5JVHQ

The crystal structure large ribosomal subunit (50s) of deinococcus radiodurans in complex with evernimicin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5jvhQ00
4F25A 2E5HA 3CD6S 2E5IA 5CXTA 3PIOQ 1K8AT 3CCVS 1OO0B 5DDOC 1DRZA 5GAGU 1X4HA 4IOAQ 5DETA 1O0PA 2MSSA 1Q7YT 2D9OA 1R8PA 2QEXS 2KXHA 1UP1A 1D9AA 3UD4P 2RQ4A 2MPUA 1SJ4P 2FPHX 3CF5Q 1KOOA 4ED5A 3CMAS 1WTBA 1Q82T 1A7GE 3V4MA 2M88A 2AYMA 2CQDA 3EGNA 2RS2A 2HGMA 1WHWA 2CQIA 4QQBA 4Y00A 2LXUA 2X1FA 3PIPQ 2K3KA 1WWHA 1U1KA 2KVIA 1M5KC 2CQBA 2MKCA 2OJ3A 3EGZA 2RRBA 2F3JA 2L41A 2ZJRQ 1D8ZA 3MDFA 3CPWR 1M5VC 3DLLQ 1Q86T 5D77A 1NO8A 2MXYA 2FC8A 2YTCA 3MI7X 4FXWA 1VBXA 2CQ1A 2PEHA 2ADCA 1NU4A 1X5TA 2DISA 1VQMS 1X4DA 2J0SD 1DBDA 1K9MT 1KQSR 2K8GA 1FJEB 3NS5A 2KM8C 2J76E 5IM0A 1CVJA 3UCGA 2WBRA 3MUVP 1VQ5S 1HD1A 2XNQA 2XSFA 1N54B 3VALA 4WFBQ 2CJKA 5GAEU 2VONA 2CPXA 2PE8A 1KOHA 3B4DA 3N9UC 1FJCA 1WG4A 4W90B 1JMTA 2CQ0A 3L3CA 3CTRA 1OWXA 3BS9A 3CCES 3S8SA 3LPYA 2AD9A 1N8RT 3UE2A 2KI2A 3G8TA 2RRAA 2M4MA 1PO6A 2MYFA 2GO9A 3CCMS 2BOPA 2DGTA 1X4EA 2MJNA 3RW7A 3BO4A 3MUTP 4F02A 4LIRA 1FJ7A 2MKJA 1DZ5A 3G4SS 3IRWP 2GHPA 2HGNA 1VBZA 5JVGQ 3BEGB 3R27A 2OTJS 2MZRA 1YI2S 2MQQA 3G8SA 3B4MA 1M1KT 4FXVA 2VOPA 1SJRA 5ITHA 5DM6Q 3S7RA 2CQ4A 5EN1A 2N3LA 2X1BA 1WEXA 2DNQA 5BJRA 1VQLS 3CXCR 1WI8A 2MQOA 1BY9A 5LXRA 2OIHA 1M90T 1S72S 2I38A 1AUDA 2DNPA 2MY8A 3DXBA 5GVQA 2UP1A 1U6BA 2M2BA 2FHOB 2KYXA 2DGXA 2KHCA 2CQ2A 1U1MA 2MZ1A 5GMKa 1SJ3P 2MKHA 2LKZA 2MZSA 4A8XA 5IM0B 1A9NB 1URNA 5DM7Q 2MKIA 2MZJA 5LXYA 1WHYA 3ULHA 2DGUA 2MKKA 1W2BR 1VQKS 2YWKA 5LSOA 1P1TA 2JWNA 1SJFA 2MGZA 1VQNS 2HYIB 2CQ3A 2CPZA 3CCQS 1U1OA 1KC8T 2M8DB 3UD3P 5MLCV 2MGZB 2KT5A 4WFNQ 4V19X 2MQNA 3SDEA 2MQPA 1UFWA 4YB1P 5CYJA 5LJ5Y 2AYGA 1VQ8S 1S79A 1L3KA 3CMES 3CCLS 2DB1A 2ZJPQ 5LSLA 2DGSA 2RUGA 4UQTA 1NJIT 2NZ4A 2EK6A 3MXHP 2DNKA 1FNXH 1HL6A 4W92B 2KG0A 1VQOS 5DDRC 2KXNB 4C4WA 2DGWA 1P27B 2MKSA 3G71S 2RQCA 1HA1A 2X1AA 2RU3A 2AYEA 1YJWS 2M70A 1HD0A 2OTLS 4ERDA 1VQ6S 1VQ4S 4CQ1A 5HL7Q 2CPJA 5D78A 3NNHA 2U2FA 2YH1A 3CCUS 1YTYA 3CUNA 1WHVA 2CQGA 2JX2A 1U1LA 2G0CA 2B0GA 5H1SV 1YITS 2DO0A 3UCUP 4PKDB 4TLQA 4LMZA 1JJ4A 2KFYA 2DHXA 3MD3A 2RVJA 4TU9A 2O3DA 4C0OC 2E5JA 2HGLA 2JVOA 3D2WA 1X4BA 1PGZA 2RT3A 1VBYA 2CPDA 2CPHA 2DNNA 3ZZZA 2F9JA 3OW2R 4QU6A 1X4GA 1RK8A 2DIUA 2RS8A 4UY8T 1RKJA 3K0JA 2G1DA 1IQTA 4TU7A 4WIIA 2N82B 2LMIA 4QU7A 3TP2A 1VQPS 1ZH5A 1UW4A 2E5GA 2DGOA 3SDEB 3VF0B 3ZZYA 3BO2A 5FJ4A 1WEZA 2YKAA 2N7CA 2XNRA 4WF9Q 4ZKAA 1F9FA 2XB2D 4RU2A 2QFJA 1FT8A 2M0GB 3CCRS 3CC4S 2M52A 2M9KA 2KG1A 2DH8A 1WG1A 1VQ7S 1SXLA 1WELA 1KD1T 4WKRA 1QM9A 2MQLA 1WF1A 3EX7B 1X0FA 1Q81T 2ZJQQ 2DNOA 3P6YC 3VAMA 2VOOA 2MJUA 3J7YU 4OZ0A 1VQ9S 1H2UX 3Q2TC 2BZ2A 2AYBA 2MQMA 1U1QA 4IO9Q 3MOJB 3THTA 4M5DB 1N88A 1UAWA 4J5OA 2MB0B 1FXLA 4EGLA 2F9DA 4Z2XA 3U1LA 3H2UB 4C7QA 2DNMA 3HI9A 1K73T 1X4AA 1JJHA 3THPA 3G96A 2XS5A 2KRBA 2J0QD 2MY7A 1ZZFA 2YH0A 2SXLA 2CPIA 4YOEA 3VAJA 5DDPC 1YJNS 2DO4A 3MUMP 1OIAA 1N52B 2I2YA 2KU7A 2LXIA 3U1MA 2Q79A 1WF0A 3P3DA 1OPIA 1B7FA 2KRRA 1XN9A 3NS6A 3CCJS 1YHQS 2J8AA 3CULA 3RW6A 4F26A 2KXFA 2M8HA 5GADU 5JVHQ 1SJQA 2CPFA 1WF2A 3MD1A 3HHNB 2MHNA 1YJ9S 4YUDA 1YWXA 1X5PA 2DNLA 3SXLA 4QPTA 1WI6A 4LJMA 3CC7S 2DNZA 1U1RA 3G9CA 3BO3A 2LEBA 1WHXA 2QA4S 3VAKA 1X5SA 5IFMA 4WCEQ 1WG5A 5DDQC 1H6KX 5HO4A 2XS7A 1FO1A 4P6QA 2ADBA 3SMZA 1H2VZ 3JB9k 2JRSA 3G6ES 2DNRA 3VAHA 3CC2S 5IQQA 4IUFA 2CPYA 2KH9A 4CH1A 2DH9A 3I56S 2FC9A 1VC6A 2E44A 1U1NA 2A3JA 4WFAQ 2DHGA 3S6EA 2N3OA 3I55S 2DNHA 1ZZNA 2VODA 2KN4A 3R1HA 2LQ5A 1DHMA 2LECA 2HZCA 3TYTA 3VAIA 2LYVA 2ERRA 2CQPA 2DHAA 3NMRA 1FHTA 3IWNC 3TO8A 1G2EA 1JJ2R 2CPEA 2RNEA 3P49B 2DGVA 1YIJS 3CCSS 1H2TZ 2D9PA 4CH0S 5CA5A 3H2VE 1X4FA 3R1LA 4Y0FA 2DIVA 3NNCA 2MMYA 4PRFA 3P5TL 2KM8B 4BS2A 2LCWA 2OSQA 3FEYB 2LEAA 4PR6A 1U2FA 2NLWA 3UWTA 3S01A 1M5PC 3Q2SC 3UCZP 2M7SA 1U1PA 2D3OR 2LA4A 2DK2A 2MSTA 3US5A 1WEYA 2DNYA 3J7ZT 2DH7A 2HVZA 4OZ1A 2DHSA 2U1AA 2G4BA 1VC5A 5GAHU 1QVFR 4IOCQ 4U67Q 2OSRA 3VAGA 2DNGA 3FEXB 1VC0A 3VAFA 2X1GA 1U6FA 2CQCA 1X4CA 2DITA 2LA6A 2MZQA 1M5OC 4TU8A 2DGQA 2FY1A 1R8HA 3NNAA 2XS2A 2JVRA 4CIOA 2V94A 3MURP 2L9WA 2L08A 1QVGR 3LQVA 2CQHA 5LJ3Y 2EVZA 2MZTA 2EK1A 1X5OA
chains in the Genus database with same CATH superfamily
2E5HA 4ENOA 3RJMB 2E5IA 4EBDA 1TK8A 5CXTA 3DGPB 4ETXA 1SC1B 4B3SF 3CCVS 4DF4A 4F4KA 1Z4UA 3IRXA 1X4HA 3M32B 2BQRA 2XMUA 3W9JA 3T5LA 1U45A 3M2UB 3I4PA 2OD4A 4NA1A 3NWRA 1AYEA 3UD4P 3V4IA 3D9BA 2IAJA 2RQ4A 2CG4A 2ZH5A 2MPUA 3G87A 3DOKA 1KBRA 1PBAA 2FPHX 4F50A 2FHMA 4URQU 3L9ZA 1UA0A 1YLXA 4MMOA 4U95A 3OL6A 1VRUB 1SKRA 4ED5A 4IG3B 2HPUA 2VV5A 3DHWC 3MWBA 3CMAS 5I3UA 4ES2A 5FLXU 4QW9A 1T94A 3C15A 1XWLA 3TZWA 4MKAA 5CAAA 3T5KA 2KZMA 3MECB 2QN6B 1S1TB 4TYAA 4JI4J 3CNQP 4FDFA 3DLGB 4HT5A 2GGPB 2ZH3A 2NSCA 1Q95G 5LMNJ 5L1LA 3DLEB 3THVA 1YJ7A 4B9NA 2X1FA 5KT5A 3IG1A 2QMXA 3PIPQ 4USVA 2K3KA 1IKWA 2BJ7A 2XMAA 5CABA 2HURA 2KVIA 4XPCA 2AJ1A 3BQ1A 5HP1A 3QT5A 3JSMA 4XDDA 1RHRB 2JC1A 2RRBA 5DO2A 1D9FA 2JLEA 2VFVA 2W9CA 1CJVA 3GZ7A 3DLLQ 3GE9A 3VGTA 2MXYA 