5JVHQ

The crystal structure large ribosomal subunit (50s) of deinococcus radiodurans in complex with evernimicin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
b'SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5jvhQ00
1ZH5A 2KYXA 1M5VC 2DGSA 5DM6Q 1VQ4S 2QFJA 1JJ2R 2NLWA 2JVOA 3ZZZA 2DNQA 2X1AA 2CQBA 1KC8T 2KH9A 3I56S 3H2VE 1SJ4P 1VBYA 2G1DA 1VBZA 2DNRA 4IO9Q 4CH1A 2YWKA 2HGNA 2HZCA 2G4BA 2BOPA 2CPDA 5H1SV 2XNRA 2X1BA 1WELA 2MQQA 2ADCA 3MXHP 1H2VZ 3FEYB 4QPTA 2N7CA 2VODA 1SJ3P 5LSOA 1X4EA 1WTBA 2MMYA 1X4AA 3TP2A 3P6YC 1U1RA 3NS6A 2G0CA 2OSQA 2I38A 1Q81T 5D78A 5CXTA 5GMKa 1AUDA 2DGOA 4WF9Q 3UWTA 3P3DA 3CMAS 2HVZA 1VQNS 1VQPS 4PKDB 1VBXA 2DNHA 2MQOA 2CPIA 2KM8B 1VQLS 4W90B 3MUMP 2K8GA 3EX7B 1WHVA 5DDRC 2DH7A 1WEXA 3L3CA 3V4MA 2F9JA 3D2WA 3VAKA 3FEXB 4A8XA 5IM0B 2KU7A 2HGMA 4FXWA 1YTYA 1HD0A 2DIUA 4UY8T 3J7YU 2YTCA 2HYIB 3BO2A 3ZZYA 2RQCA 3ULHA 1WG4A 2MJUA 1YJ9S 1U6BA 3UCGA 2DHGA 1UP1A 1A7GE 2XS5A 1YHQS 2N3LA 2J0SD 3NMRA 3CC2S 3K0JA 5LXYA 3EGZA 1U1LA 2X1GA 3THPA 2KHCA 1FJCA 3MD3A 2D9PA 1U2FA 3BO4A 2PEHA 2M8DB 1VQMS 1S72S 1XN9A 4CIOA 1HL6A 2DNOA 5GADU 2PE8A 5CA5A 1NJIT 1YI2S 1JMTA 1K73T 1PGZA 5IQQA 3UCUP 2DK2A 2KVIA 1WI8A 1X0FA 1UAWA 2L9WA 1WG5A 2F3JA 1R8PA 1FO1A 2FC8A 4M5DB 4IOAQ 2RU3A 1DHMA 5LJ5Y 2AYGA 2VOOA 1WHYA 1X5PA 2ERRA 2M70A 5IM0A 5BJRA 2DO0A 3BEGB 1SJRA 1OPIA 1QVFR 1U1QA 3S01A 3G4SS 2MKSA 3UE2A 1JJHA 3OW2R 2WBRA 2CQHA 1VC5A 2E44A 2LCWA 3R27A 2CPYA 2YH1A 2M0GB 2X1FA 2CPZA 4QQBA 2MSSA 2AD9A 2CQ3A 2CQ1A 2MKCA 3TYTA 1Q82T 2MQMA 3G96A 4W92B 2DNPA 2BZ2A 3NS5A 1VQ5S 3VAFA 1YIJS 3G8SA 2FHOB 3RW7A 2LKZA 2MQLA 2MHNA 3CCES 1DRZA 2YH0A 2XS2A 1X5SA 1U6FA 2KXNB 3VAGA 3CF5Q 1M5KC 2MQPA 2LECA 2DHXA 1YWXA 4TU8A 2RS2A 1S79A 4CQ1A 5HO4A 2UP1A 3CC7S 2FPHX 4YUDA 2GO9A 2CQPA 3MUTP 4LIRA 3CCUS 3VAJA 3VAIA 2LQ5A 1U1MA 3CC4S 4J5OA 1X5OA 4C4WA 2D3OR 1U1NA 3Q2SC 1SJQA 3SMZA 2EK1A 1Q7YT 2MKJA 1YITS 5GVQA 5DM7Q 2B0GA 2MB0B 2U2FA 2CQIA 2KG1A 5DDOC 4V19X 1QM9A 2JRSA 2F9DA 2RS8A 4OZ0A 3MI7X 3UD4P 2KT5A 3B4DA 2AYEA 1X4DA 4TU7A 2RUGA 2KRRA 2MZRA 2DNMA 2D9OA 3Q2TC 2MKIA 4F26A 2DNKA 3JB9k 4IUFA 5DETA 1X4HA 2DGXA 2MPUA 2MY8A 1UFWA 3MDFA 5GAEU 2EVZA 4PR6A 2MXYA 1M5OC 2NZ4A 1M1KT 4YB1P 1NU4A 2M7SA 2RQ4A 1PO6A 1W2BR 2ZJPQ 3P5TL 2M88A 1FHTA 2JVRA 4WIIA 2DITA 2CQ4A 3IWNC 2DISA 4PRFA 2M9KA 3TO8A 1JJ4A 2I2YA 2CPFA 4CH0S 3DXBA 4TU9A 1YJNS 4LJMA 1F9FA 3CCMS 3VALA 1VQKS 1BY9A 3LQVA 1HA1A 3THTA 4WFAQ 2XB2D 3HI9A 2XSFA 4F25A 1H2UX 2MQNA 4WFNQ 3R1LA 1ZZNA 2E5JA 3CTRA 2DB1A 3CPWR 1VQ9S 1N54B 2LYVA 1U1OA 2ZJRQ 1WI6A 2LXUA 1VQ7S 2MZTA 1X4BA 2AYMA 5LJ3Y 1VC0A 3CMES 3MURP 3CCSS 4C0OC 1K8AT 1ZZFA 2MYFA 2J76E 2N3OA 2MJNA 1QVGR 3CCJS 1X4FA 1WWHA 2MKHA 2FC9A 1DBDA 4BS2A 2RT3A 2DGUA 3U1MA 2QA4S 1WG1A 2CQDA 2QEXS 2VOPA 3PIPQ 2JWNA 3CCLS 5DDPC 2OIHA 1SXLA 2DNLA 3H2UB 2LMIA 3P49B 3SXLA 2L41A 3US5A 4QU7A 2ZJQQ 4Y00A 2M8HA 1URNA 5D77A 2ADBA 4ED5A 3J7ZT 4FXVA 2YKAA 4LMZA 2K3KA 1VC6A 2LEAA 1R8HA 1WHXA 4TLQA 4U67Q 5FJ4A 2DNGA 1WHWA 1P1TA 2CQGA 3BO3A 2MKKA 3EGNA 3MOJB 1KOHA 2DNZA 3G6ES 1FJEB 2MZSA 2DNYA 1P27B 2DGTA 2FY1A 1WF0A 3BS9A 2A3JA 2MGZB 2DNNA 2KN4A 2LA4A 2RNEA 2SXLA 2E5IA 4C7QA 3CXCR 3B4MA 3G8TA 1OIAA 5IFMA 2CJKA 2CQ2A 2MY7A 3S7RA 3NNHA 2DHSA 2CQCA 2M4MA 3S8SA 2OJ3A 3CULA 2JX2A 4ERDA 4WKRA 1KOOA 2KRBA 1WEZA 1H6KX 2LXIA 4P6QA 1WF1A 3VAMA 1FJ7A 2KFYA 2O3DA 1U1PA 1D8ZA 1H2TZ 1CVJA 5JVGQ 2DH8A 3CCVS 1YJWS 4WFBQ 1DZ5A 1NO8A 3CUNA 4EGLA 2VONA 2KXHA 3CCRS 1OWXA 2OTJS 1VQ8S 3UD3P 2GHPA 5LSLA 2DGWA 1VQ6S 1X4GA 4UQTA 2CPJA 2OSRA 3SDEB 1Q86T 4OZ1A 1WEYA 2CPEA 3G9CA 5EN1A 2XNQA 1M5PC 2OTLS 5GAGU 1L3KA 4WCEQ 1U1KA 1RKJA 1VQOS 1OO0B 3CCQS 3UCZP 3VF0B 2MZQA 5GAHU 2KI2A 2LEBA 2MGZA 4YOEA 2U1AA 1UW4A 4IOCQ 2E5HA 2DHAA 1G2EA 2EK6A 2AYBA 1N52B 5JVHQ 3MD1A 2DGQA 1K9MT 5LXRA 2Q79A 1X5TA 3IRWP 1KQSR 5CYJA 1B7FA 1FXLA 1O0PA 2MSTA 2L08A 2LA6A 4ZKAA 5ITHA 2KXFA 5DDQC 2MZ1A 3PIOQ 3I55S 1WF2A 3MUVP 3NNCA 2J8AA 2CPXA 2M52A 1X4CA 2E5GA 2V94A 2DIVA 4Y0FA 4RU2A 1D9AA 2CQ0A 1KD1T 1N88A 3N9UC 1SJFA 2DH9A 1HD1A 2RVJA 2KM8C 2KG0A 1RK8A 4Z2XA 2HGLA 1FNXH 3SDEA 3VAHA 2XS7A 2N82B 1M90T 3DLLQ 2RRAA 3NNAA 2CPHA 2M2BA 1A9NB 3S6EA 3HHNB 2J0QD 2MZJA 4F02A 1FT8A 2DO4A 5MLCV 3CD6S 2RRBA 3RW6A 1IQTA 4QU6A 5HL7Q 3U1LA 3G71S 2DGVA 3R1HA 3LPYA 1N8RT
chains in the Genus database with same CATH superfamily
