5JVGL

The large ribosomal subunit from deinococcus radiodurans in complex with avilamycin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5jvgL01
1Q7YO 3DLLL 1VQ8N 3PIPL 1K9MO 1YITN 1YIJN 1YJWN 2ZJQL 3CCJN 3CCMN 1YJ9N 1K73O 2OTJN 5MLCQ 1YJNN 4IO9L 3CCLN 1OVYA 1QVFM 1K8AO 1VQKN 3CF5L 1NJIO 4U67L 5GADP 1VQ5N 4WFBL 3I56N 3CXCM 5JVHL 1VQ7N 3CCVN 3CD6N 1W2BM 5JVGL 1YHQN 1Q86O 3CCEN 1S72N 3CPWM 3I55N 1VQLN 3CCSN 5GAEP 1N8RO 1VQNN 3G6EN 4WFNL 1JJ2M 3J7ZO 1VQ6N 2ZJRL 4UY8O 3G4SN 4WCEL 1KQSM 5H1SQ 1M1KO 2ZJPL 3CMEN 1KC8O 4WF9L 3CCRN 1Q81O 1Q82O 5DM6L 1KD1O 5DM7L 1VQON 1ILYA 4IOCL 3CMAN 1YI2N 5GAHP 3CC4N 3CC7N 1M90O 3CCQN 2QA4N 3CC2N 3OW2M 1VQPN 1VQMN 1QVGM 2OTLN 3PIOL 5GAGP 3G71N 5HL7L 4WFAL 1VQ4N 2QEXN 1VQ9N 3CCUN 4IOAL
chains in the Genus database with same CATH superfamily
3HYFA 3QETA 1HJOA 2P9UA 3AY9A 2HBMA 4CJSA 4N56A 4CF2A 4IEEA 1E3MA 1YIJN 1YJ9N 1TYQA 4CEDA 4ILGB 4JV5K 4CF1A 4BC3A 3RMBA 3O08A 4YY3K 1QVFM 2VCPA 4BC2A 5HBMA 1K6YA 4MLEA 1HJRA 2QM1A 5LY3A 2FSNA 4OKKA 5BRFA 3AVAA 4B3MK 4B1VA 1Q9XA 3RRHA 2OA8A 1NK0A 1N34K 4CZLA 3MX5A 4H0OA 5AQNA 3RWUA 5JVHL 4F2SA 3ZSRA 1RTJA 3T1AA 4DR5K 2KFNA 3NHGA 3SAGA 1Z6RA 3UKRB 1XMQK 4QOZB 3IUCA 3OYHA 4CJ7A 2F8TA 2G8KA 3AO2A 5AQXA 2E2QA 3T3FA 4H5TA 1VRTA 3G6EN 1BGXT 1QSYA 5AZJB 4FJKA 5FPEA 4M3UA 2J4RA 4UY8O 4I9QA 4DF8A 3D2EA 4CGDA 3FZHA 4XH1A 2A1RA 1BOTO 5T7BA 1JCEA 3VQBA 2V52B 2IVNA 4F3OA 4QS8A 4JN4A 1Q18A 1IO2A 1NK9A 2I5JA 4M41A 5GAHP 4CZKA 1LW2A 3B6OA 3RR8A 3LM9A 4IOXA 1TGOA 2IOCA 5CY4A 3MN7A 2E5LK 4M3YA 1NM1A 1NKEA 2YHYA 1XHZA 4CF9A 4XIUA 1RGIA 3WNEA 3NCIA 2IAJA 5AQHA 2W6LA 3C0BA 4CBWA 5C2FA 3ZT3A 1RDWX 1HLUA 5HRRA 1SZ2A 1ZXOA 4OJRA 4JKBA 5ELZA 3VTIA 3K5NA 1IBKK 2E6MA 4EHTA 1HNZK 3MWPA 3U9ZA 3OYMA 4KHSA 4H0PA 5LJWA 3SMSA 2WTUA 3OYCA 1WNSA 1RBVA 2O8DB 1RBSA 1KAXA 4YHHK 2OPSA 4DTNA 3K0SA 3QBXA 4RW9A 3A5MC 4BRFA 3RRGA 3C7NB 1EXQA 4CEAA 1WUAA 3OYGA 3S41A 2E2OA 4FO0A 2HVIA 1WN7A 4ZTJA 3WXLA 3JYTA 5F0XA 5GADP 5DK5A 3AVCA 4Z4CA 2P9PB 3VQ7A 4E1MA 4RWTA 2EX3A 1XC3A 4EFHA 4BR9A 5AQSA 4YORA 3CQXA 1WSJA 2P9IB 3A0IX 2UXCK 4OPKA 4DV3K 4CFBA 4I9LA 1RT3A 3VQ4A 4G9ZA 1RDAA 1NGFA 2Y1IA 1U2VB 4DS4A 3AVNA 4DQRA 4CZEA 5H1SQ 1NU0A 1J5OA 2Q31A 3DOLA 2QWMA 4CGHA 2HW3A 2VYPA 1C1BA 4YOUA 4CJLA 4YOYA 1BISA 1VQON 2QK9A 1IH7A 2UXDK 1WSEA 1KXPA 2E88A 4E7IA 3TPQA 3N4QA 2O8EA 4DQIA 3HO1A 2QA4N 4A5AA 4BR2A 2ETJA 3AO1A 4DFPA 4OO1J 3KKSA 4CCHA 4JK9A 2BDPA 1W9HA 2FBYA 3ZEUB 2BGGA 3QERA 1CZ9A 2B5JA 3CJAA 3N4PA 3RR7A 3GE1A 3CJ9A 1QZ5A 3IDHA 3R8EA 4GV6A 3VGMA 2F96A 3H45C 1A5XA 4NXMK 4H5VA 4HUGA 5FRMA 1W0HA 3NVMA 1OVQA 3FGUA 5KPZA 5EXWA 4E89A 5BREA 3CERA 4BDZA 4E3SA 1T7PA 1NGIA 1FXXA 1C0GA 3SQ0A 1T05A 2UYTA 3CJ1A 1YJNN 4HUEA 1U04A 4JI4K 1RT7A 3ISNC 5C24A 4BRQA 4EZ6A 4LC9B 3A8YA 4K8ZA 1KLMA 2NRRA 4Q5VA 4BVOA 1B9FA 3MEGA 4H4MA 3IG1A 3SPZA 4BRAA 3BY5A 2HBLA 4N47A 4IG3A 4JLHA 4MQ3A 2QI2A 4PWDA 4DR4K 5M1NA 1NJWA 4N5SA 3K57A 1LWFA 3WUHA 4EIAA 3CXCM 1EWRA 1V4TA 3KZBA 3V9SA 4FJLA 4BR4A 1TL1A 3CM5A 2ZQBA 3QEWA 1EWQA 5C15A 3F9KA 3G0ZA 3QFPA 4LH4A 2ATQA 1BL3A 2NZTA 2X78A 4IEIA 3ZSWA 3UKUA 3G4SN 4AH9A 2G8UA 4DTUA 3SQ2A 2G8VA 3ZSXA 1TKXA 3ZCMA 3QESA 4FYDA 1RTDA 5AQPA 3ZX3A 1DT9A 1TKDA 1BQNA 3NFAA 3RVCA 4DV1K 3O3HA 1KC8O 3NF6A 3OYKA 1WBDA 3V1RA 3NGYA 2VWBA 3CYMA 1QSSA 1S5JA 4ELVA 2VWKA 2YCHA 5SZTA 4IFEA 3KLIA 4FLXA 4FW1A 4FK0A 3FZLA 2HMIA 4MFBA 3CCQN 1TUYA 4KI6A 3ZSZA 1N36K 4CEQA 1ZBLA 3PIOL 3HK2A 1HYZA 2Q3SA 4NB4A 3VF6A 3L2RA 3O9TA 1GOAA 1LAVA 4OKEA 3THWA 4TSXA 3QIOA 1KCFA 1IKXA 3MMVA 3FR0A 4DV4K 1RDBA 3RSEA 4DV2K 4PL8A 3O4QA 5AQKA 5LL6Z 4ZTFA 5BRDA 3QNNA 1FKOA 3DMJA 3THXA 4DR2K 5KI6A 1N5YA 4CZHA 4FSVA 4JS5A 3ULDA 3KKRA 4CGJA 3DXMB 1D8YA 4DG1A 3U3GA 3V1OA 4XH5A 1ITGA 2YNGA 4FWLA 3J80O 3E66A 4HCBA 1NGBA 3CHWA 4CIEA 4RCHA 1TK0A 4KHPK 2IGIA 4KKOA 3PLAA 3DLBA 2IC3A 3F9MA 5CR4A 1U45A 1HNWK 4A61A 4ELUA 4AHVA 3TU5A 4GVMA 3SJHA 3DLGA 4HUFA 4R5PA 3KWGA 1VQNN 3AVGA 3NGZA 4EP5A 3BEXA 1XQSC 2GWKA 4FZZA 2QWRA 4DU3A 5BPLA 1U4BA 5JLFA 4F9OA 3MN5A 2ZJPL 3C6AA 2P9SA 3PUFA 3E9PA 4O4GA 3THVA 1HNIA 3GOIA 4M3RA 4E7JA 3TSUA 3D2FB 4JI6K 3HSCA 1RBUA 4IXCA 4NYNA 2A41A 4YFUA 4JKFA 1M90O 2Z1JA 3O9RA 2PZSA 5HP1A 3CC2N 3SJJA 4AHTA 1VAZA 4DV7K 2OCEA 1NGAA 2OANA 3TWHA 3U8XA 1JXBA 1OH7A 4A5BA 1LWCA 4O8UA 3C6UA 4JHDB 1EKEA 1X9JA 4DSFA 1C0FA 1SUQA 5J2NA 4H0TB 2RKIA 5E41A 4FXDA 4MO5A 4F8RA 4AM6A 3Q7CA 4E1JA 2QEXN 1FKPA 3HI0A 1NK4A 5K14A 1T44A 4JK7A 3J81O 4DFKA 4CGGA 2IVOA 4PKHA 4K41A 2YJFA 4PHTX 3CCJN 5C12A 4RG8A 2P9KA 3V1QA 1GLLO 3VOVA 3EL2A 1VSMA 1TAUA 4CJKA 4Y1CA 1VQKN 4JKGB 1HYVA 5KPTA 5JS2A 3LP2A 3QICA 4JAXA 4BRNA 3V9UA 3PSIA 3RMAA 2ITMA 5LMUK 1DTQA 3LDOA 3VETA 3L2UA 5EY4A 4BC5A 4F3TA 3DLRA 2YHBA 4H5WA 4CBUA 1NWKA 3AA5X 3OHRA 4W5RA 2HMPA 4O44A 3KK3A 5M1PA 1RT1A 4R79A 1VSLA 4CGFA 1BU6O 4YDUA 4L3QA 1KFDA 5LJVA 4WFNL 4X66K 3AV9A 3TARA 1TAQA 3THYA 3OS2A 3TI0A 2W40A 1OKJA 4B1UB 4W5TA 1KQSM 2QKKA 4KO0A 1G15A 3PV8A 4FJNA 4WQ4A 1HX1A 3MN9A 1JLGA 4RW6A 1QE1A 3M6GA 3KD5E 5TKWA 4CJEA 2D4WA 2GEMA 3IKMA 3O8MA 1H1VA 4B1ZA 4CK3A 4IOCL 1P8ZA 4LF4K 4BE0A 5IT9O 4BRPA 1XMOK 3O5BA 4KTZA 3CC4N 4CF0A 4DLGA 1WBBA 3KLHA 2FSKA 2Q1NA 3VQ8A 3KWIA 4IKFA 3WNHA 5GAGP 1N6QA 3KVGA 1KVAA 4I6MB 1WAFA 3BGRA 2ZGYA 4HHTA 4CHNA 4C23A 3V9XA 2NNWA 3DYAA 2HVHA 5KGWA 3ENBA 1VQ9N 3CCUN 2G8HA 3SK3A 5C10A 3DLLL 1D4XA 3AVJA 2HSTA 3VQQA 2QXLA 2JLEA 4BC4A 4RTFD 3ZSYA 5BPMA 1ZBUA 3CIPA 3WEEA 3TSQA 4HWIA 3NH1A 2OYQA 3WXKA 3CCLN 2FLOA 4NCAA 2QW9A 4CEFA 3WXJA 4NLBA 4CJRA 3SYZA 1GLDG 4FOIA 4KH4A 1SL0A 3AO3A 3ID8A 3ENOA 3B8AX 1NKBA 3HVTA 3QBWA 4CJPA 2HOEA 4OPHA 5C42A 1LWEA 1RCHA 4QS7A 1VQ5N 4GV9A 5AZIA 4KH5A 5FDLA 2GX9A 1VQ7N 5BR9A 3VEWA 2CH5A 3ULEB 4FM2A 2FF6A 4KH6A 2D0OA 3O4WA 3OYFA 4LF5K 1RTHA 1NGJA 3OYEA 3AVHA 4H8KA 3DM2A 3ZX2A 4BWJA 1HR0K 5JMVA 3H46O 2I7PA 1R0AA 4IJNA 1S1TA 3C95A 3OYJA 2P5OA 2AJQA 2P9LA 3IRXA 2I7NA 3VQ9A 2NRWA 1NG9A 2YHXA 1TV6A 4WF9L 4KB0A 1JL1A 5AQFA 4DQQA 5AQMA 4DTOA 1WLJA 4DUZK 4FWRA 2GV9A 3U4LA 2O4GA 5F2RA 2W41A 3SUNA 4AHRA 4BG9A 4J8FA 1NMNA 2WUSA 1HNXK 1JCFA 3A5NC 4E0DA 4YOTA 3H3NO 4BRKA 3CFPA 3DRSA 3GG4A 1Q7YO 3HRGA 3AGKA 2GUIA 1K9MO 2XO7A 3QFUA 1GLJO 2Y1JA 2IVPA 2FXUA 1NK5A 1NK6A 4KTQA 3VF4A 4FJ9A 4JD2B 4N76A 3VA3A 1I94K 4Z0UA 4X64K 4IZ9A 1J5EK 1S9EA 3CETA 2VGMA 4FPAA 2YJEA 3V81A 3T1HK 2O8FB 1GLEG 1NKCA 3DAWA 4BRMA 3ITHA 3HPGA 3S3MA 5FRNA 4B9MA 3C6TA 2KTQA 4BRGA 1JLCA 3CQYA 2F8SA 2G8FA 3OS0A 3O1WA 4LY7A 1LCUA 2UU9K 2NRTA 4W5QA 3G25A 4FK4A 4BROA 1ATRA 4DUYK 2PAVA 4HTUA 1MWMA 1J54A 2QWPA 1UAXA 3WQTA 3QINA 1L5UA 4ISGA 4JYAK 1TVRA 4OPAA 5AQGA 5BN8A 4E7LA 4PKIA 3LDNA 4JKEA 