5JVHQ

The crystal structure large ribosomal subunit (50s) of deinococcus radiodurans in complex with evernimicin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
b'SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5jvhQ00
2DHXA 5LXYA 2CJKA 1WG4A 1WHXA 3CUNA 3DLLQ 2XNRA 1WG1A 2DNQA 2N7CA 2DHSA 1U1MA 2E5IA 2EK6A 2FHOB 2MZSA 1R8PA 5GAHU 1YJ9S 1OWXA 2RQCA 1YITS 3IRWP 4FXWA 2AYGA 2JWNA 5GAGU 1NU4A 3CCRS 2DNPA 1VQ8S 3CCUS 3G8SA 3R1LA 1CVJA 2MY7A 2MQPA 2MSTA 1X4AA 1X4FA 1O0PA 2G1DA 3SDEB 1M5VC 5IM0A 2LA6A 2DGSA 1PGZA 2CPZA 1VQ9S 4F25A 1WEXA 2ERRA 1WI8A 2CPXA 1QVGR 2XS7A 1KOOA 1VC5A 2UP1A 5D78A 2JRSA 2F9JA 4TU7A 2DO0A 1UW4A 5ITHA 2MKSA 1Q7YT 2CQHA 1H2VZ 3G6ES 1YHQS 1U1KA 2HYIB 1YWXA 4RU2A 2AYBA 5DETA 2FC8A 5JVHQ 2D9PA 3BEGB 1JJ2R 4PR6A 2BZ2A 1WWHA 2HGLA 2XB2D 4C4WA 3THPA 1U2FA 2KU7A 4C7QA 2KG0A 2A3JA 2LKZA 3ULHA 2XS5A 1SJFA 3U1MA 2MKJA 2Q79A 2CQIA 2O3DA 1VC6A 3Q2SC 2MZTA 2CPIA 1FT8A 3G71S 1QM9A 3CCJS 2LXIA 4EGLA 2LEAA 4WFBQ 1FO1A 2KVIA 3BO3A 4IOAQ 3EX7B 2YKAA 4IUFA 2XS2A 1YI2S 2DNLA 2GO9A 4YOEA 1KQSR 1R8HA 2MJUA 4IOCQ 1K8AT 3P6YC 2DGUA 3MURP 2KFYA 1VBXA 1VQMS 1HD0A 1FNXH 1N8RT 3CC2S 2DIUA 1VBYA 2LCWA 5D77A 5DDQC 2MKKA 2J8AA 5LXRA 3CCVS 1NO8A 5DM6Q 2RNEA 1YTYA 3CCLS 3J7ZT 2ADBA 1N54B 3CCSS 3PIPQ 2VOPA 1RKJA 2LXUA 2RQ4A 1WHWA 1VBZA 3HHNB 4CIOA 2KRRA 2CPDA 2DNOA 4W92B 1WELA 2VOOA 1UP1A 2AYMA 1B7FA 3I55S 3P5TL 3IWNC 3CMAS 2EVZA 3VAHA 2J0SD 4WFAQ 4QU7A 1PO6A 2X1BA 1X4HA 2HZCA 1HL6A 3B4DA 3P49B 1URNA 2JVOA 2OIHA 2CPHA 1L3KA 2DH9A 2RU3A 1X4EA 2EK1A 4ERDA 4WKRA 3VAGA 1WG5A 1G2EA 1U1RA 2GHPA 4PRFA 2DH7A 2AYEA 4Y00A 1DRZA 5LSOA 1KOHA 5GADU 2MQOA 2MKHA 4QQBA 5DDPC 1YJWS 1X5PA 3SDEA 1X4GA 2MGZA 2LA4A 2DNRA 1YIJS 3H2UB 2MQMA 4CQ1A 1BY9A 4W90B 1KD1T 4F26A 2DNMA 1FJEB 3P3DA 2N3OA 3S8SA 1XN9A 4F02A 1SJQA 3FEXB 3NMRA 1D9AA 2DO4A 2M70A 1U6FA 3TP2A 2DGTA 2KN4A 1WEYA 2F9DA 3UCZP 2LYVA 2KXFA 1M5PC 1M5OC 3VF0B 4WIIA 1WF0A 1WHYA 2AD9A 2D9OA 3UCGA 3MUTP 5HL7Q 2MPUA 1NJIT 2SXLA 2MQQA 2RVJA 5LJ3Y 5MLCV 2HVZA 1X5OA 5GMKa 2PE8A 1U1LA 3LPYA 3J7YU 3BS9A 3CULA 1VC0A 1X5TA 4IO9Q 2DGVA 2MZJA 3CD6S 2RRAA 2DNZA 1P1TA 2ADCA 4UQTA 1JMTA 2M0GB 4LIRA 2I38A 1VQOS 3R1HA 2DH8A 2KXNB 1OIAA 4TU8A 1VQKS 2RT3A 3MI7X 2X1FA 2RS2A 2MQLA 1X5SA 1ZZFA 2OSQA 2MMYA 3MD1A 5IFMA 2JX2A 2HGNA 3VAJA 2OTLS 1UFWA 2K3KA 1WHVA 2QA4S 1SXLA 2KG1A 2CQDA 3RW6A 2U1AA 2N82B 1DZ5A 3L3CA 1FXLA 4C0OC 3CPWR 3MUVP 5DM7Q 1SJRA 3MXHP 1ZH5A 2M9KA 2CQ0A 3VALA 4A8XA 1N88A 3NS5A 2KT5A 1A7GE 1X4BA 2LEBA 3SXLA 3US5A 5CA5A 4BS2A 2NLWA 4WFNQ 3RW7A 1H2UX 1VQNS 2XSFA 3MDFA 5CXTA 2KHCA 1OO0B 3CMES 3CCES 1WI6A 1FJ7A 3NS6A 1UAWA 3S6EA 4Z2XA 3U1LA 4WF9Q 2CPEA 1W2BR 4FXVA 4ZKAA 1VQ7S 4P6QA 1WEZA 5EN1A 1VQLS 2JVRA 4PKDB 3ZZYA 2M52A 1U6BA 1U1PA 2MZQA 4UY8T 1WF2A 1P27B 3TYTA 2F3JA 5FJ4A 5GVQA 1DBDA 2BOPA 2CQPA 2MYFA 1IQTA 2RS8A 2MY8A 2I2YA 3LQVA 2PEHA 2KRBA 3EGNA 2CPFA 1AUDA 3SMZA 2E5GA 4U67Q 3NNAA 2FPHX 2LECA 2DNHA 2G4BA 3TO8A 5IM0B 3UCUP 2U2FA 5HO4A 2MZ1A 2FY1A 3UD3P 2D3OR 2MKIA 2KXHA 1FHTA 3VAMA 2CPJA 3MUMP 2M8DB 2DGXA 1Q81T 2MSSA 2CQCA 2M7SA 1VQ4S 1YJNS 2CQBA 1M5KC 2MQNA 2OSRA 3UD4P 2CQ1A 2DGWA 2YH1A 2E5HA 2K8GA 1WTBA 2LQ5A 2M8HA 2VONA 1U1OA 1SJ3P 2X1AA 4QPTA 4OZ0A 1K73T 1H6KX 2M88A 2OTJS 4LJMA 3HI9A 2DK2A 2RUGA 1VQPS 5CYJA 1Q86T 3EGZA 3N9UC 4TU9A 2E44A 3S7RA 3V4MA 2ZJPQ 3H2VE 2L08A 4LMZA 3CXCR 1H2TZ 3BO2A 1HA1A 3FEYB 1M1KT 3UE2A 2G0CA 3B4MA 1X4DA 2HGMA 4WCEQ 1M90T 2YWKA 1JJHA 2YH0A 5H1SV 2RRBA 1N52B 2DHGA 3BO4A 3CTRA 2E5JA 2YTCA 3OW2R 2DGQA 2KH9A 2FC9A 2M4MA 3I56S 2DHAA 3NNCA 1VQ6S 4QU6A 3G96A 3MD3A 2MXYA 1JJ4A 2NZ4A 3G4SS 2DB1A 5BJRA 3D2WA 4OZ1A 1RK8A 1X0FA 1VQ5S 2DITA 2X1GA 5GAEU 5DDRC 1WF1A 2QEXS 3PIOQ 3DXBA 2DISA 2ZJRQ 3K0JA 2MKCA 3NNHA 2DNNA 2DNYA 1OPIA 3CF5Q 2MB0B 1Q82T 4TLQA 1A9NB 2V94A 2L41A 2WBRA 2DGOA 3THTA 2LMIA 2M2BA 1S72S 2MZRA 2CQ2A 2L9WA 2J0QD 3ZZZA 2MGZB 3CC7S 4YB1P 2DNKA 2CQ3A 3VAIA 2MJNA 1F9FA 2J76E 3JB9k 3CCMS 1X4CA 2N3LA 1D8ZA 1K9MT 2OJ3A 4V19X 3G9CA 4Y0FA 3UWTA 2KI2A 2B0GA 2DIVA 1U1QA 3R27A 4ED5A 3CC4S 2KM8C 1KC8T 2CQGA 2KM8B 2CPYA 2KYXA 1ZZNA 3VAFA 3G8TA 2QFJA 5LJ5Y 5DDOC 4J5OA 2MHNA 3Q2TC 1U1NA 1S79A 3S01A 4M5DB 3CCQS 1DHMA 2CQ4A 4CH0S 1FJCA 3VAKA 5IQQA 2ZJQQ 1QVFR 3MOJB 5LSLA 2DNGA 5JVGQ 2XNQA 4YUDA 4CH1A 1SJ4P 1HD1A 2VODA
chains in the Genus database with same CATH superfamily