3AXKA 1S6PA 4CNZA 3H5UA 5DG9A 3KLEB 4IO1A 4I4BA 1PJ7A 4TY8A 3M8PB 4J9MA 3H2VE 1VI7A 2VH7A 5J2MB 1FA0A 1Z1ZA 2LU2A 1NXIA 4B9NA 3BF4A 1FJGF 4OYZA 4EYIB 4M8LA 2FHJA 4C0BA 1X4AA 1IBKJ 2G0CA 6AT1B 5HANA 2HLTA 1HR0F 2EPIA 1VQYA 2KZZA 4QR1A 4BHQA 2H5IB 1XNRF 2BJ7A 2KM8B 4UT4A 1N32F 2K8GA 4O4GA 3BM7A 2UZAA 1Q78A 1VRTB 2QX0A 2F9JA 2ALZA 1SC3B 2BX6A 2YXLA 1RTIB 2HGMA 1PIEA 1ZPVA 2B5JB 1JLCB 2V8PA 4X4NA 1PYTA 1QSLA 1BQXA 5EWEA 3K0JA 2C3YA 1HBNA 3D7SB 1NZ8A 3BO4A 1RT1B 3BGUA 5CA5A 1MLAA 2B9EA 2HRTA 4DV3F 3F0NA 2FC8A 3GYNA 1C0UA 4G1PA 1HI0P 2VU5A 3D0HE 4CLZA 5LL6d 3E01B 5CYMA 3S01A 4LRFA 1UWAA 3BV8A 1JJHA 4KT0C 3IR7B 3BGRA 1RT6B 1S97A 1S1XB 3HM9A 1AUSL 3AOBA 2A2DA 2GFFA 2DNPA 4ZMMA 4DX8H 2ZWPA 3KG1A 1RZMA 2HQFA 5CAAA 1N5SA 3FMWA 2MHNA 1V3RA 3ZXWA 4RNHA 5I42A 1U8WA 5HO4A 1MNEA 3FBBA 3T1YF 2CVEA 2W2MP 1G4CA 1HNIB 2W01A 4XPCA 4DPUA 2XMTA 4NA2A 1KN6A 2JRSA 8ATCB 3M9MB 2XY6A 4QJVA 2XZDB 2OFGX 1Q8BA 3CGIA 1JXVA 1MW7A 1RXOB 5H9FJ 4HACB 3VR1A 2WCXA 5ETKA 5C5JA 3RBZA 4RUCA 1S6QB 4DFMA 3W8GA 3G86A 4PRFA 2M9KA 4PZVA 3K5OA 1RHQB 2IBOA 1IWGA 4J9OA 2RUSA 4IQXA 2J7UA 4OLOA 2RIJA 1J5OA 4Q8EA 4EZ6A 1N36F 3KJVB 2AYMA 3SCKE 4X4RA 4DR2J 3PRDA 2J76E 3D6FB 4A8OA 4DL7A 4DX6A 1WWHA 4MIAA 1KLMB 5E33A 3VCDA 1BQNA 2CQDA 3AXMA 5KFMA 4LF4F 5KFVA 3VZIA 3HHLB 2CRLA 3CJ0A 1HQ2A 3H2UB 3P49B 4PQAA 1WD6A 1MSWD 1DARA 2DRBA 3NEKA 4DPOA 2ASJA 2IA0A 2V0NA 2XGQA 5C42B 4LRBA 1N33J 4DHVA 4ECXA 1S9FA 2AGQA 1JLAB 3CXCR 4BDPA 3G8TA 2J6UA 2F8MA 4DPTA 3OTOF 3P8BB 4FYXB 3ENAA 4XO0A 5KFBA 2ZEJA 4ZVOB 1R89A 2H4YB 2WK4A 3DLGA 2QE5A 2ZBQA 4YDDB 4DU8A 1CJTA 2WSFC 2OTJS 3H42A 4TKTA 3AODA 5H9FK 4LVOP 2OTLS 5BYSA 1PBAA 3FBCA 5GAHU 5T14A 1PJ5A 4ED4A 4Y2AA 2J7KA 4TN2A 2Q79A 1TKXA 1C1BA 1UZDA 1E6YA 1HR0J 2ASYA 2KXFA 3O6QA 4AT1B 2JH3A 3IG1B 4WU3A 2DH9A 3DHXA 2R7UA 2HIYA 2W9CA 4I2PA 1CBKA 2HRYA 1X0PA 2W1BA 2ZC4A 5KOXA 1JNRB 5HL7Q 4GVBB 3KMSA 3LPYA 1N8RT 1FF2A 4FKYA 4G65A 2HS4A 2VPXB 3TW0A 3DM2A 3FSXA 3ZZZA 4CT8A 2IVMA 2NCKL 3PFOA 4FF3A 3R3TA 2GQQA 4DV3J 4CH1A 1HPZA 2ZH2A 3Q8RB 4ITSA 2O67A 2YPZA 4Y2CA 3DLEB 5LT5A 1MROA 4ED1A 4X4QA 1OS5A 1IBLF 1SJ3P 4P10A 3NXZA 1RCOB 4DSKA 2WVDA 3LTOA 3JXOA 2PGCA 3DMJB 2D3O1 5CXTA 2FY8A 2V2VA 4LSLA 3M6WA 5HK4A 1N48A 2VFVA 3SSSA 2VV5A 2NPFA 5KFYA 3TJAA 3IN5A 3KLIB 4FXWA 4DPWA 1HD0A 1YG0A 1RHJB 3J7YU 1KFSA 3Q8SB 3BKFA 1JB0C 3MM6B 2MJUA 4X66F 4J9VA 3UCGA 4IDKA 3TA0A 3HKWA 4ZLJA 1T05B 2HMIB 1ULRA 4JI1F 3AD9C 3GYGA 1FJCA 3JAMY 1GT8A 3MPDA 4ZVGA 2PMWA 3C8YA 2VL1A 1Q7LB 1S1VA 2KVIA 3H59A 1X8DA 1X9MA 1J2VA 4WYLA 3M32A 3GIMA 2Y0BB 4NCGA 2EFQA 3W7BA 4DQSA 3F44A 2RSQA 2HNYA 4DV0J 3HJFA 5HAOA 2CPYA 2QL7B 2KTQA 3W9HA 1QE1A 2G9OA 1U45A 3I32A 3SQOP 1MN9A 1Q4RA 5T41A 5DG8A 4AQYJ 1N36J 2CWKA 2MQPA 2IMOA 1BQMA 1GQEA 2PEBA 2LQ9A 1FKAF 4C8OA 4B3MF 1UEKA 5C24A 1C4AA 2D3OR 1N4LA 1S7HA 3EZOA 1Q7YT 4Q0BB 5DM7Q 4CO3A 1NDPA 3BKTA 1X4DA 3JQJA 4IUFA 2EBGA 3MDFA 3O44A 3HDSA 1MMLA 3SQGA 2FUG9 5F8JA 5E3PA 3MM9A 3TZZA 2PMHA 4PXCA 1X9WA 2IRYA 4DS4A 2FHKA 3TO8A 2HQIA 4CH0S 1KEKA 4ZVTB 4IOBA 3CVKA 1ZBTA 1B4SA 1TL1A 1OYDA 2C2EA 3KXDA 3PV8A 4KSEB 1NUEA 4WFAQ 4KYZA 2B7BB 4WTYA 2A6OA 1CPZA 1X31C 3DU6A 2QC3A 2Z4PA 2DBBA 2MQ8A 3HULA 1K8AT 1RHRB 1FESA 3DGVA 1X4FA 4P74A 4USJC 1WG1A 4I68A 2J5AA 3A8JA 4C8LA 2DD8S 1SBRA 4Z7CA 1FXRA 5D6GA 2KB2A 2ROGA 4I0WA 1KS2A 2FLLA 3B8HA 5A2QU 1V6HA 2MKKA 5D4NA 1RWWB 2DNYA 3CE8A 3V6HA 2CJKA 3QRPA 2CQ2A 5KOWA 2IIHA 3NNHA 4CTAB 2IMWP 4WKRA 1GMUA 3CEDA 1Z4UA 4NASA 1NK8A 4B3SF 2Z57B 2DCUB 1HMVA 2ZVSA 4J7CA 2W8LA 1FD2A 2K2PA 3FRYA 3QT6A 3FFIB 1TK0A 1EX8A 2OSRA 4WTOB 4AE5A 2UXCJ 1FNOA 3EVWA 3CCQS 2HHTA 3N4WA 3OJSA 1BUXA 4J9RA 4ELUA 3ETOA 4OYPA 1FDAA 1EB0A 1SVDA 4DF4A 3JYTB 1O0PA 3C16B 5IS2A 3NNCA 1H74A 4OYMA 1B99A 4E2FB 1ZTWA 4CT9A 4XPEA 9ATCB 2A2CA 2CJYB 3MCMA 5IZHA 3M1VA 2CPHA 5HLFB 1KDNA 4R25A 2VBZA 4JI8J 5L46A 5KFLA 4WZMA 4MH8A 2V9KA 4F0MA 4GO5X 3JSRA 1ZH5A 3NOGA 2ZC3A 4USVA 1UWBA 2HAIA 3BREA 3O5TB 4NX9A 4HI1A 3BPDA 2J0WA 4O3RA 2CNLB 2JC0A 3SEOA 1RKIA 4GRSA 1F9EB 2NUUG 1FVQA 4JOUA 1N6QB 3FGVA 2OPQA 5IT9U 4NXMF 2DJWA 2ILZA 2MQQA 1UL3A 4FS1A 2AJ0A 3OL8A 3K8VA 2UUAJ 2ACYA 2MMYA 4OZNA 5AJ3J 2OMLA 4ICLA 1ROFA 3HZGA 1B0VA 5L38A 1NLKL 1ZOTA 4Q5VA 2DGOA 2CFXA 1IUJA 3MR2A 1VQNS 2VKZG 5FD1A 3K59A 4RW7A 3CIMA 4NYPA 3PRVA 1TVRA 1R8CA 1SC6A 3CNQP 4BWMA 3KLGA 1HW8A 3QGPA 4QIFA 1FI4A 1YJ9S 3MMBA 1LW0B 3I0SA 3QFHA 1U1LA 1MU2B 4UOCA 5HMYA 3AAWB 5F3TA 4RUBA 1KSPA 1TV6A 1V5IB 2CYYA 2Y9HA 3FZBA 3UCUP 1RWXB 1X0FA 4CLYA 3I9ZA 3MM8B 3BBBA 2RU3A 5JUMA 2UXBF 1QY7A 3BEGB 2ZNYA 2W4DA 1RQ0A 3QZ7A 3KK2A 1NPRA 4JUZA 3SCLE 3D66A 4UOGA 2YH1A 4CP5A 2BKPA 3ENVA 4QR2A 2VZ9A 1HBUB 2B56A 3LAMA 4K2XA 3CIZA 3G8SA 3KHGA 3E2EA 2MQLA 3FUYA 1DQ9A 1NMEB 1U6FA 3T5LA 5JXSA 4QWBA 4CQ1A 3WZ0A 3TA1A 2VA2A 3IR6B 1AZSB 2FLOA 5D3GB 3DYAA 1YITS 3GJTB 2OLWA 4OI3A 3T5KA 2B4VA 2UU9J 2HRUA 2RS8A 4TNOA 3E8OA 1RT3B 2G1HA 3UFCX 2H5JB 4XK8C 3RBEA 3JB9k 1VR6A 3QIPA 3K17A 1QJHA 3KNAA 1U49A 3ITHA 4KO0A 5IC4B 5HATA 2CVIA 4YHHF 4QIGA 3IRXA 4Y2KA 3ONQA 2R7TA 2RRNA 4NRUA 2CPFA 1YJNS 4EYHB 4OX6A 4F4XA 4X62J 1HWLA 2ASLA 1PYSB 1DJ0A 3LQVA 3OR2A 5SZTA 3AB4B 3UO0A 1VJQA 3HT0A 3MPVA 3TX0A 2ZJRQ 3M8QB 1VQ7S 1A0OB 2YKPA 4NXNF 4C0OC 3PR4A 3LPEA 3MM7B 3C19A 3GLJA 4O44A 1GXTA 2E1CA 3DRSB 5H9EK 5CZVA 4N8OA 2OIHA 3HO1A 1Q5YA 4PQUB 1JLQA 1FRKA 4TQRA 4J9LA 3J7ZT 2K3KA 3C15A 1IKVB 2KJVA 1LWCA 4RX6A 4LSNA 4URSA 3V2UC 1S0OA 2DGTA 1ZAXA 2FY1A 2EBEA 3DRRB 4I7FA 3FVYA 3TR5A 2UUCF 3R6GB 4I69A 1FRXA 3CD5A 3S8SA 3QRQA 3OFGA 4UOFA 2R2RA 1X9SA 4LBPA 4LFAF 1R27B 4LF6J 2FZGB 1RWOB 4KHPF 5M2RA 4ZIVA 2DGWA 3OTDA 3PYGA 3G9CA 1K1QA 2CDRB 1M5PC 4RUHA 1JIHA 3M8PA 3M8ZA 2MZQA 4IG0A 1H73A 1IR0A 1JKHA 5HJXA 2JJ4D 4IOCQ 1FTCA 1HIYA 4NXMJ 1CJUA 2QLXA 4IKAA 3OVBA 1EQ0A 4NCBA 3KJQB 1B0PA 1WOSA 