3FZFA 3KD1E 4LFCK 3CJBA 4NCGA 3VEVA 1RNHA 1E4GT 4BRIA 4KFBA 1IG9A 2A42A 1LW0A 3MWTA 1DEJA 5M1KA 1RTIA 1U48A 1EO1A 1D5AA 2PFUA 4CFDA 1T6CA 1Z25A 1J9AA 3L2VA 2HBJA 1X3NA 2WOMA 3MEEA 1BO5O 5CYQA 1JLQA 2YNHA 3T7ZA 3O9QA 3O9SA 5KPRA 4DSLA 1DGKN 3ZSOA 1VQPN 3LWLA 1HRHA 1BWFO 3ZX0A 4B9QA 4CBXA 1SKSA 2Q0RA 1KAYA 4CHQA 3LM2A 1GLAG 1S1UA 4M7XA 2HBKA 4K0KK 3SV3A 1JLFA 2E8AA 1B92A 2P5GA 1T6DA 3AAPA 3C6HA 1QQMA 3PIPL 3UKRA 3OVNA 3R9PA 3VQDA 4FM1A 2DY4A 2HHSA 5AQRA 3TABA 1A5VA 1DTTA 3CCMN 3THWB 2HHHK 3ID6A 2PYJA 1NGCA 4B1WB 4FLYA 4CHPA 5AZJA 1NGGA 3GBTA 1JLBA 4J2BA 4XEIA 4LF8K 3SQ4A 2HF3A 4X62K 4YOWA 1BDGA 3CQ8A 1MWKA 5AFUH 3QEXA 3LDLA 1C0TA 1ZC6A 4B9LA 1L3TA 4FLUA 1SL1A 1J53A 1REVA 1HMVA 1XI1A 1EQYA 4FWMA 4CF8A 4NCBA 4KHQA 3EEQA 3M8QA 3CD6N 1S3XA 5JLHA 3KJVA 2CGKA 1Y97A 5GIOA 3VPZA 2VG5A 2FBTA 1ATSA 3I8DA 1O13A 2WC9A 4LFBK 2GUPA 3K2PA 3DLKA 3PX4A 5AQIA 4JI0K 1YXQA 4BRCA 2NRZA 1XWLA 3L3UA 1B9DA 1SV5A 3BZCA 5FPMA 3A2FA 1SL2A 1Q82O 2Q2RA 4DQ8A 1KD1O 3HTVA 4L8RB 2O8DA 4I2QA 1VHXA 3KLEA 3CC7N 4FJXA 1T3VA 1RBTA 3MXIA 1QS4A 5M1FA 1QZ6A 2ITGA 2AP1A 4FZXC 4IDHA 1TUUA 1WSHA 3IMXA 4FLTA 2E2PA 4BR0A 5HL7L 3R1XA 3PO5A 4BGAA 4WFAL 1OH5A 4B9VA 4F2RA 4BG8A 3AVKA 2G8WA 1HNVA 3PX6A 1U6ZA 4UQGA 1JXEA 3DLHA 4K42A 3FLCO 1MU2A 3SI6A 3NH2A 3SV4A 3AO5A 2FC0A 1A5WA 4CERA 3SPYA 3V6DA 2ZE2A 2V51B 3HP6A 4AQYK 3SLCA 4CJFA 5AFUA 4J2DA 3B6PA 3OYLA 2FF3B 4PKGA 2O8BB 1MA9B 5FLXO 2ZF5O 4M3WA 2D0BA 2HHWA 3H3OB 5HRNA 4DSIA 1OVYA 1U2VA 2BH1A 1C1CA 4CHYA 2UUAK 3AVIA 4IDKA 2HHVA 1YTAA 3MCPA 3LALA 3S3OA 3HPOA 2FBXA 2XY6A 1C0UA 4JI1K 1SKRA 1Q8IA 4A62A 4CFAA 3C65A 3J7AP 3ZETB 2BTFA 4FLVA 5BN9A 1NK7A 1KAZA 4H0XB 2DFEA 4PA1A 4O0JA 3L2QA 4DU4A 1MDUB 3LWMA 1T8EA 2NLXA 3ZYYX 3I55N 1LV5A 3LPUA 1WSFA 3EZ5A 2WBNA 3JAMO 5AJ3K 2O4IA 5A2QO 5JS1A 2V7YA 3J7ZO 3K9JA 3CJCA 1CLQA 3M8SA 3OYAA 3PY8A 4CFCA 4DHYA 1K8KA 5TKYA 1M1KO 4CVNE 1BI4B 5AQWA 2BANA 4CJ3A 4JKCA 3HBTA 3NBPA 2W6KA 3HL8A 4CZGA 3QNOA 4DSJA 1XUPO 2VWJA 1KFSA 1VSFA 5C0YA 4CJUA 3K5LA 3DXKB 3LZJA 3P39A 3P4IA 3OS1A 2RHKA 1Y64A 2QKBA 2E4LA 2KZMA 1KVCA 3EE8A 1ESVA 4LFAK 3E01A 4AHSA 2DPNA 3JS6A 3G71N 1HYSA 1WAJA 1WOQA 4KHUA 4FJIA 2P9NB 4FJMA 4B9UA 1VQ4N 3H1VX 3HVRA 1BHLA 3EO3A 4FM0A 2OZMA 3MECA 4J2EA 3M8PA 4CJVA 3D0PA 3TANA 1YVUA 1K73O 2OTJN 1IG8A 4JK8A 4J2AA 4IO9L 3WT0A 3G10A 2UXBK 4EZ9A 3MCAB 4BREA 2Q0UA 3LAKA 4CJ4A 4BQLA 1VSIA 2BE2A 4FJ8A 2RF2A 3TAMA 4DTRA 2X74A 2HNYA 4RW4A 5J1EA 4QCLA 2IDOA 4DS5A 3R3LA 4FVUA 4IFYA 2D0PA 4XH4A 3SZ2A 2WFBA 2IS3A 2F7TA 1Q86O 5EOYA 3H08A 1S1XA 3AA3A 2P9UB 4KBOA 4JI3K 2CH6A 3MEDA 5AQJA 4E7HA 4JRQA 1UOCA 5EX5A 3CCSN 1TYQB 1JLAA 2A5XA 4CGIA 4GW6A 1JJ2M 5DMRA 3IS9A 2E2NA 2XY8A 5KRSA 4DSKA 4CD3A 4Q0BA 3QIPA 3RMDA 4CEOA 4NYFA 5KRTA 4IBNA 3AVMA 4CI6A 4DLEA 2GBZA 4DR7K 4OLAA 3LL3A 2D1KA 4I7FA 1HKCA 3SUQA 4E7KA 5DM6L 4C1NK 4CW7B 4A2AA 2LSNA 1GLFO 3E9LA 3UE5A 3BUZB 3WXIA 2KKZA 4BVPA 4LSLA 1HKBA 3GDQA 3VA0A 1OH8A 4WQ5C 4DB3A 4C8NA 3DXMA 3MXMA 4FL9A 2PYLA 5CZ1A 1IKVA 3DOKA 4FVMA 4DF4A 3VMFB 3W3DA 3ZSQA 1Z05A 4EP4A 5M1OA 1BA1A 3ASMA 2KW4A 3FE1A 1YUWA 1JKHA 1QSLA 3D2EB 3JXUA 4GVEA 1XC9A 1VQ8N 2Z1GA 3WNGA 2QWQA 4CESA 4V19S 2UUCK 3V9ZA 4B3RK 3V9WA 4LF9K 3LPTA 4DV0K 1WSGA 2E1ZA 3LAMA 4FCYA 2RN2A 1C6VA 3LZIA 2QTDA 4O55A 3D6RA 3BF3A 4RW8A 3OTOK 4C8LA 5FROA 2FSJA 1D9FA 4Z4HA 3S9HA 1U49A 4O5FA 4U67L 3AO4A 4YOVA 2E20A 3K5MA 1SKWA 4CEZA 3I56N 2HHUA 3F2KA 4B1YB 4DR3K 1YF5L 3I0SA 4M45A 3NF9A 4JKDA 3KTQA 5J2PA 3NDKA 4CK1A 4ID1A 4ILHA 3AARA 1ATNA 3OYDA 1VSDA 3E1YA 4BE1A 1CZAN 3HT3A 4FJJA 3VERA 3QEPA 1RFQA 4FWQA 4CZJA 2HF4A 2O8CA 1S1WA 1C1AA 1VRUA 2QWLA 3L8BA 1NBWA 3FZMA 2D5RA 3HJFA 4DTXA 1NGDA 3QMLA 1BCMA 1FK9A 3O3GA 1CXQA 4FWOA 1TL3A 1OH6A 3O3FA 3WQUA 3K58A 3M3ZA 1YI2N 3L4QA 3NAEA 3EE9A 1W7AA 4DFJA 5AQOA 1EETA 4DR1K 2DTUA 3FFKB 1XHXA 4JKGA 4MDBA 3OJUA 1TKTA 3ZSVA 4DKWA 1SQKA 3SUOA 3VQPA 1QQNA 5D3GA 3ALYA 2F4VK 3F73A 1ZYQA 5CYMA 3NF7A 1NJXA 4Z4EA 1IJJA 2A1SA 4KREA 3W0LA 3SUPA 5AQUA 4FWSA 5AQVA 4N41A 5CHIA 1LAWA 2KHOA 3CG7A 4BDYA 2GELA 4CIGA 2ZJQL 1BG3A 4LF7K 3LDQA 3T1YK 4DMNA 4OGEA 4CJWA 2E6LA 4C8KA 4GV3A 2O8EB 1RDCA 4O8KA 3P5JA 5J2MA 4DTSA 1K8AO 2QWOA 4NLCA 3D45A 4GKKK 3SCXA 1Q9YA 4FLZA 1NJIO 1F21A 4Z94A 3Q7BA 3C94A 3LP3A 5AR0A 3NE6A 2PBDA 4KRFA 1HPMA 2DFHA 1NMDA 5BR8K 4IJAA 5LMNK 3CCVN 2H3GX 4HTLA 3MDQA 4Z4FA 5HLFA 3L3VA 3VGLA 2KQ2A 4B9NA 3KLGA 3HM8A 1VQLN 4FZYA 4KHNA 2VG7A 1ASVA 1X1PA 3AVBA 1X9MA 4B3TK 4M63C 3RTVA 4I6MA 3VF2A 2RPIA 1BIUA 3OYBA 2KLAA 4K43A 4FWNA 2YHWA 3HXMA 2RE2A 4OPJA 3TTDA 4IFVA 1DLOA 3CCRN 1Q81O 3HM9A 2KZZA 1CZBA 4FLWA 1ILYA 3CMAN 1EP4A 4EHUA 5KGXA 3JSMA 3O9UA 4ICLA 3UB5A 3I8BA 1YT3A 4O5BA 4B8AB 1BIZA 3DRPA 3OYIA 1WB9A 3S3NA 3D7EO 4FJ5A 1NGHA 3EZWA 3O1BA 3TAQA 2A3ZA 1VQMN 4BR5A 2YKMA 1CXUA 3L0QA 4HVJA 4O0IA 3UKUB 4YDUC 1RILA 3O80A 3VQCA 5E26A 2Q97A 5JICA 3ZLJA 4JKHA 2IIRA 4FWPA 1IKYA 2QWNA 1HQEA 4WQ4C 3ULEA 4CK2A 4C8MA 3OBYA 3VEYA 3BDPA 1X9WA 2KFZA 3I0RA 4YOXA 2D0CA 3WXMB 4LF6K 5GINA 3FZKA 2YHAA 4AHUA 5BPNA 4JI8K 3NVKA 2VQEK 1HQUA 5HRPA 1DKGD 1QQCA 4CZIA 5C2DA 2ZGZA 3SMPA 4DWIA 4ZHRA 4K8XA 4AHCA 4Y0WA 3PX0A 1GOCA 3H1QA 3VEZA 3EYZA 4FJ7A 3I33A 2E1YA 4EAHD 3RSEB 3K59A 5JVGL 1QHTA 2ASMA 4CD1A 1RBRA 3A5OC 4E1NA 2YV0X 1QQOA 3TAFA 3THXB 3VQAA 1N8RO 3BF1A 1S22A 4RW7A 5AQYA 5HRSA 2FBVA 4OVLA 2ZJRL 3KK7A 1NNEA 3SQ1A 4BQZA 2V7ZA 3OBWA 1IBMK 3WNFA 3NH0A 2JWKA 3U9DA 1NJZA 3TAPA 1T03A 3CMEN 2W42A 3MAQA 4DQSA 3EKSA 2HHXA 4BR7A 1I39A 1K8KB 5DM7L 4K25A 5FPNA 1NJYA 4JD2A 3IFRA 1R59O 5EVZA 4E19A 1G99A 1ASWA 1NK8A 3VN5A 3LDPA 3AAQA 2A6AA 3AVFA 1C0MA 2Q36A 4JI2K 2O8FA 3DI6A 3ZT2A 1QVGM 3PO4A 4BGBA 2B4JA 4KB1A 3SBTA 4IG0A 1JL2A 3LP1A 3DLEA 3MXJA 2BUPA 5EU7A 1E4FT 3QO9A 4JS4A 2YNFA 4ELTA 4B8CA 1HKGA 1RT2A 5F1XA 3R6MA 4CECA 2P9SB 4G1QA 4LD0A 4MO4A 5J2QA 1YITN 1RT4A 2R7YA 4PUOA 4WQ5A 2GWJA 2HNDA 3BZKA 2B6AA 3C7NA 3OY9A 4H0VB 3TSPA 4KAZA 4B3SK 1GOBA 3CJ7A 4KV8A 2OPRA 3K5OA 4AF1A 3QLHA 1RT5A 5AQQA 4DTPA 1YVNA 5ADXH 4DQPA 2ASOA 3CF5L 4A59A 2XRIA 2P9PA 5E84A 3KIOA 3M8RA 5KQ8A 3AGRA 2XHBA 3P83D 4H5RA 3SAHA 1TK8A 2P9IA 4OLBA 4WFBL 1S6QA 3AA2A 1L3VA 4FW2A 3EN9A 4JI5K 4DR6K 3TTCA 3DRRA 1L3SA 3CCEN 4H0YB 1S72N 3L2WA 5CZ2A 4B08A 4C8OA 3ZT1A 1KTQA 3QB0A 2ZM6K 3NF8A 3AA4A 2DFFA 2QXFA 1LOTB 1VSHA 2P9KB 4MLHA 3OJSA 1YAGA 1S6PA 1HPZA 3A5LC 4DV6K 4M3TA 4WCEL 1VSKA 3ZT0A 4IO8A 2YI1A 1KLNA 1ZBIA 3KLFA 4PY5A 4BRHA 3VQ6A 3LDSA 3OYNA 4DV5K 2F9TA 4QAGA 5KQDA 2XY5A 4WE1A 5CE3A 2YNIA 3ZEUA 4BE2A 1XNQK 4OGCA 2VQFK 2PY5A 3K9KA 1GLBG 2X6SA 3OW2M 3MX2A 4KI4A 2HB5A 3J7YP 4B9SA 2OTLN 1S1VA 1TK5A 1S9GA 3T19A 3M5RA 2CGLA 3THYB 5GIPA 2JWLA 4PL7A 