1HNWJ 5KFZA 2FVCA 3E01A 4WFYA 4ZVGA 2C2KB 3VVTA 3UDVA 5GAGI 2ZZMA 2KDOA 3V81A 1NDKA 4FXWA 1VBXA 3KNGA 3DLBA 3J81U 2H51B 1MW7A 4PXEA 5EX0A 2UXBJ 2RQKA 1X5TA 1SQGA 1CPZA 4NL5A 2DISA 2VPWB 4O3RA 4LF7F 4ZP9A 2MKYA 1KQSR 1FJEB 3MM9B 3EDQB 2B3TB 4H4MA 4DR1F 2J76E 3IBCB 4LF2A 4EYIB 1JLFA 5KFFA 2G9OA 2G2YA 3T6BA 4MJKA 4ZPCA 1EJ7L 2CVIA 1YIJS 4AL6A 3AJ1A 1UEKA 3TAPA 1YQHA 3TA1A 1EP4B 3PO4A 5E0OA 1VQ5S 1CQMA 1HD1A 2XSFA 3VALA 3JQKA 2XWXA 2DEIA 3QNWB 4OYBA 4LF8J 4I6AA 3TVYA 1U26A 1HARA 5K8NA 1FJCA 1FNMA 5F8JA 2F40A 1JMTA 3RTVA 1GQEA 4P9SA 3FSIA 1SL2A 2IA6A 4ICLB 1TVRA 3JAMY 2IDLA 2CJQA 3OFEA 5A76A 3CCES 4ZVTB 3P5BP 2HZVA 2R7XA 3QMQA 5J2QA 1FEHA 3FBFA 2GAGC 3OQ2A 4HR2A 2RRAA 2DR7A 1YBTA 2MYFA 1DTTB 4NLYA 3U27A 1FKOB 4DEZA 2FVSA 4K0KF 3CCMS 4JUZA 6FD1A 3UDLA 1NSKL 2KB2A 3HHKA 3BO4A 3NAHA 4PYAA 1LNQA 1HNVB 4R8UA 4P75A 3MCOA 2CG8A 2J7UA 2CJ9A 2GHPA 2QLBB 1OYEA 3IWXA 4HH0A 4JI5J 5AE2A 3JSRA 2VICA 5JVGQ 3BEGB 2VFSA 3R27A 5HJXA 2LFVA 5E5NA 1RZMA 5B0BA 2IJFA 1RTIB 1YI2S 5GAEI 2XCAA 2AJ0A 5BXIA 8ATCB 3HSJA 1GMWD 3TUPA 1WOOA 4CP5A 1RTJA 1M1KT 4FXVA 3PRVA 1HWIA 5DM6Q 3AOAA 3S7RA 2ASJA 4OLOA 2CQ4A 2N3LA 2X1BA 3EUNA 1QD1A 3ILIA 3R2DJ 1H3DA 2ALYB 3A3NB 1MG7A 5U47A 2W2PP 1WEXA 4WE1B 4EFAC 2DNQA 5BJRA 3W65A 1VQLS 3CXCR 3PR5B 1RWOB 3R7BB 4QYZK 4F8RA 5KFYA 3VWSA 1T9TA 2DT9A 2FGCA 3IAS9 3E2EA 2DNPA 4PWUA 2UXDF 1Q8BA 3CWJA 2QLWA 3MCSA 2PC6A 3M8PA 3I9V9 1H73A 1RU1A 4OYAA 2KO1A 4OYPA 5C7PA 1U6BA 2ASYA 1EARA 1RAFB 4DR6F 2CYYA 2FHOB 4CNYA 4GKJF 4DL6A 2BV3A 2JEGA 2AP6A 2CNNB 2HVDA 2LXFA 4F2RA 2LKZA 2MZSA 4ZN3A 1LXJA 5DRKA 1R27B 4KSEB 4ES1A 5DM7Q 4NX9A 4OZNA 1JLEA 5AXMA 1SVDA 3OJSA 4NXNJ 3R5AA 1U7LA 2VODA 3SV4A 1XTZA 5BYQA 2DGUA 4DR4J 1S97A 4DSIA 1EX8A 2FJAB 3BB5A 4BLGA 5M2PA 3IO1A 5SUHA 1JLBA 4JI2J 2BRKA 3W62A 3UR0A 4KHPJ 1UWBA 2VG5A 2JWNA 4B17A 1M5SA 2BJ9A 2FDNA 3SQGB 2E5LF 4OJ3A 2F7VA 2HYIB 3LP2A 1RT4A 4KKOA 3UD3P 3CD0A 4NLQA 1VGYA 4F0HA 3M8RA 2ASLA 4TY8B 4V19X 1R8BA 2MQNA 2XMWA 3WHIA 5MAOA 3JSMB 3MPYA 3SDEA 3FCWA 3PKMA 3RU0A 3D66A 1NJYA 2KVQE 4ZMMA 5IC4B 3KHRA 5EWGA 3EYZA 1S79A 3K5OA 1HPZA 2LQ8A 1GH8A 4B3RF 3MTKA 3EZUA 2YNGB 5L46A 5D0EA 1T3NA 3BYPA 4O3OA 1LK7A 4B3TJ 2A6MA 2DGSA 2XGPA 2K1RB 1NJIT 3FMWA 3LO3A 4B3OA 2XYPB 4GKKF 3W2WB 1PIEA 2DNKA 1OY6A 4H4KA 4QIGA 5A6PA 5H9FJ 4FF2A 4USTA 4DSJA 1TTHB 2FJVA 2XO7A 5EUHA 1JLFB 2ZH4A 3M8QA 3NMAA 2DGWA 4C4WA 1RSCA 2G2ZA 3MM9A 1WORA 1YBAA 1O51A 3M2UA 3CDBA 2DHHA 3M32A 4I7FB 4OI2A 2AYBA 2CVEA 2J6UA 3W2WA 3PY8A 4C8YA 1S6QB 2HKEA 5F8MA 2BBEA 4YS2A 1WC3A 1HI8A 1FJGF 5A8RB 1F60B 3N28A 3MR5A 3MPUB 4NMXA 3P4UB 3GV5B 4EK2A 1TAQA 3L7OA 2P9GA 3T41A 5HQLA 4DPOA 2B5JB 1FDAA 1FXDA 2F8MA 3B78A 4O4GB 4C48A 1XMOJ 2YH1A 2FLOA 5B0FA 3NEKA 1J5OA 3BDPA 1XNRF 3QAEA 3CUNA 2FGOA 4Z7YA 1JKHB 4RW8A 1PSDA 2CQGA 2JX2A 2XBPA 4X84A 1LWEB 3VGSA 2MLZA 3AAWB 1Q8IA 3DLEA 3OSNA 3ITHB 4Y28C 2PMHA 2Y1RI 4DX5A 4GVBA 3T19A 2IA0A 2XZDB 1R7IA 2YNFB 3SQOP 4DX6A 3QJJA 1PYOB 3DN9A 4RW4A 3PW7A 1V9OA 4L72B 2V67A 4M5LA 2KFYA 4FF3A 4HHHA 4YY3J 3PRDA 2QMUB 3MD3A 5I42B 1U2CA 1VI7A 2RVJA 3DHXA 1RTHA 1TKXA 1XMBA 1IBMJ 2QRRA 1OSDA 4ZN1A 2R9LA 1RU2A 3C8YA 4ZA1A 5E33A 1VMBA 2Z56B 3IA0A 5KFIA 4QIEA 3D2WA 3D28A 1WTBA 3TX8A 4AT1B 2F65A 2VB6A 1VBYA 1S1WB 4OX6A 2LQBA 3ZZZA 3OW2R 2BKNA 3MTJA 2FJWA 4ZPTR 3F44A 2RS8A 1S9GB 1TL5A 3HDSA 3K0JA 1RT5B 4K4TA 2RDIA 3T6JA 3UN5A 5CHCB 2R7TA 5D8HB 5KG1A 4NXMJ 2NYHA 3BZQA 4N5SA 1C0TB 1TL1B 1TMJA 2C3UA 1Q5YA 2HAFA 2LMIA 2PGCA 3HJVA 3DI6B 2QJ3A 2N82B 2VQFF 1VQPS 1EETA 1M5HA 1WOPA 3EVOA 5B0EA 3SDEB 1VRTA 3VF0B 2HHUA 4TY8A 2XNRA 2K06A 1KQGB 3FUYA 1U8SA 4YR0A 2FZGB 3OR2B 4KPCA 3OTCA 4D3GA 4A8MP 4KIAA 1S0MA 1MN7A 1FT8A 1JLBB 4CLLA 3CSKA 3CC4S 2M52A 2EFVA 1ZBTA 3CIZA 3C19A 3DCAA 4ECZA 3SFUA 2V69A 2EEYA 3HVAA 4I0WA 5CD4A 2HWTA 3IP0A 3QATA 4DI6A 3Q23A 1KHVA 1IR1A 1HBUA 1QM9A 3DOMB 4HL9A 4IH7A 3DOLB 2DNOA 1ZS6A 3HFZB 2I6WA 4C2MA 3K5MA 2UVWA 1CLFA 4OX8A 4R8UB 1LW2A 2CAJA 2H65B 3J7YU 1QUPA 3Q22A 4DR3F 2ILYA 3MM8A 3K5LA 1Q8LA 1N48A 1X8DA 4RNHA 3CDWA 3KLFA 4K4WA 4IO9Q 3QGGA 4LF5F 1KLNA 4DMZA 1CC8A 2RE1A 2XM3A 3CJ8A 2CDQA 4MT1A 3W63A 3HLUA 3C6UB 1N34F 3EPGA 4F4YA 1RWNB 4OYZA 1HWLA 4FYVB 2Y8YA 2HHQA 2VF3A 4Z2XA 3G6YA 4ICLA 4N7TA 4U9RA 5HMWA 3H2UB 3O2IA 4C7QA 1K73T 3HI9A 2R7SA 1Z2LA 3AHPA 4DQRA 1TKTB 4DL4A 4FYWB 4I1TA 3A3PB 3BPSP 3KG1A 3LP0B 4RLEA 4F3QA 5D4OA 4JBCA 2PI5A 3H4DA 1NZ8A 4YOEA 2FJBB 2DBBA 3KG0A 5DDPC 1YJNS 2XG8A 3MM8B 4OYWA 3TVZA 4KTQA 4P72A 1BQNB 1NPKA 3M2VB 2I2YA 3JQMA 4DR1J 3V6JA 5A0YA 1WF0A 3OXGA 2J0WA 1HBUB 2IY5B 1OPIA 5IV4A 4NE9C 1UEUA 3NCRA 1XN9A 2V9WA 3CCJS 2ASDA 2GMLA 1RADB 2WHOA 1DLOB 1YKWA 1PCAA 3BF4A 4NASA 2YWGA 2RF2A 4P73A 5HI7A 2BW7A 2KXFA 3K57A 1PC5A 1OY8A 4KT0C 3K59A 3HCXA 3VHQA 3OR2A 2R2UA 1HBMB 5EWFA 2Q43A 5KFQA 3FCHA 5T7LB 1HIYA 1V6HA 3P45B 4MKVA 4ZJLA 3AOCA 4ZOSA 2FJDB 2UUBJ 2FJXA 2V8GA 3EXCX 3GIIA 2AT1B 2XMJA 4IH6A 3PJXA 4ED3A 3WDOA 3HHLC 3MR6A 3D3CJ 1LEOA 2DNZA 3EJMA 3MF5A 1NEEA 2NCKL 1ZM9A 4IG0A 4F4XA 1L3VA 1U49A 4N8NA 4RUHA 3BO3A 3BREA 3KHGA 4TXSA 2LEBA 4ELUA 2QA4S 3HHLD 1RE1B 1RHJB 1S99A 