2HNYA 1NAQA 1WG4A 2I0XA 2XBPA 1UWBB 2EBEA 2ROGA 4O0NA 4WYLA 2BRLA 4OYXA 1EIYB 2XNRA 4ZLNA 2DNQA 2DCUB 3NNHA 3P5BP 2VDIA 1TL7B 1DQ8A 4PUOB 1Q0NA 1ICEB 1TKTA 2E5IA 2EK6A 3EJMA 4IH7A 2BA9A 1U1MA 2G9OA 2NPFA 1OWXA 3FK4A 3NAIA 1TKXB 3M8WA 4JV5F 2F1FA 1SPBP 3HVAA 3LF0A 3TJ9A 1U0HA 1NK6A 5EX0A 1CSJA 1TTHB 4RLEA 4I6AA 3SCJE 4EBDA 1VQ8S 4HKQA 3HVTA 2WVBA 3CCUS 1Q1KA 4CO3A 1IBKF 1CVJA 5T41A 4K8RA 2ASYA 2OPSA 4LUBA 3L7UA 1IR2A 2VQEF 5KFEA 2DYAA 4ZOSA 2HAIA 4M95A 2HVHA 2RJZA 1T3OA 2Z56B 2YWEA 1OY9A 3PNIA 5EX3A 1M5VC 1TV6A 2R8JA 3QLHB 1NB2A 2Q6CA 3N6LA 4ZA1A 2YBVA 3R97A 1DLOB 3EZ5A 4EBCA 3PX6A 3AJ2A 1D8YA 2GZOA 4M5GA 1VQ9S 4X4OA 3M8PB 2IM1A 4K4WA 1Q4RA 2HNDA 2CPXA 1QVGR 1UZDA 4QWAA 4YQWA 5JJBA 5KTQA 4ER8A 2EC0A 3IMQJ 3LTOA 5D78A 1K47A 3FFIB 2F9JA 3H90A 2H51B 4TU7A 1NRKA 2B9XA 1UW4A 4J9UE 4IDKB 2MKSA 1Q7YT 4ECSA 4P7VA 1QAJA 3FRYA 2ASLA 2CZ9A 3SFUA 1FXDA 3LO3A 2HFVA 3OXFA 1UVKA 3G6ES 3SQGA 2RILA 3MAAB 1YBUA 2RDDA 3HHDA 4RU2A 2LXFA 4ZVUB 2AYBA 5HJXA 4IQMA 5EHHA 1S0OA 1AXQA 1QAXA 1O5JA 3PEJA 3FQKA 4Q2LA 2EG2A 2BKOA 2ZVSA 4DCJB 1FDAA 1FRIA 3EGWB 2BZ2A 1WWHA 3M4XA 1VS3A 2KKHA 3IR6B 2YWGA 2H5EA 3MPDA 2XB2D 1LOUA 1NJYA 2UVVA 2A3JA 3M8ZA 3H40A 3KFWX 1SC4B 2XY5A 1C1CB 4QIFA 3ULHA 3LP1A 4UZCA 4P52A 2FHJA 3BR9A 4ZMMA 5HJYA 3RTVA 3ADAC 3HSJA 2XSJA 1YBTA 3M8PA 3DLKA 3U1MA 2EC2A 2Q79A 2O3DA 2IVYA 3LGNA 1B70B 1RAOA 1UPMB 4KC5A 3THVA 2NSCA 1R8AA 1N6QA 3JAMY 2CPIA 4WBFA 3EXYA 5B0BA 1FT8A 4RPFA 3G71S 1QM9A 2H3EB 2UUTA 2LXIA 2GJFA 2W2NP 2G2ZA 4G1IA 2D3O1 1RWMB 1FO1A 2OELA 3VWSA 3BO2A 1N5QA 4NA3A 1ULRA 2NXJA 2YKAA 1BE4A 2ZITA 4NMXA 2OPQB 4WE1B 2XS2A 2HFUA 4NLQA 1RKIA 2AZ1A 1RQ0A 3KG4A 4OYPA 3HO1A 1IWGA 1KS2A 3R2DJ 2IAJB 2G1HA 3MEEA 4DN9A 4YOEA 4CO1A 1FWKA 1XJWB 1R0AB 2VPWB 2BUNA 3MMCA 4Y28C 3R7SB 2EBGA 1CJKB 1G4CA 3TJ8A 3MURP 2DVIA 3KMQA 1U26A 2HBRB 3M6XA 4YN3B 5F8IA 2RDJA 1FNXH 1TAQA 3O3LA 1TUVA 2YKQA 4A8OA 2J9DE 2D3ZA 2XSJB 5D77A 3R5DA 4L3KA 5DDQC 5F8LA 4O0IA 1NKBA 4LR7A 5DZ7A 2HQCA 4KGZB 3OTBA 5LXRA 2HNYB 4ZCLA 3CCVS 4B9SA 2RNEA 3I82A 3CCLS 1B3TA 1UEUA 3CD5A 3N6NA 1EKRA 3WBZA 2CRLA 2IM2A 4JUZA 3SCKE 4NI2A 1RKJA 2JEJA 4QYRA 2IVMA 2XMUA 4DV7F 3MM7B 5LMUJ 2M3DA 4F4KA 1ZAVA 1S6PB 3MMAA 2XMJA 2C2KB 5KG4A 3V6JA 3FC9A 5KFXA 4IG3A 2CPDA 4PWUA 1TUWA 3RB4A 1VRUA 3L95X 4PG7A 4RBUA 5ETNA 1B99A 3Q86A 5ETMA 2IM3A 1UCNA 3FBFA 1TFWA 2KFZA 2GX8A 4ALZA 2PSZA 4I0WA 4O4RA 4BCAA 3V81A 5B0DA 3I55S 3P5TL 4LFCF 3RGIA 4A8FA 4LQ3A 2OEMA 3IWNC 3K5LA 2FJVA 4E98A 3RB0A 3FFIA 2E29A 5E3CA 3PR4A 3MR3A 4DV0F 4X64J 3SQOP 2ZHOA 2OMOA 2X1BA 3KHGA 2CNLB 3MTJA 1C4AA 3SI8A 4LF8F 2JVOA 2P5VA 3CDEA 4X66J 4X64F 2Q43A 1ZPVA 3NGUA 2GIFA 1UVIA 4PWDA 4GKKF 4QW9A 3V4IA 4DPYA 4HACA 3BM7A 4WKRA 2F7VA 2A6OA 1TQLA 1Q78A 4I1TA 3N01A 3BYRA 4WP8A 5A8WB 3J81Y 3KK1B 1FVQA 4LVNP 1TUGB 5KFWA 2F4VJ 4CWBA 2XM3A 5K5MA 1GQEA 1P1LA 1KOHA 4ICLB 2H54B 4LRAA 1FF2A 5A0YA 5LSOA 3NRBA 2MQOA 3ZZPA 4QQBA 2Y8WA 1REVB 5DDPC 3DOMB 1YJWS 9RUBA 1EB0A 3SDEA 5D4LA 4A47A 1MG7A 5MAOA 2W4CA 4ATNA 5BYSA 3KLFA 2OPPB 4TY8A 4PQUA 3NGRA 2QZ8A 3TUIC 3M05A 3PW7A 4MIBA 1ZTWA 1TMMA 1V3SA 3NOGA 3TWZA 1F2GA 4CQ1A 1F3FA 4EBEA 4Y2MA 3DOKA 2PFDA 1UWBA 4OJ1A 1BQNB 3H5XA 1LWCB 1FJEB 2Z57B 4ED7A 1HBNB 1XN9A 4O44B 3H4DA 4LFCJ 2ZHAA 4FYWB 3VZHA 3W66A 4OZ5A 1ZM3A 4X84A 3QWPA 2FLPA 3GFZA 2LVWA 1D9AA 2JNJA 4ZLPA 2HBZB 4NMLA 4F8RA 3CT9A 2DGTA 1NUEA 3TP2A 4ECWA 1T05A 2EFOA 2OPQA 4CM0A 3M9OB 2XY7A 2NQPA 1WEYA 3GTYX 3K8WA 3KLHB 3HJFA 4N47A 1UMJA 2LYVA 4LVOP 1IKVA 5CZXA 1M5PC 4ILRA 4WWSA 4QR2A 3BV8A 4DMZA 1M1GA 1H72C 2AD9A 4HR2A 3M32B 1RACB 3BN4A 3GCXP 3HLUA 2MPUA 1HMVA 1SL2A 2ZZNA 1FKPA 4FNHA 4YR0A 2XO6A 2MQQA 5L46A 3NGTA 5MLCV 1T03B 2A0FB 6FDRA 3FMWA 4LREA 4ZPWR 1TVRB 1IBMF 3EWGA 4NE9C 3CULA 1OQ3A 1YZ6A 2W7PA 2UU9F 1OSCA 3BSAA 2OPRB 3D66A 4M5NA 4IO9Q 2HNDB 3RU0A 2W9BA 1Y9OA 2BBEA 3IA0A 4ID5A 3FNNA 2AEJA 1S10A 1Z1ZA 1G1XA 2PD1A 2ADCA 1DTTB 1XBWA 1KVJA 2ACYA 1S97A 2HS0A 4USTA 3R1HA 2QJ3A 2KXNB 5E0OA 1OIAA 4TU8A 4L72B 2COLA 4KFBA 1SH2A 3M8RA 1L5UA 2PO4A 2J6TA 1HR0F 3D3BJ 3MMAB 2MQLA 1X9MA 4MKVA 1X5SA 1GK8A 2WONB 3MD1A 3UDVA 3QJPA 3PRVA 3TANA 3TAMB 2IA0A 3I31A 2LQBA 4QZVB 5AXLA 1UFWA 2XMAA 4KR0B 1VCTA 1WHVA 3WDOA 4DL4A 4JI4J 1RTHA 4DI6A 3RW6A 4LQ9A 2RH3A 4N8OA 1RTIB 1WC1A 1VGYA 3CSKA 5F3TA 1RYRA 3DLEB 4HL9A 3PTWA 4R5PB 2VBZA 2B7BB 3PDNA 1T7PA 3NOCA 3DLKB 3CDAA 2W8LA 3O6QA 3MUVP 1AA1B 4DR7J 4B3OB 3AD9C 3QPIA 4O3SA 4OYMA 1ZH5A 1HI8A 2EEYA 3R7BB 3D3CJ 5IOLA 1N88A 2JC1A 4Q43A 1F3VA 2B51A 1X8DA 3CJ5A 4X4PA 2K2PA 2HMIB 3DOMA 3IXQA 3US5A 3H98A 3MWBA 2NLWA 4WFNQ 4NLPA 2R7QA 3A8JA 1L3UA 4K4YA 3RW7A 4ED3A 1RT6B 1H2UX 1IBKJ 2HRYA 5E3QA 3TZWA 3T1YF 3PZPA 1VLYA 2AV5A 1GEHA 4K4XA 3S6EA 2UUCJ 1GMWA 3U1LA 1JLFB 1UTAA 1KDNA 3NBPA 2XZDB 1W2BR 3MECA 4QYZJ 2N4CA 2PMWA 2F40A 1C0TA 1S7HA 2V9WA 1S1TA 1HKAA 2POKA 5JXSA 1IKWB 3FUYA 4PKDB 3ZZYA 5KFLA 5K8PA 1VBKA 3A1YG 5IV3A 2ALYB 1JLAA 3M6UA 4EUVA 2OO4A 1P27B 4B3RJ 3IG1B 4HH1A 5CYQB 1DBDA 3DU5A 5LL6d 4LF5F 1TL1B 2PA3A 4LF4J 1CC8A 4FF2A 4NLUA 2GMJA 5KG0A 2PEHA 1XMQF 3R9LA 1HWUA 2AJFE 1M5HA 2VFTA 1VRUB 3AHPA 1W26A 2AEMA 2D7SA 2IVFB 3SMZA 3SQGB 5AE2A 3HF5A 3PV8A 4CNZA 2BJDA 1F2HA 1H38A 1RHRB 3I4PA 2DR8A 3OR2B 4DR1F 2LECA 2DNHA 3M2RA 2VBWA 3PYFA 4JI1F 2H4WB 5HVGA 3C2PA 1RHMB 4E8UA 2QX0A 4LF7J 1AZSB 4ZJLA 5EWGA 2CADA 4E2FB 3E51A 2PMZD 4LSNB 2AJ1A 4USKA 5L9XA 2MKIA 4PXDA 2W2MP 3NCQA 1FHTA 2YX7A 3KG0A 3I5AA 2W25A 4QIEA 4QJVA 4Y65A 4LIWA 3MUMP 3Q8RB 3DYAA 1SUQB 1QAIA 1WORA 2B8QA 1F60B 2NZCA 4M5HA 3T6JA 4DV5J 2FHJD 1GFWB 2MSSA 4FNIA 4IRDA 4HHJA 4A8MP 1S0NA 1CJVB 1JLQA 4DR2F 2MQNA 1ELOA 4AUKA 1SL0A 4JI7F 2CJBA 2E5HA 2IBOA 1F5CA 2JEGA 1RYSA 2GO8A 2M8HA 2XZWA 3PW4A 2UUWA 5HP1A 4KIAA 1SJ3P 4UY85 3QJLA 2FJDB 1NHVA 4QPTA 4OZ3A 3I0RB 1H6KX 1VLOA 1JKHA 5ETSA 5G4DA 3VQSA 4B9UA 2OTJS 5DJBA 1SIWB 2VG7B 3HI9A 3KJNB 4M5IA 