4DTMA 3QEVA 4M42A 4IWVA 3U3YA 4OX9K 3QEIA 1O1WA 3VQEA 5ADXA 1RDUA 1RT6A 1YJWN 3UIQA 4JEPA 4BACA 2VGNA 4AM7A 4CE9A 4BRDA 3PSFA 4DU1A 5HOOA 4LSNA 3SAFA 3KHYA 1IBLK 1X9SA 4Z4IA 2ZD1A 4CZFA 4MDAA 4CZMA 4H5NA 4W5NA 3ZT4A 3O4NA 3BP8A 1GLCG 1EX4A 1JLEA 1QHAA 3DJCA 4H03B 2HHTA 2EWSA 3MN6A 1VSJA 2A40A 1WSIA 4A2BA 4CJ5A 3CFRA 1YHQN 1NOYA 1N33K 4PQUA 4CJQA 3CPWM 4FPBA 1J6ZA 2HHQA 1VQ6N 3WEEB 2Z1HA 3L6QA 4BRLA 2F9WA 1BUPA 2YX6A 1FW6A 4H4OA 3HOSA 5BRHA 4KPYA 3VGKA 4CJTA 3QDKA 3GL1A 4CHOA 2NUBA 2O8CB 2ASPA 4I2PA 4DSEA 3J8AA 1V4SA 4JKAA 1D9DA 2EHGA 1XNRK 1NGEA 1UWBA 3SNNA 1L3UA 5AZIB 4M7YA 2O8BA 4JNEA 4B1XB 5I9EB 3V4IA 4HCCA 1W97L 2GTDA 2XY7A 1ZBSA 3T69A 5SWMA 2UUBK 3LP0A 4FJHA 5IWAK 4LH5A 3VESA 1ZBHA 3TR8A 2YKNA 3O6WA 4GY2B 3TAGA 4GMJB 1BCOA 4BY9C 2G8IA 1N32K 3ZETA 2CGJA 4CIFA 4F4KA 1ZBFA 3ENHA 3KK1A 3MK6A 3LANA 4FOEA 1YTUA 3IAYA 1IV0A 4IOAL 1FJGK 2P9LB 4KHYA 4OKJA 3HP9A 3HSTB 3HOTA 1X3MA 2NRVA 4AILC 3ATUA 1VSEA 2ZWHA 4ILJA 5MLCQ 4GNIA 5AQLA 4NO7A 4FWKA 1QTMA 3CI5A 3ATVA 3VEXA 1Z26A 4U7BA 5I3UA 2AA4A 4DFMA 2NRXA 5I42A 2NRHA 1BI4A 4CEEA 3U6FA 4ID5A 3VTHA 4X65K 2VG6A 5HROA 4B9TA 3VQ5A 1SS6A 4KTWA 3DWLA 3E9OA 1ASUA 4Z4GA 5AQTA 3RMCA 3HZ6A 4YNQA 3H6EA 1KRPA 4DTJA 3FFIA 3DXKA 1W2BM 1UA1A 1SAZA 3EY1A 5FPDA 3OA9A 3L4IA 4FJGA 5GAEP 3NMUA 2Z1IA 4JRPA 4DCHA 4C1NI 4ISFA 4WYBA 2WONA 1BQMA 2X6NA 3VENA 2P9NA 4QS9A 5B8HA 4FK2A 3AVLA 3TTFA 3D2FA 4M3ZA 1KVBA 1NOZA 1IKWA 2P51A 5M1QA 4BWMA 1BA0A 3CFOA 4BDPA 4W5OA 2JGUA 2OPPA 3P38A 3EKUA 5C25A 3TAEA 5KTQA 2OZSA 2P1JA 1VK0A 3KK2A 4M3XA 2D0AA 3M1FA 1RDDA 1I3AA 3P31A 1P90A 4JI7K 4KHWA 4ISEA 4JHDA 3SBGA 4CEBA 4B3OA 2HNZA 1U47A 1JCGA 3HPHA 4NXNK 4CHZA 2OPQA 1NLVA 4Y1DA 3CPEA 3CM6A 1KSPA 4A57A 1HUXA 1UA0A 5AQZA 4GKJK 3NGIA 1TKZA 3VEOA 3F5TA 3P1GA
chains in the Genus database with same CATH topology
4JKHA 1T44A 4JK7A 2IIRA 4FWPA 1HJOA 2P9UA 2IVOA 2QWNA 4PKHA 4K41A 2YJFA 3AY9A 2HBMA 4PHTX 4WQ4C 3ULEA 4IEEA 1YIJN 2V51B 3CCJN 1YJ9N 1TYQA 3SLCA 4ILGB 5AFUA 5C12A 3OBYA 2P9KA 2FF3B 4PKGA 3VEYA 4BC3A 1GLLO 3VOVA 1MA9B 3EL2A 2ZF5O 4YOXA 3H3OB 3O08A 3WXMB 5GINA 3FZKA 5BPNA 1OVYA 1U2VA 1QVFM 3NVKA 2BH1A 1VQKN 2VCPA 4BC2A 5C0YA 4JKGB 4MLEA 2QM1A 1DKGD 5LY3A 5KPTA 2FSNA 3QICA 3MCPA 4JAXA 4BRNA 4CZIA 5BRFA 2ZGZA 3SMPA 5C2DA 4B1VA 2ITMA 4Y0WA 4A62A 3LDOA 3VETA 3C65A 4CZLA 3ZETB 3MX5A 4H0OA 5EY4A 3H1QA 2BTFA 3VEZA 5AQNA 3I33A 5BN9A 4BC5A 5JVHL 1KAZA 2E1YA 4H0XB 4EAHD 1MDUB 3RSEB 5JVGL 4H5WA 3SAGA 2ASMA 2NLXA 4CBUA 4CD1A 3A5OC 1NWKA 3ZYYX 1Z6RA 3UKRB 3OHRA 3IUCA 3I55N 4CJ7A 2HMPA 5AQXA 1QQOA 2E2QA 5M1PA 2WBNA 4R79A 4H5TA 1N8RO 1BU6O 1S22A 3BF1A 4L3QA 4YDUA 2V7YA 3G6EN 5LJVA 4WFNL 5AQYA 3J7ZO 3K9JA 3CJCA 5AZJB 5FPEA 2ZJRL 2J4RA 3KK7A 4UY8O 2W40A 4BQZA 4DHYA 2V7ZA 1OKJA 1K8KA 3OBWA 5TKYA 4B1UB 1M1KO 1KQSM 2JWKA 3U9DA 5AQWA 3D2EA 4JKCA 4WQ4A 3HBTA 3FZHA 3CMEN 1HX1A 3MN9A 4XH1A 4CZGA 1BOTO 1XUPO 1JCEA 3M6GA 3EKSA 4K42A 2V52B 5TKWA 2IVNA 1K8KB 2D4WA 2GEMA 4BR7A 3IKMA 4K25A 4QS8A 3O8MA 1H1VA 4JN4A 4B1ZA 4IOCL 1P8ZA 5FPNA 1Q18A 4JD2A 4BRPA 5GAHP 3DXKB 3O5BA 4CZKA 3CC4N 3P39A 3IFRA 1R59O 3P4IA 5EVZA 1G99A 2RHKA 1Y64A 2FSKA 2Q1NA 3LM9A 3LDPA 4IOXA 3AAQA 2A6AA 2Q36A 3EE8A 3KWIA 1ESVA 3MN7A 1NM1A 1QVGM 2YHYA 2DPNA 5GAGP 3JS6A 3KVGA 3G71N 1RGIA 4BGBA 1WOQA 4I6MB 3SBTA 2P9NB 2BUPA 5AQHA 1E4FT 2ZGYA 3C0BA 4CBWA 1VQ4N 5C2FA 1RDWX 3H1VX 4C23A 1HLUA 1HKGA 2NNWA 3EO3A 5F1XA 3ENBA 1SZ2A 1ZXOA 3R6MA 1VQ9N 3CCUN 4JKBA 5ELZA 3VTIA 2P9SB 3SK3A 5C10A 3DLLL 4MO4A 4EHTA 1D4XA 3MWPA 3U9ZA 2HSTA 1YITN 4H0PA 5LJWA 2QXLA 4WQ5A 3SMSA 2GWJA 1K73O 4BC4A 2OTJN 3C7NA 4RTFD 1IG8A 4H0VB 3TSPA 4JK8A 5BPMA 3WEEA 1KAXA 3CIPA 4IO9L 3TSQA 3CJ7A 4HWIA 3WT0A 4AF1A 3MCAB 3WXKA 3CCLN 2FLOA 5AQQA 2QW9A 4BREA 3QBXA 2Q0UA 1YVNA 3A5MC 4BRFA 3WXJA 4NLBA 4BQLA 2ASOA 1GLDG 5ADXH 3CF5L 4A59A 3C7NB 4FOIA 4KH4A 1WUAA 2P9PA 5E84A 3ID8A 3S41A 3ENOA 5KQ8A 3B8AX 2E2OA 3QBWA 4FO0A 3AGRA 3R3LA 4H5RA 2HOEA 4OPHA 3WXLA 3SAHA 4FVUA 4QS7A 5F0XA 2D0PA 2P9IA 4XH4A 5GADP 5AZIA 4WFBL 1VQ5N 4GV9A 2WFBA 2P9PB 4KH5A 1VQ7N 2GX9A 3EN9A 2F7TA 4RWTA 3TTCA 1Q86O 5EOYA 5BR9A 3CCEN 1XC3A 4EFHA 3VEWA 2CH5A 4H0YB 3CQXA 2P9UB 4KBOA 4YORA 5AQSA 2CH6A 4BR9A 1S72N 5AQJA 2P9IB 3A0IX 3ULEB 3QB0A 5EX5A 3CCSN 1TYQB 2A5XA 1LOTB 2P9KB 4MLHA 2FF6A 1JJ2M 4KH6A 1YAGA 2E2NA 4G9ZA 2D0OA 1NGFA 3O4WA 4CD3A 1NGJA 3A5LC 4WCEL 1U2VB 3ZX2A 5JMVA 4CZEA 5H1SQ 3H46O 2I7PA 4CI6A 4IO8A 2YI1A 4IJNA 3LL3A 2Q31A 2D1KA 2P9LA 2QWMA 2I7NA 4BRHA 1HKCA 2VYPA 2NRWA 2YHXA 2F9TA 4WF9L 4YOUA 5DM6L 5KQDA 4C1NK 4YOYA 1VQON 4A2AA 5AQFA 1GLFO 3E9LA 5CE3A 3UE5A 3BUZB 5AQMA 3ZEUA 1KXPA 2E88A 3WXIA 2KKZA 4BVPA 3TPQA 3N4QA 1HKBA 3GDQA 3K9KA 4A5AA 4WQ5C 4BR2A 4DB3A 1GLBG 2QA4N 4OO1J 3DXMA 4FWRA 5DM7L 3OW2M 3MX2A 4FL9A 4JK9A 3U4LA 3ZEUB 2OTLN 3CJAA 5F2RA 2W41A 3N4PA 3GE1A 3M5RA 3VMFB 3W3DA 2CGLA 3CJ9A 1QZ5A 3IDHA 5GIPA 2JWLA 4J8FA 1Z05A 2WUSA 4BG9A 4PL7A 5M1OA 3R8EA 1BA1A 1JCFA 4IWVA 3VGMA 4GV6A 3FE1A 1YUWA 3A5NC 3H45C 4H5VA 3D2EB 4YOTA 3JXUA 3NVMA 3FGUA 3H3NO 4GVEA 5EXWA 4BRKA 5KPZA 5BREA 3GG4A 1Q7YO 1VQ8N 3HRGA 3CERA 3AGKA 1K9MO 5ADXA 2QWQA 3QFUA 1NGIA 1RDUA 1GLJO 1C0GA 1YJWN 2IVPA 2FXUA 4JEPA 2UYTA 3CJ1A 1YJNN 3VF4A 2E1ZA 4JD2B 2VGNA 4AM7A 4BRDA 4BRQA 4IZ9A 2QTDA 5HOOA 3D6RA 4LC9B 3A8YA 3CETA 3BF3A 3SAFA 2VGMA 4FPAA 2NRRA 2YJEA 3KHYA 4BVOA 1GLEG 4CZFA 3DAWA 4MDAA 4BRMA 4BRAA 2HBLA 4CZMA 4BRGA 2FSJA 4H5NA 2QI2A 3CQYA 3BP8A 1GLCG 1QHAA 4O5FA 4U67L 4YOVA 5M1NA 3O1WA 2E20A 1LCUA 3DJCA 3WUHA 4H03B 3I56N 3F2KA 4EIAA 3CXCM 2EWSA 1V4TA 2NRTA 3MN6A 3G25A 4B1YB 3KZBA 1YF5L 4BROA 2A40A 4A2BA 1YHQN 1ATRA 4JKDA 4BR4A 2PAVA 1MWMA 3CPWM 2QWPA 3WQTA 4ILHA 4ISGA 4FPBA 3AARA 1ATNA 5C15A 5AQGA 4OPAA 1J6ZA 3E1YA 1CZAN 3QFPA 3VERA 5BN8A 1RFQA 4PKIA 3LDNA 2NZTA 3FZFA 4FWQA 4JKEA 2HF4A 3CJBA 4CZJA 1VQ6N 3WEEB 3L6QA 3VEVA 4BRLA 2QWLA 2F9WA 1BUPA 2YX6A 4IEIA 1NBWA 3UKUA 3HOSA 5BRHA 3FZMA 3G4SN 1E4GT 4BRIA 3VGKA 5AQPA 3QDKA 2A42A 1NGDA 3GL1A 1DT9A 3ZX3A 3QMLA 3MWTA 1DEJA 5M1KA 3RVCA 4FWOA 2ASPA 1KC8O 3J8AA 1EO1A 2PFUA 1V4SA 4JKAA 2VWBA 1T6CA 3WQUA 1NGEA 2YCHA 3M3ZA 1YI2N 2HBJA 5AZIB 4IFEA 1X3NA 4M7YA 4JNEA 4B1XB 5I9EB 3L4QA 1BO5O 3EE9A 1W97L 2GTDA 3FZLA 5AQOA 1ZBSA 3CCQN 3FFKB 3T69A 3T7ZA 3O9QA 4JKGA 3O9SA 4MDBA 5KPRA 1TUYA 3VESA 1DGKN 1VQPN 4DKWA 1SQKA 3O6WA 4GY2B 3PIOL 1BWFO 1QQNA 3ZX0A 4B9QA 4CBXA 4BY9C 2Q0RA 1KAYA 4NB4A 3LM2A 3VF6A 1GLAG 3ZETA 2CGJA 4M7XA 3O9TA 3ENHA 2HBKA 3MK6A 4FOEA 1IJJA 3W0LA 3MMVA 3FR0A 5AQUA 4IOAL 4FWSA 2E8AA 3RSEA 3AAPA 3C6HA 1T6DA 2P9LB 4PL8A 5AQVA 5AQKA 1QQMA 5CHIA 3HOTA 5BRDA 2KHOA 3R9PA 3UKRA 1X3MA 3PIPL 2NRVA 5AQRA 2GELA 3ATUA 