YIJ N;  1VQM N;  3CCS N;  3CF5 L;  3G71 N;  1VQN N;  3G4S N;  3I56 N;  1VQP N;  2OTJ N;  1VQ9 N;  3J7Z O;  4WFN L;  1JJ2 M;  3CC2 N;  3CXC M;  2ZJR L;  4IOC L;  1W2B M;  1NJI O;  5DM7 L;  1N8R O;  3CCQ N;  5MLC Q;  3CCJ N;  4U67 L;  5GAG P;  1KC8 O;  1VQ4 N;  3CMA N;  5JVG L; 
#chains in the Genus database with same CATH topology
 4BC2 A;  1KQS M;  3SUP A;  1X9M A;  2VG6 A;  4PUO A;  4BRN A;  3P83 D;  2QA4 N;  4YFU A;  3VQP A;  4AH9 A;  5LMU K;  5LMN K;  3VQ4 A;  1M90 O;  3HVR A;  3G0Z A;  1KD1 O;  3G10 A;  5KGW A;  4F4K A;  4QOZ B;  4H5T A;  4KH5 A;  1NNE A;  3Q7C A;  4E7K A;  3KK7 A;  4WF9 L;  4OLB A;  1HNZ K;  3CPW M;  5KPZ A;  4DSL A;  1OVY A;  4LY7 A;  1SKW A;  2Z1I A;  3OS1 A;  1D9F A;  4DTO A;  1N6Q A;  2G8F A;  4Y1C A;  3RMC A;  5CR4 A;  1GLJ O;  2I7N A;  5KI6 A;  4FJJ A;  1VQ5 N;  1C1A A;  4OKJ A;  4C8O A;  1A5X A;  4RG8 A;  5J1E A;  3OS0 A;  3QER A;  3SUQ A;  4BRK A;  3Q7B A;  3D7E O;  5HLF A;  1I3A A;  4CHY A;  1NM1 A;  4B08 A;  4NO7 A;  4FJL A;  4HVJ A;  1QQO A;  5E84 A;  2KFZ A;  1BQN A;  1NGI A;  2FSJ A;  2QTD A;  3MK6 A;  4A5B A;  4FLU A;  2I5J A;  1VQ6 N;  1GLC G;  1VSH A;  4JKG A;  2YHX A;  1T03 A;  3AO2 A;  3ZYY X;  4BR7 A;  4PKG A;  1NGH A;  5C10 A;  4FJI A;  4FCY A;  1U49 A;  5BRH A;  3QO9 A;  4OJR A;  1IBM K;  4J2E A;  5D3G A;  4O5F A;  5JLH A;  4C8L A;  3V1R A;  5DK5 A;  3PY8 A;  3BZK A;  3QIO A;  3G25 A;  3AVK A;  2Y1J A;  4QAG A;  3ZSZ A;  3VQ7 A;  1S6Q A;  5AQU A;  2UXC K;  3SUN A;  3OYI A;  4CGI A;  4CD1 A;  4PL7 A;  3TSU A;  3SAF A;  3TAE A;  4E7H A;  2IS3 A;  1JLG A;  4BR0 A;  4MFB A;  1YXQ A;  2HHX A;  2DFH A;  3O9T A;  2HHU A;  4DV7 K;  1VQ7 N;  5AQY A;  3UKR A;  1RBT A;  3JYT A;  3J7Y P;  2NRX A;  2UXB K;  3D2E A;  1YUW A;  2FSK A;  2ITM A;  3K57 A;  5AR0 A;  1YJW N;  5GAE P;  3QBW A;  1C0T A;  4JNE A;  1A5V A;  4GVE A;  1KAZ A;  5IT9 O;  3SQ1 A;  3CET A;  3O4Q A;  4DTP A;  3DLH A;  2E4L A;  2ASO A;  5M1Q A;  5HRN A;  4DV6 K;  3A2F A;  4PHT X;  2PYJ A;  3LM9 A;  1RFQ A;  1IKW A;  2O8E B;  3PIP L;  4C8M A;  3SZ2 A;  3C94 A;  4WCE L;  4YOU A;  3TI0 A;  5AQN A;  2O8F A;  5FRN A;  1KAY A;  1X1P A;  3OYH A;  4DQI A;  3MMV A;  2BDP A;  3VQQ A;  1NGA A;  4KRE A;  4IOX A;  2E1Y A;  3WNH A;  4B9M A;  1SZ2 A;  2F96 A;  4M3Y A;  4LH5 A;  3RWU A;  2HNZ A;  4MO5 A;  3I0R A;  3ENB A;  1SV5 A;  3GDQ A;  4BE0 A;  3OBW A;  3BY5 A;  3NDK A;  5JS2 A;  1LAV A;  3HYF A;  2GEM A;  2F8T A;  5AQL A;  4HUF A;  3ZT2 A;  4GKK K;  4HTU A;  3RMB A;  4UY8 O;  4JKD A;  4YDU A;  4A57 A;  2YI1 A;  4B9Q A;  4CJE A;  1HNW K;  4AM6 A;  3QIN A;  2P9L A;  3HTV A;  1RGI A;  2G8H A;  2JLE A;  2GUI A;  4PY5 A;  1IH7 A;  2KZZ A;  1W2B M;  3RRG A;  4YHH K;  5CY4 A;  1K6Y A;  1RTD A;  2VWB A;  2X6S A;  4BGB A;  3CFR A;  4FLW A;  1K8K B;  3H6E A;  4UQG A;  2P9P B;  1NU0 A;  3QNN A;  1SKR A;  2DPN A;  1NK9 A;  4CEZ A;  3TAQ A;  5K14 A;  3H3N O;  4EHU A;  1Z26 A;  1NGG A;  4FO0 A;  1EXQ A;  3VQ8 A;  1MDU B;  5FPN A;  4ID5 A;  3K9K A;  5KQD A;  3NGZ A;  3DRR A;  2F4V K;  4JKB A;  3V9X A;  1TYQ B;  1IG8 A;  2BTF A;  4F2R A;  1TL3 A;  4HWI A;  4O5B A;  3MAQ A;  2QWM A;  2FBX A;  3D2F A;  4CHO A;  3OYL A;  2ZF5 O;  3RMA A;  2JGU A;  4JAX A;  1SAZ A;  4CZM A;  3ZSQ A;  4F3T A;  4OX9 K;  2ZE2 A;  1SUQ A;  2YJE A;  3HP6 A;  2P5G A;  1X3N A;  3QB0 A;  4A2B A;  4CIG A;  3VA0 A;  1XMO K;  3M6G A;  1ILY A;  1U2V B;  3NFA A;  3CQX A;  4H03 B;  5LJW A;  4FJ8 A;  4E7L A;  4DSJ A;  4CJP A;  5J2N A;  4BRP A;  3H45 C;  1BCM A;  3CM5 A;  3MCP A;  4BRF A;  2WTU A;  4CHZ A;  3TPQ A;  1QSS A;  4N56 A;  4PQU A;  4CHP A;  4HUG A;  3T69 A;  3LAN A;  2X74 A;  3THW A;  5KRT A;  2YX6 A;  4JI0 K;  1GLE G;  4FWN A;  3BEX A;  4WFN L;  3EZ5 A;  3HPO A;  4H0O A;  3CC2 N;  3PV8 A;  4FLV A;  1KFS A;  2P9N B;  2OZS A;  1XI1 A;  