3L09A 2F1FA 2HW3A 4DLGA 1WF2A 1KVKA 2CPXA 1O6XA 2L48A 2UVWA 2ZHAA 4LF8J 2HGLA 2BW7A 3ZZOA 3S6EA 3I0RA 3J81Y 3RW6A 4B3OA 3BQ1A 1R6YA 1PAEX 3NOCA 1RTIA 3W8PA 4OYOA 1VISA 2RU9A 3D1QA 1JLCA 2CJBA 4DUZJ 2DGSA 5DQIA 3BSAA 4F8RA 3I5AA 3W5ZA 4DFPA 4LRAA 4Z7YA 1RT1A 4JV0A 5EWGA 3LOUA 3MMCA 3LP0B 3GSDA 1KWMA 4DSJA 3OR1B 3I6PA 2QYCA 4OJHA 1RTDB 3QT5A 4OYXA 2KJWA 4HDHA 4EMDA 3E01A 2W9BB 4I6AA 9RUBA 4RBUA 4N47A 4JI0J 2CPIA 5HBMA 1S1XA 3DHWC 3KLFA 3VAKA 5L1LA 2GHVC 5IM0B 3DOLA 1I5OB 3RUBL 4ZPDA 4CO5A 3UN2A 2DHGA 3NMRA 5U47A 4H54A 4CO2A 1LW2B 5CABA 1NJYA 1ZAVA 4ETZA 4OI0A 2FIUA 3Q23A 5C25B 2D9PA 4MFBB 2FJAB 2WRMA 4FXDA 4DL6A 3A13A 5KFWA 3IO1A 5KG2A 4EO6A 4FF4A 2K3IA 2VPYB 2AYGA 1WHYA 2GIQA 2ERRA 5HQLA 4HACA 2IY5B 2CQHA 3PJ9A 2X1FA 4QQBA 1S6QA 1Y3JA 5AXMA 1VRUB 4P7VA 5KT3A 2GS8A 4TQSA 4DCJB 4A8QA 1MMDA 2LECA 2DHXA 2VG7B 2FPHX 3C66A 1UPPA 2QJ3A 3VAJA 4Q2LA 4NOHA 5KFOA 2DT9A 1SQFA 4U96A 2MB0B 2KG1A 1FXDA 4DQPA 5CD4A 3T5HA 3R97A 2HQGA 1TP7A 2AZ3A 2DY9A 3LGNA 3HHLA 5RUBA 1XMOJ 3NGTA 1KLNA 3T6BA 2OKQA 2GVDB 4U7UD 5A8RB 2G13A 5DETA 3GYXB 4ZPWR 2EVZA 4PR6A 3Q8YA 2NXEA 2ZUGA 5BR8F 4USMA 5BXIA 3ZFVA 4NL5A 5G0RA 4QYRA 4B08A 3PG9A 3EM1A 2RMLA 4EUVA 1JLAA 1I3OB 2RDDA 2P5VA 3DXBA 5B09A 2HNDA 2KT2A 1FDBA 3CCMS 3BKUA 1ZM4A 4LFCF 1T3NA 3GE9A 5ETPA 3CSKA 2HNZB 4RW4B 1NK5A 3MM5A 1HA1A 2W7AA 2XB2D 4KHPJ 2R8GA 1HI8A 4ECQA 1N54B 7FDRA 3Q8VA 4OV1A 2MJNA 3Q22A 4LRCA 3BSNA 3IAM9 3IGVA 4LRDA 5AE1A 2FC9A 3BDEA 4FF2A 2QA4S 3RAQA 3CB4A 1S4EA 2VQFJ 1SXLA 3Q8QB 4PAAA 3US5A 4ES1A 1HARA 1U09A 4FXVA 2G0JA 3KUEA 1MN7A 4TY9A 3OXGA 4PG5A 1IVZA 1CJVB 1ZM2A 2HKEA 3L7PA 2BJEA 2RNEA 1CQMA 3B4MA 2RQMA 3RB3A 1LWFB 1F0XA 2OJ3A 4ERDA 4DV4F 1F9HA 1R31A 1ZM9A 3QMQA 4P6QA 1KQFB 3UPFA 2C22A 3IM8A 4GVBA 4C11A 2I9SA 2V2ZA 1T9WA 2KXHA 4DV2J 5A0YB 1X4GA 3VGVA 3SDEB 4OZ1A 4NI2B 3HX9A 2XC9A 4K50A 3NY0A 1S76D 1T9TA 1KBRA 4JI6F 2O5DA 4OZ3A 4C0HA 2BA9A 2ZZMA 2ZM6F 3TQEA 4OX9F 2WW4A 3WIVA 4C97A 3EJMA 3Q0AA 1X5TA 4X65F 5KG3A 1GK8A 1HWKA 4TY8B 3GV7B 4B3TJ 3LH2S 1SL0A 2W7PA 4RU2A 3LGHA 4RNMA 3H2LA 1SJFA 2HFOA 4NLGA 3DMJA 2NXNA 3HVWA 2M2BA 2D74B 2XSJA 1KR4A 1IQTA 2CJXB 3RRKA 3HP6A 2QMXA 4JV5J 4CYUA 4PPZA 3T9NA 3MPUB 3D6TB 1IKYB 5AXKA 3C14A 4ALZA 2NLWA 2JVOA 2IJRA 4HHUA 1T05A 3NS7B 2HEKA 1WORA 1VQSA 1RE1B 2CQBA 3I56S 3OBIA 2COLA 2ACMA 2EC0A 1VBZA 4ER8A 4JP8A 4EBDA 1HHTP 2V4QA 1IBCB 1K0TA 1WTFA 4LF9F 4USIA 1F3FA 2I38A 1AROP 5LMUJ 3VZHA 4OJ1A 4QPXA 3CO9A 3NAHA 2PC6A 3LALA 1WKKA 4F3QA 2YTCA 2LDIA 3ZZYA 4LR8A 3W5XA 1BGXT 1RISA 5GAEI 4ANEA 3BGRB 2HBRB 4RW8B 3W3SA 3ZTOA 3N6NA 5IV4A 3PW0A 3Q86A 1GXLA 4Q0BA 3V6DB 4NMLA 1RHKB 5F0WA 5IWAJ 2Y1RI 4K0KJ 2L9WA 2HQCA 3V6KA 2Z30B 4OQJA 2ZHOA 1UVKA 5BR8J 5LJ5Y 2KL8A 4JI5J 2J9DE 3MMAA 2IBKA 1NK7A 2BEFA 4DR1J 3N01A 2BMBA 2N7YA 4QYZK 2HK3A 2CQ3A 3TYTA 3AA9A 2V2KA 2BJ8A 2QV6A 3VQTA 1SH3A 2D7SA 3TJ8A 3VAGA 3J7AN 4DQIA 2G2ZA 3CC7S 3NL0A 4R5PB 2XBPA 4P75A 3VAIA 3CC4S 2XZTB 4ZN3A 1WC5A 3GSIA 2EK1A 4B9VA 2YBVA 4U8VA 2DVIA 3GFHA 4CLSA 1CLFA 3AJDA 2OPPA 3BZQA 1NHVA 3KDNA 3BYRA 1NSQA 2VBXA 1ZAWA 5IT4A 2CJQA 1PO6A 5KFGA 5F8IA 3DRYA 1H7XA 2RE1A 5F8NA 1BQNB 4ED3A 3MEDB 3IWNC 1YBUA 5GAGI 4RBVA 1DQAA 8RUCA 4HI2A 3LP1A 4CTAA 1F9FA 4L3NA 5SUHA 2BJDA 2GJ2A 7AT1B 5AE2A 3QYYA 2NSCA 3DI6A 4WFNQ 3C3LA 2IM3A 2KDOA 2HHHF 3PDNA 3CJRA 2VHGA 2OFHX 5ETMA 4TLRA 4KQZA 3DLGB 1TQLA 2FGOA 2JWNA 2ZH1A 4WP8A 1KNZA 3R2CJ 2VG5B 4OZJA 1CJTB 4QU7A 1YQHA 2NZCA 4HTIA 3NGRA 5D77A 4CLKA 3QRRA 4ZP8A 3H0PA 3JYTA 2E29A 3CDUA 2QLFB 4TLQA 2NXUA 5FJ4A 4NE9C 1P1TA 3MOJB 4DX5A 1U02A 4CH7A 4UUWA 4EZ9A 4J91A 2ALYB 3NG8A 5DS7A 5IFMA 1F5BA 3TEGA 1DQ8A 3NKYA 2VQEJ 1TELA 3L4BC 4RR5A 4ATNA 3CJKB 1C1BB 5HLFA 1W7WA 1A6LA 1E6YB 1D8ZA 4OHWA 1OSCA 4EGLA 2H5EA 1SJ1A 4ED6A 2W9CB 4U6PA 2DR9A 5KFHA 5I3PA 3ISND 1XERA 2B9YA 1RT2A 3ICLA 2QN6B 2U1AA 4MKAA 1E6VA 1N6QA 1N52B 2X3DA 2BQ3A 1RAAB 3UDLA 2LU1A 3JSYA 1VS3A 1SV5A 2XWXA 3PYEA 4LREA 3QAUA 4A8SA 2BR0A 1L5UA 2KG0A 2EFPA 1V9OA 2VDHA 1MROB 2N82B 1TKZA 3QJPA 3UR3C 1GFWB 4X64F 1S12A 4UQGA 3CD6S 3H98A 2WTFA 3MMJA 3BN4A 2DGVA 3JQMA 2WSEC 3LA0A 5FIIA 4UY85 3M8YA 1P1LA 1TUVA 2QSFA 1S99A 2YKMA 4LSLB 3QWPA 2HBQB 3D1HA 3N6LA 5B08A 4TYAA 4KBIA 2K7KA 2XG8A 3TUZC 1KC8T 3ETMA 2N4CA 5IT0A 1D09B 1MU2A 3DGPB 2YKOA 3LP2B 2D69A 4IO9Q 1RTJA 4ECRA 3B78A 4CI0B 2XNRA 1WELA 3AHPA 4LBHA 4IFYA 1RTHA 3ILOA 2DR5A 3FSYA 3MM8A 4L76A 1RA6A 2HWIA 3TP2A 2XO6A 3R6LB 2GMHA 4IFVB 4G1QA 2YNIB 3SFUA 5KG7A 5EX0A 3P3DA 1S1VB 3NP5A 3IXQA 2XYPB 3GIJA 3FJ2A 4PKDB 2MQOA 1WOOA 5GMEA 1WHVA 4DSIA 3LUYA 4ZLNA 3PZPA 2KFNA 1S6OA 3GILA 4NEZA 1HBUA 2AMCB 4NCGB 1NEEA 3DN9A 4XTTA 2BQRA 4DV7F 1GMWD 1N0UA 2R8IA 2HNYB 1U6BA 3MWBA 2RH3A 2J0SD 3TZXA 3CC2S 1QE1B 4KY3A 2HVIA 2NSBA 3THPA 2KHCA 3M4XA 3D54A 2BRLA 3MD3A 3RG6A 5HVFA 4CIOA 5D3GA 4M5MA 4Q2MA 2WOMB 1MG7A 4LF1A 4PXDA 2XM3A 2VOOA 1X5PA 3A3PB 5C24B 1ACMB 3R2DJ 1Q8KA 4ED7A 1OY8A 2Y8WA 1GMVA 2FVRA 2JEFA 3HPOA 2HHVA 4L3KA 2ROEA 2BW2A 4O3QA 2BBEA 2VDIA 3EICA 1T7PA 4PYAA 2J7WA 4P71A 5C2GA 2DTJA 1O51A 3CCES 2ZDOA 4ZP6A 1X5SA 3MM9B 4FKXA 5DLGA 3MTJA 