2ZWHA 2ZJQL 1BG3A 4ILJA 3CCMN 3ID6A 3LDQA 1NGCA 4GNIA 4CZHA 5MLCQ 4B1WB 4FSVA 5AQLA 4NO7A 5AZJA 1NGGA 4FWKA 4GV3A 3GBTA 4O8KA 3CI5A 3ATVA 3VEXA 4U7BA 1K8AO 2AA4A 2QWOA 4NLCA 2NRXA 3DXMB 2NRHA 4XEIA 2HF3A 4YOWA 1BDGA 1MWKA 4XH5A 5AFUH 3VTHA 3LDLA 1ZC6A 4FWLA 1NJIO 4Z94A 3Q7BA 3E66A 5AR0A 1NGBA 1SS6A 2PBDA 3CHWA 3DWLA 3E9OA 4RCHA 1HPMA 5AQTA 1EQYA 4FWMA 3HZ6A 1NMDA 3PLAA 4IJAA 3H6EA 3DXKA 3CCVN 3CD6N 1W2BM 2H3GX 1SAZA 3F9MA 1S3XA 3MDQA 4HTLA 5CR4A 5FPDA 5JLHA 2CGKA 4A61A 3OA9A 3VGLA 5GIOA 3VPZA 3HM8A 3L4IA 3TU5A 1VQLN 3SJHA 1ATSA 5GAEP 3NMUA 3KWGA 1VQNN 4DCHA 4C1NI 4ISFA 4WYBA 4M63C 3BEXA 1XQSC 4I6MA 3VF2A 1O13A 2WC9A 2GWKA 3VENA 2P9NA 4QS9A 2GUPA 2QWRA 5B8HA 5BPLA 2KLAA 5AQIA 5JLFA 4K43A 1YXQA 3D2FA 3TTFA 4F9OA 4FWNA 3MN5A 4BRCA 3C6AA 2NRZA 2YHWA 2ZJPL 5M1QA 2RE2A 5FPMA 2P9SA 3TTDA 1BA0A 3E9PA 3CCRN 1Q81O 1Q82O 2Q2RA 3P38A 3EKUA 4DQ8A 3GOIA 1KD1O 3HTVA 3TSUA 3D2FB 1ILYA 3HSCA 4IXCA 3CMAN 4EHUA 2A41A 3O9UA 3M1FA 3CC7N 3P31A 1P90A 4JKFA 1T3VA 4ISEA 3UB5A 3I8BA 4JHDA 1M90O 3O9RA 3SBGA 3CC2N 5M1FA 1QZ6A 1VAZA 2AP1A 4IDHA 1NGAA 3D7EO 1TUUA 1NGHA 3EZWA 3O1BA 2OANA 1JCGA 2A3ZA 3IMXA 1VQMN 3U8XA 2E2PA 4A5BA 4BR5A 3L0QA 4O8UA 4BR0A 3R1XA 5HL7L 1NLVA 4JHDB 4BGAA 1X9JA 4WFAL 3CPEA 1C0FA 3UKUB 4A57A 1HUXA 4YDUC 4H0TB 4BG8A 3O80A 5E26A 5AQZA 1U6ZA 4MO5A 3VEOA 2Q97A 3F5TA 3Q7CA 4AM6A 4E1JA 2QEXN 5JICA 3FLCO 3HI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y O;  3DLL L;  1VQ8 N;  3PIP L;  1K9M O;  1YIT N;  1YIJ N;  1YJW N;  2ZJQ L;  3CCJ N;  3CCM N;  1YJ9 N;  1K73 O;  2OTJ N;  5MLC Q;  1YJN N;  4IO9 L;  3CCL N;  1OVY A;  1QVF M;  1K8A O;  1VQK N;  3CF5 L;  1NJI O;  4U67 L;  5GAD P;  1VQ5 N;  4WFB L;  3I56 N;  3CXC M;  5JVH L;  1VQ7 N;  3CCV N;  3CD6 N;  1W2B M;  5JVG L;  1YHQ N;  1Q86 O;  3CCE N;  1S72 N;  3CPW M;  3I55 N;  1VQL N;  3CCS N;  5GAE P;  1N8R O;  1VQN N;  3G6E N;  4WFN L;  1JJ2 M;  3J7Z O;  1VQ6 N;  2ZJR L;  4UY8 O;  3G4S N;  4WCE L;  1KQS M;  5H1S Q;  1M1K O;  2ZJP L;  3CME N;  1KC8 O;  4WF9 L;  3CCR N;  1Q81 O;  1Q82 O;  5DM6 L;  1KD1 O;  5DM7 L;  1VQO N;  1ILY A;  4IOC L;  3CMA N;  1YI2 N;  5GAH P;  3CC4 N;  3CC7 N;  1M90 O;  3CCQ N;  2QA4 N;  3CC2 N;  3OW2 M;  1VQP N;  1VQM N;  1QVG M;  2OTL N;  3PIO L;  5GAG P;  3G71 N;  5HL7 L;  4WFA L;  1VQ4 N;  2QEX N;  1VQ9 N;  3CCU N;  4IOA L; 
#chains in the Genus database with same CATH topology
 3HYF A;  3QET A;  1HJO A;  2P9U A;  3AY9 A;  2HBM A;  4CJS A;  4N56 A;  4CF2 A;  4IEE A;  1E3M A;  1YIJ N;  1YJ9 N;  1TYQ A;  4CED A;  4ILG B;  4JV5 K;  4CF1 A;  4BC3 A;  3RMB A;  3O08 A;  4YY3 K;  1QVF M;  2VCP A;  4BC2 A;  5HBM A;  1K6Y A;  4MLE A;  1HJR A;  2QM1 A;  5LY3 A;  2FSN A;  4OKK A;  5BRF A;  3AVA A;  4B3M K;  4B1V A;  1Q9X A;  3RRH A;  2OA8 A;  1NK0 A;  1N34 K;  4CZL A;  3MX5 A;  4H0O A;  5AQN A;  3RWU A;  5JVH L;  4F2S A;  3ZSR A;  1RTJ A;  3T1A A;  4DR5 K;  2KFN A;  3NHG A;  3SAG A;  1Z6R A;  3UKR B;  1XMQ K;  4QOZ B;  3IUC A;  3OYH A;  4CJ7 A;  2F8T A;  2G8K A;  3AO2 A;  5AQX A;  2E2Q A;  3T3F A;  4H5T A;  1VRT A;  3G6E N;  1BGX T;  1QSY A;  5AZJ B;  4FJK A;  5FPE A;  4M3U A;  2J4R A;  4UY8 O;  4I9Q A;  4DF8 A;  3D2E A;  4CGD A;  3FZH A;  4XH1 A;  2A1R A;  1BOT O;  5T7B A;  1JCE A;  3VQB A;  2V52 B;  2IVN A;  4F3O A;  4QS8 A;  4JN4 A;  1Q18 A;  1IO2 A;  1NK9 A;  2I5J A;  4M41 A;  5GAH P;  4CZK A;  1LW2 A;  3B6O A;  3RR8 A;  3LM9 A;  4IOX A;  1TGO A;  2IOC A;  5CY4 A;  3MN7 A;  2E5L K;  4M3Y A;  1NM1 A;  1NKE A;  2YHY A;  1XHZ A;  4CF9 A;  4XIU A;  1RGI A;  3WNE A;  3NCI A;  2IAJ A;  5AQH A;  2W6L A;  3C0B A;  4CBW A;  5C2F A;  3ZT3 A;  1RDW X;  1HLU A;  5HRR A;  1SZ2 A;  1ZXO A;  4OJR A;  4JKB A;  5ELZ A;  3VTI A;  3K5N A;  1IBK K;  2E6M A;  4EHT A;  1HNZ K;  3MWP A;  3U9Z A;  3OYM A;  4KHS A;  4H0P A;  5LJW A;  3SMS A;  2WTU A;  3OYC A;  1WNS A;  1RBV A;  2O8D B;  1RBS A;  1KAX A;  4YHH K;  2OPS A;  4DTN A;  3K0S A;  3QBX A;  4RW9 A;  3A5M C;  4BRF A;  3RRG A;  3C7N B;  1EXQ A;  4CEA A;  1WUA A;  3OYG A;  3S41 A;  2E2O A;  4FO0 A;  2HVI A;  1WN7 A;  4ZTJ A;  3WXL A;  3JYT A;  5F0X A;  5GAD P;  5DK5 A;  3AVC A;  4Z4C A;  2P9P B;  3VQ7 A;  4E1M A;  4RWT A;  2EX3 A;  1XC3 A;  4EFH A;  4BR9 A;  5AQS A;  4YOR A;  3CQX A;  1WSJ A;  2P9I B;  3A0I X;  2UXC K;  4OPK A;  4DV3 K;  4CFB A;  4I9L A;  1RT3 A;  3VQ4 A;  4G9Z A;  1RDA A;  1NGF A;  2Y1I A;  1U2V B;  4DS4 A;  3AVN A;  4DQR A;  4CZE A;  5H1S Q;  1NU0 A;  1J5O A;  2Q31 A;  3DOL A;  2QWM A;  4CGH A;  2HW3 A;  2VYP A;  1C1B A;  4YOU A;  4CJL A;  4YOY A;  1BIS A;  1VQO N;  2QK9 A;  1IH7 A;  2UXD K;  1WSE A;  1KXP A;  2E88 A;  4E7I A;  3TPQ A;  3N4Q A;  2O8E A;  4DQI A;  3HO1 A;  2QA4 N;  4A5A A;  4BR2 A;  2ETJ A;  3AO1 A;  4DFP A;  4OO1 J;  3KKS A;  4CCH A;  4JK9 A;  2BDP A;  1W9H A;  2FBY A;  3ZEU B;  2BGG A;  3QER A;  1CZ9 A;  2B5J A;  3CJA A;  3N4P A;  3RR7 A;  3GE1 A;  3CJ9 A;  1QZ5 A;  3IDH A;  3R8E A;  4GV6 A;  3VGM A;  2F96 A;  3H45 C;  1A5X A;  4NXM K;  4H5V A;  4HUG A;  5FRM A;  1W0H A;  3NVM A;  1OVQ A;  3FGU A;  5KPZ A;  5EXW A;  4E89 A;  5BRE A;  3CER A;  4BDZ A;  4E3S A;  1T7P A;  1NGI A;  1FXX A;  1C0G A;  3SQ0 A;  1T05 A;  2UYT A;  3CJ1 A;  1YJN N;  4HUE A;  1U04 A;  4JI4 K;  1RT7 A;  3ISN C;  5C24 A;  4BRQ A;  4EZ6 A;  4LC9 B;  3A8Y A;  4K8Z A;  1KLM A;  2NRR A;  4Q5V A;  4BVO A;  1B9F A;  3MEG A;  4H4M A;  3IG1 A;  3SPZ A;  4BRA A;  3BY5 A;  2HBL A;  4N47 A;  4IG3 A;  4JLH A;  4MQ3 A;  2QI2 A;  4PWD A;  4DR4 K;  5M1N A;  1NJW A;  4N5S A;  3K57 A;  1LWF A;  3WUH A;  4EIA A;  3CXC M;  1EWR A;  1V4T A;  3KZB A;  3V9S A;  4FJL A;  4BR4 A;  1TL1 A;  3CM5 A;  2ZQB A;  3QEW A;  1EWQ A;  5C15 A;  3F9K A;  3G0Z A;  3QFP A;  4LH4 A;  2ATQ A;  1BL3 A;  2NZT A;  2X78 A;  4IEI A;  3ZSW A;  3UKU A;  3G4S N;  4AH9 A;  2G8U A;  4DTU A;  3SQ2 A;  2G8V A;  3ZSX A;  1TKX A;  3ZCM A;  3QES A;  4FYD A;  1RTD A;  5AQP A;  3ZX3 A;  1DT9 A;  1TKD A;  1BQN A;  3NFA A;  3RVC A;  4DV1 K;  3O3H A;  1KC8 O;  3NF6 A;  3OYK A;  1WBD A;  3V1R A;  3NGY A;  2VWB A;  3CYM A;  1QSS A;  1S5J A;  4ELV A;  2VWK A;  2YCH A;  5SZT A;  4IFE A;  3KLI A;  4FLX A;  4FW1 A;  4FK0 A;  3FZL A;  2HMI A;  4MFB A;  3CCQ N;  1TUY A;  4KI6 A;  3ZSZ A;  1N36 K;  4CEQ A;  1ZBL A;  3PIO L;  3HK2 A;  1HYZ A;  2Q3S A;  4NB4 A;  3VF6 A;  3L2R A;  3O9T A;  1GOA A;  1LAV A;  4OKE A;  3THW A;  4TSX A;  3QIO A;  1KCF A;  1IKX A;  3MMV A;  3FR0 A;  4DV4 K;  1RDB A;  3RSE A;  4DV2 K;  4PL8 A;  3O4Q A;  5AQK A;  5LL6 Z;  4ZTF A;  5BRD A;  3QNN A;  1FKO