1F21 A;  1C1C A;  4JYA K;  2A3Z A;  1U47 A;  1N8R O;  4RW8 A;  2DY4 A;  4FLZ A;  1BHL A;  4FW2 A;  1IG9 A;  1XC9 A;  4BRM A;  4B9L A;  1GLD G;  3D45 A;  5IWA K;  4Z4F A;  4IXC A;  3K5N A;  3CMA N;  3BGR A;  2WC9 A;  3K59 A;  1VSE A;  3LAM A;  4JK7 A;  4H0Y B;  3TTD A;  5CYQ A;  4HTL A;  4JKC A;  4B3O A;  2YKN A;  3HST B;  3O3F A;  4WFA L;  3S9H A;  2HBM A;  2CH6 A;  2HVH A;  5F0X A;  4A59 A;  1S3X A;  3NH0 A;  1HNV A;  1SKS A;  5SZT A;  4PWD A;  3LDN A;  2IAJ A;  3CJ9 A;  2FLO A;  3VA3 A;  3SPY A;  1Z6R A;  2ZWH A;  3LDL A;  1XHZ A;  1NJW A;  1JLB A;  2P9K B;  3ATV A;  4H0P A;  1XQS C;  3OS2 A;  2O8D A;  4KHS A;  2O8B B;  1FXX A;  3HPH A;  4MLH A;  4DU3 A;  4FK0 A;  5CZ2 A;  1L3V A;  4CFD A;  4QS7 A;  2D0O A;  4KI6 A;  1BIU A;  3DLB A;  1ESV A;  2XY8 A;  5C2F A;  5AZI B;  4CEA A;  4E89 A;  4BRE A;  3U9Z A;  1SQK A;  4OPK A;  3SQ2 A;  2W6K A;  2VWK A;  3L3U A;  4CF1 A;  3UB5 A;  1WSH A;  2YNH A;  1J5O A;  2QM1 A;  4C8N A;  2E2Q A;  3G6E N;  3SMS A;  4HCC A;  1NGJ A;  2LSN A;  3EE8 A;  3GL1 A;  3I0S A;  2RE2 A;  1TKD A;  4RW6 A;  5AZJ B;  3ENH A;  1NKE A;  1VQM N;  4YOT A;  2PFU A;  4CZH A;  4X64 K;  1S1U A;  5EU7 A;  2ASP A;  2P9S B;  1VQP N;  5JLF A;  4WE1 A;  3MN7 A;  1E4F T;  3A5N C;  1KLN A;  4H8K A;  3ZLJ A;  2A5X A;  3VEO A;  3CXC M;  1CLQ A;  3DRS A;  3TAR A;  4B3S K;  1X9W A;  4I6M A;  3A5O C;  1JXE A;  4F3O A;  4JD2 A;  4KHN A;  3V9W A;  4BRQ A;  4XH5 A;  4FSV A;  3A5M C;  2UUA K;  4Z4H A;  2YNI A;  4AHU A;  2VWJ A;  4PA1 A;  4Z4I A;  2QW9 A;  3KJV A;  4DF8 A;  2CGJ A;  2YNF A;  2X78 A;  2O8C A;  4IFV A;  1DTQ A;  4CEQ A;  5AJ3 K;  1J5E K;  2ZJP L;  1BL3 A;  2GWK A;  4FJ7 A;  4FLX A;  3CFO A;  1VRT A;  3THV A;  1KLM A;  4B8A B;  4KB1 A;  1REV A;  1W9H A;  2I7P A;  3CG7 A;  3WXL A;  3J7A P;  2NRH A;  3O08 A;  1T44 A;  1BA1 A;  1SL0 A;  1HQU A;  1YTA A;  1EP4 A;  4CZI A;  4U7B A;  2QWL A;  4NXN K;  3FLC O;  5GIP A;  3R8E A;  2DFE A;  4O44 A;  5AQO A;  3WEE A;  3TAN A;  4I2P A;  1ZBH A;  2G8K A;  4DQQ A;  3UIQ A;  4FJN A;  1HPM A;  3ZX0 A;  3M8R A;  3NHG A;  4H5W A;  4FWS A;  3C6U A;  4BDP A;  4CCH A;  2HMI A;  1RDU A;  4FOE A;  3SV4 A;  1HYV A;  4BC4 A;  4EP4 A;  1E4G T;  3SCX A;  4DUY K;  2OPQ A;  3CQ8 A;  2VQF K;  4KHU A;  4CGF A;  3VQE A;  2Z1H A;  2D0B A;  4BR5 A;  2XY6 A;  4OVL A;  3B6P A;  4CZE A;  2YJF A;  5BR8 K;  3SBT A;  2HST A;  3MXJ A;  1QVG M;  3ZSY A;  1B9D A;  4GMJ B;  3CD6 N;  1A5W A;  2EHG A;  4TSX A;  1S6P A;  4FWM A;  5LL6 Z;  4X62 K;  4DFK A;  4DQS A;  4KHP K;  1RDW X;  1QQC A;  2F9W A;  4IG3 A;  4J8F A;  3KIO A;  2Q31 A;  2FSN A;  1U6Z A;  2HHW A;  2A40 A;  2B4J A;  3OYK A;  1JJ2 M;  4EFH A;  3L2Q A;  3C7N A;  3ZSV A;  5AQG A;  1BDG A;  4DQP A;  2FBT A;  3RSE B;  1RT4 A;  4B9U A;  1R59 O;  5KGX A;  3KK2 A;  3WXJ A;  3P5J A;  3EY1 A;  3OYB A;  1HPZ A;  1RT6 A;  3CHW A;  5BPL A;  3VMF B;  4CES A;  1MU2 A;  2CH5 A;  2GEL A;  1K8K A;  4L3Q A;  3THX B;  1HYZ A;  3AO4 A;  5EXW A;  1YVN A;  2IVP A;  2E6L A;  4GV6 A;  4DSF A;  3O6W A;  1C0U A;  1LWE A;  1WAF A;  4W5O A;  4O0J A;  4CER A;  2GX9 A;  4BVO A;  5EY4 A;  4OGE A;  2A1R A;  4DMN A;  1BWF O;  2QEX N;  1TYQ A;  1BO5 O;  5AQI A;  4CHQ A;  4DU4 A;  1TAU A;  5SWM A;  4Z94 A;  3HOS A;  2B5J A;  3O1W A;  2FBY A;  3E9O A;  3L4Q A;  4FJM A;  2BGG A;  3O4W A;  4C8K A;  1TK8 A;  1Q9X A;  3U8X A;  4BQZ A;  3J81 O;  3CCV N;  1ASV A;  4CEE A;  1YIT N;  4KHW A;  1TUY A;  4DCH A;  4B1U B;  4CF2 A;  1TK5 A;  2XY7 A;  2P9U B;  4RW9 A;  5LY3 A;  4JV5 K;  4DSK A;  4LF6 K;  4H5N A;  4IEE A;  5AQR A;  4CIE A;  3AO1 A;  2Q0R A;  5AQW A;  3F9M A;  3PIO L;  3DOK A;  4G9Z A;  2F7T A;  2QKK A;  1XHX A;  1U2V A;  3J8A A;  4KFB A;  3F9K A;  3CIP A;  4B1Y B;  1YF5 L;  1RT1 A;  3QET A;  4KBO A;  3VF2 A;  4M41 A;  4H0T B;  3IAY A;  