2DK2A 2XMVA 1XNQF 3LALA 1VQPS 2ILYA 3W60A 3X3UA 3KLVA 2IMOA 1Q86T 5DG7A 4DV1J 5AJ3J 2ZEJA 3EMTA 4JI8J 4H4OA 4NEYA 4DV0J 3CD7A 3FSIA 3GSDA 4URGA 3ILIA 1HBMB 2XEXA 2ZJPQ 2L08A 4LMZA 1I51B 3HT0A 1ZS6A 4AQYJ 3EE3A 3KOAA 2JZ5A 4ECVA 3OV7A 5FD1A 3ZTSA 1X31C 4DR1J 3AA9A 1JJHA 1RT7B 2YH0A 3ILOA 3M2UB 5K8NA 5H1SV 1X0PA 3BO4A 4ED0A 4X4TA 4ZVFA 1YJVA 2F8EX 2NXCA 4A8YA 2YTCA 3G6VA 3OW2R 4JI8F 4F67A 4DV7J 3CCZA 1NK4A 3H4BA 1VI7A 2HRTA 3NNCA 1NZAA 1RT6A 2WB4A 1NPRA 1S12A 3BSCA 3PR5B 2WSCC 4DPWA 1JK9B 4OJ3A 3SFGA 2AX1A 3B54A 4B17A 5E3RA 3OLAA 4I7FB 3K5OA 4ZPTR 4R8UA 4A8SA 3GJRB 4GC6A 2F4FA 1GXTA 4WYWA 4ES3A 3P4UB 1VQ5S 4JI0F 1HNXJ 4F0HA 1IQZA 2DITA 2IM0A 3EUNA 4YY3J 4X65F 2GVZB 5GAEU 4KHPF 1WF1A 1Y5IB 2ZVIA 4OHZA 2BABA 3BGFA 5A6WA 4ECZA 2XMMA 2YQ1A 1JQGA 1JLBB 3N28A 3HULA 2H5JB 3D6MB 3KLGA 2Q66A 2MKCA 2HHVA 4FPIA 4P2SA 2DNYA 4UT4A 1OPIA 3TUZC 3CF5Q 1ZETA 4RUHA 3CO0P 4C97A 4F36A 3T9ZA 4TLQA 2H5IB 3DU6A 2UZAA 2V94A 1GXLA 1C1BA 4LBIA 4UW2A 3ET6A 4ZP7A 2C2EA 3UR0A 4C9DA 3TAMA 2Y0SD 5F41A 1B0TA 4I7FA 2V67A 2Y1RI 1MN9A 2OUGA 4PG6A 5I3PA 4ZDNA 1T11A 1T95A 2MZRA 8AT1B 4ANEA 1YLXA 2MGZB 3H42A 1E6VA 2DPJA 1CBKA 4DU7A 4X4VA 2X51A 3DI6A 1HHTP 2HVIA 2DR9A 5AE3A 3BPDA 3R3TA 3DOLB 1UEKA 2Y1LB 3A3PB 1F9FA 2J76E 4OYZA 2RIJA 3C66A 3MCNA 2GGPB 2QA2A 1UEVA 1D8ZA 2IYGA 2HQIA 1Y11A 3CO9A 4FYVB 2V34A 1RT4B 2LDYA 2IC3B 1RBAA 5EDWA 1NK8A 3G9CA 3NGSA 5ADZA 4MK9A 4U7UD 1LWEA 1S6UA 4NZ6A 2DIVA 2HHPA 3UDCA 3CC4S 1RXOB 2BE2A 3JS9A 3AFGA 4P72A 2V50A 2CJQA 2QYCA 3W2VB 2P8IA 3PJWA 3ZTRA 4RW6A 3G8TA 4CNYA 5KFMA 5DDOC 3VAFA 4J5OA 2MHNA 3BB5A 4U9RA 1S79A 3U7JA 4C0BA 4ZIWA 3FDSA 4TQRA 4DLEA 4OI0A 2R7UA 1MSWD 2HKEA 1SC1B 1IKVB 2QT7A 1R7IA 3FBBA 5M2UA 3J80Y 1HHSA 1UETA 3UQSA 1KTVA 3SBMA 2ZJQQ 1FX2A 1RE1B 2CAJA 3C6UA 4CM2A 1QVFR 2CVEA 2I9SA 3WQPA 3ZFVA 1BQXA 5J2PB 3IAM9 2UUBF 4CH7A 2XNQA 1I94J 5HQMA 4CH1A 1BUXA 3M32A 3JAMU 1Q8KA 3GYNA 4RKUC 4TQSA 2UXCJ 4X62F 4Y2AA 5LXYA 3BSNA 4DS5A 1HBMA 4NCAA 2XHWA 3CUNA 8ATCB 5CD4H 3SCLE 1KKHA 5HBMB 3T5KA 1FWPA 2QSWA 4U8VA 1SH3A 1K1SA 2N7CA 3HHEA 3M2VB 5I42B 1WC6A 3OVBA 2J7WA 5CABA 3U02A 2VPYB 4NLWA 4A4JA 3HCXA 1MN7A 3PO4A 4P2XA 4K0KJ 2BMBA 2KT2A 1R43A 4DUYJ 2ZE2B 1B0PA 2ZNZA 4YR3A 1YITS 1EP4B 2JWNA 4KYZA 1TKXA 3ITHB 1NU4A 5GAGU 4N41A 3UDLA 2FVQA 1XMQJ 3HFKA 1RHJB 2VC0A 4RUBA 5C2GA 3OJSA 4RUAA 3RBZA 3TARA 1HNVA 3R1LA 4KHRA 3K8VA 3KLEA 1S1WA 1Q8BA 3CJ8A 4ECUA 4CYUB 5DGAA 2R7VA 1LFWA 1UPPA 3W65A 1MNEA 5IT4A 3QGIA 1OY6A 2YX1A 2PI5A 1KNZA 1O0PA 2GVDB 4TY9A 4WJBA 4X4UA 2J9DA 5M2RA 2ZBIA 3SDEB 4YHHF 4ZP9A 1IKYA 1PAEX 3DYAB 4ED8A 3MAQA 2F5GA 2LA6A 4CLWA 2BJ9A 2DGSA 1RHUB 1PGZA 2EW9A 4F25A 4KO0B 1BXNA 1UKUA 3JYTA 3ONQA 4CLPA 2B8PA 2WVEA 3DKDA 1EP4A 1XR5A 5IC6B 2JRSA 3DDNA 3C16B 2ZE2A 4DWIA 4H4KC 5H9FK 2DO0A 3DGPA 4DSJA 4BWMA 3C14B 4P2FA 3BDPA 2CQHA 3PW2A 1YHQS 4CRJA 4KRWA 2XCAA 1U8WA 1FFSB 2HYIB 2KTQA 4DQQA 4NLGA 4YFUA 1CJUB 3ZZRA 5B0EA 4JV1A 1YJTA 2DTJA 2FC8A 5DETA 1EKSA 3D6TB 1RT5A 3ISZA 1R27B 3UPFA 4IG3B 1JJ2R 4DR5F 3TVKA 1TL3A 3DDKA 4KH0B 4MTPA 4OLPA 4YDXA 4CT9A 1Q5VA 1NDLA 2HGLA 2FDNA 2VB6A 1NCLA 3N4WA 5HROB 5F0UA 4RW9B 4OYIA 5J2MA 4C4WA 4LRCA 1PG5B 3I9V9 2BW7A 3HMJG 2Y8YA 1OQ6A 3KHLA 1HPZA 4PQUB 2E7WA 2ZH8A 1WC3A 2JL9A 4YB6A 4U96A 1D09B 3KDNA 4ZPDA 4DV4J 3M30B 4DUYF 5E5NA 2ILZA 3MCSA 5A76A 5J2NA 3BBBA 5G0RB 4QCLA 4JV5J 3QFHA 4O23A 1VDHA 4RW6B 5D4NA 3UO0A 2MKJA 3UVJA 2C2RA 2CQIA 5B08A 2E9RX 1NLKL 2BE2B 3AT1B 3HSDA 3MMBA 4WK1A 3JSBA 4DV4F 3M6WA 2CDRB 1SKSA 2VFUA 2C28A 4HTIA 5E2QA 3DLJA 3VGVA 2MLYA 3LANA 3O8WA 1TKDA 4OHYA 2XY6A 4WFBQ 1FFGB 4ZPCA 2KVIA 3A8EA 3MEEB 3BO3A 2P9EA 3HKWA 4IOAQ 4K4VA 3J80U 2J8SA 4WXOA 3OUYB 4ED1A 5FDLA 4KGXB 2H1YA 1YI2S 1SKWA 3S1TA 2DNLA 5A8KA 4LFBJ 4NZ0A 3IS9A 3OR1B 1S5ZA 2R4FA 3DLEA 3F56A 4KFBB 4CI0B 3GG0A 3C6TB 4CTAA 1FA0A 4M1KA 2NR0A 2DGUA 2VASA 3GP9A 2FLOA 1VBXA 2AWZA 2XYGB 1K44A 1VQMS 2R7TA 4EEYA 3QMQA 4UOHA 4ZCMA 2W8KA 3EYZA 2E1PA 4R8UB 3CCWA 3CC2S 1VRTB 4KHPJ 1JLBA 3NG8A 1SBRA 2NREA 4OZ2A 2P6SA 2MKKA 3KK2B 4V19J 2CJXB 4JP8A 4DQRA 5KFPA 4F2SA 1HI1A 1NO8A 3D0GE 1MWQA 4ZVTB 5DM6Q 4HYKA 5HMWA 1I6JA 2KFNA 1KSPA 1C0UB 3J7ZT 2X3DA 3SYZA 2BE9B 3QT6A 4ITSA 1N56A 2HHWA 3PACA 2HPUA 3PJXA 2RQ4A 2V69A 3D1OA 2VG5A 2AIRB 2CNOB 4NXMF 1YRTA 2HG4A 3L09A 3MF5A 4MYTA 3DLHA 4F50A 4I69A 2OP5A 3D0HE 5A8RA 3OFGA 1WSRA 1RDRA 1VFJA 2K1RA 1C1CA 2CNKB 3PRBA 3OTDA 3FVYA 4XPCA 4N56A 2DNOA 4O3QA 3R7NB 2A1BA 3KLHA 4W92B 1WELA 3LWLA 1SVDA 2VOOA 4I67A 1T03A 3G82B 3U27A 3GILA 1RUSA 1N36J 1S0VA 4AQYF 2AU0A 3MFHA 4MK8A 2J0SD 3RAXA 1PCAA 3VV2B 1Y00A 2B6AA 5K9FA 4QU7A 5SZTA 2RMLA 4USUA 4ZVHA 1DJ0A 1EARA 1FRHA 4JB8B 1O51A 1X4HA 1YJRA 1UWAA 2HZCA 2KB2A 3B4DA 3NXZA 4USJC 3ZXWA 5HVHA 1RWPB 2CG4A 3Q8PB 3P49B 2DBBA 2B43A 2V8PA 4IFVB 2HFOA 2ZH5A 2CZ4A 2AF6A 2L9DA 2ASDA 3C14A 5LMNJ 2R7SA 3DGPB 1WOOA 1PBUA 3GYXB 4ERDA 1HQUB 3TA0A 2J5AA 5KG3A 1AUDA 2IA6A 4C98A 4F3OA 1HBOA 1G2EA 4DU8A 2AGQA 2GHPA 2DH7A 2E1AA 3I5BA 3ISND 2GJIA 5T14A 1S1VA 2DPIA 1BWVA 2PDAA 1NJXA 2R7XA 2QMXA 4IO1A 3VGTA 4XPEA 4DV3J 4DR2J 4DF4A 1DRZA 2MKHA 4CLUA 4FF1A 3T1YJ 