1N56A 2XY5A 1FX4A 1SJQA 4H4KA 3SMZA 1CJKA 2MKJA 3U1NA 1VHIA 3DRSA 1QAYA 3CJTA 2FJBB 4JI2F 3VTIA 1LWEB 1X4HA 4M5IA 2FZCB 4HT5A 2NZ4A 2QLJB 2NYHA 1NU4A 4JV2A 3PX4A 5EDWA 2HVDA 2QYGA 1FK9B 3QGHA 2IVYA 3R5DA 1U6ZA 3HVAA 1S6UA 3DCAA 5GAHI 1AYEA 5ETOA 4QWEA 1QSSA 4F4WA 2XGPA 2DB1A 2LYVA 2R8JA 3PM9A 1WI6A 5LJ3Y 1XNQJ 4IRCA 3GG0A 3CCJS 3TAPA 4ECVA 4YEAA 4HHJA 2RT3A 1NB7A 1RAGB 1GTHA 4G3IA 1S7IA 2PSZA 2YWWA 1R3NA 3CDAA 4FF1A 3RRGA 4Y00A 2ADBA 3MF5A 4WWSA 1XK8A 3GONA 2CQGA 5A8WA 3G6ES 1LKZA 1UVIA 4C7QA 4LFBF 2QRRA 3LWMA 3MECA 4EU0A 3D4JA 4LF7J 3IMQJ 2XLJA 3W62A 2NYIA 1DAXA 4Y2IA 2GIRA 3GJSB 2WB4A 1TAUA 1H2TZ 1TFYA 2B4OA 3CCVS 4OX8A 2G2YA 3AOCA 2XI2A 1SL1A 1OWXA 2Z2MA 2VUGA 1Q16B 4XDDA 4DV6F 5EN1A 3M1VB 1YDLA 1NSPA 3AT1B 2R42A 2CZ9A 2LEBA 3K2YA 2BOAA 3K89A 1O5JA 1UWBB 2DGQA 2GC8A 5LXRA 3OR1A 3J7YI 2W2NP 2E9ZA 4KTQA 3QT7A 3CCWA 1RU2A 2FVCA 2J8AA 5KFDA 2DIVA 4YY3J 4KHRA 5KFIA 2EFOA 1HWIA 3QLHB 3SI8A 2OPQB 1OJ4A 2BYCA 3M6VA 3TOQA 3P96A 3RU0A 2E9RX 2AIRB 2RHQB 4LIWA 3T6JA 4F02A 4DV7J 3QO9B 5I3QA 1IM6A 4ICLB 2KYXA 3OTBA 2W9AA 2BABA 4F04B 2VG6B 2J9CA 1NHUA 1IBKF 2EG1A 3ZZTA 4FVCA 4URQU 3FCWA 3OL9A 4RW7B 1OMSA 4C48A 5L1IA 3L7OA 5EX3A 1RADB 4JI4J 4MFBA 1RWNB 4D3GA 4DR6J 5HP1A 2DNRA 3FCVA 5CCLA 3VGUA 5KFXA 3EGVA 4DV1J 1DFDA 1S57A 3CDBA 2HHWA 2WW8A 1XBWA 2I6WA 2R7XA 4DCOB 3UI3A 3TNVA 5D78A 1TV6B 4WF9Q 2V69A 2HVEA 2ZVIA 4KRWA 2UV8A 2JFDA 2DNHA 1SKWA 4RKUC 2QZ8A 4FPIA 5DDRC 1RLDA 1PCAA 3L3CA 4ES3A 1VRUA 5ETSA 2R7VA 3K5NA 4EBCA 5K20B 3HLUA 2QIFA 5HROA 1TL7B 1RCXB 4FYYB 2N3LA 2RHSB 1NJXA 1RYRA 5EGYA 5ADZA 2P6TA 1XEZA 2XZWA 1VDHA 2PEHA 2M8DB 2E1RA 3UQSA 2RDIA 1XWLA 2YPYA 3GU0A 1FRIA 2E66A 2D3ZA 2J0XA 3NGUA 2DPJA 2X51A 4X4OA 3GIKA 1RT7B 1DHMA 2AJQA 3EXYA 3W60A 1CG2A 1Z2LA 1OPIA 2HURA 3W61A 1ICEB 2WB1D 2QFIA 1NBEB 2DKOB 5KG1A 2BANA 3RB4A 3EUNA 1Y3KA 1PSDA 2E44A 2LCWA 2APOA 4ZVUB 2MSSA 4PWWA 4O0IA 4ETXA 1B0TA 3NS5A 1VQ5S 2ZH6A 5E7OB 1TL3B 2LKZA 4RW4A 4OZ2A 2C3MA 1NM2A 2WAQD 4KGKA 1AA1B 3IRXB 2YX4A 2JOQA 5KFPA 2FJDB 1ZYQA 4Y34A 4EEYA 2CQPA 3FK4A 4MMOA 4B02A 3QNWB 2EEYA 2XMMA 1FRHA 2RAQA 2XYGB 4K7QA 2B0GA 4J37A 3POTA 4DR3J 4DXLA 3UD4P 1G3OA 2OEJA 2RUGA 7FD1A 2PN6A 4OZLA 4KGXB 2MY8A 5D15A 2FJXA 2MLYA 4ENOA 4YB1P 3M8WA 4O44B 4DR2F 1Y7PA 1GH8A 1CJVA 1HNZJ 5B0AA 4UF4A 3D0GE 1JLQB 4YP3A 1FRJA 3C15B 1LWCB 3HI9A 3I4PA 1S59A 3G8QA 1BHNA 4M5HA 2MZTA 1X4BA 5HMXA 1OY6A 1N33F 5A0YA 3CCSS 2ZOGA 4DPYA 2Y0SD 3EDQB 4L72B 4NI2A 1C0TB 3ZNJ1 5J1NA 3W9JA 1VYAA 2VOPA 3PIPQ 3Q24A 3R5GA 4I56A 5CH7B 3EXCX 1AB8A 4DR4F 2M8HA 2DR7A 4NYZA 4DR5J 2OAUA 4IG0B 4RWWA 1JKHB 1PC4A 5T7LB 2AJ2A 1FVSA 1CJUB 4C3MA 1QLNA 2C3PA 3D5MA 2XLIA 2M4MA 2YY3A 2JX2A 4A8FA 4AUKA 2LXIA 4CRJA 3VAMA 1UKUA 4LT6A 1CVJA 1DZ5A 3QJLA 5B0FA 3FMBA 2GHPA 2UXDF 1IKYA 2CPJA 1Q86T 2WSCC 3CCTA 4F7VA 1L3KA 3I0RB 5D4LA 1Q8LA 3TX8A 3NLCA 4B3OB 2VIHA 2BUNA 3BQ0A 4ZCKA 4OJGA 4QZVB 4YR3A 3MD1A 4QCLA 2GQCA 3IS9A 1K47A 4K4WA 2L08A 4NLQA 3DKDA 5GMDA 4URGA 5KTQA 2HWHA 3MMCB 2XS7A 3PW4A 1YJVA 4OYBA 3CJ8A 1LK5A 1F2GA 1V3SA 1LEOA 3DDIA 2NXCA 2VPWB 4WKYA 3B82A 1QD1A 1WJ9A 4M5JA 3KYLA 4FN5A 4ZVFA 3TI0A 2J9DA 1J5EJ 5HBMB 1Q1KA 4RW8A 3CJ2A 3T1HJ 3PX0A 2X1AA 3R8YA 3KLFB 5KT7A 4EWTA 3DOLB 3SCIE 2G1DA 2HGNA 1FDDA 1MMNA 3V6DA 2BOPA 1ZA2B 2A18A 3FEYB 3TWZA 1D3WA 4HT7A 5JMNA 3HHKA 5KAKA 4OI1A 1ZA1B 2OEKA 2OSQA 3P45B 2E7VA 5G4DA 1Y5LB 3LANA 4F0KA 3EVMA 2P9GA 5K8NA 4CLTA 3CJ3A 1S1UB 2AEMA 4R5PA 2VASA 1S1TB 4DV0F 1UMJA 3SFGA 1NCLA 1KRPA 3R9LA 3BDPA 2PFFB 2BDPA 2WVBA 1XN9A 2ZOFA 5J2QA 1K73T 3TA2A 5IV3A 1NH7A 1GAOA 4AQYF 2AJ4A 2R7SA 4MYTA 1WG5A 4AFFA 4IOAQ 3UNGC 4JV1A 3DLKA 3TANA 2XWYA 2GA7A 2Z8QA 2M5YA 2WHOA 3HJVA 4DV5J 3SYZA 1VIOA 1LOUA 3PO5A 2LP4A 3MEDA 2XI3A 3BQ2A 1UJ5A 3V5RA 2EFNA 4E0DA 2Z2ZA 4KR0B 3RW7A 3PACA 2YH0A 2F40A 3BSCA 1DTQA 1Y5NB 3TUJC 3PJWA 5G0RB 2FJVA 1UVLA 3IA0A 3KFWX 3TJ9A 2HNDB 4J5OA 4C4WA 3Q2SC 4DUYJ 1YGYA 4K2JA 5A6WA 1S9GB 4RL1A 4USTA 2U2FA 3MM5B 1N5YA 2R7WA 3MI7X 4RWXA 4DR4J 4WFXA 2MZRA 2Q66A 2D9OA 4KV8A 5L8RC 2VG5A 2AQ4A 2QT7A 1TUGB 1EAYC 1XTZA 1R0BG 2LXFA 2QO3A 3MR6A 4Q8FA 1L3TA 4LVNP 2K1RB 4YN3B 3ZZPA 4DWIA 2EC2A 3CJKA 4DF8A 5L1JA 2W24A 4MKYA 4P72A 4ZOSA 1RLCL 2UXDJ 2YX1A 4MIBA 1FWPA 5KFZA 2UV8G 2Q6CA 3KK1B 4HH0A 2N3OA 2K7JA 3KUGA 4QIWD 4ILMA 4DOZA 3MAAA 3BPSP 3UW1A 2EFGA 5K8OA 3KG0A 2BQUA 4C11B 1I94F 1PAUB 1N5VA 1XMQJ 5DDPC 2QTWA 2LMIA 1WC4A 2FVSA 2AJ1A 2R3VA 4S0MA 2DHHA 4C2MA 1WOPA 4O4RA 2MZSA 2UXCF 4USUA 3C6TB 2DNNA 3KWMA 4OI2A 2YQ1A 4C8NA 2VBWA 1Z2ZA 3NGSA 1FWKA 3TUPA 2I5JA 1WDTA 1FFWB 2VJVA 1D1UA 1RBLA 1S1WB 1LNQA 4LF5J 3LAKA 5JVGQ 3M2RA 3J81j 3DRPB 2R8HA 1S49A 3CCRS 1HNVB 1JLEA 4DZDA 1HQEA 5B0DA 3ET6B 3ADAC 2DXEA 5L1KA 1T11A 5D4PA 3L95X 5F8GA 3PKMA 2XSJB 4HTJA 2Y1IA 1WKLA 4RW9B 4Q7AA 4CYUB 2E5HA 3DGPA 2DHAA 3LP2A 2AYBA 1AFIA 4JI8F 1BC6A 1VK3A 2ZH5A 3JS9A 3C14B 1FX2A 1JXLA 4ZK7M 3A8EA 4IFVA 1ZM3A 2YNIA 1D9AA 2FQQB 3IC1A 3PNIA 4YB7A 3LWLA 2JNJA 1U48A 4HR2A 3DLLQ 3PVXA 3NNAA 2KT3A 1S9EA 3DOMA 2MZJA 5MLCV 1NK9A 3PW7A 4UUXA 2IA6A 2UUAF 4YB6A 2ZHBA 2V63A 1T8EA 1RTZA 