2HNY A;  3AVA A;  3CC4 N;  4CFB A;  1RT2 A;  1TVR A;  1VSM A;  3E01 A;  2VGN A;  4AHR A;  1XMQ K;  2AA4 A;  3DMJ A;  4YNQ A;  5J2M A;  2A41 A;  3VGM A;  1HKB A;  1NGC A;  1SL1 A;  2HHV A;  3O9S A;  3D0P A;  2E6M A;  4KTZ A;  1S1W A;  3L2V A;  4KV8 A;  1NJY A;  4BRI A;  1C0G A;  2Q1N A;  3D6R A;  3HXM A;  2KKZ A;  3DI6 A;  4NXM K;  4CEO A;  4HHT A;  4DR4 K;  3NGI A;  4KKO A;  4NYF A;  2HW3 A;  1N36 K;  3CJB A;  2QXL A;  4DS5 A;  4IG0 A;  3DXK A;  4NLB A;  5BR9 A;  3V4I A;  5C24 A;  4K25 A;  1HJO A;  1P90 A;  5JVG L;  2ZD1 A;  2KW4 A;  2G8W A;  4M3Z A;  3KLF A;  3O3H A;  2D4W A;  3CQY A;  3LPT A;  1Q9Y A;  3CCR N;  2P5O A;  4AF1 A;  4WQ4 A;  2IGI A;  4ELV A;  1T3V A;  1K73 O;  1OH8 A;  1WOQ A;  2NRW A;  5I9E B;  3DXM A;  3P1G A;  5HRO A;  3AAP A;  3U3G A;  4JLH A;  3TU5 A;  3CCE N;  3PO4 A;  1YAG A;  1T8E A;  3C6T A;  4AIL C;  3T1A A;  1GLL O;  3ZET A;  4CEF A;  4LF8 K;  4I9Q A;  4CFA A;  4IBN A;  5LJV A;  3VQ5 A;  5KPT A;  5J2P A;  1IO2 A;  3HRG A;  4CZK A;  4DTX A;  3U4L A;  3E1Y A;  4GY2 B;  4H0X B;  4JRQ A;  1J6Z A;  2O8B A;  3K58 A;  4IWV A;  4MO4 A;  1LCU A;  5GAH P;  3AO3 A;  3DLR A;  4CJ7 A;  4F9O A;  4BQL A;  3VF6 A;  1WBD A;  5AZI A;  4LC9 B;  4M3X A;  3EO3 A;  4H5V A;  2A1S A;  4WFB L;  1NGE A;  1RBR A;  3RVC A;  3ZT4 A;  4JI7 K;  3CI5 A;  2E8A A;  5DMR A;  1KRP A;  3AVN A;  2PY5 A;  2YKM A;  4JI3 K;  2NRT A;  3I55 N;  3VGL A;  5B8H A;  4J2A A;  1LOT B;  1SS6 A;  3G4S N;  3TWH A;  4DS4 A;  1NK7 A;  5JIC A;  2W6L A;  3O8M A;  3SJH A;  1WNS A;  2BE2 A;  1KVB A;  4DG1 A;  1HKG A;  1LWF A;  1T05 A;  3THY A;  3AV9 A;  3QML A;  4YOV A;  1RTH A;  5AQQ A;  1NG9 A;  4QS9 A;  2PYL A;  4ZTJ A;  4ILH A;  4FXD A;  4WQ5 A;  4YDU C;  4CVN E;  1KSP A;  3B6O A;  4XIU A;  3I33 A;  3FZF A;  4JI4 K;  3VQB A;  4B8C A;  3KHY A;  3AO5 A;  4JKF A;  3TAM A;  3CJC A;  3AVG A;  3K5L A;  4BE2 A;  1C0F A;  3UKU A;  3ID8 A;  1QQN A;  2NUB A;  5AQJ A;  1VSK A;  4ID1 A;  5FDL A;  4BRC A;  4BRH A;  4CED A;  4BC5 A;  1CXU A;  3CPE A;  3ZX2 A;  3JAM O;  1DT9 A;  2A42 A;  4BWJ A;  4NB4 A;  1HMV A;  3VEW A;  4E7J A;  3SI6 A;  3A8Y A;  4JI1 K;  3WXM B;  3ATU A;  3AA2 A;  5AQS A;  4K41 A;  3C6H A;  4Y0W A;  1RTI A;  3T1Y K;  3AVM A;  1KFD A;  2PZS A;  5I42 A;  4RWT A;  3O9U A;  1M1K O;  4E1J A;  5JS1 A;  3SAH A;  4DTN A;  2XY5 A;  1VQ8 N;  3HM9 A;  3K5O A;  5AQP A;  4KAZ A;  3VEY A;  1VSF A;  3UE5 A;  5BRE A;  4FPB A;  3ID6 A;  4ISG A;  1BIS A;  3MED A;  4CW7 B;  4LSL A;  1ZBL A;  3SNN A;  1LV5 A;  4M42 A;  4B9N A;  1RNH A;  3AVJ A;  3OBY A;  3GE1 A;  4KTW A;  1I39 A;  1HR0 K;  3TAF A;  4JK9 A;  3DAW A;  1FKO A;  1E3M A;  3TAP A;  4JI8 K;  4ILJ A;  4CGG A;  3NF9 A;  3LZJ A;  3F5T A;  1J54 A;  1JCF A;  5FPD A;  4PL8 A;  4A2A A;  3M8P A;  3T19 A;  3CYM A;  5CYM A;  4OKK A;  1UOC A;  5AQF A;  4FVU A;  4FWQ A;  1QHA A;  1GLA G;  4CK2 A;  4DV0 K;  2Q2R A;  1VSD A;  4IOC L;  4E1N A;  4R5P A;  1KCF A;  1ITG A;  4IDH A;  3DOL A;  3FFK B;  1NK6 A;  3SMP A;  5GAG P;  3RTV A;  4DB3 A;  3OY9 A;  1OH5 A;  2D5R A;  3RSE A;  4EAH D;  3KLG A;  1LW2 A;  3E66 A;  1H1V A;  5F1X A;  1NJX A;  4DHY A;  3SK3 A;  3MEC A;  3LP2 A;  1O1W A;  2GTD A;  2RF2 A;  4CE9 A;  2HBL A;  1FJG K;  4QCL A;  4DFM A;  4JS4 A;  2BUP A;  1BUP A;  3HT3 A;  3OYC A;  1EO1 A;  3SBG A;  3THX A;  3AA4 A;  3HK2 A;  3KLH A;  2HHT A;  1EWQ A;  4CJK A;  4KB0 A;  4YOR A;  3FZM A;  3IS9 A;  3CCM N;  1GLB G;  1EX4 A;  5TKY A;  3R9P A;  4FVM A;  1NOY A;  4M7X A;  5FRM A;  2XO7 A;  1BI4 B;  4JKG B;  3LZI A;  2NRV A;  2GWJ A;  4FZY A;  1U04 A;  2VG5 A;  4RCH A;  1U4B A;  4DSI A;  1S72 N;  3GG4 A;  4LH4 A;  2NZT A;  2KLA A;  4CZJ A;  3SAG A;  3CCL N;  3OTO K;  4RTF D;  3ULD A;  2IDO A;  2OAN A;  5HRS A;  1N33 K;  4DV2 K;  4DR7 K;  3O3G A;  4WYB A;  3U3Y A;  1NK8 A;  