5IFMA 3RRKA 1IKVA 5DDQC 1H6KX 4FBTA 2H9ZA 3ADAC 3JSBA 4FVMA 2VQEF 4DS5A 4UT4A 3TAQA 1TFWA 3QWPA 2H54B 2ZKTA 1HKAA 4LR8A 1UWAA 3HSZA 2JRSA 4NEZA 4IKAA 4CO0A 1XR5A 5HQ8A 3G6ES 2R8HA 2C28A 3FSYA 4DWIA 3RBXA 1QLNA 4ECSA 2DNRA 2EG2A 2QC3A 4H4OA 1DTQB 2B6AB 4IUFA 3B8HA 4BC7A 2A18A 2BOAA 2XEXA 1IKXA 1HMVA 2FHJD 4LF5J 1I3OB 4Q8FA 1RTDA 1LQ9A 3MMCA 2F5GA 1JNRB 2OKQA 4DU7A 3HPOA 1UFLA 3ITHA 3S6EA 5AE1A 1ZZNA 1N34J 2KN4A 1HBOA 2JZ5A 2ZDOA 2CIMA 2XI2A 3FFIA 3PVXA 2QA1A 3H98A 3HK2A 3IBWA 3IG1B 1GMWA 1MWZA 4X62F 4TQSA 1Q16B 2C2DA 4RZRA 2ERRA 2GC8A 4CZCA 5KOXA 5J2MB 4X65J 2HNYB 2UUWA 3LAKA 3U7JA 1DURA 3M9NB 4DV3F 5D4PA 2QT7A 2HBQB 1GTHA 1YVFA 2C3MA 3TO8A 5C42A 1G2EA 1AFJA 1SL1A 1FFSB 3FFIB 1HWUA 4DUZF 1VRUA 7FDRA 3MFIA 2BKOA 5I3QA 5J1PA 4NLTA 2X51A 1QTNB 2D7SA 4C8OA 2UUTA 2RD5C 2DGVA 1MNEA 2VL1A 4GO7X 5BR8J 4ID8A 4J9QA 3IXQA 4LT6A 1RQ0A 5CA5A 2VIHA 1S10A 1TU0B 2JLFA 4OYOA 1C2PA 2W7OA 4N76A 4Y0FA 4KH0B 2BJ8A 3SEOA 2VJUA 3NNCA 2FB0A 1QAIA 4ANCA 2B9YA 2B6AA 2JEIA 3LWMA 4J9KA 3D1HA 2ZH2A 3NWGA 5IZHA 1FRLA 4ELVA 2W7PA 1IWGA 3G2XA 3FEZA 1TFYA 1U2FA 3IR6B 3UWTA 1URRA 3PW0A 3KOAA 3GWCA 1L3UA 2DY9A 2A1BA 2YPZA 1J2VA 1HPZB 1QE1B 4GO5X 4HHJA 1IN0A 1LWCB 3AD8C 4TYBA 3UFCX 5A2QU 5H9EK 4Q44A 2D3OR 2ZWPA 1NBEB 1WEYA 2DNYA 4NCGB 4YHHF 5KFGA 4PQUB 1Y00A 1X31C 2W9AA 3I82A 2U1AA 2HFSA 4FVCA 5HLFB 2DY1A 5GAHU 2AEJA 2QE5A 3R6GB 3KG4A 1ZM3A 2VFRA 2YKMA 3JS9A 4FBUA 5LT5A 3UN3A 5F8GA 2RF2B 3I5AA 2X1GA 1JLAB 1U6FA 1KTVA 1WKJA 3CJRA 3DC2A 4O0NA 3CIMA 2DKOB 2F4FA 4I2QA 4ED6A 4DFPA 1TL3B 1U0HB 2B8PA 2QL7B 2R4FA 3ZTPA 1S7IA 3DRXA 3IWLA 3J80Y 4QIWD 2FY1A 3NNAA 3POTB 2WSFC 4JI8F 5DQGA 5L8RC 3PJ9A 4EGLA 1HFEL 2VG7A 3JTOA 4CIOA 4P7VA 1MU2B 3PW5A 3K2YA 3HD2A 1DJ0A 1IBKJ 2PMWA 3E3XA 5K5MA 1UKUA 1JB0C 1HNXJ 4L3NA 3OR1B 4NA2A 4Z7CA 4CYUA 4B9TA 2VPZB 2V5HG 1M1GA 2EK1A 1XJWB 3A12A 3KWMA 4KPYA 4PZVA 4RNNA 4O23A 3KLIA 2XWYA 4LF6J 1RAOA 2FYXA 4FYYB 4OYIA 3PIOQ 3SV3A 5K9FA 1CJTA 3NCQA 4USIA 1N33J 1OO0B 3ICLA 1DRZA 4K5SA 3NOCA 1JQGA 3DRSB 4P10A 1Q7YT 2LU2A 2WW4A 1SQFA 2WSEC 1SQEA 4DZDA 1D9AA 5FIIA 1ZYQA 2QEXS 4NXNF 4M95A 3V5RA 2V2VA 3UN2A 2AEMA 3Q8UA 3RZAA 3EDRB 4AYBD 4OZLA 4U8VA 3WQPA 4CT9A 4JI1J 2QLJB 2J0XA 4KR0B 1KWMA 1RTJB 4FYDA 3NRBA 1QAXA 3Q8QB 2EFOA 2HFVA 1RBLA 3C16B 3DU5A 3QIPA 4AE5A 4DUTA 1BQMB 1WTFA 2WOMB 1RT1B 4UUWA 5DZ7A 3SSQA 3W61A 2L9DA 2V8DA 1RHQB 2E5LJ 1XNQJ 1P9YA 2AJQA 1GTEA 2AYMA 3EGNA 2RS2A 1HYSA 4WIQA 1J5EJ 1WHWA 3ENQA 4QQBA 4CCHA 4Y00A 3QO9B 2YQ3A 2CJBA 2HFNA 1R0AB 1M5KC 3NGRA 2CQBA 4NLRA 4LSNA 3R97A 1ZAXA 2L41A 3MDFA 5ETVA 3NL0A 1R31A 2RQMA 3KUGA 4ZHRA 3VV2B 1NO8A 2OHDA 1XR6A 2RUSA 3BR9A 1HR0F 3KK3B 5GMDA 4PG8A 1YX2A 1FK9A 2YTCA 3M6XA 5J1EA 3R5GA 4ZPWR 3O44A 2BYCA 3S1TA 1U0HA 3BR8A 5HMXA 1TK0A 2VQFJ 1TKDA 2PEHA 3IS9B 3PNIA 1MWQA 1NU4A 1TVRB 2YKQA 3DI6A 3N0VA 4NYZA 1BUXA 1LWXA 4DV4F 1VQMS 1RT2A 1X4DA 1QAJA 2OH2A 3NNHA 2HQDA 1DBDA 2DCUB 2ROEA 1EHWA 2K8GA 2ZD1B 2EC0A 2O01C 2VKRA 3M1VA 2WBMA 2BACA 5IS2A 4IQXA 1D3WA 1SPBP 4ZLPA 5IM0A 3OVSA 3UCGA 3SCIE 2GS8A 3D0HE 4P2XA 3GV7B 3RGIA 3MUVP 3M8SA 3RAQA 3GSIA 1KFDA 3OTOF 2IBKA 1WKKA 2W2NP 4LRCA 2XNQA 4OZ3A 4WU2A 3H25A 2W9BA 2CJKA 4WTOB 3CJ3A 4HDGA 1GXUA 4DL5A 1NLKL 1WUUA 1VHFA 2D3ZA 1RTHB 1WG4A 1Y5LB 2HHPA 4MFBB 1XMOF 4W90B 4DR3J 4I64A 5T41A 2DJWA 4ZP6A 2XSJB 3EXYA 3M9MB 3W2VB 3BS9A 3MM6A 1JNZB 4KYZA 1HHSA 3S8SA 1YRTA 5F9LA 4F4ZA 4U7CA 2NR0A 1SH2A 1RJJA 3UE2A 3AXMA 3NBPB 3OUYA 4J37A 3X1LB 1TKXB 1S1UA 2GO9A 1JLCB 5ETMA 1FERA 4WYLA 1RGVA 2JFDA 3QPIA 2XHWA 2Q66A 4C8LA 4LUBA 1KDNA 1UJ4A 2DGTA 1X4EA 2PSZA 2MJNA 1AB8A 4OZ2A 5C25A 1JIHA 3MUTP 4FF4A 3T1AA 1IKWB 4LIRA 4QBUA 2RIJA 3A8KA 4HACB 2VC0A 3PFEA 2ZZTA 2R7VA 2YX7A 3NKYA 3R5CA 2D1CA 5J2MA 1RYSA 3HZGA 3WZ0A 4WK1A 4Y65A 2DVIA 4A8QA 3FQKA 4K0KJ 2V63A 4NZ0A 1SC3B 2MQQA 4A8WA 3RR8A 3MCMA 2CZVC 2VC1A 4JI1F 1S4EA 3EICA 5DGBA 4DQIA 4S0MA 3W8PA 2CKWA 2YNIA 2LDIA 1X9WA 4WKYA 2EWHA 2YY3A 2HBRB 1J27A 1KKHA 1FX4A 4GVLA 1PYTA 1RACB 2UU9F 4TY9A 5LMUF 2QSFA 1WI8A 2MQOA 1BY9A 3KDOA 4IDKA 2HZAA 1SUQB 5E3QA 5FDLB 3Q8PB 4IDKB 1LWFB 5FDLA 1QSLA 1MMLA 1P1LA 3D0IE 4B3OB 3FVYA 1U8WA 4F0KA 1AUDA 2KT2A 1TKZA 2RU9A 2WB4A 4L3KA 6AT1B 5M2RA 4IO1A 3TZXA 1BWEA 1UVIA 4ED2A 1OYDA 3DXBA 5GVQA 4LFBJ 2UP1A 2ATLA 3W60A 4DV1F 3H7HB 2GJIA 5GADI 4AQYF 3QGIA 2DGXA 3C14A 5KG2A 4DFJA 3GJSB 2CJAA 4F7VA 5LOQA 2MZ1A 3R5DA 3FBEA 3QYYA 4ALZA 2F4VJ 3GU0A 4A8XA 5IM0B 4NLOA 1N6QB 1H38A 1GK8A 2YNGA 5A2QY 1WC0A 2HQFA 3NXZA 2ZM6J 4DSFA 1NKEA 3QT8A 1LFPA 2E1RA 4WK3A 3ULHA 3W7BA 3WX4A 4LF9J 2EI5A 3ETMA 4FXDA 3IBFB 1W2BR 5KOWA 3QRQA 1FX2A 1VQKS 2XY6A 3NS7B 4DV0J 4C3MA 3PX6A 3J81Y 1P1TA 4ILLA 4NLSA 3EGWB 2LQ9A 1H0HB 2QLFB 3CCQS 1KC8T 3ET6B 2M8DB 4JV5J 1T9XA 4DN0A 1KVIA 4MH8A 3CJ0A 1D1UA 1T95A 2W4DA 3L4BC 3BBFA 1ZOTA 4LSNB 2NZCA 3MR2A 4JI6J 4KC5A 3BN4A 1NB2A 4KQZA 5CYJA 4JI3J 2PD1A 5LJ5Y 3M4XA 3RBDA 3H2LA 3RRGA 3PXGa 2HVEA 4JI2F 4YR3A 1HW9A 4RW6A 2NXUA 2QZ8A 4KAIA 3BGRB 3CMES 1B0PA 1VK3A 2WK4A 4WXWA 2WAQD 4RWWA 2EFQA 2IHR1 5M2UA 4RR5A 1VIXA 3CD5A 3DDKA 4USWA 3V2UC 2RUGA 3QSIA 4I6YA 2XI3A 3W9IA 3RB3A 