A;  3DMJ A;  3THX A;  4DR2 K;  5KI6 A;  1N5Y A;  4CZH A;  4FSV A;  4JS5 A;  3ULD A;  3KKR A;  4CGJ A;  3DXM B;  1D8Y A;  4DG1 A;  3U3G A;  3V1O A;  4XH5 A;  1ITG A;  2YNG A;  4FWL A;  3J80 O;  3E66 A;  4HCB A;  1NGB A;  3CHW A;  4CIE A;  4RCH A;  1TK0 A;  4KHP K;  2IGI A;  4KKO A;  3PLA A;  3DLB A;  2IC3 A;  3F9M A;  5CR4 A;  1U45 A;  1HNW K;  4A61 A;  4ELU A;  4AHV A;  3TU5 A;  4GVM A;  3SJH A;  3DLG A;  4HUF A;  4R5P A;  3KWG A;  1VQN N;  3AVG A;  3NGZ A;  4EP5 A;  3BEX A;  1XQS C;  2GWK A;  4FZZ A;  2QWR A;  4DU3 A;  5BPL A;  1U4B A;  5JLF A;  4F9O A;  3MN5 A;  2ZJP L;  3C6A A;  2P9S A;  3PUF A;  3E9P A;  4O4G A;  3THV A;  1HNI A;  3GOI A;  4M3R A;  4E7J A;  3TSU A;  3D2F B;  4JI6 K;  3HSC A;  1RBU A;  4IXC A;  4NYN A;  2A41 A;  4YFU A;  4JKF A;  1M90 O;  2Z1J A;  3O9R A;  2PZS A;  5HP1 A;  3CC2 N;  3SJJ A;  4AHT A;  1VAZ A;  4DV7 K;  2OCE A;  1NGA A;  2OAN A;  3TWH A;  3U8X A;  1JXB A;  1OH7 A;  4A5B A;  1LWC A;  4O8U A;  3C6U A;  4JHD B;  1EKE A;  1X9J A;  4DSF A;  1C0F A;  1SUQ A;  5J2N A;  4H0T B;  2RKI A;  5E41 A;  4FXD A;  4MO5 A;  4F8R A;  4AM6 A;  3Q7C A;  4E1J A;  2QEX N;  1FKP A;  3HI0 A;  1NK4 A;  5K14 A;  1T44 A;  4JK7 A;  3J81 O;  4DFK A;  4CGG A;  2IVO A;  4PKH A;  4K41 A;  2YJF A;  4PHT X;  3CCJ N;  5C12 A;  4RG8 A;  2P9K A;  3V1Q A;  1GLL O;  3VOV A;  3EL2 A;  1VSM A;  1TAU A;  4CJK A;  4Y1C A;  1VQK N;  4JKG B;  1HYV A;  5KPT A;  5JS2 A;  3LP2 A;  3QIC A;  4JAX A;  4BRN A;  3V9U A;  3PSI A;  3RMA A;  2ITM A;  5LMU K;  1DTQ A;  3LDO A;  3VET A;  3L2U A;  5EY4 A;  4BC5 A;  4F3T A;  3DLR A;  2YHB A;  4H5W A;  4CBU A;  1NWK A;  3AA5 X;  3OHR A;  4W5R A;  2HMP A;  4O44 A;  3KK3 A;  5M1P A;  1RT1 A;  4R79 A;  1VSL A;  4CGF A;  1BU6 O;  4YDU A;  4L3Q A;  1KFD A;  5LJV A;  4WFN L;  4X66 K;  3AV9 A;  3TAR A;  1TAQ A;  3THY A;  3OS2 A;  3TI0 A;  2W40 A;  1OKJ A;  4B1U B;  4W5T A;  1KQS M;  2QKK A;  4KO0 A;  1G15 A;  3PV8 A;  4FJN A;  4WQ4 A;  1HX1 A;  3MN9 A;  1JLG A;  4RW6 A;  1QE1 A;  3M6G A;  3KD5 E;  5TKW A;  4CJE A;  2D4W A;  2GEM A;  3IKM A;  3O8M A;  1H1V A;  4B1Z A;  4CK3 A;  4IOC L;  1P8Z A;  4LF4 K;  4BE0 A;  5IT9 O;  4BRP A;  1XMO K;  3O5B A;  4KTZ A;  3CC4 N;  4CF0 A;  4DLG A;  1WBB A;  3KLH A;  2FSK A;  2Q1N A;  3VQ8 A;  3KWI A;  4IKF A;  3WNH A;  5GAG P;  1N6Q A;  3KVG A;  1KVA A;  4I6M B;  1WAF A;  3BGR A;  2ZGY A;  4HHT A;  4CHN A;  4C23 A;  3V9X A;  2NNW A;  3DYA A;  2HVH A;  5KGW A;  3ENB A;  1VQ9 N;  3CCU N;  2G8H A;  3SK3 A;  5C10 A;  3DLL L;  1D4X A;  3AVJ A;  2HST A;  3VQQ A;  2QXL A;  2JLE A;  4BC4 A;  4RTF D;  3ZSY A;  5BPM A;  1ZBU A;  3CIP A;  3WEE A;  3TSQ A;  4HWI A;  3NH1 A;  2OYQ A;  3WXK A;  3CCL N;  2FLO A;  4NCA A;  2QW9 A;  4CEF A;  3WXJ A;  4NLB A;  4CJR A;  3SYZ A;  1GLD G;  4FOI A;  4KH4 A;  1SL0 A;  3AO3 A;  3ID8 A;  3ENO A;  3B8A X;  1NKB A;  3HVT A;  3QBW A;  4CJP A;  2HOE A;  4OPH A;  5C42 A;  1LWE A;  1RCH A;  4QS7 A;  1VQ5 N;  4GV9 A;  5AZI A;  4KH5 A;  5FDL A;  2GX9 A;  1VQ7 N;  5BR9 A;  3VEW A;  2CH5 A;  3ULE B;  4FM2 A;  2FF6 A;  4KH6 A;  2D0O A;  3O4W A;  3OYF A;  4LF5 K;  1RTH A;  1NGJ A;  3OYE A;  3AVH A;  4H8K A;  3DM2 A;  3ZX2 A;  4BWJ A;  1HR0 K;  5JMV A;  3H46 O;  2I7P A;  1R0A A;  4IJN A;  1S1T A;  3C95 A;  3OYJ A;  2P5O A;  2AJQ A;  2P9L A;  3IRX A;  2I7N A;  3VQ9 A;  2NRW A;  1NG9 A;  2YHX A;  1TV6 A;  4WF9 L;  4KB0 A;  1JL1 A;  5AQF A;  4DQQ A;  5AQM A;  4DTO A;  1WLJ A;  4DUZ K;  4FWR A;  2GV9 A;  3U4L A;  2O4G A;  5F2R A;  2W41 A;  3SUN A;  4AHR A;  4BG9 A;  4J8F A;  1NMN A;  2WUS A;  1HNX K;  1JCF A;  3A5N C;  4E0D A;  4YOT A;  3H3N O;  4BRK A;  3CFP A;  3DRS A;  3GG4 A;  1Q7Y O;  3HRG A;  3AGK A;  2GUI A;  1K9M O;  2XO7 A;  3QFU A;  1GLJ O;  2Y1J A;  2IVP A;  2FXU A;  1NK5 A;  1NK6 A;  4KTQ A;  3VF4 A;  4FJ9 A;  4JD2 B;  4N76 A;  3VA3 A;  1I94 K;  4Z0U A;  4X64 K;  4IZ9 A;  1J5E K;  1S9E A;  3CET A;  2VGM A;  4FPA A;  2YJE A;  3V81 A;  3T1H K;  2O8F B;  1GLE G;  1NKC A;  3DAW A;  4BRM A;  3ITH A;  3HPG A;  3S3M A;  5FRN A;  4B9M A;  3C6T A;  2KTQ A;  4BRG A;  1JLC A;  3CQY A;  2F8S A;  2G8F A;  3OS0 A;  3O1W A;  4LY7 A;  1LCU A;  2UU9 K;  2NRT A;  4W5Q A;  3G25 A;  4FK4 A;  4BRO A;  1ATR A;  4DUY K;  2PAV A;  4HTU A;  1MWM A;  1J54 A;  2QWP A;  1UAX A;  3WQT A;  3QIN A;  1L5U A;  4ISG A;  4JYA K;  1TVR A;  4OPA A;  5AQG A;  5BN8 A;  4E7L A;  4PKI A;  3LDN A;  4JKE A;  3FZF A;  3KD1 E;  4LFC K;  3CJB A;  4NCG A;  3VEV A;  1RNH A;  1E4G T;  4BRI A;  4KFB A;  1IG9 A;  2A42 A;  1LW0 A;  3MWT A;  1DEJ A;  5M1K A;  1RTI A;  1U48 A;  1EO1 A;  1D5A A;  2PFU A;  4CFD A;  1T6C A;  1Z25 A;  1J9A A;  3L2V A;  2HBJ A;  1X3N A;  2WOM A;  3MEE A;  1BO5 O;  5CYQ A;  1JLQ A;  2YNH A;  3T7Z A;  3O9Q A;  3O9S A;  5KPR A;  4DSL A;  1DGK N;  3ZSO A;  1VQP N;  3LWL A;  1HRH A;  1BWF O;  3ZX0 A;  4B9Q A;  4CBX A;  1SKS A;  2Q0R A;  1KAY A;  4CHQ A;  3LM2 A;  1GLA G;  1S1U A;  4M7X A;  2HBK A;  4K0K K;  3SV3 A;  1JLF A;  2E8A A;  1B92 A;  2P5G A;  1T6D A;  3AAP A;  3C6H A;  1QQM A;  3PIP L;  3UKR A;  3OVN A;  3R9P A;  3VQD A;  4FM1 A;  2DY4 A;  2HHS A;  5AQR A;  3TAB A;  1A5V A;  1DTT A;  3CCM N;  3THW B;  2HHH K;  3ID6 A;  2PYJ A;  1NGC A;  4B1W B;  4FLY A;  4CHP A;  5AZJ A;  1NGG A;  3GBT A;  1JLB A;  4J2B A;  4XEI A;  4LF8 K;  3SQ4 A;  2HF3 A;  4X62 K;  4YOW A;  1BDG A;  3CQ8 A;  1MWK A;  5AFU H;  3QEX A;  3LDL A;  1C0T A;  1ZC6 A;  4B9L A;  1L3T A;  4FLU A;  1SL1 A;  1J53 A;  1REV A;  1HMV A;  1XI1 A;  1EQY A;  4FWM A;  4CF8 A;  4NCB A;  4KHQ A;  3EEQ A;  3M8Q A;  3CD6 N;  1S3X A;  5JLH A;  3KJV A;  2CGK A;  1Y97 A;  5GIO A;  3VPZ A;  2VG5 A;  2FBT A;  1ATS A;  3I8D A;  1O13 A;  2WC9 A;  4LFB K;  2GUP A;  3K2P A;  3DLK A;  3PX4 A;  5AQI A;  4JI0 K;  1YXQ A;  4BRC A;  2NRZ A;  1XWL A;  3L3U A;  1B9D A;  1SV5 A;  3BZC A;  5FPM A;  3A2F A;  1SL2 A;  1Q82 O;  2Q2R A;  4DQ8 A;  1KD1 O;  3HTV A;  4L8R B;  2O8D A;  4I2Q A;  1VHX A;  3KLE A;  3CC7 N;  4FJX A;  1T3V A;  1RBT A;  3MXI A;  1QS4 A;  5M1F A;  1QZ6 A;  2ITG A;  2AP1 A;  4FZX C;  4IDH A;  1TUU A;  1WSH A;  3IMX A;  4FLT A;  2E2P A;  4BR0 A;  5HL7 L;  3R1X A;  3PO5 A;  4BGA A;  4WFA L;  1OH5 A;  4B9V A;  4F2R A;  4BG8 A;  3AVK A;  2G8W A;  1HNV A;  3PX6 A;  1U6Z A;  4UQG A;  1JXE A;  3DLH A;  4K42 A;  3FLC O;  1MU2 A;  3SI6 A;  3NH2 A;  3SV4 A;  3AO5 A;  2FC0 A;  1A5W A;  4CER A;  3SPY A;  3V6D A;  2ZE2 A;  2V51 B;  3HP6 A;  4AQY K;  3SLC A;  4CJF A;  5AFU A;  4J2D A;  3B6P A;  3OYL A;  2FF3 B;  4PKG A;  