3S41 A;  4CZG A;  1N32 K;  2HB5 A;  2BAN A;  3N4Q A;  4GV9 A;  4Z4C A;  4DFP A;  3VQ6 A;  4Z4G A;  4OO1 J;  3PX6 A;  5FRO A;  2GBZ A;  4FZX C;  1OVQ A;  4CJU A;  3KKR A;  1CZB A;  2QWP A;  3AVH A;  3MXI A;  4CHN A;  1OH7 A;  5E41 A;  3CFP A;  4CI6 A;  4B9S A;  1VQN N;  1RIL A;  3H46 O;  4JI2 K;  4FWO A;  4LFC K;  4FWK A;  3M1F A;  2OTJ N;  1RTJ A;  3PUF A;  1VQ9 N;  3J7Z O;  1BU6 O;  3V1Q A;  3SYZ A;  2G8V A;  4M3R A;  1UA0 A;  1HNX K;  3D2E B;  2IIR A;  4H4O A;  3QFP A;  4N41 A;  4DR3 K;  3S3O A;  3LL3 A;  3T3F A;  2X6N A;  4FLT A;  1VAZ A;  3MWP A;  1N34 K;  2KFN A;  3OA9 A;  4MDB A;  3LPU A;  4RW7 A;  1WUA A;  2QKB A;  1IBK K;  1T6C A;  4NCB A;  5FLX O;  1KTQ A;  5KPR A;  1OKJ A;  3CC7 N;  4BVP A;  3HO1 A;  2V7Z A;  4JHD B;  5AQX A;  1WBB A;  3SV3 A;  3GOI A;  4JRP A;  3P38 A;  1UA1 A;  4BRA A;  4B3R K;  3WQU A;  3VEX A;  2HMP A;  1VQO N;  4FW1 A;  3ULE B;  4E19 A;  5AQT A;  4OKE A;  2OTL N;  4CJV A;  3ZT3 A;  3HOT A;  2DFF A;  2JWK A;  3PSI A;  1DKG D;  2XHB A;  5ADX A;  5E26 A;  1BQM A;  4F2S A;  1I94 K;  2F9T A;  4CF9 A;  1JL1 A;  2HF3 A;  2IVO A;  4W5T A;  4LFB K;  4FM1 A;  1HUX A;  4YOY A;  4CEC A;  1Q82 O;  3V9S A;  3DLG A;  3IDH A;  3C65 A;  4W5Q A;  4FJK A;  1ZXO A;  1VHX A;  4CJF A;  4CJ5 A;  4HUE A;  1DGK N;  1NGB A;  2KHO A;  2JWL A;  2O4G A;  4ZTF A;  3KWG A;  2HND A;  5JMV A;  1VRU A;  1JCE A;  2W42 A;  2RPI A;  4MDA A;  4M45 A;  4GV3 A;  3WQT A;  2YNG A;  4H0V B;  3CER A;  4O55 A;  3VEV A;  4DTJ A;  1Q86 O;  1J9A A;  2UUB K;  4CJL A;  2QK9 A;  1Q8I A;  1XC3 A;  1NK4 A;  3ZCM A;  2O8E A;  1YIJ N;  2ETJ A;  3FFI A;  4M3W A;  1ZBU A;  4EP5 A;  3QEV A;  4FZZ A;  4I7F A;  5M1F A;  4BDY A;  1KAX A;  3L8B A;  4DFJ A;  3MXM A;  4R79 A;  1TKZ A;  3ZT0 A;  5MLC Q;  2HOE A;  3WNE A;  3OYE A;  3QFU A;  3OYJ A;  1P8Z A;  1NMD A;  1L3T A;  4DV4 K;  2P1J A;  3NE6 A;  1TKT A;  3R1X A;  2E88 A;  1LW0 A;  3U9D A;  2R7Y A;  4DR1 K;  4DLG A;  3LDS A;  3FE1 A;  3AGR A;  3WUH A;  3ZT1 A;  4DTM A;  1RBV A;  1D9D A;  2VQE K;  2E1Z A;  3LAK A;  1VSJ A;  4GVM A;  1HKC A;  1S5J A;  3FZK A;  1XNQ K;  3KLI A;  3LAL A;  4BRD A;  4KI4 A;  4A62 A;  3VGK A;  1ZBF A;  4BR9 A;  4NYN A;  3V1O A;  3MEE A;  3C0B A;  4JS5 A;  4DV3 K;  5FPM A;  3M8S A;  1K8A O;  1L3U A;  1C6V A;  3ZSO A;  4N76 A;  4W5N A;  3HZ6 A;  4KO0 A;  1IBL K;  1Y64 A;  4GNI A;  2P9P A;  5GAD P;  4DR5 K;  3U6F A;  4CZF A;  5KRS A;  1HLU A;  4O8K A;  3KK3 A;  4B9T A;  1S1X A;  1HJR A;  1EQY A;  3ZSR A;  1X3M A;  2ITG A;  3THW B;  3PX0 A;  5C12 A;  3M8Q A;  4CJS A;  1ZBS A;  4B1Z A;  1R0A A;  2HVI A;  5HRP A;  3EN9 A;  4H5R A;  4G1Q A;  2OA8 A;  3R6M A;  4BY9 C;  1NMN A;  3MX2 A;  3O4N A;  3BDP A;  1V4T A;  4CFC A;  2QI2 A;  3L6Q A;  3VPZ A;  3WT0 A;  4IFY A;  3WNG A;  2YHA A;  1Z05 A;  3SPZ A;  3L2W A;  1BIZ A;  1EKE A;  4IO9 L;  1ASW A;  3CF5 L;  1RBS A;  2IOC A;  2OPP A;  4E1M A;  3KD5 E;  2YHB A;  2YHY A;  4CBU A;  3MN6 A;  2D0C A;  4M63 C;  4CF8 A;  1O13 A;  1W97 L;  1KVC A;  2ZGY A;  4K43 A;  4CBX A;  2Z1G A;  1HRH A;  1SL2 A;  3QEP A;  2O8D B;  4H4M A;  4CIF A;  1L3S A;  2XRI A;  4LFA K;  2VG7 A;  1V4S A;  1BG3 A;  2YV0 X;  3FZH A;  4O8U A;  3OYN A;  4E7I A;  4F8R A;  5AQZ A;  4FJX A;  3P39 A;  1B92 A;  1YHQ N;  4B3T K;  2Y1I A;  1QE1 A;  1QQM A;  3IRX A;  2E20 A;  3LWM A;  5J2Q A;  3QIC A;  4KTQ A;  2Z1J A;  2UXD K;  3HJF A;  1YVU A;  1IKY A;  2P9N A;  1IKV A;  3BZC A;  4BR2 A;  4E0D A;  3HM8 A;  1YJN N;  2OZM A;  3LP3 A;  3T7Z A;  4FL9 A;  3A0I X;  3EKU A;  3HVT A;  4JKA A;  3RRH A;  5C2D A;  1U45 A;  5EOY A;  3HSC A;  3V9U A;  2F8S A;  4FK4 A;  4BRL A;  4WQ4 C;  5DM6 L;  1K9M O;  1BI4 A;  3B8A X;  2ZGZ A;  4AHT A;  2IC3 A;  3SUO A;  3WXI A;  1TV6 A;  3DYA A;  4O0I A;  1W0H A;  4ZHR A;  5AQM A;  4IJA A;  1DEJ A;  4I6M B;  