2NZ4A 3IR7B 3LGHA 5L1JA 1G4CA 4Y2KA 3MXHP 4ZJOA 3HP6A 1OJ4A 4Y2CA 2M5YA 4OX9J 1RTZA 3LP0A 2KG0A 2VA3A 5THWA 4N77A 2I1RA 2KXNB 1HNWF 4NLVA 1P27B 1WKLA 5DG7A 2GQQA 5KG7A 5AJ3F 4OI0A 2HFOA 1WSVA 2LEPA 2ZD1A 3T9ZA 4DLGA 1HA1A 2RJZA 1F3VA 2BQ3A 1RT6B 2AYEA 1NHUA 1RA6A 3GB0A 4WFXA 4K4UA 3IS9A 4GKKJ 4KFBA 2IM0A 4CLPA 5HANA 2AF6A 3CJ5A 1VQ4S 2WONB 1C0UA 3NLCA 2XYGB 3M7VA 5IXUA 3FZ2A 5A8WA 3L09A 3KK3A 3I4HX 3WBZA 4OIXA 2HAIA 2AJFE 4QIVA 5IC6B 4X4PA 5D78A 2MEWA 5C2CA 1FEEA 4JB8B 1K44A 5KFBA 1K0TA 3J7Z5 3GIKA 1R89A 4USUA 4DLEA 1WHVA 2OFHX 1HNZJ 4EU0A 2HSEB 3BBCA 1M0SA 3UI3A 4ZVOB 3DOMA 3ZO7A 4AFFA 2DO0A 1HYSB 2XZWA 3R3TA 4PKDB 2LP4A 1FKPB 4NEYA 4EMDA 1RKIA 1L3TA 3AT1B 1G6BA 2YX1A 1XNRJ 4NRUA 2JL9A 2FVQA 4KGXB 4DCOB 4ED8A 2YKMB 1WJ9A 4J9PA 5KFUA 3W8GA 4CM2A 2AKWB 4OI1A 3LWLA 4DR7J 1BMQB 1N4LA 5HLFA 5D4LA 2CWKA 3AB4B 3MAAB 2DXDA 1UEVA 4J9MA 1T9VA 3LA0A 4UY85 2UUAF 2XYHB 3MAHA 2XULA 4M8LA 1VRTB 4RUAA 4YFUA 2K3IA 1HHQA 3DRSA 4DV2J 2QG9B 2BE9B 5B0GA 1WOSA 1EP4A 3RB4A 1PGZA 4DQPA 2HW3A 1R0CB 2CPDA 1DAXA 2QO3A 1QE1A 2DNNA 4C98A 3BH6B 3HFVA 3GJQB 3TJ9A 1X4GA 2YWHA 3OL9A 4H4MB 3GIJA 1YZ7A 2BANA 1SCJB 1F5AA 2WVFA 4ID5A 4NPOA 5I3PA 1FTCA 3ZZUA 4I67A 4A8OA 1C4AA 3LP1A 1ZH5A 1B64A 4LFAJ 2DGOA 1E6VA 1Y5IB 4DPXA 3H5YA 1RLDA 3W9HA 4EI2A 4F4AA 2YKAA 2VHGA 4WF9Q 4ZKAA 1F9FA 3AXKA 1FD8A 4RW7B 3FRZA 2DTJA 2N4DA 1N32F 3MMJA 3G82B 4B3MJ 4LR9A 1JJCB 4C8ZA 3HJFA 1TL3A 2HBZB 3J7AN 5ETQA 2M9KA 2Z30B 2CJXB 2KG1A 3NY0A 4RW4B 3QGPA 3CJKA 5KFVA 1VQ7S 1KFSA 3HO1A 1KD1T 4WKRA 4FPRA 2PO4A 2VBYA 3BKFA 5JXSA 3FBCA 1YBUA 4CO5A 4DFKA 2AMCB 2BW2A 4DR6J 3VAMA 1N6QA 1MLAA 2NXJA 2MJUA 4NLDA 5DQIA 2GO8A 3LAMA 1Y11A 2P9EA 2VBZA 1VQ9S 1S1XA 1H2UX 1ELOA 2OPPA 2BZ2A 1EB0A 1XBWA 1UZDA 2J9EA 4KV8A 4U96A 3Q2TC 1UTAA 3C14B 2BM1A 4QW8A 5JMNA 4DU8A 1IBLF 2FHKA 3THTA 2O67A 3H20A 1KEKA 4ZVEA 4DQSA 2IAJB 4U8YA 5L9NA 1RTDB 1ZTTA 1R0BG 2W7AA 1AROP 2W4CA 3M30A 4G6VB 4J5OA 2I8EA 3HULA 4LSLA 5A8RA 1PJ5A 3MM6B 3NAIA 3FDSA 2APOA 2HLTA 2QL5B 3QAUA 3ENWA 2VASA 4K2XA 3W2VA 4IYQA 3SBMA 4MIAA 2DNMA 2ZDPA 1X4AA 1XK8A 2WVDA 3PZPA 2HEKA 2OPQA 5CYMB 3THPA 4OI4A 1ZM4A 1F5BA 2AIRB 4C0BA 2KRBA 3A13A 4Y2AA 2HNDB 2J0QD 4C8KA 1RWVB 4CLUA 4U7UD 1HW8A 1FTRA 2Z58B 5IOLA 4CNZA 4IR1A 3R5JB 3EMTA 2NXCA 3R7SB 1BXNA 4YDDB 1T7PA 1S4FA 1HQUB 7FD1A 2XY5A 4LF4F 2HHWA 2I9SA 4P2FA 4RX6A 2KU7A 2LXIA 3M1VB 2Q79A 3U1MA 4EO6A 3KHHA 2JEFA 3LANA 3H90A 6FDRA 4N41A 3F0NA 1Q0NA 2AWZA 2V2QA 1FDBA 1K1QA 2IJNA 1NM2A 1RT2B 3KJNB 1WC4A 4NLWA 4LREA 2R7UA 3GJRB 1AUSL 3GFHA 4XDCA 3RW6A 3Q0AA 2GA7A 4O0IA 1S6UA 2VG6B 1HBOB 1NAQA 2AV5A 3HHEA 4OZJA 4RL1A 1RBAA 2JSXA 5GADU 3EZOA 1V3SA 1FK9B 1NHKL 4FF1A 3IM8A 4OQJA 4PXBA 3M9OB 3DDIA 3RB6A 2YXLA 3K5PA 3RYLA 1CULA 3HFKA 4JYAF 3W1YC 3MOZA 2BA9A 4NZ7A 2OFGX 4YB6A 4OMFG 3SCJE 1NK4A 1O8BA 2Z2YB 1IVZA 3IGVA 4X4TA 1Q5VA 4ZLJA 3TARA 1FRHA 3SXLA 2Y0SD 1K47A 4MFBA 4QPTA 2NUUG 2XC9A 3CC7S 3JYTA 4RBUA 2OUGA 4MYTA 2DRDA 4DV7J 3FKBA 1FRKA 2R2TA 1FRIA 2EFGA 1Y9OA 1SI9A 4QOTA 1X5SA 3VAKA 2GHWA 1HI1A 4DX7A 4WCEQ 2ZNYA 3AQOA 4J9OA 2XS7A 3F73A 2NQPA 3I5BA 2ZOMA 3SMZA 5L38A 3PACA 5E3AA 3DRPB 4UZBA 3HVRA 1U24A 1H2VZ 3M2RB 1TKTA 4HDHA 3JB9k 5K14B 4Y3CA 4M1KA 1TR0A 2E9ZA 2E9TA 3HSDA 4DL2A 2OEMA 2W25A 2ZNZA 1S1VB 3G8QA 1YJUA 5F9NA 5IQQA 3H4BA 3CC2S 1CS4B 2CPYA 4A8KA 4B3SJ 2J7WA 5KFNA 1C1CB 2KH9A 4QYZJ 5D0GA 3I56S 2ATCB 2DPJA 1VC6A 3DGVA 1IBLJ 4M5NA 2BJ3A 2CA9A 4WFAQ 2DHGA 1YJTA 3ZNUA 2C1EB 3GCWP 1SKWA 3KYLA 2HQ3A 2IPOB 2DNHA 1JK9B 2OP5A 2PA8D 3HHLB 4ZPDA 3R1HA 1T05A 4USMA 3DYAA 3N01A 3Q8RB 4ECRA 2OEJA 1DLOA 1IBCB 3JQJA 1R0AA 1MU2A 2K7KA 3TYTA 3QO9A 2LYVA 4HEA9 4JV0A 4B9MA 4QCLA 2PA3A 4F36A 2YX4A 1ZPWX 3EE3A 2DHAA 2B56A 4CO2A 4DPTA 5A0YB 5KFMA 2QYGA 2YKNB 2HNZB 2IRYA 3TWZA 5HMZA 3C16A 3GP9A 5KFRA 1VLOA 2CPEA 3M8YA 2DR8A 2RNEA 2COLA 3NCPA 1RDRA 1PJ6A 3GR0A 4LQ3A 1C1BB 1S59A 3L95X 5ETNA 2J8SA 1DQ8A 4E8UA 1F6TA 1RXOB 4DV3J 1FWPA 2UUCF 2ZBCA 3M6VA 4Q2MA 4DSKA 1C0TA 1TL1A 3PFOA 1ACMB 1RISA 4KGMA 4BS2A 5D3GA 2LCWA 2WZ1A 2OSQA 4B9UA 2E1PA 2LEAA 4QYRA 4K4XA 3M8WA 2NLWA 4FP9A 4TN2A 3D4JA 4OYXA 2OPSB 3BKTA 1SV5A 2G13A 2KT3A 1U1PA 3NGKA 2DK2A 5LSRA 1X9MA 2BQUA 3JTNA 1Z2ZA 3QWUA 3KXDA 1N36F 2Z2MA 2PI4A 1VISA 2LLZA 4YQWA 3J7YI 1U0SA 3PW4A 3WX8A 2XMVA 1S0VA 1VC5A 4LF8F 2G4BA 2HFZA 4CLTA 1REVB 4NI2B 4IOCQ 3DU6A 3K8VA 4JV1A 1IJEB 2FZCB 2VG6A 2R8GA 1S12A 1X4CA 1U4BA 3FC9A 1M5OC 5DGAA 4ZIVA 5K8OA 4K4YA 2DD8S 1TELA 3AB2B 4YHHJ 1BQXA 2OELA 4C8NA 4KGVB 3ZNJ1 1IBMF 3E01B 5AJ3J 2IC3B 3VGVA 2DR9A 4ZIWA 5AXKA 3E8OA 3MURP 5LMUJ 3CDAA 3SZ2A 2L9WA 1HQUA 4DR5F 2ACYA 2ROGA 1VBKA 3QRRA 2P6SA 4ZK7M 4QPXA 3GSDA 3PG9A 5D15A 1NKBA 3GYNA 1S7HA 2B5JA 5KFWA 4Q5VA 1LWCA 3OFHA 2MZTA 5B09A 2X3GA 5LJ3Y 1RCOB 4J9NA 2B4VA 3R7NB 2G1HA 1RWWB 4J9LA 4F25A 4ECUA 2B4PA 1V3ZA 4BBYA 4FNHA 4GC6A 3PJWA 3H0PA 1RAEB 4ED1A 1PILA 3CJSA 3KJQB 3QRPA 4PPDA 4EWTA 4O4RA 1IR0A 1MN9A 5DDOC 3BGLA 3B82A 4HTIA 5GAGU 3H5UA 4RNMA 3T5JA 1N5YA 1Q78A 1O0PA 4IOAQ 2JC0A 2KXHA 1RT3B 1UP1A 4WP9A 3DRRA 1FFGB 2H5IB 2R3VA 4G1PA 3RB0A 3DRRB 1B4SA 1UA1A 2Y8WA 5H9FK 1HQEB 