2O8B B;  1MA9 B;  5FLX O;  2ZF5 O;  4M3W A;  2D0B A;  2HHW A;  3H3O B;  5HRN A;  4DSI A;  1OVY A;  1U2V A;  2BH1 A;  1C1C A;  4CHY A;  2UUA K;  3AVI A;  4IDK A;  2HHV A;  1YTA A;  3MCP A;  3LAL A;  3S3O A;  3HPO A;  2FBX A;  2XY6 A;  1C0U A;  4JI1 K;  1SKR A;  1Q8I A;  4A62 A;  4CFA A;  3C65 A;  3J7A P;  3ZET B;  2BTF A;  4FLV A;  5BN9 A;  1NK7 A;  1KAZ A;  4H0X B;  2DFE A;  4PA1 A;  4O0J A;  3L2Q A;  4DU4 A;  1MDU B;  3LWM A;  1T8E A;  2NLX A;  3ZYY X;  3I55 N;  1LV5 A;  3LPU A;  1WSF A;  3EZ5 A;  2WBN A;  3JAM O;  5AJ3 K;  2O4I A;  5A2Q O;  5JS1 A;  2V7Y A;  3J7Z O;  3K9J A;  3CJC A;  1CLQ A;  3M8S A;  3OYA A;  3PY8 A;  4CFC A;  4DHY A;  1K8K A;  5TKY A;  1M1K O;  4CVN E;  1BI4 B;  5AQW A;  2BAN A;  4CJ3 A;  4JKC A;  3HBT A;  3NBP A;  2W6K A;  3HL8 A;  4CZG A;  3QNO A;  4DSJ A;  1XUP O;  2VWJ A;  1KFS A;  1VSF A;  5C0Y A;  4CJU A;  3K5L A;  3DXK B;  3LZJ A;  3P39 A;  3P4I A;  3OS1 A;  2RHK A;  1Y64 A;  2QKB A;  2E4L A;  2KZM A;  1KVC A;  3EE8 A;  1ESV A;  4LFA K;  3E01 A;  4AHS A;  2DPN A;  3JS6 A;  3G71 N;  1HYS A;  1WAJ A;  1WOQ A;  4KHU A;  4FJI A;  2P9N B;  4FJM A;  4B9U A;  1VQ4 N;  3H1V X;  3HVR A;  1BHL A;  3EO3 A;  4FM0 A;  2OZM A;  3MEC A;  4J2E A;  3M8P A;  4CJV A;  3D0P A;  3TAN A;  1YVU A;  1K73 O;  2OTJ N;  1IG8 A;  4JK8 A;  4J2A A;  4IO9 L;  3WT0 A;  3G10 A;  2UXB K;  4EZ9 A;  3MCA B;  4BRE A;  2Q0U A;  3LAK A;  4CJ4 A;  4BQL A;  1VSI A;  2BE2 A;  4FJ8 A;  2RF2 A;  3TAM A;  4DTR A;  2X74 A;  2HNY A;  4RW4 A;  5J1E A;  4QCL A;  2IDO A;  4DS5 A;  3R3L A;  4FVU A;  4IFY A;  2D0P A;  4XH4 A;  3SZ2 A;  2WFB A;  2IS3 A;  2F7T A;  1Q86 O;  5EOY A;  3H08 A;  1S1X A;  3AA3 A;  2P9U B;  4KBO A;  4JI3 K;  2CH6 A;  3MED A;  5AQJ A;  4E7H A;  4JRQ A;  1UOC A;  5EX5 A;  3CCS N;  1TYQ B;  1JLA A;  2A5X A;  4CGI A;  4GW6 A;  1JJ2 M;  5DMR A;  3IS9 A;  2E2N A;  2XY8 A;  5KRS A;  4DSK A;  4CD3 A;  4Q0B A;  3QIP A;  3RMD A;  4CEO A;  4NYF A;  5KRT A;  4IBN A;  3AVM A;  4CI6 A;  4DLE A;  2GBZ A;  4DR7 K;  4OLA A;  3LL3 A;  2D1K A;  4I7F A;  1HKC A;  3SUQ A;  4E7K A;  5DM6 L;  4C1N K;  4CW7 B;  4A2A A;  2LSN A;  1GLF O;  3E9L A;  3UE5 A;  3BUZ B;  3WXI A;  2KKZ A;  4BVP A;  4LSL A;  1HKB A;  3GDQ A;  3VA0 A;  1OH8 A;  4WQ5 C;  4DB3 A;  4C8N A;  3DXM A;  3MXM A;  4FL9 A;  2PYL A;  5CZ1 A;  1IKV A;  3DOK A;  4FVM A;  4DF4 A;  3VMF B;  3W3D A;  3ZSQ A;  1Z05 A;  4EP4 A;  5M1O A;  1BA1 A;  3ASM A;  2KW4 A;  3FE1 A;  1YUW A;  1JKH A;  1QSL A;  3D2E B;  3JXU A;  4GVE A;  1XC9 A;  1VQ8 N;  2Z1G A;  3WNG A;  2QWQ A;  4CES A;  4V19 S;  2UUC K;  3V9Z A;  4B3R K;  3V9W A;  4LF9 K;  3LPT A;  4DV0 K;  1WSG A;  2E1Z A;  3LAM A;  4FCY A;  2RN2 A;  1C6V A;  3LZI A;  2QTD A;  4O55 A;  3D6R A;  3BF3 A;  4RW8 A;  3OTO K;  4C8L A;  5FRO A;  2FSJ A;  1D9F A;  4Z4H A;  3S9H A;  1U49 A;  4O5F A;  4U67 L;  3AO4 A;  4YOV A;  2E20 A;  3K5M A;  1SKW A;  4CEZ A;  3I56 N;  2HHU A;  3F2K A;  4B1Y B;  4DR3 K;  1YF5 L;  3I0S A;  4M45 A;  3NF9 A;  4JKD A;  3KTQ A;  5J2P A;  3NDK A;  4CK1 A;  4ID1 A;  4ILH A;  3AAR A;  1ATN A;  3OYD A;  1VSD A;  3E1Y A;  4BE1 A;  1CZA N;  3HT3 A;  4FJJ A;  3VER A;  3QEP A;  1RFQ A;  4FWQ A;  4CZJ A;  2HF4 A;  2O8C A;  1S1W A;  1C1A A;  1VRU A;  2QWL A;  3L8B A;  1NBW A;  3FZM A;  2D5R A;  3HJF A;  4DTX A;  1NGD A;  3QML A;  1BCM A;  1FK9 A;  3O3G A;  1CXQ A;  4FWO A;  1TL3 A;  1OH6 A;  3O3F A;  3WQU A;  3K58 A;  3M3Z A;  1YI2 N;  3L4Q A;  3NAE A;  3EE9 A;  1W7A A;  4DFJ A;  5AQO A;  1EET A;  4DR1 K;  2DTU A;  3FFK B;  1XHX A;  4JKG A;  4MDB A;  3OJU A;  1TKT A;  3ZSV A;  4DKW A;  1SQK A;  3SUO A;  3VQP A;  1QQN A;  5D3G A;  3ALY A;  2F4V K;  3F73 A;  1ZYQ A;  5CYM A;  3NF7 A;  1NJX A;  4Z4E A;  1IJJ A;  2A1S A;  4KRE A;  3W0L A;  3SUP A;  5AQU A;  4FWS A;  5AQV A;  4N41 A;  5CHI A;  1LAW A;  2KHO A;  3CG7 A;  4BDY A;  2GEL A;  4CIG A;  2ZJQ L;  1BG3 A;  4LF7 K;  3LDQ A;  3T1Y K;  4DMN A;  4OGE A;  4CJW A;  2E6L A;  4C8K A;  4GV3 A;  2O8E B;  1RDC A;  4O8K A;  3P5J A;  5J2M A;  4DTS A;  1K8A O;  2QWO A;  4NLC A;  3D45 A;  4GKK K;  3SCX A;  1Q9Y A;  4FLZ A;  1NJI O;  1F21 A;  4Z94 A;  3Q7B A;  3C94 A;  3LP3 A;  5AR0 A;  3NE6 A;  2PBD A;  4KRF A;  1HPM A;  2DFH A;  1NMD A;  5BR8 K;  4IJA A;  5LMN K;  3CCV N;  2H3G X;  4HTL A;  3MDQ A;  4Z4F A;  5HLF A;  3L3V A;  3VGL A;  2KQ2 A;  4B9N A;  3KLG A;  3HM8 A;  1VQL N;  4FZY A;  4KHN A;  2VG7 A;  1ASV A;  1X1P A;  3AVB A;  1X9M A;  4B3T K;  4M63 C;  3RTV A;  4I6M A;  3VF2 A;  2RPI A;  1BIU A;  3OYB A;  2KLA A;  4K43 A;  4FWN A;  2YHW A;  3HXM A;  2RE2 A;  4OPJ A;  3TTD A;  4IFV A;  1DLO A;  3CCR N;  1Q81 O;  3HM9 A;  2KZZ A;  1CZB A;  4FLW A;  1ILY A;  3CMA N;  1EP4 A;  4EHU A;  5KGX A;  3JSM A;  3O9U A;  4ICL A;  3UB5 A;  3I8B A;  1YT3 A;  4O5B A;  4B8A B;  1BIZ A;  3DRP A;  3OYI A;  1WB9 A;  3S3N A;  3D7E O;  4FJ5 A;  1NGH A;  3EZW A;  3O1B A;  3TAQ A;  2A3Z A;  1VQM N;  4BR5 A;  2YKM A;  1CXU A;  3L0Q A;  4HVJ A;  4O0I A;  3UKU B;  4YDU C;  1RIL A;  3O80 A;  3VQC A;  5E26 A;  2Q97 A;  5JIC A;  3ZLJ A;  4JKH A;  2IIR A;  4FWP A;  1IKY A;  2QWN A;  1HQE A;  4WQ4 C;  3ULE A;  4CK2 A;  4C8M A;  3OBY A;  3VEY A;  3BDP A;  1X9W A;  2KFZ A;  3I0R A;  4YOX A;  2D0C A;  3WXM B;  4LF6 K;  5GIN A;  3FZK A;  2YHA A;  4AHU A;  5BPN A;  4JI8 K;  3NVK A;  2VQE K;  1HQU A;  5HRP A;  1DKG D;  1QQC A;  4CZI A;  5C2D A;  2ZGZ A;  3SMP A;  4DWI A;  4ZHR A;  4K8X A;  4AHC A;  4Y0W A;  3PX0 A;  1GOC A;  3H1Q A;  3VEZ A;  3EYZ A;  4FJ7 A;  3I33 A;  2E1Y A;  4EAH D;  3RSE B;  3K59 A;  5JVG L;  1QHT A;  2ASM A;  4CD1 A;  1RBR A;  3A5O C;  4E1N A;  2YV0 X;  1QQO A;  3TAF A;  3THX B;  3VQA A;  1N8R O;  3BF1 A;  1S22 A;  4RW7 A;  5AQY A;  5HRS A;  2FBV A;  4OVL A;  2ZJR L;  3KK7 A;  1NNE A;  3SQ1 A;  4BQZ A;  2V7Z A;  3OBW A;  1IBM K;  3WNF A;  3NH0 A;  2JWK A;  3U9D A;  1NJZ A;  3TAP A;  1T03 A;  3CME N;  2W42 A;  3MAQ A;  4DQS A;  3EKS A;  2HHX A;  4BR7 A;  1I39 A;  1K8K B;  5DM7 L;  4K25 A;  5FPN A;  1NJY A;  4JD2 A;  3IFR A;  1R59 O;  5EVZ A;  4E19 A;  1G99 A;  1ASW A;  1NK8 A;  3VN5 A;  3LDP A;  3AAQ A;  2A6A A;  3AVF A;  1C0M A;  2Q36 A;  4JI2 K;  2O8F A;  3DI6 A;  3ZT2 A;  1QVG M;  3PO4 A;  4BGB A;  2B4J A;  4KB1 A;  3SBT A;  4IG0 A;  1JL2 A;  3LP1 A;  3DLE A;  3MXJ A;  2BUP A;  5EU7 A;  1E4F T;  3QO9 A;  4JS4 A;  2YNF A;  4ELT A;  4B8C A;  1HKG A;  1RT2 A;  5F1X A;  3R6M A;  4CEC A;  2P9S B;  4G1Q A;  4LD0 A;  4MO4 A;  5J2Q A;  1YIT N;  1RT4 A;  2R7Y A;  4PUO A;  4WQ5 A;  2GWJ A;  