3ZEU B;  3RMD A;  4JD2 B;  4IDK A;  1JL2 A;  4DTU A;  3K9J A;  1XUP O;  3ZX3 A;  4V19 S;  3DLE A;  1VQL N;  2O8C B;  2P9K A;  2D0P A;  2NNW A;  1RT3 A;  3QEX A;  1GLF O;  4K8Z A;  4PKH A;  3WNF A;  4CK3 A;  3L2R A;  4IEI A;  2AP1 A;  3DJC A;  2Q3S A;  3FGU A;  3L4I A;  3PLA A;  1JXB A;  1ATS A;  3E9L A;  3O5B A;  5GIO A;  2ZJR L;  5EVZ A;  2E2N A;  4Z0U A;  3NAE A;  1YTU A;  3WEE B;  4FJ9 A;  4BDZ A;  1X9S A;  4FPA A;  3JSM A;  5GIN A;  3VQC A;  4CGJ A;  3QES A;  2QWQ A;  1VK0 A;  3TTC A;  2HBJ A;  3O1B A;  2RHK A;  5BRF A;  1VQ4 N;  3NVK A;  3DRP A;  4JKH A;  5AZJ A;  2HHQ A;  1B9F A;  5AFU A;  4DQR A;  3O80 A;  1NWK A;  2P9S A;  3CCU N;  2O4I A;  5H1S Q;  3L0Q A;  3MN9 A;  4WQ5 C;  4JHD A;  3VOV A;  3A5L C;  1D5A A;  4X65 K;  3VTI A;  4BAC A;  3VF4 A;  2WBN A;  5EX5 A;  5HOO A;  3ISN C;  3QEW A;  5ADX H;  3CJ1 A;  3ULE A;  4HCB A;  1MWK A;  1L5U A;  1YI2 N;  4YOX A;  4AHS A;  2P9I B;  4B9V A;  1S1T A;  1DLO A;  1GOB A;  2E2P A;  2HF4 A;  3ZSW A;  4BGA A;  3OJS A;  2ZM6 K;  4FJG A;  2G8I A;  3QLH A;  4DF4 A;  1CZA N;  3OYD A;  2FBV A;  3ASM A;  2ZJQ L;  4BC3 A;  3C7N B;  3OHR A;  3M5R A;  3C6A A;  2V52 B;  5AQK A;  4IKF A;  4FWP A;  4KRF A;  3FZL A;  3EYZ A;  4M3U A;  4Y1D A;  3I8D A;  3DWL A;  4YOW A;  3LDP A;  1JLF A;  3JXU A;  3AY9 A;  4C23 A;  3O9Q A;  4DTR A;  5CZ1 A;  1CZ9 A;  3TAG A;  3OYF A;  4JKE A;  3KWI A;  1RDA A;  5F2R A;  5C0Y A;  1Z25 A;  3MX5 A;  2CGK A;  3LDO A;  1NBW A;  2YCH A;  4CGD A;  4NCG A;  3QDK A;  2NRZ A;  3KVG A;  2OCE A;  2BH1 A;  3I56 N;  3RR8 A;  2G8U A;  4C1N K;  2H3G X;  5BN9 A;  4KPY A;  3AGK A;  4DSE A;  5FPE A;  1ZYQ A;  3PX4 A;  4JEP A;  1BGX T;  1UWB A;  1FW6 A;  5BPN A;  3NF7 A;  3VEZ A;  3IFR A;  3ALY A;  2IVN A;  4W5R A;  2FF6 A;  4CBW A;  3VET A;  1KC8 O;  1S9G A;  1ATN A;  5M1P A;  4IJN A;  1S1V A;  4Q0B A;  1N5Y A;  4OPH A;  4Q5V A;  4IZ9 A;  4JI5 K;  5HBM A;  4B1X B;  3OVN A;  3EZW A;  4EIA A;  2Q0U A;  2KQ2 A;  4M3T A;  1ZBI A;  4CJR A;  3VQA A;  2FC0 A;  3LM2 A;  3KD1 E;  1FKP A;  2W41 A;  3V9Z A;  3F73 A;  2V51 B;  3VN5 A;  1OH6 A;  4DUZ K;  3EL2 A;  4LF9 K;  4OPA A;  1G99 A;  1YJ9 N;  4FM0 A;  3NMU A;  1JLE A;  3H08 A;  4RW4 A;  3VEN A;  3DLL L;  3KTQ A;  4ICL A;  5HRR A;  3PO5 A;  4FK2 A;  1QTM A;  5KQ8 A;  3VTH A;  2DTU A;  2VYP A;  3MN5 A;  2B6A A;  1RDD A;  3KZB A;  3LDQ A;  1T7P A;  4IOA L;  1D8Y A;  3K2P A;  4CF0 A;  1BOT O;  2OPR A;  1NJZ A;  3VER A;  1J53 A;  1BCO A;  1ZC6 A;  4IFE A;  4BR4 A;  3GBT A;  3LP1 A;  4A61 A;  1S22 A;  3SJJ A;  3TSQ A;  3L3V A;  4DR6 K;  3N4P A;  4FOI A;  1BA0 A;  5ELZ A;  4QS8 A;  4DR2 K;  1Y97 A;  1JLA A;  1HNI A;  3VQD A;  4DU1 A;  5BPM A;  3QNO A;  3I8B A;  5HL7 L;  3HL8 A;  4K0K K;  1MA9 B;  3EKS A;  3CME N;  5C25 A;  1WSG A;  3TAB A;  1T6D A;  3T1H K;  1WSE A;  2RN2 A;  2HHH K;  3TSP A;  1KVA A;  2CGL A;  3NBP A;  3OJU A;  3DXK B;  3TTF A;  4Z4E A;  3CCS N;  3V81 A;  1QZ5 A;  3H1Q A;  3IUC A;  1ATR A;  3O9R A;  1CXQ A;  1IV0 A;  1VSI A;  4XEI A;  2KTQ A;  2OPS A;  4I2Q A;  1HYS A;  1QSY A;  2ATQ A;  4J2B A;  2P9U A;  3AVB A;  2FF3 B;  3AVI A;  1W7A A;  1WSJ A;  5AQV A;  2QWN A;  3DXM B;  5DM7 L;  3JS6 A;  3S3M A;  4N5S A;  4OGC A;  2FXU A;  3ITH A;  4KH6 A;  3R3L A;  4DWI A;  4LD0 A;  4DV1 K;  1D4X A;  1JLC A;  3ZET B;  3S3N A;  3ZSX A;  2PAV A;  4FWL A;  4AM7 A;  4CJQ A;  5KTQ A;  4GKJ K;  3UKR B;  1RCH A;  1TUU A;  3NH1 A;  3P4I A;  4DV5 K;  3DLK A;  1NK0 A;  1QHT A;  1UAX A;  4YY3 K;  3DM2 A;  1EWR A;  5C15 A;  1JCG A;  3OW2 M;  1QSL A;  1VQK N;  4L8R B;  1NGF A;  1C1B A;  1S9E A;  3L2U A;  4KHQ A;  5C42 A;  1ASU A;  3HI0 A;  1RT5 A;  4BG8 A;  2O8F B;  3HPG A;  4ISE A;  3VQ9 A;  1Q7Y O;  3NF8 A;  3K5M A;  4CJW A;  3TR8 A;  2PBD A;  3H1V X;  4MLE A;  2WOM A;  1G15 A;  1TK0 A;  2RKI A;  