3FGVA 4ES3A 2AGQA 4C3LA 1Z1ZA 4ED7A 2UUBF 1S77D 3R5BA 2ZC3A 2IM1A 1KOOA 3AOBA 1SH3A 2ZE2A 4QR0A 2XTJP 3KMSA 4DR2J 2FVRA 2GIRA 4JI0F 2UXBF 4F67A 1A7GE 2CZ9A 3D6FB 3DFEA 3LPEA 1VJQA 4IG0B 4MAKA 2H4YB 1U48A 2CQDA 1TZ0A 4MKYA 4TLRA 2K7JA 3KLGB 3HZEA 2DRAA 3D68A 2VD3A 1NK7A 2LXUA 3SIPB 4JI6F 4I6WA 4NCAA 1JKHA 2CDRB 3T1HJ 1WWHA 4CI0B 2BDPA 1S1XB 4KV8B 2EKYA 5EGYA 3EGZA 4RWXA 4DHVA 3QSYB 4DOZA 2OJ3A 1M5VC 2ZJRQ 4JI7J 3VVUA 3CJQA 4MK9A 4ED0A 1UETA 1SKUB 3MMBB 2MTLA 1JLCA 3PEJA 3I6PA 4DCJB 3BKUA 2FC8A 1Y0HA 4QWEA 3QQCD 2POKA 1HMVB 3EX7B 1GMUA 4R5PA 1NSAA 5F3ZA 3N5FA 4G1QA 3MEEB 3UVJB 1FI4A 4MYUA 2J0SD 1KR4A 1GNKA 2IM2A 3PM9A 4QIFA 2Y3YA 3A4TA 3I87A 2CFXA 1KLMB 3NS5A 3ENAA 4MTPA 4WBFA 4WJBA 2A6OA 2GW8A 2KM8C 1BD6A 1CBKA 1CVJA 1RUSA 1RT7B 2DRBA 3GYGA 4USJC 1PAUB 4G1IA 5HROB 4LQ9A 2V4RA 2A0FB 2FUG9 1N54B 2J9DA 2AU0A 2P6TA 3GFYA 2YKOA 4WFBQ 5GAEU 5H9EJ 2VONA 1VHIA 1KOHA 3N9UC 5ETPA 4CO1A 7AT1B 1RA7A 2MLXA 3CO9A 5DLFA 2ZVIA 4ZP7A 4RNOA 4YP3A 1OSCA 2HIYA 5D3GB 2VDHA 1PAEX 3EGVA 4C9DA 2NSBA 3J7A1 3LPYA 3FNNA 2AD9A 1U25A 4OJHA 3UD5A 2HHHJ 2KI2A 3C6UA 3G8TA 5KAKA 4PWDA 2E1CA 4X4UA 3MAAA 3CDUA 4M5DA 1X0PA 1FCAA 1C1BA 1IQZA 2RSQA 2V8PA 4ZHRB 1GFWB 3L7UA 4OZ5A 2BOPA 3N6NA 4IRKA 4RU9A 1KQFB 2VBXA 2V2ZA 5DG9A 5CQGA 2GAHC 2ZWOA 1QJHA 3O3LA 3BN7A 2O66A 2MKJA 1Q1KA 3M6WA 1RHUB 4ECTA 3IRWP 1DZ5A 2FLNA 4A8FA 3KKFA 1PBUA 1DQAA 2EC2A 3AH6A 3OLBA 2HGNA 2Z0GA 1VBZA 2UXDJ 2OTJS 4DV2F 2MZRA 3GG1A 5HJYA 4DL3A 2ZH7A 1RHKB 1UVNA 1BQMA 1TL7A 1DARA 5CZVA 4ZPBA 1KQKA 1T05B 1MWYA 3B4MA 4ZVHA 1JXLA 1SJRA 4K4SA 1HNIB 1BE4A 4KO0B 5ITHA 4DPYA 3TA2A 5EN1A 1WD6A 1DTTA 3KNAA 4QWAA 2EW9A 2HIQA 3KJFB 3D3BJ 5F8IA 2V0NA 1I94J 1RWPB 4LFAF 2VBWA 2OIHA 3TUIC 2KYZA 5F8NA 2F1FA 4DS4A 3TRGA 2H3EB 2I38A 4YY3F 2R7QA 1FDDA 2IRUA 3LF0A 4WP3A 2PIIA 4WTYA 1F1BB 5KFLA 3W64A 5KFOA 4DUYJ 3N6MA 9RUBA 1SH0A 2M2BA 1S1WA 1F2HA 1WACA 4KO0A 4XK8C 3OBIA 4I56A 1TAUA 2XLKA 2ZH9A 3CJ4A 4PUOA 4HI2A 5E2QA 3MAQA 1I51B 4JOUA 4IOBA 4K2JA 1NPPA 4M5JA 2BJEA 2DR5A 4LFCJ 1A9NB 3C3LA 1HWKA 3AFGA 1BGXT 4GRSA 4ZVQB 5LXYA 4X65F 3JYTB 3PW2A 1UL3A 2JEJA 2WVCA 1B0TA 1F3FA 2B8QA 1FXRA 4FNIA 3FSXA 5DQHA 3O1LA 3ZZOA 5KTQA 1AA1B 1EQ0A 2EFPA 3WIVA 5LSOA 2GMJA 2MGZA 1C4CA 1HWJA 3KK1B 1VQNS 5HK4A 2CQ3A 4UOCA 1OS5A 1SJ1A 2NXEA 3ZFVA 2RDJA 1FKOA 1CJKB 3DLJA 1VIOA 3I0RB 3NGSA 3TEGA 5HATA 3ZZPA 2HS3A 5MLCV 3OVBA 3MM5B 3K17A 2MQPA 1UFWA 4PQUA 2MDAA 4RJVA 1J5OB 2EFNA 2W8KA 3CO0P 3GONA 3A1YG 4O4GA 1VQ8S 2X3DA 4OI6A 1RBOB 4DV0F 1L3KA 2GHVC 3I32A 4C97A 3GLJA 1L5UA 2DB1A 5LSLA 1WC1A 2UVUA 1RABB 1NDPA 5DG8A 4YMEA 3N5BA 2BKPA 4YN3B 2AEFA 4LBHA 4ETZA 1TUVA 2HFUA 3QGHA 4DJBA 4OJGA 4R0JA 1NZAA 2J7KA 1HL6A 4W92B 4DCPB 4LF4J 1VQOS 1Y4ZB 4LRAA 4C0HA 4LSZB 3G71S 2KJWA 2NUHA 2WCXA 4CM0A 1H7WA 3EM1A 5CYMA 2KJVA 4C6AA 4Q43A 2PN6A 2B7BB 2IYGA 1FF2A 1LWFA 1T0TV 4WU3A 2IVFB 1GXLA 1YJVA 3TX0A 4CO4A 2GFFA 2M70A 1HD0A 3KK2A 1FA0A 1YJWS 2MQ8A 3PYGA 4ERDA 4OFZA 4JI5F 4LBPA 4AD6A 4GVBB 5D0HA 5KT4A 2XO6A 1R8CA 3CW2C 4E98A 3MMBA 1YGYA 2J5AA 3D5MA 2CJYB 1FWKA 1CJVB 2CPJA 2VUGA 4HI1A 4XO0A 4UOFA 5HVFA 3H5SA 5FLXY 3SCKE 1AZSA 1YTYA 2GIQA 4X2BA 4M5GA 1APSA 3HXMA 1U1LA 4R0EA 2C3OA 2H4WB 2G0CA 2B0GA 1VCTA 3E51A 1FNOA 3DRYA 5EX3A 5HQMA 5H1SV 5IWAF 2GGPA 4BCAA 5KT2A 5F0UA 3VCDA 4J9SA 3UCUP 1W25A 3MMCB 1OPZA 5I4MA 5KFDA 2XCPA 3GIRA 3OUYB 3ISZA 3C15B 1GX5A 3D6HB 4OV1A 4LMZA 3HT3A 1N5TA 2EKNA 3JXOA 1S6QA 3DLHA 1D09B 4C8MA 1DTQA 2DHXA 5A6WA 4FPIA 3HVTA 5K8PA 1IXKA 1HNZF 2QL9B 1HQEA 3HKWA 4QWBA 1XMQJ 1OQ3A 1H74A 1NJZA 3KTQA 1HBNA 1ZA1B 2BX6A 4O3PA 5EHHA 2E7XA 2EXUA 1E6VB 4EBEA 5A8KB 3KMQA 1IKVB 2DCLA 2XHCA 1NUEA 5L9XA 3W5YA 1N5YB 3MPWA 2XSJA 4URGA 3DM2A 2F8EX 2H48B 3C46A 1XNQF 2F9JA 1KS2A 2L9NA 4QU6A 2YWFA 2DIUA 3RAXA 1TL4A 2C2EA 4F0MA 1S76D 1NKCA 3IGNA 1Q7LB 2E29A 2G1DA 3WC0A 1IQTA 3NGDA 1LXNA 3I0SB 2PEBA 4GC7A 5IV3A 3G6VA 1W7WA 3M6UA 4KHPF 3TUJC 1UW4A 1XR7A 2E5GA 4DX8H 3MEGB 2QA2A 4USHA 3ZZYA 1T9YA 1FESA 2J9CA 3PYFA 3NGUA 1WEZA 3OD2A 4RW9A 2N7CA 4KRWA 3BO2A 1HR0J 3CJTA 4FZVA 5HBMB 2B7CB 2HS4A 3H40A 2HLUA 2Y1JA 1TV6B 1JLQB 3K5NA 1F2GA 1UWBB 2QFJA 5AXNA 1SBRA 4IRCA 2KZZA 3G6XA 2GVZA 2DH8A 2BE2A 4ZVSB 4OJ1A 2ZZNA 4Q0BB 4RKUC 1SXLA 3GV8B 4JV2A 4B3RJ 4CRJA 4C11A 1NXIA 1WF1A 1X0FA 1Q81T 2ZJQQ 4A47A 4ZP8A 2XQCA 2ZOGA 1BQNA 1Y3JA 4AQYJ 4WIIA 4DF8A 2VOOA 3P6YC 4ILMA 2WOMA 3D7SB 2DXEA 2R7OA 1FWLA 2HQGA 4KBIA 3UO0A 1NH7A 5KG3A 3HHLA 2YVSA 5IQ6A 1U1QA 3VTIA 1R3NA 4DL0C 3EWGA 4DV6J 2R8KA 3UQSA 2W4PA 4L75A 4M5DB 5IT9Y 3UNGC 1VQYA 2LVWA 1GT8A 1E6YA 1UAWA 1RT1A 2IM3A 3QIDA 2MB0B 1FXLA 4RPFA 2B9XA 4J9VA 5D4NA 4DFMA 4LRDA 2PFDA 3AA9A 2FLLA 4K50A 3U1LA 1FJGJ 4KH1B 3U02A 5L39A 4RBTA 1D9DA 1Y10A 1JJHA 1WDDA 4OYMA 5L1IA 1NK6A 4HKQA 3G86A 2ROPA 3DRPA 4F04B 3IM9A 2VJVA 2WW8A 4QR2A 3P8BB 3PRBA 4ER8A 5LL6d 2YH0A 3I31A 2SXLA 2CPIA 3OHAA 4D3HA 4ZVFA 4N47A 3M05A 2A2CA 2HQCA 2KHDA 3CMQA 4K5RA 3I5CA 1RTIA 2GQ2A 3KHLA 3MCNA 3D1QA 1ZTWA 5E7OB 1N52B 1TUGB 2HNZA 1SC4B 2ZH6A 1K0VA 2ACMA 2BXJA 3P3DA 3OJUA 1B7FA 2HQIA 1VJWA 4LR7A 1RP5A 1NMEB 1YHQS 1S6PA 2J8AA 3I96A 5C24A 