2H4YB 2GIQA 5HMZA 1NZ8A 1X5PA 5A8WA 4U7CA 3KK1A 2VQFJ 2HHHF 3GR1A 5SUHA 3ENAA 3KLFB 1RGVA 2E5LF 4C3KA 3ZC4A 1RAIB 1NKEA 1BQNA 4C3MA 1RHKB 1O6XA 1FRKA 1NHUA 1HWIA 4K2XA 2VKRA 3M2RB 4W4MA 1VHFA 2UVRA 4ES1A 4IYQA 4G3IA 1BY9A 2ZZMA 3C19A 4DN0A 2EI5A 1ZM9A 5HMXA 3DRPB 4F26A 4CDIA 2N3OA 5KFAA 1F1BB 3EXCX 3PG9A 3S8SA 3HD1A 1JLQB 1SJQA 2AZ3A 3FEXB 4DR7F 4WP3A 3RZAA 3HHKA 3MR5A 3LAKA 4EI2A 1NKCA 1LW0A 4KGKA 4KKOB 2M70A 1BMQB 2RU9A 3ZO7A 4JI3F 1QJHA 2BJ8A 4CO0A 2GNKA 2KN4A 4AFFA 4P9SA 5K14A 4Z7CA 3UCZP 1DQ9A 1QAYA 3VF0B 1FE0A 5IWAF 4WIIA 1Q16B 2W2QP 3QIPB 5J1EB 4QWBA 1WHYA 3T1HF 5L1IA 3UCGA 4MT1A 3I9ZA 1QTMA 1NJIT 1TAUA 3AJ1A 3MECB 4DL6A 1TZ0A 3NBPB 3HZGA 2KZMA 4OLOA 2HVZA 1FK9B 3MM9A 3HDSA 4RNOA 1NDCA 3BS9A 4ZPVR 1IKWA 3AOBA 2V4QA 1VC0A 3RYLA 1GT8A 1X9WA 3UR3C 3NY0A 2JHEA 1WSVA 3CD6S 1UW9A 2W01A 2IRUA 3D6HB 2DNZA 4OHXA 2OD4A 7FD1A 2MQ8A 3MR2A 3V6DB 1FE4A 4UQTA 5HN0A 2F4VF 1JLAB 2M0GB 2I38A 3CNQP 3EVMA 4ZVQB 5HI7A 3I4HX 5DQHA 3GV5B 3CMQA 2E1CA 3KNAA 4ELUA 4HHUA 3M1VA 2KYZA 1SV5A 4LBPA 3TNVA 1ZZFA 4DZDA 2IY5B 2C22A 2D74B 2JX2A 1N5YB 1BQMA 2OTLS 3MM6B 2LQJA 4JV2A 3K89A 5KFCA 1CJKA 1HWJA 1SXLA 1XC9A 3DHXA 1AZSA 1FRJA 4J91A 1TK0A 1G7CB 2J0XA 3FEZA 2U1AA 4OZJA 2FGCA 1DZ5A 3L3CA 4C8YA 1FXLA 4C0OC 4RBVA 1VJQA 3C46A 2BW2A 2Z2YB 3EICA 4I2QA 4QW8A 3CEDA 1XMOF 4NX9A 5DM7Q 1XR6A 3FRZA 1XK8A 3H2LA 1CJTB 2HMIA 4PZVA 2M9KA 3VALA 2FTRA 2QLXA 1UJ4A 1A7GE 5M2PA 4DG1B 2LEBA 3SXLA 3D68A 2J0WA 2E7XA 2W24A 3IM8A 5IWAJ 4NLOA 1RZMA 1FFWB 4Q2MA 5DQGA 4FF4A 3DN9A 1NSKL 1T9TA 4WIQA 1TR0A 4CLKA 2UUCF 2YQ3A 2XG8A 5HVFA 4C48A 2KHCA 3NEKA 1OO0B 5KFYA 4USWA 2ROPA 1UAWA 2ZH9A 2R42A 3D0IE 3IGVA 5AT1B 4K7QA 3CDBA 3ILLA 2J9CA 1S48A 3AXMA 4JI7J 2APOA 4FXVA 4X65J 4O3RA 1HMVB 5T7LA 3J7A1 2OPRA 5KT4A 2R7WA 2YX4A 3G86A 3CJSA 4GKKJ 4ZIVA 4I6YA 3IRXB 2QMWA 5LSRA 1U1PA 2AT1B 5L1KA 5FIIA 3TQEA 1S6OA 3RRGA 2E9ZA 1WF2A 3TYTA 4JI2J 5FJ4A 1BGXT 1R8CA 3DRRB 5GVQA 3RRKA 2BOPA 4WTYA 1SL1A 2IHR1 4QIGA 1C0UA 3W5XA 5KFFA 2MY8A 3Q24A 4FDFA 4BWJA 3J7Z5 1RAEB 4M5DA 5DS7A 1YX2A 1SH0A 2RB7A 3GJSB 1RTJB 3EGNA 2DY9A 2B3TB 2ZDOA 4RW8A 1X7VA 2KHDA 1T0TV 3ZNJ1 5DGBA 2AGPA 2GIRA 2ZZTA 5I4MA 1OS5A 3QRQA 2FPHX 5L1LA 1OPZA 2R2RA 3LWMA 2G4BA 2XMKA 1ZPWX 4PYAA 3TO8A 3PYGA 1B7YB 3HX9A 4KH1B 1OY8A 4OJHA 4WU2A 4Z7YA 3WZ0A 2MZ1A 3KYLA 1AW0A 1WUUA 4PXCA 5B09A 2BJ3A 2V4RA 1HBUA 2DD8S 2QMUB 2OGUA 2F8MA 3T9NA 2Y9HA 3OT9A 1V6HA 5DRKA 5D0RA 2V63A 2HIQA 4CLZA 2DGXA 4OYAA 4DOZA 1XWLA 2FGOA 2JEFA 1WC0A 4MKYA 2K7JA 2CQCA 2M7SA 1JB0C 1GTEA 3BR8A 4Y2KA 4OI2A 3ZTQA 1PYSB 1CC7A 1YJNS 3HFZB 1M5KC 2V8HA 1OMSA 1EHWA 4LBHA 2XWYA 2D3UA 1AYEA 4WKYA 2DGWA 2LQ8A 2YH1A 2FUG9 2K8GA 4YB5A 5HSPA 1N34J 1EX8A 4NYOA 5C24A 3V2UC 3BDEA 5ETVA 2X1AA 1RA7A 1FKOA 4UF4A 3ISNC 3V6HA 4DR6F 1N32F 2VZ9A 4U95A 1O8BA 3NMAA 2JH3A 3K7RA 3BGOP 2RUGA 1VMBA 1ZA1B 4O3OA 4A48A 2ASJA 3MM6A 4OYWA 1HNZF 3EGZA 3LH2S 3PJ9A 4TU9A 4GMKA 1VISA 4R0JA 3ETMA 4PAAA 5AXKA 2HEKA 1FESA 3V81B 1U7LA 2E44A 3S7RA 2QN6B 1XTZA 3AB4B 5H9EJ 3CVKA 3LW5C 3HK2A 1IKXA 1VQSA 4KGMA 2RE1A 1LW2B 3E3XA 1TKZB 1IR0A 1X60A 1E6YB 1UFLA 2HVDA 3EM1A 3FEYB 3LGMA 3UE2A 3W62A 4DL2A 3G8QA 1X4DA 2HGMA 4QIVA 4ZHRA 2FVPA 2YWKA 3PYDA 1SQGA 1CQMA 4B3SJ 3O2IA 1N52B 2BACA 4MK7A 2XQCA 2P9GA 4ELTA 3CTRA 2BR0A 4NXNF 1RWXB 2IYIA 3WX4A 5KFNA 2E5JA 3H59A 2HHUA 2HHQA 2HFNA 1J2VA 5BR8J 4J9KA 4EYHB 1EQ0A 2DGQA 4USIA 4P2MA 1U6ZA 2WTFA 2IC3A 2V68A 2YWHA 3EVWA 3I56S 1SKUB 3LP2A 3HP6A 3HVRA 3Q23A 3IWLA 2YY3A 3LUYA 2HK3A 1H7XA 2C1EB 2JOQA 3DRYA 3ETOA 5B0CA 3G96A 1VQ6S 1KLMB 2WCXA 4ANDA 3G4SS 4PQAA 3K2YA 2DXDA 4ENOA 3VVUA 4BC7A 3PKYA 5C24B 4IQXA 2DB1A 4QWEA 4B3SF 3OVSA 4ILLA 4DHVA 3CDUA 4LRBA 2W1BA 5ETOA 1A0OB 3GV8B 3GWCA 3AAWB 2JJ4D 4LRFA 3GZ7A 3HVWA 4GVLA 3OBIA 2V0NA 3UFCX 1ZTTA 4YP3A 3DXBA 5DLGA 5AXMA 2NUHA 2GAGC 4M5MA 4HTJA 4DR4F 1S49A 2FQQB 1EZZB 3MPUB 2D69A 3JQMA 4NI2B 3RBDA 1RTDB 1YJUA 3QO9A 2LU1A 2QLFB 2WK4A 3I6PA 3IR7B 4I4BA 3OFEA 1IM6A 3ITHA 2FB0A 2W7OA 2HWTA 4IRCA 1CJVA 3RBXA 1FDDA 4DX8H 3RG6A 1OSDA 3M9NB 1HQUA 4DV6J 2GQQA 2ZBPA 3Q8YA 2ABYA 1UVNA 1KR4A 1HNIA 1T3NA 2HSEB 2X7IA 2XMTA 2WBRA 3OFHA 2EFPA 3CJQA 5I3QA 1LK5A 2QL7B 3M2VA 2JFDA 3D28A 3KKFA 2LP4A 2FJXA 1S72S 4KAIA 3IBFB 4N7TA 1MMNA 4DX5A 4NLYA 4RW8B 3TA2A 2J0QD 4JI5F 1CULB 2Z2ZA 3T6BA 1ZBTA 2O1PA 4FS1A 1CG2A 2JLFA 2NPIA 4I64A 3JQJA 4ECYA 1UVJA 1LEOA 4CTAB 2CQ3A 3DNCA 3VAIA 5KT5A 3CIMA 1MU2A 2JSXA 3JB9k 3H0PA 2V4JA 2YNIA 3KNGA 3GV7B 2R8KA 2VFVA 2G0JA 2N3LA 2V6AA 3TI0A 1HQEA 4FYDA 1DURA 2HQ3A 4TLRA 4ZN3A 1NBEB 4V19X 4MIAA 1VOMA 1QUPA 2KI2A 2B0GA 4OI3A 1ZAXA 3T5HA 1YQHA 1DTTA 3I32A 4FVCA 1KQGB 4P74A 4DSFA 1U1QA 1JNRB 1M1HA 2KM8B 2CPYA 3CJKB 5DG9A 2XLIA 3KMSA 1ZZNA 1GMWD 3Q2TC 2QFJA 2QL9B 5LJ5Y 4K4UA 2C3PA 1U1NA 1LWXA 4JI3J 3K5PA 4LFAJ 4OX8A 3ZTOA 4I2PB 1N5TA 3S01A 1KEKA 2AEFA 2CQ4A 4CH0S 4ECQA 5D8HB 4N8NA 1TK8A 1F0XA 4H4MB 3VGUA 4DQIA 3VAKA 3K5NA 5B0AA 1RWUA 2E9TA 5IS2A 4LR9A 2YKNA 4YUDA 1GX5A 1NK0A 1SJ4P 1R0AA 2QV6A 3SIPB 5KT2A 4LFBF 1FDBA 5U47A 4BBYA 2DHXA 2HQFA 1MMDA 2C2ZB 3A4TA 1HQEB 3CDWA 4C8MA 4C11A 4EYIB 3TUJC 2MKYA 1GMUA 