1NGD A;  1WSI A;  4KHY A;  3QEI A;  4JN4 A;  4O4G A;  2QWR A;  3KLE A;  2D0A A;  4B1V A;  1Q81 O;  1DTT A;  4ISF A;  1Q18 A;  3QBX A;  4LF5 K;  3THY B;  1LAW A;  4AQY K;  4X66 K;  4EHT A;  1KXP A;  1QZ6 A;  4A5A A;  4EZ9 A;  4DKW A;  3WXK A;  3IG1 A;  3OYG A;  4CJ3 A;  4LF7 K;  4JK8 A;  5BRD A;  4PKI A;  3ZEU A;  3SQ0 A;  5JVH L;  4CJ4 A;  1TGO A;  3BF3 A;  3AVF A;  4IO8 A;  2WFB A;  3SLC A;  4CEB A;  5CHI A;  2P9L B;  1RBU A;  2KZM A;  2EX3 A;  3IKM A;  4CJT A;  3P31 A;  1JLQ A;  2VGM A;  4ELU A;  4BG9 A;  2GV9 A;  3UKU B;  1U48 A;  2HHS A;  4EZ6 A;  3AVL A;  4C1N I;  3H3O B;  3HP9 A;  4DQ8 A;  1C0M A;  1VSL A;  2P51 A;  4CK1 A;  2AJQ A;  1YT3 A;  5M1K A;  4K8X A;  3EE9 A;  3NCI A;  3W0L A;  2ASM A;  3AAR A;  1RT7 A;  3FR0 A;  5M1N A;  2WUS A;  3QIP A;  4U67 L;  4FYD A;  1RDC A;  5CE3 A;  1HX1 A;  5TKW A;  4OPJ A;  4N47 A;  3AVC A;  4B3M K;  2YHW A;  5T7B A;  2NLX A;  1XNR K;  5AFU H;  4J2D A;  3BUZ B;  1X9J A;  3VES A;  5A2Q O;  4BE1 A;  1GOA A;  4M7Y A;  1NKC A;  3AA3 A;  3D2F B;  3LWL A;  4E3S A;  1WN7 A;  4DTS A;  4ELT A;  4XH1 A;  3NH2 A;  3KKS A;  3BP8 A;  3OYM A;  4JI6 K;  5BN8 A;  4BWM A;  4LSN A;  5AQH A;  1NKB A;  4XH4 A;  3C95 A;  3MCA B;  1IKX A;  3HBT A;  2VCP A;  4NLC A;  3PSF A;  1XWL A;  2QWO A;  3LP0 A;  2UU9 K;  4AHV A;  2UUC K;  3NVM A;  3NGY A;  4CD3 A;  2P9I A;  1RDB A;  3AAQ A;  4FM2 A;  3SQ4 A;  2E5L K;  1TL1 A;  3E9P A;  4ILG B;  3M3Z A;  1NOZ A;  1MWM A;  4FLY A;  2Q36 A;  2V7Y A;  2A6A A;  1QVF M;  2D1K A;  2NRR A;  1TKX A;  4FJ5 A;  2GUP A;  3CJ7 A;  3F2K A;  2J4R A;  3KK1 A;  2E2O A;  3MEG A;  4DLE A;  4FWR A;  2W40 A;  1LWC A;  3EEQ A;  3MWT A;  3CM6 A;  2WON A;  1IJJ A;  1HQE A;  4FJH A;  3CJA A;  1FK9 A;  4KH4 A;  3OYA A;  1WLJ A;  3G71 N;  3ENO A;  2QXF A;  2HBK A;  1WSF A;  4NCA A;  3NF6 A;  4MQ3 A;  3MDQ A;  2Q97 A;  4GW6 A;  5M1O A;  1WB9 A;  1QS4 A;  1EET A;  1WAJ A;  4LF4 K;  1TAQ A;  1NJI O;  2OYQ A;  2ZQB A;  1NLV A;  4AHC A;  4BRG A;  3CCQ N;  3IMX A;  4OLA A;  4K42 A;  3K0S A;  4BRO A;  4CGH A;  3RR7 A;  2UYT A;  4B1W B;  3CCJ N;  1JKH A;  3V6D A;  1GOC A;  3J80 O;  2EWS A;  1NK5 A;  4I9L A;  3BF1 A;  3W3D A;  5HP1 A;  3AA5 X;  5I3U A;  4CZL A; 
#chains in the Genus database with same CATH homology
 5AFU A;  2HBL A;  2GWK A;  3O80 A;  4BC2 A;  1KQS M;  1NWK A;  2BUP A;  2P9S A;  1BUP A;  3CCU N;  1EO1 A;  3SBG A;  4BRN A;  2I7P A;  5H1S Q;  2QA4 N;  3L0Q A;  3MN9 A;  3WXL A;  2NRH A;  4WQ5 C;  4JHD A;  3O08 A;  1T44 A;  1BA1 A;  3VOV A;  3A5L C;  4CZI A;  4U7B A;  2QWL A;  3VTI A;  3FLC O;  1M90 O;  4YOR A;  3FZM A;  3VF4 A;  5GIP A;  2WBN A;  5EX5 A;  5HOO A;  3CCM N;  1GLB G;  3R8E A;  1KD1 O;  5TKY A;  3R9P A;  5AQO A;  3WEE A;  5ADX H;  3CJ1 A;  4H5T A;  4KH5 A;  3ULE A;  3Q7C A;  4M7X A;  1MWK A;  3KK7 A;  1YI2 N;  4YOX A;  4WF9 L;  2P9I B;  3CPW M;  5KPZ A;  1HPM A;  4JKG B;  1OVY A;  3ZX0 A;  2HF4 A;  2E2P A;  2NRV A;  4H5W A;  4BGA A;  4FWS A;  2GWJ A;  1RDU A;  4FOE A;  4RCH A;  4BC4 A;  1S72 N;  3GG4 A;  1CZA N;  2NZT A;  2KLA A;  4CZJ A;  1E4G T;  3SAG A;  5CR4 A;  2ZJQ L;  4BC3 A;  1GLJ O;  2I7N A;  3CCL N;  4RTF D;  3C7N B;  3OHR A;  3M5R A;  1VQ5 N;  2OAN A;  3C6A A;  4BR5 A;  2V52 B;  5AQK A;  4FWP A;  4CZE A;  3FZL A;  2YJF A;  4WYB A;  3SBT A;  3S41 A;  4CZG A;  2HST A;  1QVG M;  4BRK A;  3DWL A;  3N4Q A;  3Q7B A;  3D7E O;  3JXU A;  3LDP A;  4YOW A;  4GV9 A;  3CD6 N;  4OO1 J;  3AY9 A;  1NM1 A;  4NO7 A;  4FWM A;  4C23 A;  3O9Q A;  1QQO A;  5E84 A;  2FSJ A;  1NGI A;  2QTD A;  1RDW X;  3MK6 A;  4JKE A;  3KWI A;  5F2R A;  4A5B A;  5C0Y A;  2F9W A;  1VQ6 N;  1GLC G;  4J8F A;  3MX5 A;  2QWP A;  2CGK A;  4JKG A;  3LDO A;  2YHX A;  1NBW A;  2YCH A;  3ZYY X;  4BR7 A;  4CI6 A;  2Q31 A;  3QDK A;  2FSN A;  2NRZ A;  3KVG A;  1VQN N;  