5A2QY 2CIMA 3GCXP 5AJ3F 5DM6Q 3ZO7A 3R5BA 4P2FA 2E1MC 4F36A 3I4HX 3GV5B 4JI3J 5E3CA 1HBMA 4J9KA 1TL4A 1JQGA 5KG4A 2F63A 1F60B 1DTTA 2WOMA 3TAMA 2XQCA 2N7CA 5HQMA 4NZ6A 1X60A 3UVJA 4JI7J 4ZP9A 2HZVA 4E98A 2AT1B 3AJ2A 4DN9A 4RW6B 1BWEA 1Y10A 3CJSA 1CC8A 2R4FA 4EFAC 2R2UA 5A8KB 1FTRA 3NMAA 4W90B 1M1GA 1QTNB 3OTCA 1RB0A 4ZVSB 3M9OB 2HFVA 2GJFA 4MKBA 1XIQA 1TMMA 2HYIB 4AYBD 3Q83A 3MMAB 1QAJA 1SC4B 2JHEA 1MWYA 3BB5A 2ZD1B 2DR6A 1WC1A 5J1PA 3GJRB 1FFGB 4HH1A 1FFSB 2HFZA 2QA2A 1HL6A 2YKNA 5GADU 2AJFE 4XIUA 1REVB 1PGZA 3P4UB 4ZJQA 4X4SA 4F4KA 2A0FB 1LWEA 2GVZA 3KJFB 3D1OA 2IC3A 3HSDA 4F3MA 2M70A 1TR0A 3VWSA 2GQ2A 1T0TV 3UE2A 3ZC4A 1ZTTA 5DGAA 4ZVHA 4M94A 3G82B 4IYQA 2M0GB 2OPPB 1FK9A 2CNNB 2P9CA 3OXFA 3VGSA 2MQMA 2UU9F 2OD4A 3LGMA 4MTPA 2A1BA 5IT9Y 2Q43A 2RKIA 3VAFA 2JLGA 3TRGA 3RBXA 3OHAA 5EWFA 1R7IA 5DO2A 4A4JA 4M5DA 4HDGA 1KHVA 4ZVPB 4LIRA 2ZH8A 3LP1B 2DRAA 1X5OA 4KKOA 4F2SA 2EW9A 2FHMA 1PILA 1I94J 1NJZA 1NB2A 4NLPA 2M3DA 5D0HA 4WJBA 2JLEA 4B3RF 4X62F 1XJWB 3DI6B 3R5CA 2GX8A 2UUWA 2BE2A 4C8ZA 2MKIA 2DNKA 1RDRA 4W98A 2G0IA 1H38A 2Z2YB 3KDOA 3DOKB 4KB7A 2HHUA 3IWXA 1W2BR 4M1KA 4Q44A 3L7UA 2JVRA 1WC6A 3KLHB 3MHYA 2ZWOA 4ECTA 4N8NA 2I2YA 4DJBA 1F6TA 3IP0A 3W1YC 3OFHA 2EKYA 3MCNA 2R2SA 3QZ8A 3NGKA 1J27A 3R1LA 2ZBRA 3CPWR 3A3NB 1I51B 5L9NA 2O66A 2LXUA 1UZHA 2HAFA 2E5LJ 2UUBF 4YDXA 3U7JA 3I87A 1IQZA 2AV5A 4QIVA 1RU1A 3U1MA 3UR0A 2VFTA 3RTVA 1NDCA 1K44A 3DNCA 4OV6A 5E3AA 2H9ZA 4LF6F 4IQMA 2HIQA 2HFSA 2ZUAA 3M2UB 1URNA 1OQ3A 3MPYA 2BE9B 4X4TA 4DQQA 5AXLA 4P73A 1RT5A 1RT2B 2DNZA 2FGCA 3BS9A 1NK4A 4ZVRB 4LQ9A 1IBMJ 1E6VB 5K8PA 4GKJJ 1LV5A 1RAFB 3QLHA 4ECZA 2VFRA 2FLPA 2V68A 3TVZA 5ETLA 2I0XA 4H4OB 4HKQA 1SV5B 3QO9A 1TMJA 1YJWS 4WFBQ 4BC7A 1T95A 2VONA 1CULA 4HEA9 2VG6A 3EDRB 3RRHA 4L6V3 1TKZB 4UZBA 4LF8F 3NRBA 2JLFA 3G87A 4IH5A 1TKDA 2MGZA 3GZ7A 1UW4A 4AXIA 4IH6A 1C2PA 4GMKA 1YVFA 4DMZA 3SIPB 4DQRA 2YKMB 4DL4A 3ZZ0A 4F0HA 3I55S 5DDQC 4DUZF 3LW5C 1NSAA 2V94A 4WU2A 4Y0FA 3MZIA 1UVNA 1KD1T 3NCPA 4FS2A 2BRKA 1SH2A 1RTJB 3EMTA 2CUYA 2RRAA 4X4UA 3MEGA 4IFYB 1RTHB 5HJYA 1D0EA 4PWDB 2RF2B 3A4TA 5D8HB 1RAIB 3DFEA 4G1QB 1WSVA 4K8RA 1FE4A 1M5VC 2AHOB 1TL7A 2QFJA 2RB7A 2YNHB 4ZPTR 1I1GA 2EI5A 3QQCD 1U2CA 4YR0A 4JI0F 3JTPA 4RNFA 1LXNA 2ZBIA 1VBYA 1SI9A 1NJWA 4R8UB 1H0HB 2IM2A 4U7UK 3G6YA 1N5QA 2W4PA 4KJIA 1KTVA 2ADCA 5F3ZA 3FNNA 3WHIA 4QPTA 1RT7A 1WACA 1WTBA 3QPIA 4O3PA 3V4IB 1UFKA 4M95A 4DI6A 1S5ZA 2B6AA 4F50A 3UWTA 2ILYA 3CMAS 3SBMA 2CA9A 2EWHA 5F8MA 4C8MA 2O01C 4J9SA 2ZBPA 3V4MA 2L3MA 4OFZA 2G2OA 3D6MB 1R43A 2JC1A 4U8YA 4MK7A 1TL3A 1RAEB 2GJIA 3HCXA 4PWUA 4KIAA 2QL9B 2MDAA 3QWUA 2ASDA 2EG2A 4FVMA 4BLGA 2IM0A 4B3RJ 4WXWA 2KKHA 3ZZRA 1S72S 2F4FA 2C2NA 3UNYA 1DLOA 2OMOA 1SIZA 4K4VA 2F3JA 5C2CA 3KHLA 4FYDA 2R9LA 1G6BA 5BJRA 2Z0GA 2KZMA 2XHWA 1D8YA 1CJKB 4FZVA 1B70B 1IN0A 4DSEA 1RWMB 2CQ1A 3WX8A 2MKCA 1YRUA 2V67A 4W92B 3A1YG 3AQOA 1VIXA 3SZ2A 3TZYA 3PJXA 1XMOF 2NS1B 1RWPB 2FHOB 4K5RA 2KXNB 1KVJA 1M5KC 4NLRA 2UUBJ 1R8BA 4TU8A 2RS2A 1S79A 1NK6A 5HMWA 1W25A 3CCUS 1RYSA 1FKOA 2F65A 4I2QA 3TEHB 2VC1A 2CWXA 1YLXA 5GVQA 5E41A 1C0TA 3ZTRA 1N5TA 2CQIA 4ES2A 3DRXA 4WE1A 5AT1B 1X7VA 3ZTSA 4AL5A 2C2OB 4F26A 4CO0A 4Y6IA 2D41A 4BWJA 2XMJA 1I6JA 1LFWA 1M1KT 4KC5A 3IBWA 2KO1A 2AEJA 3P5TL 3OD2A 1UJ4A 3DC2A 2NUHA 2BXJA 5KFAA 2V8GA 1UJ6A 5T7LA 2QSWA 1NAQA 4ELTA 4K4TA 4FNIA 4OJ3A 4R0EA 2VQFF 4NLYA 5A8WB 1W26A 2E5JA 1VQ9S 2ZOMA 2QGFB 1C1CA 1VCTA 3MECB 1WC0A 1QVGR 3HZEA 1RWKB 4K4SA 1T03A 4MIWA 1IWAA 3BN7A 2MEWA 3BGFA 2ZJQQ 2OELA 4LMZA 4DV2F 3MEEB 3WC2A 3HT3A 2IYIA 3LO3A 1EKRA 2YWHA 4PG6A 1VLYA 2LA4A 2Z58B 2QMUB 2DHSA 2OI2A 3M30B 1WEZA 3AH6A 3FQLA 5K8MA 3EZ5A 1FDNA 1FJ7A 2KFYA 1F2HA 3ELHA 4DL0C 4X4VA 1YJRA 3V6JA 4B3TF 4UQTA 3ILIA 3PEHA 1RKJA 3M6XA 3S1TA 1VQOS 1SIWB 3C2PA 4JV5F 3FBFA 4C3KA 5J2PA 4JYAJ 5ITHA 3UDVA 3HFKA 1UA0A 2HFUA 2XCPA 1S0MA 1N88A 4J9UE 1GMWA 4HVZA 3AA8A 5HP1B 2DEJA 3CD7A 1XMBA 4Z2XA 2YNFA 2UVUA 1FNXH 2BE7D 4N56A 4J90A 1N34J 4DL5A 2VD3A 1VK8A 5K5MA 3G71S 3R1HA 2DEIA 4B17A 2XMWA 4K5SA 4MAKA 2OPRA 3H40A 2JEGA 4P52A 2LQ8A 2IJFA 1S1UA 5LMUF 1S1TA 2LFVA 2CNOB 4P2MA 4GKKF 5KT6A 3NBPA 1CEZA 2CDQA 4CM2A 3SV3A 3H25A 4ECWA 2YWKA 5HROB 2IDEA 2GMLA 4RO0A 2ABYA 3OJUA 2W7OA 1WC3A 3J80Y 1F5CA 3BYPA 4F2RA 1TKTB 1IJFB 2J6SA 4ECYA 5IWAF 1WSRA 2VB6A 4K0KF 2VC0A 1FJGJ 2DIUA 4UY8T 4E8UA 2CG8A 1NKCA 4DSLA 2BANB 2GCFA 2D3UA 3R5AA 4JI5F 1UP1A 2XS5A 5LXYA 3EGZA 4WFYA 1T9VA 3CWJA 4DR1F 4Q45A 3HXMA 5BYRA 1XNRJ 2WZ1A 4RZRA 4KFBA 1N32J 5I4MA 2E7WA 4ZHRA 1S9GA 4N77A 4PYDA 3WQPA 2XO7A 3MCOA 4CO4A 3ILLA 4AXJA 3T1AA 3G4SS 3IM9A 2MKSA 2FJWA 2E1PA 3POTB 1OSDA 3EPIA 2YNGB 4ZN1A 2QLWA 4NLSA 2K1RA 4G1IA 2Y3YA 5M2UA 3HSJA 3UDCA 4WP9A 1DRZA 3CMQA 2XS2A 3N79A 1WNEA 3H7HB 1YWXA 1F1BB 3AFGA 2YWEA 2IFXA 3MUTP 2MLXA 3MFIA 3KK1A 1U4BA 4BBYA 2F9DA 3BGOP 4CZCA 3D68A 3GIIA 4OHYA 4H4MA 3PW5A 3SSQA 6FD1A 1W2IA 4OI6A 1UFWA 2YWFA 2V8DA 4C98A 4DN0A 2AU0A 3JSBA 3J80U 2HWTA 3OPKA 2M7SA 3T1YJ 2ZJPQ 4C8YA 4PG7A 1FD8A 1B7YB 1K1SA 3C6TA 1SKRA 5CYQA 3VALA 4QWCA 2Q6BA 1UEVA 