3DLLQ 2E5LJ 1YDLA 2YNIB 3FSYA 1WG1A 3FBEA 3BBFA 1T05B 1S4FA 4RZRA 1V3RA 2DHSA 3W9JA 1NHKL 2FHOB 1HYSB 4R0EA 2MZSA 2BQRA 1R8PA 2YXLA 5GAHU 2VIHA 3ZZTA 3RBEA 2HQGA 4NOHA 2RQCA 4F2RA 2VFSA 4FXWA 4MKBA 4OZNA 3PW0A 2AGOA 3FGVA 1RISA 2QE5A 2HHXA 1GMVA 1P9YA 3IR5B 4MMOA 3OTOF 4ED2A 1R0BG 3OSNA 4DQPA 2IDEA 1RLCL 3DRSB 3TVYA 5A8KB 1NSPA 3KHRA 5A2QY 1BQMB 3G8SA 5L38A 4RNMA 3RR8A 3JSMA 2MY7A 2MQPA 1HNXF 1IKYB 3W61A 4FXDA 1RT3A 4ZVSB 3PFOA 2Q1LA 4M8LA 5RUBA 3Q8UA 5LMUF 5LM7E 4DL5A 2G1DA 3TOQA 3OHBA 1RP5A 4C8OA 1Y5NB 7FDRA 2HWHA 1DY3A 3A8IA 4GRSA 2PA8D 3MMJA 4CO5A 3DRXA 2CPZA 1T9UA 3RUBL 1WEXA 2NCKL 5HLFB 5C2CA 1KOOA 2BJEA 1VC5A 3AD7C 3OD2A 3UW1A 4JYAF 2QYGA 4X4QA 3DM2A 2P2CB 5JMNA 3L7PA 4HACB 5ITHA 1IXKA 1QD1A 1WKJA 3V4IB 2VUGA 3H5SA 2DXFA 2HAFA 1RCOB 2ZH3A 4KY3A 4KV8B 3IG1A 4B3MJ 4DSKA 1U1KA 1IVZA 4ZCIA 5ETPA 1CLFA 3KLIA 3MCOA 3DCAA 3E8OA 1W25A 4XO0A 4FVMA 1SIZA 2D9PA 3DMJA 2HRUA 2VG6B 3BEGB 3IAS9 5JVHQ 3RB3A 2HFZA 2XGQA 3VTIA 1HPZB 2KL8A 4PR6A 3M9MB 2AQ4A 1RHQB 1KQKA 2HHHJ 4RW9A 5J2MB 4FYYB 1EETB 4Q5VA 5J2PA 4DUZF 3THPA 3KJFB 4L76A 1U2FA 3QLHA 2FLNA 1TMJA 4C7QA 3IFEA 1TL3B 2KG0A 4DV3F 1RT2A 1TL4A 3BZQA 1N48A 2OHDA 2ZOMA 4ECRA 2G13A 2R8GA 1VK8A 1KFDA 2GA7A 4ANCA 4DSEA 2YKMB 2OAUA 2DEIA 2HBYB 1P9QC 3Q2SC 1M5SA 3ZZ0A 4LF9F 2GQ2A 3MFIA 2IFXA 2WRMA 3W1YC 4EGLA 4O44A 3SEOA 2E1MC 4RWXA 4ETZA 1LWCA 4A46A 5BR8F 4K4ZA 2AP6A 2YQ0A 1S76D 2WSEC 1VYAA 2ZBCA 3FZ2A 1S1UB 4OYBA 4Q7AA 5IC4B 4CYUA 4IUFA 1FI4A 1S1WB 2ZH7A 5EWFA 3GYGA 1KQSR 2B4UA 1MWZA 2K7KA 4EO8A 2IJFA 5FLXY 1R8HA 4LRDA 2MJUA 5HMYA 1FXRA 3PX0A 1E6VB 5EWEA 3R8YA 2VC1A 4K4SA 1G3OA 4OX6A 2OH2A 2KFYA 2WVFA 4ZP6A 3J7YI 2FZCB 3QSYB 4DBQA 4ECTA 1JXEA 4LSZB 4X4NA 1OYEA 2DIUA 5HQLA 4G1QA 1VBYA 2V8DA 2CXEA 3FMBA 4FKXA 2YKMA 2W2OP 5B7WA 4CO4A 1HNZJ 2J8AA 1Q8IA 2YPZA 3POTA 4UOCA 5IT9U 1HBUB 4B3RF 4G65A 1RLDA 2GCFA 4GC7A 5C25B 3DLBA 1MLAA 4J9VA 1YTYA 1D9DA 3TX0A 4NXMJ 1ACMB 1H0HB 1N54B 2LEPA 2Q6BA 2W2PP 1SC6A 3BGRB 3U1NA 1N6QB 3KK3B 4DV6F 2LFVA 2UXCF 2LXUA 3C6UB 1F5BA 4ZITA 4E0DA 3G6YA 1VBZA 2KRRA 3ICLA 4UOGA 4NL5A 1H74A 4J9PA 5HANA 4PPDA 2YNFB 3BQ0A 1HARA 2QGFB 5A8RB 4DFPA 5E41A 3TUPA 3SCIE 2VG5B 1S0MA 1XNRJ 2AYMA 4MFBA 2GS8A 2DRAA 4DXLA 1UJ5A 2QTWA 3Q83A 2GHVC 3MTKA 3G82A 4OI1A 2QLWA 5AE1A 1B7FA 1N33J 3V5RA 2XTJP 3QZ7A 3DM2B 2GHWA 4ZLJA 1R8BA 2HBQB 4WFAQ 1UVMA 3A3NB 2CJAA 3JTNA 5C25A 3O5TB 4ZVEA 1NB7A 4D3GA 1HL6A 3GONA 3GE9A 2RKIA 4UUWA 2FD2A 2NYHA 3NWRA 1Z2ZA 3GIRA 3Q22A 1MU2B 1WC4A 2K3IA 2DH9A 4QIWD 3HM9A 3QRRA 1LNQA 4Y2CA 3GB0A 4K5RA 4IDKA 1HNWJ 2EK1A 4FF3A 1HQ2A 3JXOA 1REGX 3IO1A 2YNHA 5CYMB 2GC8A 1U1RA 4ED6A 3QJJA 2UVUA 3IS9B 3OR1A 1RWOB 4DPTA 4B9LA 3N5FA 2ZD1A 3C8YA 1WDDA 2GV1A 3MGJA 5GADU 1NJZA 1RWVB 4AD6A 4DCOB 3IC1A 3BREA 3R2CJ 1X4GA 2V2ZA 3CD0A 4P75A 2MGZA 1KWMA 3PRDA 4C8NA 3H25A 3FSXA 2XZTB 1SQFA 1F6TA 4J90A 5CH7B 5CQGA 2QSFA 2XLJA 1ZAWA 1YIJS 2J6UA 2BEFA 5KFGA 2VJVA 1GX6A 3FCWA 2ZM6F 1NMEB 4TXSA 2AX0A 3H5YA 4J9MA 3A3OB 1F5AA 2RKIB 4URQU 1HNIB 2OKQA 2XMWA 1KD1T 2DNMA 1D0EA 1VRQC 3P3DA 1HI0P 2BKPA 1B0VA 3AY0A 1TP7A 2Z30B 1K1QA 4HI2A 4WFZA 2JDJA 4F02A 4DSIA 1BLUA 4RJVA 4DQSA 1UL3A 1NK9A 1KN6A 2EFQA 1T9VA 2NS1B 2FVSA 2OD6A 4K50A 4PWDB 1Q7LB 2DO4A 2BM0A 4MJKA 1S99A 1U48A 1TL7A 1L3TA 1T02A 5J2QA 2Z4PA 1XQIA 4OYOA 1PBAA 2NUUG 1XIQA 3N6MA 3LP0B 4NA2A 2JC0A 1RT1B 3H20A 4PXBA 3UN2A 4F4AA 2FHMA 1FJGJ 1WF0A 1HW8A 4I6WA 3VZIA 1FK9A 2D9OA 5KFBA 3M8QA 3WHIA 4DUTA 2HWIA 4V1Ak 3W9IA 5F8MA 3OR2A 1RAGB 3BH6B 3BKFA 4PCQA 3VQTA 5HROA 5KG5A 1HFEL 2RVJA 3ENWA 3UVJB 4NCBA 1X5OA 2XC9A 2VA2A 1JJCB 2F8HA 4CLTA 5GMKa 1U1LA 3LPEA 3KJQB 1RU2A 3KUEA 3J7YU 2HNZB 3QRPA 1E6YA 4QR1A 2BXJA 1X5TA 2BANA 3QYYA 2XO7A 1UVLA 2DGVA 2MZJA 2V4JB 1VHIA 2WBMA 3R6GB 3EDQB 3A8KA 3QT5A 2RRAA 3P45B 1YSJA 4YMEA 1JMTA 4YB7A 4LIRA 3HSGA 5KFTA 4K59A 1VQOS 3GPAA 1QTNB 2DH8A 4O4GB 2CFXA 3T41A 3RB6A 3HHLA 2VBXA 4AL5A 1RAJA 1KBRA 2VPZB 4YDDB 2X1FA 3LP0A 4K0KF 2WOMA 3I0RA 4RW7A 4LF4F 1U2RA 4EO6A 5F9NA 3W3SA 3ILJA 2MMYA 4KV8A 4LF2A 2RRNA 1XNQJ 1C2PA 2HGNA 2VBYA 1S1XA 1JLFA 2Y1IA 4Q8EA 2GMLA 1HLWA 1Y5LB 1FEHA 3TR5A 1L3VA 2KG1A 1IR1A 2CQDA 2I5JA 3DDIA 1YBAA 3Q8QB 2ZOGA 4M5JA 2C2OB 5ETTA 2ALZA 5D3GA 2ZH2A 2L48A 1S7IA 3DXSX 3QNWB 2YKPA 3CPWR 5LMNF 3GIMA 1Y10A 1MW7A 2GW8A 4F3QA 5H9EK 4OX9J 2CKWA 4OFZA 3UN3A 2UUAF 1VIXA 1SJRA 3MXHP 2DY1A 3T1HJ 2ZBQA 5DZ6A 1PJ6A 2AMCB 3TA1A 3E01B 4GKJJ 2BYCA 2R7OA 3QWUA 2DXEA 3NS5A 1I3OB 2W9CB 3NLCA 3GIJA 1X4BA 3H8YA 1TL1A 3R5CA 4DJBA 2QO3A 2QIFA 5CA5A 3EPIA 1XEZA 4BS2A 3VCDA 4Z37A 6AT1B 3JSMB 2B56A 1QUVA 4WP9A 2W9AA 4RW7B 5F9LA 1JWWA 3DRSA 3MPWA 3AJDA 3BGUA 5BYQA 3JTOA 5C5JA 1DQAA 3MDFA 4ZVOB 4EZ6A 2V5HG 5KFOA 1J27A 4Q45A 3CMES 2EG1A 3CCES 1KHWA 1FJ7A 3NS6A 4NLSA 2B9YA 6FD1A 1Y3JA 3I0SA 2CZVC 4WF9Q 4DFKA 4ZK7M 3C15A 1TELA 4P6QA 1WEZA 4IFVA 1UJ6A 5J1NA 4CLFA 2JVRA 5F8NA 3QATA 3Q8SB 1TKZA 2M52A 4M5LA 4DV1F 1EAYC 2FYXA 3ZNUA 5HLFA 4PYDA 1U6BA 2DT9A 2QA4G 2MZQA 2ZUGA 4N76A 2Z2LA 2A2CA 3PFEA 2BJ7A 3K5MA 2E7VA 3DRRA 3K59A 1NDPA 2F3JA 1TU0B 5K20B 4RUCA 4USVA 2LU2A 4WXWA 5KFRA 2ZNYA 3ENQA 2CQPA 2XHCA 