1U6Z A;  2BH1 A;  3H46 O;  4PKG A;  1NGH A;  3I56 N;  5C10 A;  4FWO A;  4FWK A;  2A40 A;  3M1F A;  5BRH A;  2OTJ N;  4C1N K;  2H3G X;  1VQ9 N;  3J7Z O;  1BU6 O;  5BN9 A;  4O5F A;  5JLH A;  3D2E B;  1JJ2 M;  4EFH A;  3AGK A;  2IIR A;  5FPE A;  3C7N A;  5AQG A;  1BDG A;  3QFP A;  3G25 A;  3LL3 A;  4JEP A;  1VAZ A;  3MWP A;  3RSE B;  5AQU A;  5BPN A;  3OA9 A;  4MDB A;  3VEZ A;  3IFR A;  4CD1 A;  2IVN A;  1R59 O;  4PL7 A;  1WUA A;  3TSU A;  3WXJ A;  3SAF A;  2FF6 A;  4CBW A;  3VET A;  1KC8 O;  1T6C A;  3CHW A;  5BPL A;  3VMF B;  4BR0 A;  1ATN A;  2CH5 A;  2GEL A;  1K8K A;  4L3Q A;  5M1P A;  4IJN A;  5KPR A;  1OKJ A;  3CC7 N;  5EXW A;  4BVP A;  1YVN A;  2IVP A;  2V7Z A;  1YXQ A;  4JHD B;  4OPH A;  3O9T A;  4IZ9 A;  1VQ7 N;  5AQX A;  5AQY A;  4B1X B;  4GV6 A;  3GOI A;  3EZW A;  3UKR A;  4EIA A;  2Q0U A;  3O6W A;  3P38 A;  2GX9 A;  3LM2 A;  4BRA A;  2NRX A;  4BVO A;  5EY4 A;  3WQU A;  3D2E A;  2W41 A;  2HMP A;  3VEX A;  1VQO N;  1YUW A;  2FSK A;  2V51 B;  2ITM A;  1BWF O;  5AQT A;  3ULE B;  5AR0 A;  3EL2 A;  1TYQ A;  1YJW N;  1BO5 O;  2QEX N;  4OPA A;  2OTL N;  1G99 A;  5AQI A;  5GAE P;  3QBW A;  1YJ9 N;  4JNE A;  3NMU A;  4Z94 A;  3HOS A;  3HOT A;  4GVE A;  1KAZ A;  2JWK A;  1DKG D;  3O1W A;  3CET A;  3VEN A;  5ADX A;  5E26 A;  3DLL L;  2ASO A;  3E9O A;  3L4Q A;  5M1Q A;  4PHT X;  3LM9 A;  1RFQ A;  5KQ8 A;  3O4W A;  3PIP L;  3VTH A;  2F9T A;  2VYP A;  3MN5 A;  2HF3 A;  2IVO A;  3KZB A;  3LDQ A;  4YOU A;  3U8X A;  4WCE L;  4IOA L;  5AQN A;  4BQZ A;  1BOT O;  1KAY A;  3VER A;  1ZC6 A;  1HUX A;  3MMV A;  4YOY A;  4IFE A;  4BR4 A;  3CCV N;  1YIT N;  1NGA A;  1TUY A;  1Q82 O;  4IOX A;  2E1Y A;  4DCH A;  4B1U B;  3GBT A;  4A61 A;  1S22 A;  2P9U B;  3IDH A;  3C65 A;  3TSQ A;  5LY3 A;  1SZ2 A;  1ZXO A;  3N4P A;  4FOI A;  4H5N A;  4IEE A;  1BA0 A;  5AQR A;  1DGK N;  5ELZ A;  1NGB A;  4MO5 A;  4QS8 A;  2KHO A;  2JWL A;  2Q0R A;  3ENB A;  3KWG A;  3F9M A;  5AQW A;  5JMV A;  3PIO L;  5BPM A;  4G9Z A;  2F7T A;  1JCE A;  3GDQ A;  3I8B A;  3OBW A;  5HL7 L;  4MDA A;  4GV3 A;  1MA9 B;  3EKS A;  1U2V A;  3WQT A;  3J8A A;  3CME N;  4H0V B;  2GEM A;  3CER A;  1T6D A;  3VEV A;  3TSP A;  3CIP A;  1Q86 O;  2CGL A;  5AQL A;  3T7Z A;  1YF5 L;  4B1Y B;  3DXK B;  4KBO A;  3TTF A;  3VF2 A;  1XC3 A;  4H0T B;  4UY8 O;  4JKD A;  3CC4 N;  4YDU A;  1YIJ N;  3CCS N;  1QZ5 A;  2VGN A;  3H1Q A;  2YI1 A;  3IUC A;  4A57 A;  4B9Q A;  1ATR A;  3O9R A;  2AA4 A;  4XEI A;  4AM6 A;  2P9L A;  3HTV A;  1RGI A;  2A41 A;  3VGM A;  5M1F A;  1HKB A;  1NGC A;  1KAX A;  2P9U A;  2FF3 B;  3O9S A;  1W2B M;  5AQV A;  2QWN A;  4R79 A;  3DXM B;  5DM7 L;  3JS6 A;  4BRI A;  1C0G A;  2Q1N A;  3D6R A;  5MLC Q;  2FXU A;  2VWB A;  4BGB A;  2HOE A;  4KH6 A;  3R3L A;  2KKZ A;  1K8K B;  1D4X A;  1NMD A;  1P8Z A;  3H6E A;  3QFU A;  3ZET B;  2P9P B;  2DPN A;  2PAV A;  4FWL A;  3CJB A;  2E88 A;  3R1X A;  3H3N O;  3U9D A;  2QXL A;  4AM7 A;  4NLB A;  3DXK A;  5BR9 A;  4EHU A;  3UKR B;  1NGG A;  4FO0 A;  1TUU A;  1P90 A;  1HJO A;  3FE1 A;  4K25 A;  3AGR A;  3WUH A;  5JVG L;  1MDU B;  5FPN A;  3K9K A;  3P4I A;  5KQD A;  4JKB A;  2E1Z A;  1TYQ B;  1HKC A;  1IG8 A;  2D4W A;  3CQY A;  2BTF A;  3CCR N;  4HWI A;  3FZK A;  5C15 A;  1JCG A;  4AF1 A;  3OW2 M;  4WQ4 A;  4BRD A;  1VQK N;  1T3V A;  4A62 A;  3VGK A;  1NGF A;  1K73 O;  2QWM A;  3D2F A;  1WOQ A;  4BR9 A;  2NRW A;  2ZF5 O;  5I9E B;  3DXM A;  3C0B A;  5FPM A;  1K8A O;  3AAP A;  3TU5 A;  3CCE N;  1YAG A;  4JAX A;  3HI0 A;  4BG8 A;  3HZ6 A;  1SAZ A;  1Y64 A;  4CZM A;  1GLL O;  4GNI A;  2P9P A;  4ISE A;  3ZET A;  5GAD P;  1Q7Y O;  2PBD A;  4CZF A;  1HLU A;  4O8K A;  3H1V X;  4MLE A;  5LJV A;  1NGD A;  1EQY A;  2YJE A;  5KPT A;  3HRG A;  1X3M A;  4CZK A;  4JN4 A;  3U4L A;  3E1Y A;  1X3N A;  3QB0 A;  4GY2 B;  