2HND A;  3BZK A;  2B6A A;  3C7N A;  3OY9 A;  4H0V B;  3TSP A;  4KAZ A;  4B3S K;  1GOB A;  3CJ7 A;  4KV8 A;  2OPR A;  3K5O A;  4AF1 A;  3QLH A;  1RT5 A;  5AQQ A;  4DTP A;  1YVN A;  5ADX H;  4DQP A;  2ASO A;  3CF5 L;  4A59 A;  2XRI A;  2P9P A;  5E84 A;  3KIO A;  3M8R A;  5KQ8 A;  3AGR A;  2XHB A;  3P83 D;  4H5R A;  3SAH A;  1TK8 A;  2P9I A;  4OLB A;  4WFB L;  1S6Q A;  3AA2 A;  1L3V A;  4FW2 A;  3EN9 A;  4JI5 K;  4DR6 K;  3TTC A;  3DRR A;  1L3S A;  3CCE N;  4H0Y B;  1S72 N;  3L2W A;  5CZ2 A;  4B08 A;  4C8O A;  3ZT1 A;  1KTQ A;  3QB0 A;  2ZM6 K;  3NF8 A;  3AA4 A;  2DFF A;  2QXF A;  1LOT B;  1VSH A;  2P9K B;  4MLH A;  3OJS A;  1YAG A;  1S6P A;  1HPZ A;  3A5L C;  4DV6 K;  4M3T A;  4WCE L;  1VSK A;  3ZT0 A;  4IO8 A;  2YI1 A;  1KLN A;  1ZBI A;  3KLF A;  4PY5 A;  4BRH A;  3VQ6 A;  3LDS A;  3OYN A;  4DV5 K;  2F9T A;  4QAG A;  5KQD A;  2XY5 A;  4WE1 A;  5CE3 A;  2YNI A;  3ZEU A;  4BE2 A;  1XNQ K;  4OGC A;  2VQF K;  2PY5 A;  3K9K A;  1GLB G;  2X6S A;  3OW2 M;  3MX2 A;  4KI4 A;  2HB5 A;  3J7Y P;  4B9S A;  2OTL N;  1S1V A;  1TK5 A;  1S9G A;  3T19 A;  3M5R A;  2CGL A;  3THY B;  5GIP A;  2JWL A;  4PL7 A;  4DTM A;  3QEV A;  4M42 A;  4IWV A;  3U3Y A;  4OX9 K;  3QEI A;  1O1W A;  3VQE A;  5ADX A;  1RDU A;  1RT6 A;  1YJW N;  3UIQ A;  4JEP A;  4BAC A;  2VGN A;  4AM7 A;  4CE9 A;  4BRD A;  3PSF A;  4DU1 A;  5HOO A;  4LSN A;  3SAF A;  3KHY A;  1IBL K;  1X9S A;  4Z4I A;  2ZD1 A;  4CZF A;  4MDA A;  4CZM A;  4H5N A;  4W5N A;  3ZT4 A;  3O4N A;  3BP8 A;  1GLC G;  1EX4 A;  1JLE A;  1QHA A;  3DJC A;  4H03 B;  2HHT A;  2EWS A;  3MN6 A;  1VSJ A;  2A40 A;  1WSI A;  4A2B A;  4CJ5 A;  3CFR A;  1YHQ N;  1NOY A;  1N33 K;  4PQU A;  4CJQ A;  3CPW M;  4FPB A;  1J6Z A;  2HHQ A;  1VQ6 N;  3WEE B;  2Z1H A;  3L6Q A;  4BRL A;  2F9W A;  1BUP A;  2YX6 A;  1FW6 A;  4H4O A;  3HOS A;  5BRH A;  4KPY A;  3VGK A;  4CJT A;  3QDK A;  3GL1 A;  4CHO A;  2NUB A;  2O8C B;  2ASP A;  4I2P A;  4DSE A;  3J8A A;  1V4S A;  4JKA A;  1D9D A;  2EHG A;  1XNR K;  1NGE A;  1UWB A;  3SNN A;  1L3U A;  5AZI B;  4M7Y A;  2O8B A;  4JNE A;  4B1X B;  5I9E B;  3V4I A;  4HCC A;  1W97 L;  2GTD A;  2XY7 A;  1ZBS A;  3T69 A;  5SWM A;  2UUB K;  3LP0 A;  4FJH A;  5IWA K;  4LH5 A;  3VES A;  1ZBH A;  3TR8 A;  2YKN A;  3O6W A;  4GY2 B;  3TAG A;  4GMJ B;  1BCO A;  4BY9 C;  2G8I A;  1N32 K;  3ZET A;  2CGJ A;  4CIF A;  4F4K A;  1ZBF A;  3ENH A;  3KK1 A;  3MK6 A;  3LAN A;  4FOE A;  1YTU A;  3IAY A;  1IV0 A;  4IOA L;  1FJG K;  2P9L B;  4KHY A;  4OKJ A;  3HP9 A;  3HST B;  3HOT A;  1X3M A;  2NRV A;  4AIL C;  3ATU A;  1VSE A;  2ZWH A;  4ILJ A;  5MLC Q;  4GNI A;  5AQL A;  4NO7 A;  4FWK A;  1QTM A;  3CI5 A;  3ATV A;  3VEX A;  1Z26 A;  4U7B A;  5I3U A;  2AA4 A;  4DFM A;  2NRX A;  5I42 A;  2NRH A;  1BI4 A;  4CEE A;  3U6F A;  4ID5 A;  3VTH A;  4X65 K;  2VG6 A;  5HRO A;  4B9T A;  3VQ5 A;  1SS6 A;  4KTW A;  3DWL A;  3E9O A;  1ASU A;  4Z4G A;  5AQT A;  3RMC A;  3HZ6 A;  4YNQ A;  3H6E A;  1KRP A;  4DTJ A;  3FFI A;  3DXK A;  1W2B M;  1UA1 A;  1SAZ A;  3EY1 A;  5FPD A;  3OA9 A;  3L4I A;  4FJG A;  5GAE P;  3NMU A;  2Z1I A;  4JRP A;  4DCH A;  4C1N I;  4ISF A;  4WYB A;  2WON A;  1BQM A;  2X6N A;  3VEN A;  2P9N A;  4QS9 A;  5B8H A;  4FK2 A;  3AVL A;  3TTF A;  3D2F A;  4M3Z A;  1KVB A;  1NOZ A;  1IKW A;  2P51 A;  5M1Q A;  4BWM A;  1BA0 A;  3CFO A;  4BDP A;  4W5O A;  2JGU A;  2OPP A;  3P38 A;  3EKU A;  5C25 A;  3TAE A;  5KTQ A;  2OZS A;  2P1J A;  1VK0 A;  3KK2 A;  4M3X A;  2D0A A;  3M1F A;  1RDD A;  1I3A A;  3P31 A;  1P90 A;  4JI7 K;  4KHW A;  4ISE A;  4JHD A;  3SBG A;  4CEB A;  4B3O A;  2HNZ A;  1U47 A;  1JCG A;  3HPH A;  4NXN K;  4CHZ A;  2OPQ A;  1NLV A;  4Y1D A;  3CPE A;  3CM6 A;  1KSP A;  4A57 A;  1HUX A;  1UA0 A;  5AQZ A;  4GKJ K;  3NGI A;  1TKZ A;  3VEO A;  3F5T A;  3P1G A; 
#chains in the Genus database with same CATH homology
 4JKH A;  1T44 A;  4JK7 A;  2IIR A;  4FWP A;  1HJO A;  2P9U A;  2IVO A;  2QWN A;  4PKH A;  4K41 A;  2YJF A;  3AY9 A;  2HBM A;  4PHT X;  4WQ4 C;  3ULE A;  4IEE A;  1YIJ N;  2V51 B;  3CCJ N;  1YJ9 N;  1TYQ A;  3SLC A;  4ILG B;  5AFU A;  5C12 A;  3OBY A;  2P9K A;  2FF3 B;  4PKG A;  3VEY A;  4BC3 A;  1GLL O;  3VOV A;  1MA9 B;  3EL2 A;  2ZF5 O;  4YOX A;  3H3O B;  3O08 A;  3WXM B;  5GIN A;  3FZK A;  5BPN A;  1OVY A;  1U2V A;  1QVF M;  3NVK A;  2BH1 A;  1VQK N;  2VCP A;  4BC2 A;  5C0Y A;  4JKG B;  4MLE A;  2QM1 A;  1DKG D;  5LY3 A;  5KPT A;  2FSN A;  3QIC A;  3MCP A;  4JAX A;  4BRN A;  4CZI A;  5BRF A;  2ZGZ A;  3SMP A;  5C2D A;  4B1V A;  2ITM A;  4Y0W A;  4A62 A;  3LDO A;  3VET A;  3C65 A;  4CZL A;  3ZET B;  3MX5 A;  4H0O A;  5EY4 A;  3H1Q A;  2BTF A;  3VEZ A;  5AQN A;  3I33 A;  5BN9 A;  4BC5 A;  5JVH L;  1KAZ A;  2E1Y A;  4H0X B;  4EAH D;  1MDU B;  3RSE B;  5JVG L;  4H5W A;  3SAG A;  2ASM A;  2NLX A;  4CBU A;  4CD1 A;  3A5O C;  1NWK A;  3ZYY X;  1Z6R A;  3UKR B;  3OHR A;  3IUC A;  3I55 N;  4CJ7 A;  2HMP A;  5AQX A;  1QQO A;  2E2Q A;  5M1P A;  2WBN A;  4R79 A;  4H5T A;  1N8R O;  1BU6 O;  1S22 A;  3BF1 A;  4L3Q A;  4YDU A;  2V7Y A;  3G6E N;  5LJV A;  4WFN L;  5AQY A;  3J7Z O;  3K9J A;  3CJC A;  5AZJ B;  5FPE A;  2ZJR L;  2J4R A;  3KK7 A;  4UY8 O;  2W40 A;  4BQZ A;  4DHY A;  2V7Z A;  1OKJ A;  1K8K A;  3OBW A;  5TKY A;  4B1U B;  1M1K O;  1KQS M;  2JWK A;  3U9D A;  5AQW A;  3D2E A;  4JKC A;  4WQ4 A;  3HBT A;  3FZH A;  3CME N;  1HX1 A;  3MN9 A;  4XH1 A;  4CZG A;  1BOT O;  1XUP O;  1JCE A;  3M6G A;  3EKS A;  4K42 A;  2V52 B;  5TKW A;  2IVN A;  1K8K B;  2D4W A;  2GEM A;  4BR7 A;  3IKM A;  4K25 A;  4QS8 A;  3O8M A;  1H1V A;  4JN4 A;  4B1Z A;  4IOC L;  1P8Z A;  5FPN A;  1Q18 A;  4JD2 A;  4BRP A;  5GAH P;  3DXK B;  3O5B A;  4CZK A;  3CC4 N;  3P39 A;  3IFR A;  1R59 O;  3P4I A;  5EVZ A;  1G99 A;  2RHK A;  1Y64 A;  2FSK A;  2Q1N A;  3LM9 A;  3LDP A;  4IOX A;  3AAQ A;  2A6A A;  2Q36 A;  3EE8 A;  3KWI A;  1ESV A;  3MN7 A;  1NM1 A;  1QVG M;  2YHY A;  2DPN A;  5GAG P;  3JS6 A;  3KVG A;  3G71 N;  1RGI A;  4BGB A;  1WOQ A;  4I6M B;  3SBT A;  2P9N B;  2BUP A;  5AQH A;  1E4F T;  2ZGY A;  3C0B A;  4CBW A;  1VQ4 N;  5C2F A;  1RDW X;  3H1V X;  4C23 A;  1HLU A;  1HKG A;  2NNW A;  3EO3 A;  5F1X A;  3ENB A;  1SZ2 A;  1ZXO A;  3R6M A;  1VQ9 N;  3CCU N;  4JKB A;  5ELZ A;  3VTI A;  2P9S B;  3SK3 A;  5C10 A;  3DLL L;  4MO4 A;  4EHT A;  1D4X A;  3MWP A;  3U9Z A;  2HST A;  1YIT N;  4H0P A;  5LJW A;  2QXL A;  4WQ5 A;  3SMS A;  2GWJ A;  1K73 O;  4BC4 A;  2OTJ N;  3C7N A;  4RTF D;  1IG8 A;  4H0V B;  3TSP A;  4JK8 A;  5BPM A;  