1S1WA 2JSXA 3H5SA 3HHDA 3RB0A 3CTRA 3V81B 3D3BJ 3DRPA 1HNVA 5LMNF 3ET6A 4OI4A 3MURP 2HLUA 3RR7A 3JSMA 1PKUA 3D28A 2C2ZB 2ZNZA 2VQEF 5KFUA 2QEXS 4RW9A 3IGNA 2AGPA 2B4PA 1R8AA 2B4UA 2GGPB 2DNLA 2IJNA 4ZJOA 5THWA 3HMJG 1JLBB 4YFUA 4DDFA 5HVGA 4N7TA 5JJBA 1OY9A 2VPZB 2E5IA 3CT9A 4OL8A 1DY3A 4TXSA 1CC7A 5CQGA 4LF4J 3IS9B 1KOOA 4FP9A 5IC6B 2CJAA 5D0RA 3T41A 3KMQA 2NPIA 3B54A 3CUNA 2P6SA 3OHBA 1RWVB 4D3HA 3UD3P 1GTEA 1RWUA 3M9NB 1EHWA 2XNQA 4DX7A 5B0GA 3PKYA 4GKKJ 1XC9A 1M0SA 2YWGA 3DU5A 3O8WA 3OTOJ 4OYAA 3H8YA 3CD0A 2HPUA 4FPRA 1NRKA 1UVMA 5DGBA 1B7FA 1FXLA 1P8GA 4YS2A 4ZKAA 2HFNA 2W2QP 2VF3A 1QDUB 1JJCB 3WDOA 4RW6A 2RVJA 1EIYB 4B9SA 2V50A 3JAMU 1M90T 1APSA 1T94A 5A8KA 3DDNA 2DO4A 4M5KA 1S77D 4DR7F 1LWXA 4ZP7A 1U25A 5B0BA 2PO4A 4NLUA 2PMZD 3GV8B 2H1YA 3MOZA 1IKXA 4ZPVR 3W2VB 3ZNUA 1B3TA 1U0HA 2ZD1A 5J1EA 4TVAB 4J9QA 3PCOB 3HKZD 5KFKA 1FKPA 3T3FA 2HZCA 2GV1A 2CPDA 4QBUA 1REVA 1H2VZ 4NA1A 1G1XA 5LSOA 3D3CJ 5I3UB 1Q5VA 1VGYA 2OD6A 1PYOB 5J2QB 4N5SA 1OPZA 3R7SB 2OPSB 3DDKA 5CZXA 5B7WA 3OV7A 1NZAA 3M2VA 3G82A 1VBXA 3KOAA 2DH7A 3DLKB 2HZAA 4ZITA 2BKNA 3K5PA 4HLBA 5E5NA 2IAJA 1IBLJ 4HHHA 3OUYA 4AD6A 1A7GE 3BBCA 1YBAA 4DL3A 2GNKA 1TUWA 3KJNB 4USWA 5HN0A 1IJEB 1U2FA 2C28A 1YRTA 3BR9A 3VQSA 1JMTA 1DTQB 3W63A 2DK2A 3G6XA 4NYOA 1PG5B 1FO1A 2AEFA 3NCRA 1RACB 1Y0HA 4ZIWA 4IR1A 4X66J 4O3SA 2DO0A 1QVFR 1U1QA 3OLAA 3DOKA 4JI1J 1RA7A 1N5YB 5KFCA 4LQ3A 3KLHA 1SPBP 1JLFB 1VLOA 3D6HB 4NRTA 3PFEA 1TL5A 2FHJD 4KV8B 2IM1A 4WYWA 3MTKA 2VFSA 2UVRA 3CF5Q 5LMNJ 4KPCA 4ANCA 1NDLA 2FD2A 4IG3A 4EK2A 4LR7A 1EZZB 4K59A 1IM4A 2LQ5A 1RI7A 2KFZA 1NPPA 1SKUB 1TK8A 3X3UA 3MGJA 1QM9A 1HKAA 2AYEA 2C2KB 3FQKA 1TU0B 3WIUA 2MPUA 2IRXA 3UD5A 3VGTA 3M2UA 4A48A 4DU7A 2MXYA 1M5OC 4B3MJ 3MAAB 1Q0NA 1XNQF 4KGMA 4CDIA 1HYSB 3RB6A 2XMKA 3QT8A 1CS4A 4LJMA 2H51B 1HI1A 3THTA 4H4OA 2XSFA 4F25A 4U95A 3CDEA 4NMXA 5IXUA 5ETQA 3BJYA 3K7RA 4WZQA 2ZH3A 2MYFA 2XLKA 2I5JB 1UTAA 3FCHA 4DL2A 1URRA 2L9DA 2MKHA 1Q79A 3N5BA 3JTOA 4G6VB 3GQCA 4ZDNA 4JBCA 2DGUA 5H9EJ 2RJZA 4LF7F 1PJ6A 3M2RB 4Y65A 1JLEB 1HQEB 3I82A 2A6MA 1U24A 1HNXF 4K4YA 4DCPB 3FBEA 2QMWA 2LEAA 4YMEA 1R8HA 4U67Q 2C3UA 3MEKA 4P2SA 4PG4A 3B6BA 4IR9A 2SXLA 2QLBB 2F5GA 1OIAA 1L3SA 3O3LA 4MYUA 1NDKA 3ZTPA 4DR7J 2DXFA 4PWDA 2RF2A 1U1PA 2DH8A 3C6UB 4ECSA 4PCQA 5MAOA 4UZCA 4ZLPA 5LSLA 2D1CA 3PX6A 4YY3F 4DBQA 4RLEA 1T02A 3EPGA 2PT0A 3PHTA 2YNHA 1NNDA 1S9EB 3DOMB 2XTJP 2HG4A 3E51A 1YRXA 1REGX 2J6TA 5C7PA 4R8UA 1JXEA 5DRKA 5JVHQ 3VVTA 3NWRA 2HS3A 4B3SJ 2W25A 3W2WB 5CYJA 3OLBA 2YX7A 5HMZA 3K8WA 3CW2C 3PIOQ 4OMFG 5FDLB 1HQUA 3V4IA 1RAOA 5KFQA 2V34A 1HBMB 2CQ0A 4F4AA 2UUTA 3UDEA 1DTTB 1DURA 5K14B 4X84A 4JI4F 3TAMB 3R7BB 4DR6F 3H20A 3UVJB 4DSFA 2B51A 3KNGA 2YVSA 3IR5B 4DV1F 3GG1A 4DG1B 1QAXA 1VQ4S 3QBCA 1JJ2R 5IOLA 3N28A 1QUPA 3JTNA 2GAGC 4OX7A 4WPAA 1SJ4P 3KG4A 4C9DA 1YKWA 4YB5A 5IQ6A 2WONB 3W64A 3MXHP 4K4XA 1P9YA 3F41A 2P8IA 1C4CA 1IKWA 3NS6A 2MKYA 3Q89A 2YKNB 4PXBA 3NCQA 4CLPA 3KLEA 4MK8A 3QSYB 1RSCA 2V4JB 1LK7A 1VQLS 4NLXA 3MUMP 5AXNA 1BLUA 2GVZB 4ZCLA 3HF5A 2IC3B 5J2MA 1YTYA 1SB6A 3BO2A 2RQCA 3GB0A 1HFEL 5F41A 5J2NB 3A8IA 2CZVC 4ZPAA 4AL6A 2B9WA 2VA3A 2RKIB 2DNOA 1Y00A 1SQEA 4A8KA 4A46A 1HBOB 3HFZB 4NLWA 1WI8A 4WK1A 4OZ5A 1R8PA 4M5DB 3OT9A 1Y5IB 2GAHC 1VRTA 4RNNA 4P9SA 2MTLA 2P2CB 2CG4A 1SJRA 1AT1B 5F9LA 1P6TA 4KKOB 2B5JA 3GMGA 1M5SA 4OIXA 2AD9A 2AW0A 2BE2B 1S0NA 4DR3F 4N41A 3QIDA 2PA3A 2IHR1 1RABB 3KHHA 1YIJS 1NSKL 2KHDA 2UXBJ 2LDYA 1TFWA 2HSEB 4YUDA 1JWWA 3M6UA 1U1MA 2H48B 4ID5B 1HNZF 4K4UA 4OZ0A 2LQJA 1RT6A 3GIRA 2KRRA 1HNWF 3RAMA 2HQDA 4L73A 1HNXJ 8AT1B 3EZUA 5M2PA 2DGXA 1HHSA 1R0AB 3MEEA 2R8KA 3VVUA 2CAJA 4WIIA 2DITA 4GC6A 2UVVA 2DISA 2J8SA 4HL9A 1JJ4A 4TU9A 1RT4B 1HNIA 1RJJA 3OQ2A 3FZ2A 2ZE2B 2C2DA 3M30A 4QIEA 2QG9B 4XAKA 1RT5B 4DS5A 4DR5F 1R0CB 4YHHJ 2V6AA 1ZZFA 1M5HA 4I6YA 3RGIA 4PUOB 3AD8C 2B9XA 3UN3A 1FERA 4BS2A 2LEPA 1HWUA 1KTQA 3M05A 1ZETA 2W2OP 3J81U 1CULB 2LLZA 2CXEA 5KFRA 2WVCA 1SUQB 4IRKA 2ROPA 1WHWA 3BO3A 3KUHA 1KOHA 4NXNJ 2MGZB 2KN4A 3H4BA 3KJVA 1NHKL 1KFDA 3HVTB 4ID8A 2AX1A 3CULA 4O23A 1KLMA 2V9WA 1VFJA 1D9FA 4FNHA 2FB0A 2R7RA 1NK0A 3TUIC 4FYVB 2DPIA 1D9DA 2NXJA 2I1RA 4CM0A 1EETB 3D67A 2C1EB 2JFKA 1LFPA 2CPEA 5C42A 3MEGB 2UUCJ 2OH2A 2PA8D 4FBTA 3PRBA 1OO0B 4WIQA 4AL7A 1Q95G 4YOEA 3MAHA 5CHCB 4LFAJ 3ISNC 5KFTA 5KT4A 2FVPA 3GFYA 2ZKTA 4J9PA 4EI2A 2V4RA 2F8HA 2GHWA 2IYGA 3MUVP 1TAQA 3DLBA 4KGVB 3QAEA 3GR1A 1J5EF 4O3OA 2AP6A 1HD1A 2KM8C 2RD5C 3T1HF 3H5YA 1YSJA 3A8KA 1TKTA 3ISZA 3HD2A 4KAIA 4RU9A 2Z2LA 3ZZUA 4F4ZA 5GADI 5KG5A 3I31A 3FC9A 4XDCA 4UTGA 3D9BA 4NLTA 3W66A 1Q8IA 1RBAA 3I96A 2B6AB 1N0VC 1EP4B 4R0JA 3OSNA 4DLEA 1QAIA 4ZCMA 1AW0A 3GPAA 4ILRA 4P7TA 2KH9A 3IG1A 3CJ5A 1RBOB 2QA4G 2G4BA 3KK3B 1Y9OA 1U26A 5H1SV 1L3UA 2X1BA 2XULA 4MK9A 2ATLA 1YX2A 2Q3PA 2HBZB 2VODA 4BCAA 1X4EA 1VBKA 5KFSA 3OVAA 1JLGB 5BYQA 1DLOB 2YNGA 2WVEA 3D2WA 4ILLA 1M1HA 4A8XA 3TZWA 2KU7A 4J9NA 1S6PB 2ZH9A 2C2RA 1S10A 4LR9A 3DLEA 4RPFA 3WX4A 4LBIA 4A47A 4DV5F 1SC1B 3HSZA 4KH0B 3GFXA 4DEZA 4CWBA 1Y4ZB 1HNWJ 