3UVJA 3GCXP 3A3OB 4LRFA 4OX9F 2FVPA 1NPRA 2BR0A 1U2RA 2HK2A 2M8HA 3FMBA 3TEHB 3C6TB 2E1MC 1TV6A 2QGFB 3ISND 2VG7B 4PG6A 3ET6A 4IQMA 2EPIA 3MM7B 4IFVB 5J2PB 2XMTA 1SJQA 5JVHQ 3BPDA 3SYZA 2CPFA 5F0WA 3W5XA 5KFXA 1WF2A 4PWWA 5HAOA 2W2MP 2L3MA 2P9CA 1FVQA 2HRUA 3PR4A 3KLVA 2MHNA 4PWDB 3I9ZA 1C1CA 3QZ8A 5KFHA 2VFTA 1YJ9S 1YWXA 3GFXA 2YWWA 1VS3A 2DNLA 5BYRA 5B0DA 1CJUB 5G4DA 1WI6A 3Q89A 4C3KA 5K20B 5K14A 1UVKA 2YNHA 3ONQA 1A0OB 2C22A 1S5ZA 4Y34A 3RBZA 4AL7A 4DR2F 2EG1A 2XY7A 1WHXA 3CT9A 4UOGA 3LALA 1WG5A 1T8EA 3CD7A 3BM7A 2AGPA 1FO1A 2BMBA 3QT6A 4I2PA 3QZ7A 3ENVA 4P6QA 2JLGA 2JH3A 3DOKB 2JDJA 3V6KA 2ADBA 1G1XA 1S9EB 3GQCA 5CYQB 4L74A 3FK4A 1RT3A 2JFKA 3EVWA 3IFEA 3QBCA 2NPFA 2KFZA 2FJEB 3DDNA 4DV7F 2C2NA 3IRXB 1I5OB 2HWIA 5CH7B 2C2OB 1RAHB 2IDEA 5ADZA 2DH9A 1A6LA 3DGPA 1F5CA 4PG7A 2GJFA 2FC9A 5KFAA 4DV6F 2FY8A 4JV5F 3C66A 2UVRA 2IMWP 4A48A 3K7RA 4DPWA 3N4WA 5IT0A 3OSPA 2O5DA 3LTOA 2N3OA 3I55S 1CG2A 3TANA 3HM9A 2VFUA 3L7PA 4PAAA 3MHYA 4A46A 2CUYA 2LQ5A 4X4QA 4BDPA 1DHMA 1G3OA 1X60A 2GX8A 3FCVA 1U02A 2LECA 1S48A 2HZCA 4UOHA 2DEJA 2VQEJ 3BYRA 1AW0A 1NSQA 4K4VA 2IC3A 2CQPA 3W3SA 2NXNA 4U7UK 1JLGB 4TU7A 1FHTA 3IWNC 3RAMA 2AZ3A 2DYAA 4YB7A 5G0RB 5I3UB 2QA4G 2OMOA 3UW1A 3Q8SB 4KJIA 5D0RA 3CGIA 5E3CA 3IC1A 1HLWA 3LOUA 5HMYA 4ATNA 1Y3KA 1GEHA 1T9WA 3OXFA 4Y6IA 3PDNA 4NI2A 3P49B 4OHVA 4CH0S 5KT6A 1BLUA 2RHSB 1BHNA 1SB6A 1S9EA 1X4FA 4ZITA 5RUBA 1JWWA 3QLHB 2OPQB 4K8RA 3J80U 1T02A 1UPMB 1K1SA 2RILA 4RO0A 2HVHA 2MMYA 4ZLNA 4B9VA 3P5TL 2KM8B 4DV4J 1B99A 4ECYA 2V4QA 2F8HA 1SV5B 1YK9A 2ZEJA 3ELHA 2V4JA 1PJ7A 3ILOA 4DZ6A 2BANB 3T3FA 2Y1IA 4HHUA 3VR1A 4AXJA 1Y7PA 1M5PC 4O3NA 4WZMA 1U1OA 2ZUGA 4DG1B 2M7SA 3D67A 4NLXA 2LA4A 2MSTA 1XERA 3N79A 4P7TA 4PYDA 3J7ZT 1FRMA 2DH7A 1U47A 3AD9C 4OZ1A 5BR8F 4RBVA 2AJ2A 2DHSA 4P52A 3Q8YA 3RRHA 3I0RA 4P2MA 1NNDA 1CJUA 3SQGA 2OSRA 4U67Q 2DNGA 3KLEA 4ZVRB 2ZH8A 3VAGA 2V2KA 2ADCA 2RRNA 4USKA 4NWBA 3KLHB 1VC0A 3CJKB 1F9HA 2DITA 3BQ0A 2KFNA 2LA6A 4HVZA 4DSEA 1X9SA 4NA3A 4TU8A 1N33F 2O1PA 3W5ZA 4A4JA 1FDNA 2B43A 5T7LA 4CLKA 2BE7D 3G82A 3OFGA 2XS2A 3TR5A 1UJ6A 2ZBPA 2JVRA 2VU5A 2ZC4A 2VPYB 4CDIA 3SI8A 2P8IA 1JXEA 1WC5A 4Y2MA 4CWBA 3GTYX 4YB5A 2R7RA 1QVGR 1EIYB 2OO4A 3DYAB 5KFKA 4DQQA 4PUOB 1FE4A 3VQSA 1SL0A 3LQVA 1NK9A 3B54A 4DUYF 2LU1A 1X5OA 3TUZC 4DDFA 2HG4A 3IAM9 4ZJQA 4N56A 2WONA 1PG5B 4KE5A 3CD6S 2UXCJ 2BABA 4MK8A 4F4WA 4ZCLA 5IT4A 1K8AT 3MZIA 4QWCA 4R25A 1RT6A 5GAHI 3QFHA 1NJXA 3TQEA 1HQ2A 5DETA 1OMSA 2MSSA 1IM6A 3JAMU 2D9OA 1R8PA 2MHEA 3ZZRA 5ETRA 4OI3A 3H59A 4WFZA 1R43A 5L1KA 1FFWB 2N7YA 2VZ9A 3MEDA 4OHZA 3SSRA 4AXIA 1SJ4P 2BJ1A 4KB7A 2QV6A 4NMLA 1KHWA 5JUMA 3CF5Q 5AT1B 1U6ZA 2DPIA 2C2MB 1GMVA 4MIWA 1CJTB 3CE8A 3TJAA 3TVKA 3MR3A 4NCBA 1H98A 3HD1A 3Q83A 3BBBA 2DR6A 4J9UE 3V4MA 4X62J 1Q82T 1AXQA 4NRTA 5J2NB 2M88A 1NSPA 1NK8A 2HGMA 1BC6A 4UW2A 2CQIA 1RWUA 3O5TB 4RW6B 3D6MB 1N5VA 5K8MA 1JXVA 4X66J 3OR1A 4QWDA 3KLFB 1D0EA 2D74B 2ZUAA 4B3TF 2UZAA 4J7CA 1U1KA 4UQGA 3OTDA 3OHBA 3HKZD 2MKCA 3MMAA 4E2FB 4ANDA 1UFKA 3OTOJ 1FRJA 1LW2B 2F3JA 4A8SA 1D8ZA 4BHQA 1JLQA 3CPWR 2F4VF 3X3UA 1Q86T 4YEAA 5D77A 2BJDA 5B0AA 4X4SA 4ZCIA 1IKYA 3POTA 2AQ4A 4DXLA 1C0UB 2R8JA 3MI7X 4RW9B 1AT1B 2HVIA 4LF9F 2CQ1A 4PQAA 5E3RA 2HRTA 2P2CB 3GYXB 1JLAA 4FYXB 5EDWA 3VZHA 2G0JA 4M63A 5EWEA 4TQRA 1K9MT 1S49A 2CNKB 1T03B 3M2RA 1NHVA 2IMOA 1NK5A 2WB1D 2AX1A 1Q79A 2BUNA 5E3PA 3ISNC 2XMKA 4NCGA 2WBRA 2FIUA 3BJYA 1NDCA 5HROA 2IIHA 2FQQB 1RWMB 2HNDA 4L73A 4Q45A 2CPXA 1O5JA 2AX0A 2PE8A 3DMJA 1JX4A 3B4DA 1EQMA 4IFYB 1O6XA 1ICEB 1WSRA 2Q6CA 4KGZB 4L76A 3R6LB 1H72C 2CQ0A 4CTAA 5B7WA 4RUCA 2HMIB 4EZ6A 3L3CA 3CTRA 2WSCC 1OWXA 1AFIA 1PC4A 2XLJA 3GIMA 5A8KA 1N8RT 1UPPA 2C3YA 5T14A 4OHYA 1CULB 2GCFA 3DLKB 4ZS6A 1D8YA 3K8WA 5F8LA 1KN6A 1LW0B 2M4MA 2Y1LB 3ZC4A 2QTWA 1PO6A 2IVMA 4Q8EA 1FD2A 2OD6A 3GR1A 4JYAJ 5I42A 3ZTSA 1HNXF 4TVAB 4NZ6A 3RW7A 4F02A 1FJ7A 3IR5B 3G4SS 1YRUA 2V6AA 3HX9A 3KLGA 4UTGA 1RYRA 2HHHF 1VYAA 4ELTA 1S57A 5KT7A 2KTQA 2Q6BA 2YBVA 3EVMA 5KG5A 1R8AA 3MECA 4HACA 1KSPA 2FLPA 1M1HA 5KFJA 4NXMF 3G8SA 2ZVSA 1R6YA 3KK2B 1B70B 5C25B 3Q24A 1QAYA 2VOPA 2UVVA 1WNEA 2YQ1A 3OL7A 1B0VA 4F3MA 1BWVA 2WVEA 4RW7A 5AE3A 4TKTA 1LW0A 5CCLA 2ZM6F 3M8QB 1S0NA 1IKXB 1VRQC 2WVBA 1YRXA 3DLKA 4GKJJ 2CRLA 4QZVB 2AJ4A 1GAOA 2V34A 1N56A 4IR9A 5LXRA 3LW5C 1M90T 4I7FA 1MMDA 3OLAA 1S72S 1UVLA 4M5MA 3M30B 4LSLB 3ZTRA 1QDUB 2MY8A 4Q7AA 5CYQA 5DLGA 4YR2A 3TQ1A 3CJ2A 1RAAB 2FZKB 1J5EF 4UUXA 3OL8A 4DR7F 4WZQA 1TP7A 2OPRA 4AL5A 4DR4F 4F2SA 2KYXA 3TW0A 1Q4RA 3HMJG 4W4MA 1UCNA 2AHOB 2KHCA 2CQ2A 3V6DB 4EZ9A 1NDLA 1R6VA 2OPPB 5F3TA 2W9CB 5GMKa 1U1MA 4OX7A 1SJ3P 1I94F 2MKHA 1CEZA 1QSSA 2W2OP 4EUVA 3MM5A 1URNA 2MKIA 4FKXA 4ITSA 2MZJA 1SIWB 3LUYA 1N0UA 1IR2A 3LP2B 4LBIA 4URSA 5KFSA 4FN5A 1WHYA 4WYWA 5HN0A 3GILA 1QTMA 1KONA 2UU9J 2G2OA 4IRDA 3RG6A 4K4ZA 2MKKA 2KL8A 2C2RA 4X4NA 3BDEA 2UUCJ 2HRYA 4X64F 3T1YJ 3EPIA 3MPDA 2YWKA 4PABA 3J81j 4EEYA 4E0DA 5J1EB 1SJFA 1FKAF 1QSYA 3U1NA 1LV5A 3R2CJ 1RT4B 4KKOB 2CPZA 1REVA 3IMQJ 3SFGA 2OI2A 1I1GA 4ECWA 4LFBF 2H5EA 3TZYA 2MGZB 