1FJGF 1LV5A 2RS8A 1JLEB 4ECXA 2IPOB 5KFUA 4DV2F 5KG6A 4ZLLA 3LQVA 1Q53A 5D4PA 2QA1A 2C2MB 4LF6F 3BJYA 4IH5A 4F04B 2VQFF 2CPFA 1CQNA 4PWWA 2E5GA 4KSEB 5J2QB 3MHYA 3CJKA 2XYPB 3NNAA 1PJ7A 2QL5B 5E3AA 1FKPB 4KHMA 3RAQA 1PSDA 1V3ZA 1U25A 2A18A 3ZTPA 5JUMA 2UXDJ 5IM0B 3DI6B 4ZPAA 5EUHA 3FQLA 3GCWP 4RWWA 2PGCA 2U2FA 1MWYA 1PC5A 1WACA 3I87A 4RW4A 3C6TA 3MR7A 3PVXA 5L9NA 3UD3P 2KXHA 2PIIA 1HYSA 2P6TA 4P7TA 4DEZA 3VAMA 2CPJA 4G6VB 3QO9B 3AOAA 4C8ZA 4BLGA 4I2QB 4DL0C 2M8DB 1N5SA 4KGVB 1V5VA 3MEGA 3VHQA 2ZUAA 2C3OA 3DOLA 2P9CA 4MIWA 4DG1A 1VQ4S 4AYBD 3KUGA 4RBTA 2CA9A 2R8HA 3R5JB 4KBIA 1VK3A 2OEKA 3OL9A 4A8KA 3D7SB 3HZEA 2OSRA 2YNHB 5CYMA 2Y0BB 3FBCA 3UD4P 3QAEA 4USMA 3HXMA 1J5EF 2HLTA 4XAKA 2H65B 2LQ5A 1TKTB 2PC6A 2YVSA 2VONA 4EU0A 3GQCA 3FZBA 3K17A 2ZDPA 1U2CA 4W98A 4OZ0A 1J5EJ 3HJVA 2E66A 3MAHA 3QSIA 4L6V3 4C2MA 4DS4A 4ILMA 1ZM2A 2GVZA 4TY8B 2AJ4A 1R89A 1K0VA 1RTHB 3W63A 1U4BA 1IWAA 1Z2LA 2VHGA 2C3MA 3N9UC 2N4DA 2BOAA 3OHAA 3R5GA 2JLEA 2PEBA 3V4MA 4CO2A 1JX4A 2RHQB 3IM9A 3MM5A 5G0RA 4X2BA 3IRXA 3M30A 1Q79A 4DPUA 3SSRA 5BXIA 3FCHA 4PEOA 2G0CA 1M90T 1IBLJ 2UXDF 2RSQA 4YR2A 3MAAA 4NCGA 3V6DA 4NRUA 4WK3A 2O01C 1LFPA 2DHGA 2L3MA 2OFGX 1RAAB 4PG5A 2NXEA 3BGRA 5E3PA 4GO5X 4HHHA 4WFYA 3F0NA 3GG1A 3AODA 1LXJA 1N0UA 2KH9A 4KPYA 3PKMA 3DMJB 3UD5A 1S6QA 3PEHA 4RNHA 4QU6A 1JKHB 1NH8A 4LF7F 2C3UA 3OL7A 1TFYA 2MXYA 3DGVA 1JJ4A 3BKTA 3SSQA 3L7OA 3R5AA 3W2WA 5HP1B 1SQEA 3H5UA 3D2WA 2BX6A 4XDDA 1X0FA 2GVDA 2FVRA 4LSLA 2ZOFA 4UOFA 2QEXS 5D0HA 2QC3A 3PIOQ 4K2JA 4IFYA 4RU9A 2R3VA 1XERA 1DTQA 1YVFA 1U24A 4NLDA 5KT6A 2ZJRQ 4OV6A 3N79A 3DLGB 4PPZA 1RTDA 3K0JA 1Y0HA 3CCTA 3HVTB 4B9TA 2KZZA 5GADI 2DNNA 4U6PA 4Q8FA 1FWLA 1U0HB 2BQ3A 4IH6A 3D4JA 2HS3A 3SZ2A 2AKWB 4KPCA 5KFSA 1RT3B 2PT0A 3HD2A 5ETQA 4Y6IA 3TZXA 2DGOA 2B4VA 2LMIA 5D0EA 1AFJA 2M2BA 3PW5A 1ZYQA 5A0YB 3MOZA 2HLUA 2BJ1A 4DR5J 5GAEI 2GFFA 3HKZD 1S6QB 2MLXA 4TYBA 2BDPA 2EWHA 3ZZZA 1FNOA 3CC7S 1R31A 4YB1P 3W5ZA 2DNKA 5HAOA 4NXNJ 2EKNA 2EXUA 2UUAJ 1F9EB 4KJIA 4JBCA 1REVA 4DV5F 1KLNA 1H3DA 3BGLA 4DR3F 1QDUB 1WOSA 3DLGA 5A2QU 2XWXA 3T19A 3OJUA 3PM9A 1T9YA 2D41A 1Z4UA 4NA1A 1YG0A 4XK8C 5KT7A 4QOTA 3LAMA 4WZMA 1HHQA 1QY7A 1K9MT 2OJ3A 1IKXB 2B6AB 4U7UK 1KTQA 2YNGB 3UWTA 9ATCB 2FVCA 2VKZG 4JI1J 2KT3A 2MHEA 3R27A 1U49A 1KQFB 1D3WA 2GMHA 4IG0B 1PAUB 1T8EA 4ED5A 2CQGA 1LKZA 3GLJA 2HS4A 4YHHJ 1RADB 2O5DA 3P8BB 5FLXU 3M8QB 3GIIA 2MLZA 1R6YA 2HURA 4PG8A 2JEIA 1X9SA 4X4RA 1UA1A 3LP2B 1U47A 5D4OA 3GFYA 4IRKA 3FKBA 4M5DB 1RBLA 5CCLA 1RT1A 5B0GA 4ZJOA 1QSLA 4OIXA 2CYYA 4FYXB 4B9VA 5IQQA 3RJMB 4S0MA 3W64A 3BQ1A 1OYDA 1FD2A 2BKNA 2ZWOA 3MM7A 5LSLA 3NCPA 2DNGA 4L74A 3WC0A 3BQ2A 2FJAB 5CHCB 1SKRA 2VA3A 3MEKA 3PO5A 1HD1A 2VODA 1RT4A 4JI2F 1SJ1A 1RCXB 3AA8A 1ZM4A 3GFHA 2CJKA 1WHXA 3FJ2A 3DRPA 2GGPA 3BBCA 4MYUA 3TAPA 2UUBJ 4ES2A 4QWDA 2UV8A 4J9OA 4RO0A 4B08A 4H4KA 3L4BC 4OI4A 3EZOA 3OVAA 2VICA 2WZ1A 2HFSA 3MPYA 2UXBJ 3W7BA 4N77A 1VQYA 3I5CA 4FP9A 5CAAA 1JLCB 2EKYA 1YJ9S 1H73A 2VV5A 1WKLA 4HDGA 4OX9F 5H9FJ 4AE5A 5I3UA 1S9EA 3IRWP 2AYGA 1CS4A 4Q0BB 1I94F 1F9HA 4GO7X 2DNPA 5D6GA 2DCLA 3CGIA 3CCRS 4J9QA 2ZKTA 3TZZA 4ED4A 1H98A 2KVQE 4WE1A 5D15A 3PX4A 4CLSA 2WONA 2MSTA 4DF8A 4FBUA 1Q5YA 1X4AA 2QFIA 2VJUA 1X4FA 3MMCB 4AXIA 3C3LA 2UXBF 1QSYA 1KFSA 2XCPA 5E7OB 2AJ2A 3IBWA 5IM0A 1IBMJ 2OPSB 4YEAA 3VR1A 4KQZA 3M8YA 1D1UA 3W8GA 2RQMA 4EWTA 4DZ6A 2D1CA 3W5YA 4WTOB 2ERRA 1WI8A 5J2NB 4F4ZA 3RRHA 2H48B 2VDHA 1XMOJ 2XS7A 1WJ9A 2UP1A 3Q8VA 2HQDA 1CS4B 3EZUA 3I96A 2R9LA 2VL1A 3JQKA 5I3UB 2VQEJ 4FPRA 2WHOA 2J7KA 1WKKA 3KDOA 3MMBB 2OLWA 4OJGA 4F7VA 1LXNA 2CJYB 3LGHA 1H2VZ 4I56A 4OL8A 1YWXA 1Y3KA 3I0SB 4H4MA 4AXJA 1HR0J 2F65A 4AL7A 2RHSB 2YWFA 3OL6A 3OPKA 1FNMA 4I2PA 2HK2A 4FBTA 1RWKB 2WAQD 2H9ZA 2HHTA 2VPXB 4H4OB 4NLXA 2VH7A 3KK3A 3C15B 4ZCKA 3NCRA 2OMLA 3F41A 2KU7A 1S9FA 2BVZA 2LKZA 5CD4A 5LOQA 2UV8G 1P8GA 1PILA 2V9KA 2VG7A 2YNFA 3EDRB 2FLLA 2XS5A 4CT8A 1CPZA 2QLBB 1FVSA 3OXGA 1CJTA 3BPSP 3CIZA 1SJFA 3KK2A 5KG1A 4ELVA 4Y34A 5L1JA 2OEJA 2ZH1A 1KVIA 1KVKA 4KB7A 4J9SA 1L3SA 1VC6A 2GQCA 3Q0AA 3WC2A 1JIHA 1H7WA 2MZTA 5J1PA 2UU9J 1I1GA 4LF1A 2ZM6J 3CCJS 3NS7B 2CWKA 1NNDA 2FJBB 3UNYA 1DARA 1FEEA 2LEAA 4B9MA 3MEDA 4OMFG 2RQKA 3EX7B 5K14B 2NXUA 1FKOB 4H54A 5F3ZA 5DQIA 1DLOA 1IBCB 1S1UA 4M63A 4NLTA 4ICLA 4PABA 4F4YA 2WOMB 5IT9Y 2G0IA 1LW0B 2GO9A 3KUHA 1TV6B 3QGHA 4KKOA 1RAFB 2OPPA 3TEGA 4HEA9 5C7PA 1NK7A 3KTQA 3G6XA 2BRKA 4IOCQ 3V6KA 4LSLB 1MMLA 1K8AT 3P6YC 2Z2MA 2IRYA 1D9FA 1ROFA 1N8RT 1HD0A 3AXKA 3DOKB 4O3NA 4DFJA 3TJAA 2DKOB 4LFAF 3W2WB 3IN5A 3EPGA 1DTQB 2LCWA 2DR7A 4C8LA 5KAKA 1NJWA 1APSA 4IFYB 4K4TA 3TX8A 2IJNA 1JNZB 4LSNA 2PN6A 4QR0A 1KONA 3WIUA 4NLVA 1J5OA 3MM9B 4QYZK 2JFKA 2ADBA 2B9WA 3OTEA 3CCSS 5I42A 3PIPQ 5KFQA 1IJEB 3IWXA 4OZLA 5BYRA 2VOPA 3LA0A 2IIHA 2QRRA 4GVBA 1JLGB 4G1PA 1WHWA 1SV5B 5K8MA 5DG8A 4CIOA 3HHNB 3CJRA 1S1VB 3NGKA 1U02A 2RDIA 2V8VA 1XMBA 2VG6A 3W9HA 2HIYA 3P96A 3QIDA 2EPIA 4CP5A 4F4WA 4CCHA 3UI3A 4PG4A 1IUJA 1S1TB 2AJ0A 3MM5B 1S6PA 1MROA 1UP1A 3PY8A 1I5OB 3KWMA 4D3HA 3CMAS 3Q89A 1HWLA 1N0VC 4LF8J 2OI2A 