3MR3A 5DLFA 2PE8A 5A76A 3UN5A 4LUBA 5IQQA 3NWGA 2ZH7A 4CLWA 1JX4A 3W65A 3EWGA 4WBFA 2BM0A 4I67A 2EFVA 1FKOB 3G2XA 4I2QB 3KLIA 3SCJE 2F8EX 1VRQC 3AJ1A 3MM6A 2WBRA 1VC5A 4MKVA 4PPDA 4WE1B 4QYZJ 2CPZA 2HMIA 4DUYF 2OHDA 4O4GB 3GFZA 3W5YA 4A8MP 4B9UA 3GCWP 3G96A 2XYHB 3K5LA 3HHEA 1S4FA 4DFKA 2HHSA 3T5JA 4W4MA 2EKNA 1BWVA 2VFUA 2Q1LA 3V81A 3TAQA 4ZJLA 1HBNB 2OUGA 1U1NA 4X4PA 1UEUA 3QATA 3FKBA 3HHLC 1RGVA 1G7CB 3DLHA 3IBCB 3DXSX 3PY8A 4GO7X 3OXLA 2KT5A 2FLNA 1YK9A 2OGUA 6FDRA 1C0UB 1UW9A 3BBFA 3U02A 4ZCIA 1EQMA 1C1CB 2GGPA 3J7Z5 1U2RA 5CYMB 3DLJA 1GXUA 2YQ0A 2VJUA 2FVQA 3ZTQA 3M8SA 4FDFA 1JLBA 2RQ4A 1UA1A 1T03B 2A10A 4CLLA 1LXJA 4ED2A 3Q8PB 2RDJA 2O1PA 2F7VA 2ZKUA 1V3ZA 4FYWB 2FJEB 2NREA 1IR2A 5HVHA 3R7NB 3F56A 3M7VA 4M63A 5F8LA 2LVWA 1XMQF 3LF0A 5I42B 5B0EA 1H2UX 2FYXA 4UOHA 4CCHA 3GJQB 1VC0A 2Y8YA 3GTYX 5D4OA 3L9ZA 4Z37A 1FRMA 3N0VA 3IFEA 2C42A 5DZ6A 4LFCJ 1MWQA 4KE5A 3MPWA 2VBYA 4LF5F 5CCMA 4LF2A 4ED5A 2YKAA 3MCSA 4P2XA 1VC6A 2DNGA 3EGNA 1WF0A 3RAXA 2HVHA 4ZLLA 2WBMA 2X7IA 1F3VA 1LQ9A 1H3DA 2JEIA 2E1AA 5KT5A 4OHXA 1YJ7A 1H6KX 2E7XA 5J2PB 2O3DA 4X2BA 1BMQB 4M5LA 1J5OB 3QSIA 5KFJA 4A8YA 3N6MA 1VOMA 1VQ6S 2YNFB 1WEYA 1NH8A 2HS0A 3W2VA 3R5JB 4WCEQ 3CJ4A 4B9MA 3ENWA 3FDSA 1XR6A 2KI2A 2KVQE 5CD4H 4DV4J 5ETTA 2OPRB 3TARA 1ELOA 3K5MA 1T3OA 1NKBA 2YQ3A 1PC5A 2HHPA 2IPOB 5I3UA 2M52A 2B43A 3IAS9 2E5GA 3EVOA 3NBPB 1GEHA 4O3NA 3PXGa 3FFIA 4JI3F 4JI6J 2OPSA 1EKSA 1P9QC 3NGDA 3IWLA 4WFZA 2L9NA 2RRBA 2ZM6J 5K9FA 1HWJA 5F0UA 4OX9J 4X65J 3O1LA 2B3TB 1JK9B 4M5GA 4JI7F 1QUVA 2RILA 3C16A 2GO8A 2PIIA 4RJVA 5LOQA 2DNQA 4F3OA 2BJ3A 4LSZB 4Q43A 1WKJA 4QOTA 3D0IE 2H3EB 2CJ9A 2XMVA 1KONA 1TKXB 3QGIA 2AKWB 5DJBA 2BVZA 4K4ZA 3RYLA 1FE0A 3P6YC 1U1RA 1EARA 3HVRA 1Q81T 4KFBB 1L3VA 2OEMA 1UVJA 4ZHRB 4I6WA 1BXNA 2BJ9A 3VHQA 4DZ6A 4I2PB 4OHZA 5DQGA 4NPOA 3OL7A 1JLFA 3EX7B 1AXQA 2DR8A 3FEXB 3OL6A 1Q53A 4U7CA 1WG4A 4NEYA 3DM2B 4CO1A 2OP5A 1YHQS 4LF9J 4C3LA 2DYAA 5HSPA 1QTMA 2FDNA 2X1GA 3OVSA 2PI4A 4PABA 2DY1A 1RAJA 1VQMS 1HPZB 1YI2S 2E9TA 1XQIA 1VMBA 1UAWA 5KG6A 4TYBA 4WXOA 1SQGA 3FRZA 3FEZA 2C3OA 1ZS6A 3MR5A 2B8QA 3OW2R 1H98A 2XMUA 3R27A 1HYSA 5DZ7A 2MLZA 1LW0A 4I64A 4H4MB 1Q82T 3HD1A 2EXUA 1VHFA 3RBDA 2BZ2A 1RAHB 4ZPBA 3EGWB 3BH7B 5EUHA 4IDKB 4QR0A 3A3OB 5ETRA 3PTWA 2UP1A 1YZ6A 2W4CA 4CNYA 1BD6A 2GO9A 2FTRA 5E3RA 5CYQB 1FRLA 1PBUA 3QFWA 1CSJA 4MT1A 1YJTA 2AGOA 4TU7A 2XHCA 4USKA 5E3QA 2ZZNA 4GC7A 1FEEA 3BGLA 3M32B 1OQ6A 1S0VA 1CQNA 5A6PA 2DRDA 3JSMB 1BE4A 5KFFA 2E5LF 1SH0A 2M88A 2N4DA 1FHTA 3I5CA 1Y11A 2CQ4A 3SSRA 5ETVA 2HQ3A 3SV4A 1HLWA 3J7A1 4NLVA 3KLVA 1AZSA 2CADA 1KHWA 1R6VA 1UETA 4QWAA 1EJ7L 1VQKS 2LQBA 1BY9A 4ZA1A 2QL5B 3VV2B 1BQMB 1QSYA 2MQNA 3TVKA 1ZZNA 2V5HG 3C6UA 4A8WA 1RT3A 3U27A 4ZVQB 3OFFA 3CMES 2VKRA 3I9V9 1IBMF 1TTHB 1TZ0A 3OSPA 4GKJF 3HK2A 2XCAA 2XMAA 4C6AA 2PI5A 4CLUA 2JL9A 2Y1LB 2L41A 4NWBA 4KH1B 4NZ7A 4NLDA 1F5AA 3E3XA 2HHHJ 3W2WA 3SQGB 5L9XA 4CLFA 4QWDA 1FWLA 5FDLA 1P27B 2A3JA 3HHLD 3F73A 3M8QA 2MY7A 3S7RA 4EBEA 4BC9A 2ZITA 4OHVA 1TL1B 4RBTA 2CQCA 5K14A 3MM7A 2KRBA 2GZOA 5LSRA 4B9TA 1IXKA 4L74A 4QW8A 1VQ8S 4DG1A 4PQUA 1B64A 3QGGA 2W2PP 1IKVA 1U1KA 2NR0A 3DRRA 4ZVEA 2AZ1A 2WONA 4L75A 2MHEA 5FLXY 5LM7E 1IKXB 1K9MT 3CCZA 2J9EA 2Z56B 3PYDA 3IRWP 1KQSR 2CZ4A 2HHQA 4KGZB 5B0CA 1U0HB 2LA6A 2MZ1A 2HHXA 5J1EB 2CNKB 1T9XA 1GX6A 1X4CA 3N9UC 1RK8A 1FKPB 4IH7A 2V4JA 5E2QA 2JZ5A 2F4VF 3HHNB 2J0QD 2PFDA 3PR5B 1HMVB 3THVA 2H65B 5E0OA 1H72C 1UPMB 3AD7C 2BV3A 1MWZA 1TK5A 1HHQA 2AX0A 3M2VB 5J2NA 2WVFA 1RUSA 3K57A 3H90A 2ZDPA 1UFLA 2B7CB 4NLOA 4YR2A 4HYKA 1FEHA 4X64J 4ZPCA 4JB8B 2IAJB 3PEJA 3AQPA 3OUYB 1HBOA 3BH6B 5EHHA 5D0GA 3RZAA 3G6VA 2POKA 2RQKA 2IRUA 4QW9A 3GWCA 3T9ZA 1S48A 3QJJA 1AUDA 5GMKa 3N5FA 3H5XA 3OTEA 2HVZA 1VQPS 4IRDA 2YKQA 2C2MB 2JDJA 1U47A 3H4DA 1WEXA 3WC0A 5KFNA 1YJUA 4PG8A 3M8RA 3ULHA 3LP0A 3X1LB 2IDLA 3FSIA 1GNKA 3ENQA 1RTDA 5L39A 2HK2A 3CO0P 4OYIA 1RHUB 2H54B 2W9BA 2V8VA 5AE3A 1NJIT 4ID5A 2DCLA 2H4WB 3BSOA 5FLXU 1YBTA 4WK3A 4NCAA 2Y1JA 4IG3B 3C46A 3NAIA 4EO8A 1SCJB 3EE3A 5IM0A 1SKSA 5D0EA 1FCAA 1T9UA 2PDAA 1R0AA 2ZBCA 2BM1A 3KHRA 5DQHA 1KVIA 3A12A 3AB2B 5KFEA 2KYZA 1LW2A 4KHMA 1KKHA 2V2QA 5HQ8A 2CKWA 1RT4A 5C25A 1TVRB 4Y28C 1AFJA 5KT2A 3KLGB 3T19A 2ZE2A 1U0SA 1KQGB 4RUAA 3RJMB 3MAQA 4C8KA 1RP5A 3MFHA 3MMBB 4I1TA 3PYFA 1XR7A 2BKOA 3GP9A 5DG7A 3I0SB 4DPXA 2GIFA 4H4KC 1KQKA 1RHMB 1CS4B 1NPKA 2R7QA 4ED0A 3PW2A 4M5NA 4Y2MA 3JQKA 4PUOA 1O8BA 3W9IA 4V19X 5DDOC 3PO4A 3B4DA 3WBZA 4ECUA 4V1Ak 2DNMA 2IVFB 3Q2TC 4DUTA 4UW2A 2DXDA 5GAEU 2X3GA 1SUQA 3KK2B 1T9YA 2I8EA 2PD1A 4OLPA 2VG7A 2BACA 3HVTA 2AWZA 3IBFB 3KKFA 4JI2J 4KPYA 2XY7A 3HSGA 3KTQA 1U1OA 2GVDA 5A8RA 1EETA 4YQWA 2NQPA 1NKEA 3DYAB 1VJWA 4ANDA 2GW8A 1DBDA 4NZ0A 2VICA 1IR1A 3ILJA 1WUUA 3CCLS 2B8PA 1HW9A 4OYWA 5ETNA 3I5BA 3QIPB 3SXLA 3P5BP 3ITHB 4KO0B 2AF6A 4F4YA 2BJ1A 2HNZA 1WHXA 1FNMA 2ZFHA 2ATCB 4V19J 1XR5A 2XEXA 5KG0A 1FJEB 2JEJA 3O2IA 2W8KA 1U7LA 4USHA 2F4VJ 3Q8UA 3RR8A 3AOAA 2OO4A 4NA3A 1UCNA 3OR2B 4ZS6A 1WF1A 4U9RA 4PEOA 4RNOA 1HQUB 1JNZB 4F67A 2ZH4A 1NO8A 5HI7A 1KP6A 2ZZTA 4JYAF 4PXEA 3MR7A 4WP3A 3PHEA 5F8HA 2P9EA 3TQ1A 1EP4A 1U8SA 1WDDA 2FZKB 2K06A 4LFBJ 5GAGU 4B9LA 3UCZP 3VF0B 1GX5A 5F9NA 1ITPA 1ZPWX 2V8HA 4GVLA 4MJKA 1YZ7A 3BR8A 1G2EA 2EK6A 3OFEA 1N34F 3CJQA 1LWFA 3KK3A 1V5VA 3EYZA 1SL2A 2R2TA 4FBUA 2MSTA 4N76A 4LSNB 1K0VA 1OYEA 4DV6J 4DFJA 4O0NA 1H7WA 4I7FB 3K58A 3GR0A 3SDEA 3VAHA 1JLGA 2GMJA 4ED8A 4ELVA 2HBYB 3CDWA 3AY0A 1A9NB 1FT8A 2R7OA 4Y3CA 4QU6A 3U1LA 3TVYA 2QA1A 3HFVA 1IKWB