3KK1A 2KT5A 4WFNQ 2GNKA 4PG5A 5J1NA 1XC9A 1YG0A 4MK7A 2PMZD 4B3MF 1RAGB 4WXOA 3FJ2A 4YB1P 2BRLA 1S6PB 5C24B 5B0CA 3H42A 3M8ZA 2AYGA 2WRMA 2HMIA 1MROA 2C2ZB 2QYCA 2A10A 2VKZG 4ID5B 4XAKA 1UW9A 5A8WB 2MLYA 1JLEB 3CCLS 5J2NA 3M8PB 2NREA 3DMJB 5FD1A 4X4OA 2C3PA 4J91A 3N6LA 3TJ8A 2ZJPQ 1IJFB 2Z2LA 4UQTA 3QIPB 1F0XA 2RH3A 4TNOA 4B9SA 2EK6A 4P2SA 4ILRA 2H1YA 3DXSX 1FNXH 4WPAA 4DUZJ 2HHTA 1RLCL 4J9RA 2QMWA 2Q1LA 3FQLA 4B08A 4CLYA 4WE1A 2E9RX 2RHQB 5DDRC 4ANEA 2AZ1A 2IJRA 3RR7A 2MKSA 4HLBA 4AUKA 2JHEA 2NYIA 3D6TB 3OXLA 5CZXA 4ZPVR 5DZ6A 4O3QA 2B4OA 3TA0A 2RQCA 3MEKA 2X1AA 2CXEA 1ZETA 1HNIA 2RU3A 3LGMA 4JP8A 2GMHA 2ZBIA 4LVNP 1N0VC 5KFTA 1VQSA 1TL7B 2OTLS 4X4VA 1VLYA 5HSPA 1VQ6S 1FKPA 4H4KC 4ECVA 1L3SA 1MSWD 2VH7A 4XTTA 1IKYB 1NH8A 4CQ1A 4ZVUB 4IH5A 5HL7Q 8AT1B 5KFCA 4DR5J 4OLPA 1EAYC 3D54A 5KFPA 1LK5A 1HNVA 2U2FA 3P96A 1NRKA 1UZHA 1QUVA 4CLFA 4ZCMA 3MMAB 3TNVA 3CCUS 1Q8KA 3SSSA 2JNJA 2ZHOA 2HHVA 1FRXA 1P9QC 1OY9A 1TUWA 1GX6A 3DOLA 3ZZTA 8RUCA 1WDTA 2LQJA 2FHJA 2HS0A 3AY0A 1KP6A 2HK3A 3BSNA 3AQPA 4TLQA 4DL7A 3OTBA 1JJ4A 4XPEA 1N5QA 1P6TA 2FTRA 1FE0A 4ED4A 3KLHA 4HTJA 1CQNA 4DPUA 2QSWA 1S1VA 1KNZA 5C5JA 2GVDB 2R42A 2VA2A 4I4BA 5HBMA 4TU9A 1T9UA 2IRXA 4WWSA 2O3DA 2V8HA 4C0OC 4JI4F 2R2RA 1XIQA 2E5JA 3CCZA 3CB4A 1W26A 3LH2S 2HGLA 3W66A 3ZTOA 3NG8A 2JVOA 1P8GA 4ZVPB 1SKSA 1YITS 4LIWA 2Q3PA 1X4BA 4DV5F 1KRPA 2RB7A 4JI0J 3F41A 4UZCA 2RT3A 3T1YF 4CH7A 4X64J 2CPHA 3HSGA 3I0SA 2ZITA 4ECXA 4FKYA 2GJ2A 2OMLA 2J6TA 1S9GA 1RK8A 2I5JB 4H54A 4UY8T 2HBYB 2ZOFA 1RKJA 3BGRA 3QJLA 4I69A 3PYDA 4F3OA 4GMKA 3T1HF 1VK8A 4M5HA 4CYUB 3K89A 4LF6F 1W2IA 4QU7A 1ITPA 3TP2A 4RNFA 3OVAA 3QJPA 1ZAVA 5SZTA 3OV7A 3BSCA 5DS7A 3VQTA 4DN9A 4K59A 1UMJA 3BGOP 3H8YA 4R5PB 5FJ4A 3WC2A 3V81B 3D1OA 4I68A 4NOHA 3TZZA 1UJ5A 1RHMB 2J9DE 2Y0BB 1YZ6A 2UUAJ 4KGKA 4QJVA 2XB2D 3OT9A 4RU2A 3HVTB 3OFFA 3PKYA 1ULRA 1ROFA 2BEFA 2M0GB 3H5XA 3CCRS 4G1QB 4NLPA 4LF1A 2IBOA 3CCWA 4G65A 1WG1A 2D3UA 3HHDA 5ETTA 4XIUA 1HHTP 1WELA 1JLGA 3KLEB 1EKSA 1KTQA 1V5VA 2HNYA 2VDIA 4PCQA 5ETOA 4ZCKA 2ZH1A 2MQLA 2ZHAA 3DLGA 3NP5A 2BM0A 2ZFHA 3ZXWA 4CLSA 3MFHA 2PFFB 2ZBQA 3QFWA 3A8JA 4EO8A 4NYOA 4LRBA 4RW8B 2JOQA 3JSYA 4OZ0A 3MR7A 5E41A 5KG0A 5CD4H 3HT0A 1KVKA 1AZSB 5HVHA 4IG3A 5KT3A 2MQMA 1NCLA 4P71A 1GXTA 1IUJA 2ZKUA 4RUBA 3V6DA 9ATCB 3MOJB 4OL8A 1DFDA 4X4RA 3BSAA 2RDDA 4NLGA 1N88A 1S1TA 3B6BA 2QLXA 2OEKA 3CVKA 2UV8G 4FS1A 1N32J 1V5IB 2BVZA 3NBPA 4X66F 4V1Ak 1TKZB 2XZTB 2RAQA 1RWKB 3V4IB 2W8LA 5HVGA 2EBEA 2F9DA 1RI7A 1SUQA 2D69A 2ZE2B 4MIBA 2W1BA 4A8YA 2XGQA 4L6V3 4BWJA 1N5SA 2ZHBA 3G96A 1TK5A 4Q0BA 2XS5A 4Q2LA 2YPYA 4JI8J 1HI0P 3FRYA 3HF5A 2W9BB 2MY7A 1DQ9A 1Q53A 1ZZFA 1LFWA 2D41A 2YNIB 4U6PA 2FD2A 3ZZ0A 3UNYA 1IBKF 4BC9A 4G3IA 2B51A 3VAJA 2UV8A 2K1RA 2KKHA 4PEOA 2DO4A 2ABYA 5C42B 1OIAA 1TMMA 3MUMP 1V3RA 3PHEA 2OAUA 4YDXA 3SCLE 2B4UA 1ZM2A 3KUHA 3CDEA 3IN5A 2M3DA 2KRRA 1IWAA 3AD7C 3NS6A 2AGOA 1Y5NB 3CULA 2I0XA 3PV8A 5ETKA 4F26A 2OLWA 4N8OA 4DV5J 3TAMB 1VR6A 2QFIA 2GZOA 1NK0A 2ILZA 4M5KA 1CJKA 1ZAWA 1HBMA 3CCTA 2GV1A 4NYPA 1F9EB 1S1UB 3MM7A 3LGNA 4IFVA 5J2PA 3EZ5A 3PHTA 3PCOB 5F41A 5JJBA 2VG5B 2AW0A 3MD1A 4O44A 3HHNB 3MGJA 2WTFA 3BQ2A 5CCMA 4YUDA 3AA8A 2NPIA 1X5PA 3LP1B 3PEHA 2YQ0A 3KJVB 4H4OB 4M94A 5GMEA 3RBEA 1S0OA 4CTAB 3ZTQA 2OPSA 2JJ4D 1LKZA 4LJMA 4IFYA 3TOQA 4ZLLA 5KFEA 3M2VA 2I5JA 2RMLA 3KFWX 1U1RA 1EZZB 3G9CA 3T9NA 4HH1A 4I2PB 1RCXB 3Q8VA 4KHMA 1T11A 4ZPAA 2Z4PA 2QX0A 1YDLA 4LFCF 3FBBA 5HO4A 2QIFA 2V68A 2Z8QA 4B02A 3D0GE 1PYSB 1OQ6A 2F63A 2Z57B 1RWXB 3BSOA 5IT9U 2RKIB 2YNHB 4Y2IA 1T03A 3JTPA 1NJWA 3BH7B 2GVDA 2GQCA 3VAHA 2IFXA 1QY7A 4CLZA 2PDAA 4O3SA 1VDHA 2E66A 2NS1B 4CH1A 4EYHB 3FZBA 3GPAA 4QR1A 1E6YB 1S6OA 3PTWA 3K58A 1XMQF 2E44A 2YKNA 5LM7E 1SC6A 2K2PA 2A3JA 4PPZA 3R8YA 5C2GA 1U1NA 4K7QA 5F8HA 2A2DA 4DBQA 1UVMA 1RAIB 2G0IA 3C6TA 3UPFA 3PX0A 3F56A 3UR3C 3OTEA 3O8WA 4WP8A 2HHSA 3BV8A 3T5HA 3VAIA 1EKRA 3MPVA 2E1AA 2W24A 3A8IA 4M5IA 1B3TA 1T3OA 1I6JA 1YJRA 2YKPA 1DY3A 1REGX 2CADA 2B9EA 2CNLB 4LVOP 2R2SA 3NMRA 5D6GA 2J6SA 2ALZA 4I2QB 4KFBB 1MMNA 1JJ2R 2UXCF 1FVSA 3ILLA 3DNCA 1CS4A 4PXDA 4UF4A 2Z2ZA 2HWHA 2GIFA 4V19J 1N36J 4ZDNA 3PYEA 2X7IA 5LMNF 4JI7F 3MEDB 4Z37A 3CCSS 1H2TZ 2D9PA 4OHXA 2DXFA 2P5VA 2RKIA 1TQLA 2V8VA 3H2VE 2V50A 3NOGA 1ZA2B 3R1LA 1XQIA 2IVYA 5J2QB 1RAJA 1EETB 2DIVA 2V9KA 1X7VA 3BGUA 5KG4A 3VGUA 2D3O1 4OHWA 4PRFA 1VOMA 4HT7A 2N4CA 4JI3F 3AJDA 3UDCA 2L48A 3O6QA 2B9WA 3FEYB 1ZPVA 4PR6A 3KLIB 1LOUA 4FS2A 3C2PA 4CT8A 2PT0A 3AJ2A 3HVWA 3R9LA 3S01A 4PG4A 2V4JB 4NLUA 1PKUA 1MROB 3Q2SC 3UCZP 2CZ4A 2E7VA 3CEDA 3DM2B 4HYKA 5ETSA 3PX4A 2EBGA 3US5A 4DSLA 1UVJA 1RT7A 2IYIA 3ETOA 1S9FA 3GFZA 4W98A 1VFJA 3NGTA 2HVZA 3QLHA 4O44B 5IWAJ 2XMMA 1HBNB 3BGFA 4KHRA 1H7XA 3KDNA 3Q86A 4P74A 1YSJA 1KLMA 1WC6A 2W2QP 4LF7J 3AODA 4PXCA 4BWMA 1SIZA 4C11B 1QVFR 2YWEA 3FEXB 3KJVA 3DKDA 1NB7A 2Y9HA 5B08A 3V6HA 3VAFA 1KVJA 2BE2B 2CQCA 2OGUA 2MZQA 3MEEA 4CO3A 2GVZB 2VPXB 3A8EA 5G0RA 1RB0A 4KY3A 5KG6A 1U09A 2YNFA 2DGQA 1B7YB 2ZBRA 1R8HA 3GJTB 4ECQA 5BYSA 4B9LA 3ILJA 3RUBL 3KUEA 2R8IA 2V94A 1G7CB 1LWEA 2C42A 3GG0A 2CNOB 2E7WA 1CSJA 5AXLA 3GMGA 3VZIA 3TAMA 2L08A 2XLIA 1CC7A 4DV1J 3TI0A 3MEGA 5HP1B 2CWXA 2H5JB 2LDYA 4J90A 2R7WA 3WIUA 2W01A 3QT7A 3UDEA 4MKBA 2CQHA 5DJBA 5ETLA 1IM4A 4DG1A 2HHXA 2EVZA 4CLWA 2OPRB 3OPKA 1XEZA 4EBCA 1RT5A 3PO5A 4OV6A