3WEE A;  1KAX A;  3CIP A;  4IO9 L;  3TSQ A;  3CJ7 A;  4HWI A;  3WT0 A;  4AF1 A;  3MCA B;  3WXK A;  3CCL N;  2FLO A;  5AQQ A;  2QW9 A;  4BRE A;  3QBX A;  2Q0U A;  1YVN A;  3A5M C;  4BRF A;  3WXJ A;  4NLB A;  4BQL A;  2ASO A;  1GLD G;  5ADX H;  3CF5 L;  4A59 A;  3C7N B;  4FOI A;  4KH4 A;  1WUA A;  2P9P A;  5E84 A;  3ID8 A;  3S41 A;  3ENO A;  5KQ8 A;  3B8A X;  2E2O A;  3QBW A;  4FO0 A;  3AGR A;  3R3L A;  4H5R A;  2HOE A;  4OPH A;  3WXL A;  3SAH A;  4FVU A;  4QS7 A;  5F0X A;  2D0P A;  2P9I A;  4XH4 A;  5GAD P;  5AZI A;  4WFB L;  1VQ5 N;  4GV9 A;  2WFB A;  2P9P B;  4KH5 A;  1VQ7 N;  2GX9 A;  3EN9 A;  2F7T A;  4RWT A;  3TTC A;  1Q86 O;  5EOY A;  5BR9 A;  3CCE N;  1XC3 A;  4EFH A;  3VEW A;  2CH5 A;  4H0Y B;  3CQX A;  2P9U B;  4KBO A;  4YOR A;  5AQS A;  2CH6 A;  4BR9 A;  1S72 N;  5AQJ A;  2P9I B;  3A0I X;  3ULE B;  3QB0 A;  5EX5 A;  3CCS N;  1TYQ B;  2A5X A;  1LOT B;  2P9K B;  4MLH A;  2FF6 A;  1JJ2 M;  4KH6 A;  1YAG A;  2E2N A;  4G9Z A;  2D0O A;  1NGF A;  3O4W A;  4CD3 A;  1NGJ A;  3A5L C;  4WCE L;  1U2V B;  3ZX2 A;  5JMV A;  4CZE A;  5H1S Q;  3H46 O;  2I7P A;  4CI6 A;  4IO8 A;  2YI1 A;  4IJN A;  3LL3 A;  2Q31 A;  2D1K A;  2P9L A;  2QWM A;  2I7N A;  4BRH A;  1HKC A;  2VYP A;  2NRW A;  2YHX A;  2F9T A;  4WF9 L;  4YOU A;  5DM6 L;  5KQD A;  4C1N K;  4YOY A;  1VQO N;  4A2A A;  5AQF A;  1GLF O;  3E9L A;  5CE3 A;  3UE5 A;  3BUZ B;  5AQM A;  3ZEU A;  1KXP A;  2E88 A;  3WXI A;  2KKZ A;  4BVP A;  3TPQ A;  3N4Q A;  1HKB A;  3GDQ A;  3K9K A;  4A5A A;  4WQ5 C;  4BR2 A;  4DB3 A;  1GLB G;  2QA4 N;  4OO1 J;  3DXM A;  4FWR A;  5DM7 L;  3OW2 M;  3MX2 A;  4FL9 A;  4JK9 A;  3U4L A;  3ZEU B;  2OTL N;  3CJA A;  5F2R A;  2W41 A;  3N4P A;  3GE1 A;  3M5R A;  3VMF B;  3W3D A;  2CGL A;  3CJ9 A;  1QZ5 A;  3IDH A;  5GIP A;  2JWL A;  4J8F A;  1Z05 A;  2WUS A;  4BG9 A;  4PL7 A;  5M1O A;  3R8E A;  1BA1 A;  1JCF A;  4IWV A;  3VGM A;  4GV6 A;  3FE1 A;  1YUW A;  3A5N C;  3H45 C;  4H5V A;  3D2E B;  4YOT A;  3JXU A;  3NVM A;  3FGU A;  3H3N O;  4GVE A;  5EXW A;  4BRK A;  5KPZ A;  5BRE A;  3GG4 A;  1Q7Y O;  1VQ8 N;  3HRG A;  3CER A;  3AGK A;  1K9M O;  5ADX A;  2QWQ A;  3QFU A;  1NGI A;  1RDU A;  1GLJ O;  1C0G A;  1YJW N;  2IVP A;  2FXU A;  4JEP A;  2UYT A;  3CJ1 A;  1YJN N;  3VF4 A;  2E1Z A;  4JD2 B;  2VGN A;  4AM7 A;  4BRD A;  4BRQ A;  4IZ9 A;  2QTD A;  5HOO A;  3D6R A;  4LC9 B;  3A8Y A;  3CET A;  3BF3 A;  3SAF A;  2VGM A;  4FPA A;  2NRR A;  2YJE A;  3KHY A;  4BVO A;  1GLE G;  4CZF A;  3DAW A;  4MDA A;  4BRM A;  4BRA A;  2HBL A;  4CZM A;  4BRG A;  2FSJ A;  4H5N A;  2QI2 A;  3CQY A;  3BP8 A;  1GLC G;  1QHA A;  4O5F A;  4U67 L;  4YOV A;  5M1N A;  3O1W A;  2E20 A;  1LCU A;  3DJC A;  3WUH A;  4H03 B;  3I56 N;  3F2K A;  4EIA A;  3CXC M;  2EWS A;  1V4T A;  2NRT A;  3MN6 A;  3G25 A;  4B1Y B;  3KZB A;  1YF5 L;  4BRO A;  2A40 A;  4A2B A;  1YHQ N;  1ATR A;  4JKD A;  4BR4 A;  2PAV A;  1MWM A;  3CPW M;  2QWP A;  3WQT A;  4ILH A;  4ISG A;  4FPB A;  3AAR A;  1ATN A;  5C15 A;  5AQG A;  4OPA A;  1J6Z A;  3E1Y A;  1CZA N;  3QFP A;  3VER A;  5BN8 A;  1RFQ A;  4PKI A;  3LDN A;  2NZT A;  3FZF A;  4FWQ A;  4JKE A;  2HF4 A;  3CJB A;  4CZJ A;  1VQ6 N;  3WEE B;  3L6Q A;  3VEV A;  4BRL A;  2QWL A;  2F9W A;  1BUP A;  2YX6 A;  4IEI A;  1NBW A;  3UKU A;  3HOS A;  5BRH A;  3FZM A;  3G4S N;  1E4G T;  4BRI A;  3VGK A;  5AQP A;  3QDK A;  2A42 A;  1NGD A;  3GL1 A;  1DT9 A;  3ZX3 A;  3QML A;  3MWT A;  1DEJ A;  5M1K A;  3RVC A;  4FWO A;  2ASP A;  1KC8 O;  3J8A A;  1EO1 A;  2PFU A;  1V4S A;  4JKA A;  2VWB A;  1T6C A;  3WQU A;  1NGE A;  2YCH A;  3M3Z A;  1YI2 N;  2HBJ A;  5AZI B;  4IFE A;  1X3N A;  4M7Y A;  4JNE A;  4B1X B;  5I9E B;  3L4Q A;  1BO5 O;  3EE9 A;  1W97 L;  2GTD A;  3FZL A;  5AQO A;  1ZBS A;  3CCQ N;  3FFK B;  3T69 A;  3T7Z A;  3O9Q A;  4JKG A;  3O9S A;  4MDB A;  5KPR A;  1TUY A;  3VES A;  1DGK N;  1VQP N;  4DKW A;  1SQK A;  3O6W A;  4GY2 B;  3PIO L;  1BWF O;  1QQN A;  3ZX0 A;  4B9Q A;  4CBX A;  4BY9 C;  2Q0R A;  1KAY A;  4NB4 A;  3LM2 A;  3VF6 A;  1GLA G;  3ZET A;  2CGJ A;  4M7X A;  3O9T A;  3ENH A;  2HBK A;  3MK6 A;  4FOE A;  1IJJ A;  3W0L A;  3MMV A;  3FR0 A;  5AQU A;  4IOA L;  4FWS A;  2E8A A;  3RSE A;  3AAP A;  3C6H A;  1T6D A;  2P9L B;  4PL8 A;  5AQV A;  5AQK A;  1QQM A;  5CHI A;  3HOT A;  5BRD A;  2KHO A;  3R9P A;  3UKR A;  1X3M A;  3PIP L;  2NRV A;  5AQR A;  2GEL A;  3ATU A;  2ZWH A;  2ZJQ L;  1BG3 A;  4ILJ A;  3CCM N;  3ID6 A;  3LDQ A;  1NGC A;  4GNI A;  4CZH A;  5MLC Q;  4B1W B;  4FSV A;  5AQL A;  4NO7 A;  5AZJ A;  1NGG A;  4FWK A;  4GV3 A;  3GBT A;  4O8K A;  3CI5 A;  3ATV A;  3VEX A;  4U7B A;  1K8A O;  2AA4 A;  2QWO A;  4NLC A;  2NRX A;  3DXM B;  2NRH A;  4XEI A;  2HF3 A;  4YOW A;  1BDG A;  1MWK A;  4XH5 A;  5AFU H;  3VTH A;  3LDL A;  1ZC6 A;  4FWL A;  1NJI O;  4Z94 A;  3Q7B A;  3E66 A;  5AR0 A;  1NGB A;  1SS6 A;  2PBD A;  3CHW A;  3DWL A;  3E9O A;  4RCH A;  1HPM A;  5AQT A;  1EQY A;  4FWM A;  3HZ6 A;  1NMD A;  3PLA A;  4IJA A;  3H6E A;  3DXK A;  3CCV N;  3CD6 N;  1W2B M;  2H3G X;  1SAZ A;  3F9M A;  1S3X A;  3MDQ A;  4HTL A;  5CR4 A;  5FPD A;  5JLH A;  2CGK A;  4A61 A;  3OA9 A;  3VGL A;  5GIO A;  3VPZ A;  3HM8 A;  3L4I A;  3TU5 A;  1VQL N;  3SJH A;  1ATS A;  5GAE P;  3NMU A;  3KWG A;  1VQN N;  4DCH A;  4C1N I;  4ISF A;  4WYB A;  4M63 C;  3BEX A;  1XQS C;  4I6M A;  3VF2 A;  1O13 A;  2WC9 A;  2GWK A;  3VEN A;  2P9N A;  4QS9 A;  2GUP A;  2QWR A;  5B8H A;  5BPL A;  2KLA A;  5AQI A;  5JLF A;  4K43 A;  1YXQ A;  3D2F A;  3TTF A;  4F9O A;  4FWN A;  3MN5 A;  4BRC A;  3C6A A;  2NRZ A;  2YHW A;  2ZJP L;  5M1Q A;  2RE2 A;  5FPM A;  2P9S A;  3TTD A;  1BA0 A;  3E9P A;  3CCR N;  1Q81 O;  1Q82 O;  2Q2R A;  3P38 A;  3EKU A;  4DQ8 A;  3GOI A;  1KD1 O;  3HTV A;  3TSU A;  3D2F B;  1ILY A;  3HSC A;  4IXC A;  3CMA N;  4EHU A;  2A41 A;  3O9U A;  3M1F A;  3CC7 N;  3P31 A;  1P90 A;  4JKF A;  1T3V A;  4ISE A;  3UB5 A;  3I8B A;  4JHD A;  1M90 O;  3O9R A;  3SBG A;  3CC2 N;  5M1F A;  1QZ6 A;  1VAZ A;  2AP1 A;  4IDH A;  1NGA A;  3D7E O;  1TUU A;  1NGH A;  3EZW A;  3O1B A;  2OAN A;  1JCG A;  2A3Z A;  3IMX A;  1VQM N;  3U8X A;  2E2P A;  4A5B A;  4BR5 A;  3L0Q A;  4O8U A;  4BR0 A;  3R1X A;  5HL7 L;  1NLV A;  4JHD B;  4BGA A;  1X9J A;  4WFA L;  3CPE A;  1C0F A;  3UKU B;  4A57 A;  1HUX A;  4YDU C;  4H0T B;  4BG8 A;  3O80 A;  5E26 A;  5AQZ A;  1U6Z A;  4MO5 A;  3VEO A;  2Q97 A;  3F5T A;  3Q7C A;  4AM6 A;  4E1J A;  2QEX N;  5JIC A;  3FLC O;  3HI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...