3K58A 2BE7D 2EVZA 2MTLA 3PHEA 4I68A 3VAHA 1OJ4A 1RSCA 4HH0A 3B6BA 1PO6A 5A6PA 3RAMA 2C42A 4KO0A 4TN2A 3WIVA 3GJTB 4C3LA 1URNA 4XDCA 5KFIA 1C0TB 4HVZA 4ZP8A 3VGSA 2OIHA 2CPHA 1BHNA 1L3KA 3AQPA 1NSAA 3QT8A 3GSIA 5KFVA 4UQGA 2RU3A 5AXNA 2DR5A 1X4EA 3TEHB 1LWEB 2ZHBA 5L8RC 1J5OB 2A2DA 1V9OA 3QIPA 1WG5A 3VAGA 2K1RB 4PRFA 2AHOB 2NSBA 4XIUA 1CEZA 2AYEA 2QLJB 4Y00A 2IAJA 4LF5J 1FRMA 2HZAA 4C0HA 2R7RA 1DFDA 2DRBA 2IDLA 2ZD1B 1FDNA 4EK2A 1NPKA 1QE1B 1AT1B 4OX7A 2UVWA 3CJ2A 3EGVA 1RTIA 3D54A 2EFNA 4P73A 5IT0A 2XULA 4RW4B 2LA4A 2DNRA 5IV4A 2Y1JA 4J9NA 3CW2C 1B64A 2CIMA 1SB6A 2GJ2A 1Y4ZB 3GJQB 4UTGA 3H2UB 3WX8A 2MQMA 2V2VA 3GMGA 4DPXA 1HW9A 4QWCA 1YJ7A 3KLGB 4F3MA 3D9BA 3A13A 3UNGC 4B3MF 4J9RA 3E2EA 4W90B 1C1BB 1YGYA 4XTTA 3QFWA 3ZZOA 4R5PA 1IBLF 2DJWA 3FCVA 1U09A 1RA6A 4JV0A 4QBUA 2IMWP 4B9NA 3O44A 1N36F 1S9EB 4OHVA 1RU1A 5E33A 4BDPA 3NWGA 2A10A 3UDEA 3KJVB 3NMRA 3R6LB 1S9GB 1YRXA 2XI3A 1FERA 3IGNA 1U6FA 3MEGB 4WFXA 2B4OA 3PXGa 3UN5A 2R2TA 4NRTA 4JI0J 1S77D 3OTOJ 5K8OA 2F9DA 4FS2A 2WVCA 1LQ9A 1RTJA 3QAUA 2YPYA 2KXFA 3F44A 4URSA 5C42A 2EFGA 1WNEA 3QGPA 1M5OC 3OFFA 4WPAA 2AW0A 4J37A 3G2XA 3QZ8A 4KT0C 4DCPB 1TVRA 4JOUA 2HW3A 4K5SA 3MUTP 1ZA2B 3KG1A 5HL7Q 2WW4A 5B0FA 3OSPA 4OHWA 2SXLA 2NXNA 1N32J 5DLFA 4PXEA 5LJ3Y 4MFBB 1KP6A 2CDQA 2CVIA 2WSFC 4ZVGA 2W9BB 2PE8A 4TVAB 1UA0A 2W4DA 3LPYA 3C16A 2WW8A 3CWJA 3LP1B 1GXUA 1FCAA 2ZFHA 2ZBRA 2FZKB 5KOWA 3LOUA 1HNWF 4EZ9A 1NXIA 1YKWA 5GMEA 2Z8QA 4MH8A 4JYAJ 1VRTA 4IOBA 1GNKA 2F63A 5IZHA 4B3TJ 2RF2A 3TVZA 1P1TA 4IG0A 3M2UA 1FKAF 3KJVA 3BSOA 4DR4J 1QSSA 4DFMA 4OV1A 2Y3YA 4M94A 1BD6A 1PYOB 3M6VA 4EFAC 2L9NA 1RT5B 1RWWB 5GMDA 1VQKS 2RT3A 2V2QA 3MI7X 3D67A 2ZC3A 4DPOA 3NGDA 4KE5A 3BYPA 2RS2A 1CJUA 1PJ5A 4ID8A 1TK5A 1S59A 1FTCA 2OSQA 5IFMA 1RI7A 2A6MA 4GKJF 3MCMA 3VAJA 2CJ9A 2KJWA 1PYTA 2JLGA 2K3KA 5KG2A 4B3TF 2B5JA 1WD6A 2QA4S 4OQJA 2IBKA 1HBNA 4Y3CA 3HSZA 1WC5A 1CULA 2I8EA 2YKOA 4DV2J 2N82B 4OI6A 2Q3PA 3QBCA 3T1AA 3ELHA 1FX4A 2DEJA 4RX6A 4WU3A 3KHHA 7AT1B 2ZKUA 2ZH4A 1IN0A 2O66A 4RL1A 1SC3B 2CQ0A 1VIOA 3A12A 3MEDB 3NAHA 3R5BA 4A8XA 3GIKA 4FKYA 2AJQA 1A6LA 1AROP 3E01A 4WZQA 2KT5A 2N7YA 4FZVA 4TNOA 4Y2IA 4UZBA 2V8GA 4AT1B 1GH8A 3HFVA 4HT5A 3K57A 4DR3J 2NYIA 1KLMA 2J7UA 3OUYA 1EJ7L 1HNVB 3JSRA 2R2SA 3DFEA 3B8HA 2ATCB 5ETRA 1VQNS 2C2NA 2XSFA 2Z0GA 3DHWC 1N34F 3CJ0A 5CXTA 3NL0A 4ZPBA 1IJFB 4CLLA 2HNZA 1WI6A 2FHKA 1IM4A 2FJWA 1FRLA 1U8SA 2B5JB 1RT2B 3OL8A 4IR9A 3KLIB 4MKAA 4NYPA 4Z2XA 2EFVA 2J9EA 2CPEA 4ZKAA 1VQ7S 1EETA 2K06A 4RR5A 3AH6A 5EN1A 1FRXA 2BANB 2Z58B 2ZWPA 4ZVPB 4ZVRB 3N0VA 1VQLS 4HDHA 4BC9A 4HI1A 3HHLC 4HLBA 2CUYA 5F8JA 3HHLB 1WTFA 1T9WA 2MEWA 4C6AA 3JYTB 4UY8T 2HHSA 2PI4A 2RUSA 4GVBB 2FJEB 5CYQA 5D0GA 4X62J 1ITPA 1PIEA 3IBCB 2MYFA 1P6TA 1XR7A 4NYZA 1AUSL 3MPVA 2XYHB 4NCGB 1IQTA 1UZHA 1NPPA 3BN7A 2I2YA 1Y7PA 4O3PA 3AD8C 3CJ3A 3B82A 3JSYA 2KRBA 5F0WA 4LF9J 1Q95G 3TRGA 2LQ9A 4U67Q 5CZVA 4B02A 4JI5J 2DRDA 3IP0A 3TW0A 3OXLA 4UUXA 1KHVA 3DC2A 4RNFA 4X4SA 4LT6A 5D3GB 4ZJQA 1NSQA 1KRPA 4NWBA 3UCUP 4DSLA 2I5JB 5HO4A 2G2OA 5KFDA 2FY1A 3MM8B 2I1RA 4A8WA 2D3OR 1AFIA 3M8SA 1DAXA 2KDOA 3BKUA 3CJ4A 1S1XB 2BQUA 2CG8A 5HK4A 3O1LA 4F4XA 4NASA 1Q8LA 1S57A 2VFRA 5HBMA 4IR1A 1Q81T 2CNNB 1RWNB 1TL5A 2CQBA 2VF3A 2R8IA 4QPXA 4IKAA 5ETLA 4ETXA 1N4LA 4Q0BA 4TYAA 5KG7A 1RBOB 2B4PA 3NKYA 2VD3A 3SV4A 2MDAA 4Q44A 2CQ1A 3D1QA 5GAGI 1N5VA 1WTBA 2RF2B 2FZGB 1T9XA 1LWFB 5EGYA 1U1OA 4JI4F 3BF4A 5FDLB 5DO2A 3TAQA 2RD5C 1PKUA 3ET6B 2M88A 2WVDA 3GU0A 1K73T 4LJMA 1WDTA 1HBOB 4F0MA 4CZCA 1W2IA 3SSSA 5IQ6A 1AB8A 2CWXA 3CE8A 3ZZUA 5CYJA 1C4CA 2BM1A 2J6SA 2YKNB 1YZ7A 2PMHA 1NM2A 2XGPA 2KJVA 4TKTA 4ID5B 1RT7A 2IJRA 5F8HA 4C11B 3T5JA 3H2VE 1RB0A 3CXCR 1H2TZ 1SCJB 4C8KA 1HA1A 2WB1D 1N33F 1W7WA 1VR6A 4M5KA 3L9ZA 1M1KT 3B4MA 4WCEQ 2HVEA 4EMDA 3BH7B 5KFJA 1JLEA 1B4SA 3H7HB 3JTPA 2RRBA 3PYEA 4DX7A 1NH7A 3AQOA 4LF6J 4USHA 1BC6A 1S9GA 4MAKA 3D1HA 2ROEA 2OFHX 4JI6J 4U8YA 3N5BA 3PCOB 3TZYA 1T94A 2DHHA 1S4EA 2FC9A 1YRUA 3GFXA 2M4MA 1LK7A 2DHAA 5ETKA 4RNNA 3GR0A 4L75A 4JI6F 4NZ7A 5C42B 3MD3A 5T7LB 2NZ4A 1RJJA 2C3YA 2ACMA 2W7AA 1EQMA 3W2VA 5LT5A 1GAOA 3G87A 4G1QB 4DX6A 2X3GA 1LWFA 3D5MA 3QQCD 5BJRA 1MROB 1BWEA 2QG9B 3OLBA 1R0CB 4OZ1A 3TQ1A 1RK8A 2W4PA 4KTQA 5KFZA 2BV3A 3PHTA 2X1GA 3QT7A 2B7CB 2E1RA 5HATA 4L3NA 5DDRC 3OTCA 1RABB 1FD8A 1NDKA 3POTB 1NK5A 1R6VA 4B3OA 2IRXA 3HHLD 2C2DA 1SI9A 2DISA 1SUQA 2B9EA 2G2YA 2FIUA 2FY8A 8RUCA 3M7VA 2ZC4A 3D6FB 4YY3F 3OQ2A 2KO1A 4NPOA 4N5SA 2MB0B 2O67A 2V2KA 3CJTA 2M5YA 4J7CA 4LR8A 3W8PA 4YS2A 3MZIA 2W9CA 1Q82T 5AJ3F 3HT3A 5HQ8A 1A9NB 2DR6A 1JLCA 2L41A 1QLNA 1WOPA 3ENVA 4HT7A 4ZS6A 3THTA 3EVOA 3HPOA 3T5LA 1HWKA 1RTZA 3KLEB 1RAHB 4P71A 3MR6A 4DDFA 4J9LA 2LDIA 4DLGA 2XI2A 2CQ2A 2L9WA 3M1VB 2I6WA 4NEZA 4DL7A 1M0SA 3NP5A 4F0KA 3SV3A 1XNRF 4CLYA 1V5IB 4ZN1A 1QE1A 2MJNA 2XLKA 5IXUA 5F8GA 3KXDA 5KFHA 3J81j 4PUOA 1JXVA 1N5YA 4NLRA 3QGGA 3RR7A 1U0SA 3J7AN 1ZOTA 4A8QA 5KFKA 3CCMS 1X4CA 2RAQA 4DUZJ 1PC4A 3MM8A 4X66F 1NEEA 2YWWA 2R2UA 4Y0FA 4O4GA 1R3NA 1U45A 2PFFB 3B78A 3X1LB 1K0TA 1HIYA 2KM8C 1KC8T 2LLZA 1GTHA 2KYXA 3AOCA 4R25A 1VJWA 4AL6A 2YNGA 5CCMA 1JXLA 4FN5A 5THWA 5J1EA 3CCQS 4L73A 1DHMA 2HZVA 5GAHI 5L39A 4BHQA 3CB4A 3T3FA 4DR6J 1FJCA 1FTRA 3F73A 4P10A 3AB2B 5KT3A 3J81U 5KOXA 1JLGA 2ATLA 4DL3A 3MOJB 3VVTA 5JVGQ 2VU5A 2ZH6A 1UFKA 4ZHRB 1URRA 1G6BA 2GAHC 1YK9A 1LW2A