chains in the Genus database with same CATH topology
2E5HA 4EBDA 1TK8A 2E5IA 5CXTA 4ETXA 4B3SF 3CCVS 4DF4A 4F4KA 1Z4UA 3IRXA 1X4HA 3M32B 2BQRA 2XMUA 3T5LA 1U45A 3M2UB 3I4PA 2OD4A 4NA1A 3V4IA 3UD4P 2IAJA 2RQ4A 2CG4A 2ZH5A 2MPUA 3DOKA 2FPHX 4F50A 2FHMA 4URQU 1UA0A 4MMOA 3OL6A 1VRUB 1SKRA 4ED5A 4IG3B 2HPUA 2VV5A 3DHWC 3MWBA 3CMAS 5I3UA 4ES2A 4QW9A 2KZMA 1T94A 3T5KA 1XWLA 4MKAA 3MECB 4TYAA 1S1TB 4HT5A 3DLGB 2GGPB 2ZH3A 2NSCA 5L1LA 3THVA 4B9NA 3DLEB 2X1FA 5KT5A 3IG1A 2QMXA 3PIPQ 2K3KA 1IKWA 5HP1A 2KVIA 4XPCA 3BQ1A 2AJ1A 3JSMA 4XDDA 2JC1A 2RRBA 5DO2A 1D9FA 2JLEA 2VFVA 3GZ7A 3DLLQ 3GE9A 2MXYA 5KFZA 2FVCA 3E01A 4WFYA 4ZVGA 5GAGI 2ZZMA 2KDOA 3V81A 4FXWA 3DLBA 1VBXA 3KNGA 5EX0A 1MW7A 4PXEA 2RQKA 1X5TA 1CPZA 4NL5A 2DISA 2VPWB 4O3RA 4LF7F 4ZP9A 1KQSR 1FJEB 3MM9B 2B3TB 4H4MA 4DR1F 2J76E 4EYIB 1JLFA 5KFFA 2G9OA 3T6BA 4MJKA 4ZPCA 2CVIA 4AL6A 3AJ1A 3TAPA 1YQHA 3TA1A 1EP4B 3PO4A 5E0OA 1VQ5S 1CQMA 1HD1A 2XSFA 3VALA 2XWXA 4I6AA 3TVYA 1U26A 1HARA 5K8NA 1FJCA 1FNMA 5F8JA 2F40A 1JMTA 3RTVA 1GQEA 1SL2A 3FSIA 2IA6A 4ICLB 1TVRA 3JAMY 3CCES 2CJQA 3OFEA 3QMQA 5J2QA 1FEHA 3OQ2A 2RRAA 2DR7A 2MYFA 1DTTB 4NLYA 3U27A 1FKOB 4DEZA 2FVSA 4K0KF 3CCMS 4JUZA 6FD1A 3UDLA 2KB2A 3HHKA 3BO4A 3NAHA 1HNVB 4R8UA 2J7UA 2CJ9A 2GHPA 4HH0A 3IWXA 5AE2A 3JSRA 5JVGQ 3BEGB 2VFSA 3R27A 5E5NA 5B0BA 2IJFA 1RTIB 1YI2S 5GAEI 2XCAA 2AJ0A 1RTJA 1M1KT 4FXVA 1HWIA 5DM6Q 3S7RA 2ASJA 4OLOA 2CQ4A 2N3LA 2X1BA 3EUNA 1H3DA 4EFAC 5U47A 1WEXA 4WE1B 2DNQA 5BJRA 1VQLS 3CXCR 3PR5B 4F8RA 5KFYA 3VWSA 2DT9A 2FGCA 3IAS9 3E2EA 2DNPA 4PWUA 2UXDF 1Q8BA 3CWJA 2QLWA 3MCSA 2PC6A 3M8PA 3I9V9 2R7SA 2KO1A 1U6BA 2ASYA 4DR6F 2CYYA 2FHOB 4CNYA 4GKJF 4DL6A 2BV3A 2JEGA 2AP6A 2LXFA 4F2RA 2LKZA 2MZSA 1LXJA 5DRKA 1R27B 4KSEB 4ES1A 5DM7Q 4NX9A 4OZNA 1JLEA 5AXMA 3OJSA 3R5AA 1U7LA 3SV4A 1XTZA 5BYQA 2DGUA 1S97A 4DSIA 2FJAB 3BB5A 5M2PA 3IO1A 5SUHA 1JLBA 2BRKA 3UR0A 1UWBA 2VG5A 2JWNA 4B17A 1M5SA 2FDNA 3SQGB 2E5LF 4OJ3A 2F7VA 2HYIB 3LP2A 1RT4A 4KKOA 3UD3P 3CD0A 4NLQA 1VGYA 3M8RA 2ASLA 4V19X 4TY8B 1R8BA 2MQNA 2XMWA 5MAOA 3JSMB 3MPYA 3SDEA 3PKMA 3RU0A 1NJYA 4ZMMA 3KHRA 5EWGA 3EYZA 1S79A 3K5OA 1HPZA 4B3RF 3MTKA 3EZUA 2YNGB 1T3NA 4O3OA 1LK7A 2DGSA 2XGPA 2K1RB 1NJIT 3FMWA 3LO3A 4B3OA 4GKKF 3W2WB 2DNKA 4QIGA 4H4KA 5A6PA 5H9FJ 4FF2A 4DSJA 2FJVA 2XO7A 5EUHA 1JLFB 2ZH4A 3M8QA 3NMAA 2DGWA 4C4WA 3MM9A 1YBAA 3M2UA 1O51A 3CDBA 3M32A 4I7FB 4OI2A 2J6UA 3PY8A 2CVEA 4C8YA 3W2WA 1S6QB 5F8MA 2BBEA 1HI8A 1FJGF 5A8RB 1F60B 3N28A 3MR5A 3GV5B 1TAQA 3L7OA 2P9GA 4DPOA 2B5JB 1FDAA 1FXDA 2F8MA 3B78A 4O4GB 1NKBA 3BDPA 2YH1A 2FLOA 5B0FA 1J5OA 1XNRF 3QAEA 3CUNA 2FGOA 1JKHB 4RW8A 1PSDA 2CQGA 2JX2A 2XBPA 4X84A 1LWEB 3OSNA 3AAWB 1Q8IA 3DLEA 3ITHB 4Y28C 2PMHA 2Y1RI 3T19A 2IA0A 1R7IA 2YNFB 3DN9A 4RW4A 3PW7A 1V9OA 4L72B 2KFYA 4FF3A 3PRDA 3MD3A 5I42B 1VI7A 2RVJA 3DHXA 1RTHA 1TKXA 1XMBA 2QRRA 1OSDA 2R9LA 3C8YA 4ZA1A 5E33A 1VMBA 3IA0A 5KFIA 4QIEA 3D2WA 3D28A 3TX8A 2VB6A 1VBYA 1S1WB 4OX6A 2LQBA 3ZZZA 3OW2R 2FJWA 3MTJA 4ZPTR 3F44A 2RS8A 1S9GB 1TL5A 3HDSA 3K0JA 1RT5B 4K4TA 2RDIA 3T6JA 2R7TA 5CHCB 5D8HB 5KG1A 3BZQA 4N5SA 1C0TB 1TL1B 2PGCA 2C3UA 2LMIA 4WIIA 3ZZPA 2N82B 4TU7A 3DI6B 2VQFF 1VQPS 1EETA 1M5HA 5B0EA 3VF0B 3SDEB 1VRTA 2HHUA 4TY8A 2XNRA 1KQGB 1U8SA 4YR0A 3OR2B 3OTCA 4D3GA 4A8MP 4KIAA 1S0MA 1FT8A 1JLBB 3CSKA 3CC4S 2M52A 2EFVA 1ZBTA 3CIZA 3DCAA 4ECZA 3SFUA 3HVAA 4I0WA 2HWTA 3Q23A 1KHVA 1QM9A 1HBUA 4HL9A 4IH7A 4C2MA 2WTFA 3DOLB 2DNOA 3EX7B 3K5MA 2UVWA 1CLFA 4OX8A 4R8UB 1LW2A 3J7YU 1QUPA 3Q22A 4DR3F 2ILYA 3MM8A 3K5LA 1Q8LA 1N48A 1X8DA 4RNHA 3CDWA 3KLFA 4K4WA 4IO9Q 3QGGA 4LF5F 1KLNA 4DMZA 1CC8A 2RE1A 2CDQA 3HLUA 3C6UB 1N34F 3EPGA 4F4YA 1HWLA 2HHQA 4Z2XA 4ICLA 4U9RA 5HMWA 3H2UB 3O2IA 4C7QA 1K73T 3HI9A 1Z2LA 3AHPA 4DQRA 1TKTB 4DL4A 4I1TA 3KG1A 3LP0B 4RLEA 4F3QA 5D4OA 4JBCA 2PI5A 3H4DA 4YOEA 2FJBB 2DBBA 3KG0A 5DDPC 1YJNS 2XG8A 3MM8B 3TVZA 4KTQA 1BQNB 3M2VB 2I2YA 3V6JA 5A0YA 1WF0A 3OXGA 2J0WA 1HBUB 1OPIA 1UEUA 3NCRA 1XN9A 2V9WA 3CCJS 2ASDA 2GMLA 2WHOA 1DLOB 3BF4A 2YWGA 2RF2A 5HI7A 2KXFA 3K57A 1PC5A 4KT0C 3K59A 2R2UA 3OR2A 1HBMB 5EWFA 2Q43A 5KFQA 3FCHA 5T7LB 1V6HA 4ZOSA 2FJDB 2FJXA 2V8GA 3EXCX 3GIIA 2XMJA 4IH6A 3PJXA 4ED3A 3WDOA 3HHLC 3MR6A 2DNZA 3MF5A 1NEEA 1ZM9A 4IG0A 4F4XA 1L3VA 1U49A 4N8NA 4RUHA 3BO3A 3BREA 3KHGA 4TXSA 2LEBA 4ELUA 2QA4S 3HHLD 1S99A 5IFMA 3RRKA 1IKVA 5DDQC 1H6KX 4FBTA 2H9ZA 3JSBA 4FVMA 2VQEF 4DS5A 3TAQA 1TFWA 3QWPA 2ZKTA 2JRSA 5HQ8A 4IKAA 4CO0A 1XR5A 3G6ES 1QLNA 2R8HA 2C28A 3FSYA 4DWIA 4ECSA 2DNRA 2EG2A 4H4OA 1DTQB 2B6AB 4IUFA 3B8HA 4BC7A 2A18A 2XEXA 1IKXA 1HMVA 2FHJD 4Q8FA 1RTDA 1LQ9A 3MMCA 1JNRB 2OKQA 3HPOA 1UFLA 3ITHA 3S6EA 5AE1A 1ZZNA 2KN4A 1HBOA 2JZ5A 2ZDOA 2CIMA 2XI2A 3FFIA 3PVXA 2QA1A 3H98A 3HK2A 3IBWA 3IG1B 1MWZA 4X62F 4TQSA 1Q16B 2C2DA 4RZRA 2ERRA 2GC8A