1J6Z A;  2QWR A;  4H0X B;  4A2B A;  4B1V A;  4IWV A;  1Q81 O;  4ISF A;  4MO4 A;  1Q18 A;  1LCU A;  3QBX A;  5C12 A;  5GAH P;  3M6G A;  1ZBS A;  1ILY A;  4B1Z A;  4CJ7 A;  1U2V B;  3CQX A;  4EHT A;  4F9O A;  1KXP A;  3EN9 A;  4BQL A;  1QZ6 A;  4H03 B;  4H5R A;  3VF6 A;  4A5A A;  5LJW A;  5AZI A;  3R6M A;  4BY9 C;  4LC9 B;  4DKW A;  3EO3 A;  3WXK A;  4H5V A;  3MX2 A;  4WFB L;  1NGE A;  4JK8 A;  3RVC A;  5BRD A;  4PKI A;  3ZEU A;  3CI5 A;  2E8A A;  1V4T A;  4BRP A;  5JVH L;  3H45 C;  2QI2 A;  3L6Q A;  3BF3 A;  3VPZ A;  3WT0 A;  4IO8 A;  3SLC A;  2WFB A;  5CHI A;  2NRT A;  1Z05 A;  3I55 N;  2P9L B;  3VGL A;  5B8H A;  4IO9 L;  3MCP A;  4BRF A;  1LOT B;  3IKM A;  3TPQ A;  1SS6 A;  3CF5 L;  3P31 A;  3G4S N;  2VGM A;  3T69 A;  4BG9 A;  2YHY A;  5JIC A;  4CBU A;  3MN6 A;  3UKU B;  3O8M A;  2YX6 A;  3SJH A;  1GLE G;  4M63 C;  4FWN A;  3BEX A;  4C1N I;  4WFN L;  1O13 A;  1W97 L;  1HKG A;  3H3O B;  4H0O A;  3CC2 N;  4DQ8 A;  2P9N B;  3QML A;  2ZGY A;  5M1K A;  4K43 A;  2A3Z A;  1N8R O;  3EE9 A;  4YOV A;  5AQQ A;  4QS9 A;  4CBX A;  3W0L A;  2ASM A;  4ILH A;  4WQ5 A;  3AAR A;  4YDU C;  3FR0 A;  5M1N A;  2WUS A;  4BRM A;  4U67 L;  5CE3 A;  1HX1 A;  5TKW A;  1GLD G;  3I33 A;  2YHW A;  4IXC A;  3CMA N;  3FZF A;  2NLX A;  1V4S A;  1BG3 A;  2WC9 A;  5AFU H;  3BUZ B;  1X9J A;  3KHY A;  3FZH A;  4O8U A;  3VES A;  4JK7 A;  4H0Y B;  3TTD A;  5AQZ A;  4HTL A;  4JKC A;  4M7Y A;  3P39 A;  4JKF A;  3D2F B;  1YHQ N;  3CJC A;  1C0F A;  4WFA L;  1QQM A;  3UKU A;  2E20 A;  2HBM A;  3ID8 A;  2CH6 A;  1QQN A;  5AQJ A;  4BRC A;  5F0X A;  4XH1 A;  3QIC A;  4BRH A;  4A59 A;  4BC5 A;  3CPE A;  1S3X A;  3BP8 A;  3ZX2 A;  5BN8 A;  1DT9 A;  2P9N A;  2A42 A;  3LDN A;  4NB4 A;  4BR2 A;  3HM8 A;  5AQH A;  3CJ9 A;  2FLO A;  3VEW A;  4XH4 A;  3MCA B;  3A8Y A;  1Z6R A;  1YJN N;  2ZWH A;  3LDL A;  3WXM B;  2P9K B;  3HBT A;  3ATV A;  4FL9 A;  3A0I X;  3ATU A;  2VCP A;  4H0P A;  1XQS C;  3EKU A;  3C6H A;  4K41 A;  5AQS A;  4NLC A;  4Y0W A;  4JKA A;  2QWO A;  4MLH A;  5C2D A;  5EOY A;  3NVM A;  3HSC A;  4RWT A;  3O9U A;  2D0O A;  4QS7 A;  4BRL A;  4WQ4 C;  4CD3 A;  2P9I A;  5DM6 L;  3AAQ A;  1M1K O;  1ESV A;  4E1J A;  1K9M O;  3B8A X;  5C2F A;  2ZGZ A;  5AZI B;  3SAH A;  3WXI A;  1VQ8 N;  4BRE A;  3U9Z A;  3E9P A;  1SQK A;  4ILG B;  5AQP A;  3M3Z A;  5AQM A;  4IJA A;  1DEJ A;  3VEY A;  3UE5 A;  1MWM A;  5BRE A;  4I6M B;  4FPB A;  3ZEU B;  3ID6 A;  2Q36 A;  2V7Y A;  4ISG A;  3UB5 A;  2A6A A;  4JD2 B;  1QVF M;  2QM1 A;  2D1K A;  3K9J A;  2NRR A;  1XUP O;  3ZX3 A;  2E2Q A;  3G6E N;  3SMS A;  1VQL N;  1NGJ A;  3EE8 A;  2GUP A;  3CJ7 A;  3F2K A;  2J4R A;  3GL1 A;  2E2O A;  2P9K A;  2RE2 A;  3GE1 A;  3OBY A;  4FWR A;  2W40 A;  2D0P A;  5AZJ B;  2NNW A;  4JK9 A;  3DAW A;  3MWT A;  3ENH A;  1IJJ A;  4ILJ A;  1VQM N;  3CJA A;  4YOT A;  2PFU A;  4KH4 A;  1GLF O;  3F5T A;  4CZH A;  1JCF A;  4PKH A;  3G71 N;  5FPD A;  4PL8 A;  2ASP A;  3ENO A;  2P9S B;  2HBK A;  4A2A A;  5JLF A;  1VQP N;  4IEI A;  2AP1 A;  3DJC A;  3L4I A;  3FGU A;  3MDQ A;  2Q97 A;  3MN7 A;  5AQF A;  4FVU A;  3PLA A;  4FWQ A;  1ATS A;  1GLA G;  1E4F T;  1QHA A;  3A5N C;  3E9L A;  2A5X A;  3O5B A;  5M1O A;  2Q2R A;  3VEO A;  5GIO A;  3CXC M;  2ZJR L;  5EVZ A;  4IOC L;  2E2N A;  4I6M A;  1NJI O;  3A5O C;  1NLV A;  4BRG A;  3CCQ N;  4JD2 A;  3IMX A;  3WEE B;  4K42 A;  4FPA A;  4IDH A;  4BRO A;  5GIN A;  2UYT A;  4B1W B;  4BRQ A;  3CCJ N;  4XH5 A;  4FSV A;  3FFK B;  3A5M C;  2QWQ A;  3SMP A;  3TTC A;  5GAG P;  2HBJ A;  4DB3 A;  2EWS A;  3O1B A;  2RHK A;  2QW9 A;  3BF1 A;  3RSE A;  2CGJ A;  4EAH D;  3E66 A;  1H1V A;  5F1X A;  4DHY A;  3SK3 A;  5BRF A;  3W3D A;  1VQ4 N;  3NVK A;  4JKH A;  5AZJ A;  4CZL A;  2GTD A;  2ZJP L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...