chains in the Genus database with same CATH topology
2HNYA 1NAQA 1WG4A 2I0XA 2XBPA 1UWBB 2EBEA 2ROGA 2XNRA 4WYLA 2BRLA 2DNQA 2DCUB 1DQ8A 4PUOB 1TKTA 1U1MA 2E5IA 2EK6A 4IH7A 2BA9A 2G9OA 2NPFA 1OWXA 3NAIA 1TKXB 4JV5F 2F1FA 3HVAA 3LF0A 1NK6A 5EX0A 1CSJA 4EBDA 4RLEA 4I6AA 3SCJE 4HKQA 1VQ8S 3HVTA 3CCUS 1Q1KA 4CO3A 1IBKF 1CVJA 5T41A 2ASYA 2OPSA 4LUBA 2VQEF 5KFEA 4ZOSA 4M95A 2HAIA 2HVHA 2RJZA 1T3OA 2YWEA 3PNIA 5EX3A 1M5VC 1TV6A 2R8JA 3QLHB 2Q6CA 3N6LA 4ZA1A 1DLOB 3EZ5A 4EBCA 3PX6A 3AJ2A 1D8YA 1VQ9S 4X4OA 3M8PB 2IM1A 4K4WA 1Q4RA 2HNDA 2CPXA 1QVGR 4QWAA 4YQWA 5JJBA 5KTQA 2EC0A 5D78A 3FFIB 2F9JA 4TU7A 1NRKA 2B9XA 1UW4A 4IDKB 2MKSA 1Q7YT 4ECSA 4P7VA 1QAJA 3FRYA 2ASLA 3SFUA 1FXDA 3LO3A 3G6ES 3OXFA 1UVKA 3SQGA 2RILA 4RU2A 3HHDA 2LXFA 2AYBA 4IQMA 5EHHA 1S0OA 1AXQA 1QAXA 1O5JA 3PEJA 3FQKA 4Q2LA 2EG2A 2ZVSA 1FDAA 1FRIA 3EGWB 2BZ2A 1WWHA 3M4XA 1VS3A 2KKHA 3IR6B 2YWGA 2H5EA 2XB2D 1LOUA 1NJYA 2UVVA 2A3JA 3H40A 3KFWX 2XY5A 1C1CB 4QIFA 3ULHA 3LP1A 2FHJA 3BR9A 4ZMMA 3RTVA 2XSJA 3M8PA 3DLKA 3U1MA 2Q79A 2O3DA 2IVYA 3LGNA 3THVA 4KC5A 2NSCA 1R8AA 1N6QA 3JAMY 2CPIA 1ZYQA 3EXYA 5B0BA 1FT8A 3G71S 1QM9A 2UUTA 2LXIA 4G1IA 1FO1A 3VWSA 1N5QA 4NA3A 1ULRA 2YKAA 2ZITA 2OPQB 4WE1B 2XS2A 4NLQA 1RKIA 3HO1A 1RQ0A 3KG4A 1KS2A 4YOEA 2IAJB 3MEEA 4DN9A 4CO1A 1R0AB 2VPWB 2BUNA 3MMCA 4Y28C 3MURP 2EBGA 2DVIA 3KMQA 1U26A 3M6XA 5F8IA 2RDJA 1FNXH 1TAQA 3O3LA 1TUVA 2YKQA 4A8OA 2J9DE 2D3ZA 2XSJB 5D77A 3R5DA 5DDQC 5F8LA 4O0IA 1NKBA 3OTBA 5LXRA 2HNYB 4ZCLA 3CCVS 4B9SA 2RNEA 3I82A 3CCLS 1UEUA 3CD5A 3N6NA 3WBZA 2CRLA 2IM2A 4JUZA 3SCKE 1RKJA 2JEJA 4QYRA 2IVMA 2XMUA 4DV7F 3MM7B 2M3DA 4F4KA 1ZAVA 1S6PB 3MMAA 2XMJA 3V6JA 5KG4A 5KFXA 4IG3A 2CPDA 4PWUA 3RB4A 1VRUA 3L95X 4PG7A 4RBUA 2IM3A 1TFWA 2KFZA 2GX8A 4ALZA 2PSZA 4I0WA 4O4RA 4BCAA 3V81A 5B0DA 3I55S 3P5TL 4LFCF 4LQ3A 4A8FA 3IWNC 3K5LA 2FJVA 4E98A 3RB0A 3FFIA 2E29A 5E3CA 3PR4A 3MR3A 4DV0F 2ZHOA 2OMOA 2X1BA 3KHGA 3MTJA 1C4AA 3SI8A 4LF8F 2JVOA 2P5VA 3CDEA 4X64F 2Q43A 1ZPVA 1UVIA 4PWDA 4GKKF 4QW9A 3V4IA 3BM7A 4WKRA 2F7VA 1TQLA 1Q78A 4I1TA 3N01A 5A8WB 3J81Y 3KK1B 1FVQA 4LVNP 5KFWA 5K5MA 1GQEA 1P1LA 1KOHA 4ICLB 5A0YA 5LSOA 1FF2A 2MQOA 1CPZA 3NRBA 3ZZPA 4QQBA 1REVB 5DDPC 1YJWS 3SDEA 5D4LA 4A47A 5MAOA 2W4CA 4ATNA 5BYSA 3KLFA 2OPPB 4TY8A 4PQUA 2QZ8A 3TUIC 3M05A 3PW7A 4MIBA 1ZTWA 1V3SA 1F2GA 4CQ1A 4EBEA 4Y2MA 3DOKA 1UWBA 4OJ1A 1BQNB 3H5XA 1LWCB 1FJEB 4ED7A 1HBNB 1XN9A 4O44B 3H4DA 2ZHAA 3VZHA 4OZ5A 1ZM3A 4X84A 3QWPA 2FLPA 3GFZA 2LVWA 1D9AA 4ZLPA 4NMLA 4F8RA 3CT9A 2DGTA 3TP2A 4ECWA 1T05A 2EFOA 2OPQA 3M9OB 2XY7A 2NQPA 1WEYA 3K8WA 3KLHB 3HJFA 4N47A 1UMJA 2LYVA 4LVOP 1IKVA 5CZXA 1M5PC 4ILRA 4QR2A 4DMZA 2AD9A 3M32B 3BN4A 3HLUA 2MPUA 1HMVA 1SL2A 2ZZNA 1FKPA 4FNHA 4YR0A 2MQQA 5MLCV 1T03B 6FDRA 3FMWA 4ZPWR 1IBMF 1TVRB 3CULA 1OQ3A 2W7PA 2UU9F 1OSCA 3BSAA 2OPRB 4IO9Q 2HNDB 3RU0A 2W9BA 1Y9OA 2BBEA 3IA0A 4ID5A 3FNNA 1S10A 1Z1ZA 1G1XA 2PD1A 2ADCA 1DTTB 1XBWA 1KVJA 2ACYA 1S97A 2HS0A 3R1HA 2KXNB 5E0OA 1OIAA 4TU8A 4L72B 2COLA 4KFBA 1SH2A 3M8RA 1L5UA 2PO4A 2J6TA 1HR0F 3MMAB 2MQLA 1X9MA 1X5SA 2WONB 3MD1A 3QJPA 3TANA 3TAMB 2IA0A 3I31A 2LQBA 4QZVB 5AXLA 1UFWA 4KR0B 1WHVA 3WDOA 4DL4A 1RTHA 3RW6A 4LQ9A 2RH3A 4N8OA 1RTIB 5F3TA 1VGYA 3CSKA 1RYRA 3DLEB 4HL9A 4R5PB 2VBZA 2B7BB 3PDNA 1T7PA 3DLKB 3CDAA 2W8LA 3O6QA 3MUVP 4B3OB 3QPIA 4O3SA 1ZH5A 1HI8A 1N88A 2JC1A 4Q43A 2B51A 1X8DA 3CJ5A 4X4PA 2K2PA 2HMIB 3DOMA 3IXQA 3US5A 3H98A 3MWBA 2NLWA 4WFNQ 4NLPA 2R7QA 1L3UA 4K4YA 3RW7A 4ED3A 1RT6B 1H2UX 2HRYA 5E3QA 3T1YF 3PZPA 1VLYA 2AV5A 4K4XA 3S6EA 3U1LA 1JLFB 1W2BR 3NBPA 3MECA 4QYZJ 2N4CA 2F40A 1C0TA 1S7HA 2V9WA 1S1TA 2POKA 5JXSA 1IKWB 4PKDB 3ZZYA 5KFLA 5K8PA 3A1YG 1JLAA 3M6UA 4EUVA 2OO4A 1P27B 3IG1B 4HH1A 5CYQB 1DBDA 3DU5A 5LL6d 4LF5F 1TL1B 2PA3A 1CC8A 4FF2A 4NLUA 2GMJA 5KG0A 2PEHA 1XMQF 1HWUA 2AJFE 1M5HA 2VFTA 1VRUB 3AHPA 2D7SA 2IVFB 5AE2A 3SQGB 3SMZA 3PV8A 1H38A 3HF5A 1AUDA 4CNZA 2BJDA 2DR8A 3I4PA 3OR2B 4DR1F 2LECA 2DNHA 3M2RA 2VBWA 4JI1F 3C2PA 4E8UA 5EWGA 3E51A 2PMZD 4LSNB 2AJ1A 5L9XA 2MKIA 1FHTA 4PXDA 3NCQA 2YX7A 3KG0A 3I5AA 2W25A 4QIEA 4QJVA 4Y65A 4LIWA 3MUMP 3Q8RB 3DYAA 1SUQB 1QAIA 3WC2A 1F60B 3T6JA 4IRDA 2FHJD 2MSSA 4FNIA 4HHJA 4A8MP 1S0NA 1JLQA 4DR2F 2MQNA 1ELOA 4AUKA 1SL0A 4JI7F 2CJBA 2E5HA 2IBOA 1F5CA 2JEGA 1RYSA 2GO8A 2M8HA 2XZWA 3PW4A 2UUWA 5HP1A 4KIAA 1SJ3P 4UY85 3QJLA 2FJDB 1NHVA 4QPTA 3I0RB 1H6KX 3VQSA 1JKHA 5G4DA 2OTJS 4B9UA 5DJBA 1SIWB 2VG7B 3HI9A 1XNQF 2DK2A 2XMVA 3LALA 1VQPS 2ILYA 3KLVA 3X3UA 2IMOA 1Q86T 5DG7A 4H4OA 3CD7A 3FSIA 3GSDA 4URGA 1HBMB 2XEXA 2ZJPQ 2L08A 4LMZA 3KOAA 2JZ5A 4ECVA 3OV7A 5FD1A 3AA9A 1JJHA 1RT7B 2YH0A 3M2UB 5K8NA 5H1SV 3BO4A 1X0PA 3QJJA 4ED0A 4X4TA 4ZVFA 1YJVA 2F8EX 4A8YA 2YTCA 3G6VA 3OW2R 4JI8F 4F67A 3CCZA 1NK4A 3H4BA 1VI7A 3NNCA 1NZAA 1RT6A 2WB4A 3BSCA