chains in the Genus database with same CATH topology
3GG1A 2IA6A 2UUAF 4YB6A 2ZHBA 1S6PA 1T8EA 5A2QY 4CNZA 2CIMA 3H5UA 4DG1B 5AJ3F 5DG9A 5DM6Q 1IKYB 5AXKA 3KLEB 1QAXA 3R5BA 1VQ4S 4IO1A 2E1MC 4ALZA 3I4HX 3GV5B 4I4BA 1JJ2R 2NLWA 2JVOA 4TY8A 1T05A 4ECRA 3N28A 1QUPA 3JTNA 3M8PB 4J9MA 1VQSA 2CQBA 4OX7A 3H2VE 3OBIA 5E3CA 3I56S 1SJ4P 3KG4A 1VI7A 2COLA 4C9DA 1HBMA 2VH7A 4J9KA 5J2MB 1TL4A 4YB5A 5KG4A 2EC0A 1VBZA 5IQ6A 1FA0A 2WONB 1F60B 1DTTA 2WOMA 1Z1ZA 4EBDA 2LU2A 4B9NA 3MXHP 3TAMA 3BF4A 4K4XA 1HHTP 1FJGF 4EYIB 2V4QA 3F41A 2N7CA 4M8LA 2FHJA 4NZ6A 4C0BA 1K0TA 1C4CA 1X4AA 1WTFA 1IKWA 4ZP9A 3NS6A 2G0CA 4LF9F 2HLTA 4USIA 4E98A 1HR0F 3AJ2A 2I38A 2EPIA 4DN9A 4RW6B 1VQYA 1BWEA 1AROP 2KZZA 4QR1A 2YKNB 4PXBA 3NCQA 1CC8A 3VZHA 2R4FA 3KLEA 4MK8A 4BHQA 4EFAC 1XNRF 2R2UA 2V4JB 5A8KB 4OJ1A 1FTRA 1LK7A 2KM8B 1VQLS 4NLXA 4QPXA 3MUMP 3NMAA 5AXNA 4W90B 1N32F 3CO9A 2K8GA 4O4GA 3BM7A 1BLUA 3OTCA 2UZAA 3NAHA 4ZCLA 3HF5A 2PC6A 2IC3B 1Q78A 1VRTB 3M9OB 2F9JA 2ALZA 3LALA 5J2MA 1RTIB 2HGMA 4MKBA 1YTYA 1ZPVA 1SB6A 2B5JB 4F3QA 2YTCA 2HYIB 4AYBD 3BO2A 2LDIA 1JLCB 3ZZYA 3MMAB 3GB0A 2RQCA 1QAJA 1HFEL 4X4NA 1BGXT 1RISA 1QSLA 5GAEI 5F41A 3BGRB 2JHEA 5J2NB 1BQXA 5EWEA 1MWYA 3BB5A 2CZVC 2ZD1B 4ZPAA 3K0JA 4RW8B 2C3YA 4AL6A 3W3SA 5J1PA 3N6NA 2B9WA 4HH1A 1HBNA 2VA3A 3PW0A 2HFZA 3BO4A 2QA2A 1GXLA 1RT1B 2RKIB 3BGUA 1HL6A 4Q0BA 2DNOA 2YKNA 5GADU 3V6DB 1Y00A 2AJFE 1SQEA 4NMLA 5CA5A 4XIUA 4A8KA 4A46A 1HBOB 1REVB 5F0WA 1PGZA 4X4SA 4NLWA 2Y1RI 1WI8A 4DV3F 4F4KA 2L9WA 4WK1A 4OZ5A 3V6KA 1R8PA 2FC8A 1C0UA 3GYNA 4M5DB 1Y5IB 4OQJA 1LWEA 2ZHOA 4G1PA 1UVKA 3D1OA 2IC3A 1VRTA 5LJ5Y 1HI0P 4RNNA 3D0HE 2M70A 4F3MA 1TR0A 2CG4A 5LL6d 1SJRA 5F9LA 3VWSA 2GQ2A 1P6TA 3E01B 2J9DE 4KKOB 2B5JA 5CYMA 3S01A 3MMAA 2IBKA 3UE2A 3ZC4A 1ZTTA 1NK7A 1JJHA 4KT0C 3GMGA 1M5SA 3IR7B 5DGAA 3BGRA 4ZVHA 3N01A 4M94A 4OIXA 2N7YA 4IYQA 1RT6B 2M0GB 1S97A 1S1XB 2AD9A 2OPPB 2AW0A 1FK9A 2BE2B 2CQ3A 3HM9A 2P9CA 3OXFA 3TYTA 3AA9A 2MQMA 1S0NA 2V2KA 2UU9F 2A2DA 2QV6A 4DR3F 4N41A 2GFFA 2DNPA 4ZMMA 4DX8H 2OD4A 3LGMA 3KG1A 3QIDA 2A1BA 4MTPA 3VQTA 1SH3A 2PA3A 2IHR1 5IT9Y 2D7SA 1N5SA 2Q43A 2RKIA 3KHHA 3VAFA 1YIJS 3FMWA 2KHDA 2MHNA 2JLGA 1V3RA 4RNHA 5I42A 3TRGA 3VAGA 3OHAA 5EWFA 2LDYA 4DQIA 1R7IA 5HO4A 1MNEA 5DO2A 4A4JA 3CC7S 4M5DA 4R5PB 1TFWA 3NL0A 3T1YF 2CVEA 2XBPA 4YUDA 4HDGA 1KHVA 4LIRA 2ZH8A 1JWWA 3VAIA 3LP1B 3M6UA 1U1MA 2DRAA 3CC4S 1X5OA 1HNIB 4XPCA 4KKOA 4F2SA 2EK1A 4B9VA 2EW9A 2FHMA 1PILA 1NJZA 4NLPA 2M3DA 2XMTA 4ID5B 4NA2A 4WJBA 1HNZF 2JLEA 1KN6A 2JRSA 4K4UA 4OZ0A 2LQJA 2DVIA 3GFHA 4X62F 4B3RF 3DI6B 3R5CA 1RT6A 2GX8A 2UUWA 1CLFA 3M9MB 2OPPA 2BE2A 2KRRA 1HNWF 3RAMA 4C8ZA 2XY6A 4QJVA 2MKIA 3BZQA 2DNKA 3EZUA 5M2PA 2DGXA 1RDRA 2OFGX 1NHVA 1Q8BA 3CGIA 1H38A 1HHSA 1MW7A 2VBXA 5H9FJ 3DOKB 1R0AB 4KB7A 2HHUA 1ZAWA 5IT4A 3VR1A 2CJQA 3MEEA 1PO6A 3IWXA 1W2BR 2WCXA 5KFGA 2R8KA 4M1KA 5C5JA 4Q44A 5F8IA 3DRYA 1H7XA 2JVRA 2RE1A 4WIIA 2DITA 4RUCA 1BQNB 5F8NA 3KLHB 1S6QB 4GC6A 4ED3A 3MHYA 4DFMA 3MEDB 3IWNC 3G86A 2UVVA 2DISA 4PRFA 2M9KA 5GAGI 4RBVA 1DQAA 4ECTA 4HL9A 4N8NA 4HI2A 1JJ4A 2I2YA 3LP1A 4TU9A 1RT4B 3K5OA 4DJBA 2IBOA 4CTAA 1F9FA 4L3NA 1HNIA 1RJJA 3OQ2A 3FZ2A 4J9OA 5SUHA 2BJDA 2ZE2B 2C2DA 3M30A 4QIEA 2GJ2A 3OFHA 2EKYA 4IQXA 2R2SA 3QZ8A 4XAKA 5AE2A 3QYYA 1RT5B 2J7UA 2NSCA 3DI6A 4WFNQ 3NGKA 4OLOA 3R1LA 2IM3A 3C3LA 2KDOA 2RIJA 3CPWR 4DS5A 2HHHF 4DR5F 1J5OA 4Q8EA 4EZ6A 3PDNA 1N36F 5L9NA 3KJVB 2O66A 2LXUA 2AYMA 3SCKE 4X4RA 2UUBF 4YDXA 3U7JA 3PRDA 1ZZFA 3I87A 1M5HA 2OFHX 2J76E 4I6YA 4A8OA 4DL7A 1IQZA 4PUOB 2B9XA 4TLRA 1WWHA 4KQZA 4MIAA 2AV5A 4QIVA 1KLMB 1FERA 4BS2A 5E33A 3VCDA 3DLGB 2LEPA 3U1MA 1TQLA 1HWUA 2FGOA 1BQNA 2CQDA 5KFMA 4LF4F 5KFVA 3VZIA 1KTQA 3HHLB 3UR0A 3M05A 1ZETA 2CRLA 2VFTA 3RTVA 2JWNA 3G6YA 3CJ0A 2ZH1A 3DNCA 1KNZA 2VG5B 4OZJA 3H2UB 5E3AA 2H9ZA 3P49B 4QU7A 4PQAA 1WD6A 4LF6F 1YQHA 2LLZA 4IQMA 2HIQA 1MSWD 1DARA 4HTIA 5KFRA 2DRBA 3M2UB 5D77A 1URNA 1OQ3A 3MPYA 4KJIA 1SUQB 4DPOA 2ASJA 4X4TA 2IA0A 4DQQA 2V0NA 4IRKA 2ROPA 4ZP8A 5AXLA 3JYTA 2E29A 3CDUA 2XGQA 5C42B 4TLQA 5FJ4A 2NXUA 1WHWA 1P1TA 1RT5A 3BO3A 1RT2B 4DHVA 3MOJB 1KOHA 2DNZA 4ECXA 2FGCA 1S9FA 4CH7A 3BS9A 1NK4A 2AGQA 1JLAB 2MGZB 2KN4A 4UUWA 4EZ9A 3H4BA 3KJVA 4LQ9A 1KFDA 1E6VB 3CXCR 3NG8A 4BDPA 5DS7A 5IFMA 5K8PA 3HVTB 3G8TA 1F5BA 2J6UA 4ID8A 1LV5A 2F8MA 3OTOF 1DQ8A 3NKYA 3QLHA 2AX1A 4ATNA 4ECZA 2VFRA 3CJKB 3CULA 2FLPA 4XO0A 4O23A 3TVZA 1C1BB 2I0XA 5HLFA 5KFBA 1KLMA 1A6LA 2V9WA 1R89A 4H4OB 1VFJA 1E6YB 1D9FA 2WK4A 3DLGA 4HKQA 1SV5B 4FNHA 2FB0A 1D8ZA 2QE5A 3QO9A 4YDDB 4OHWA 1YJWS 1OSCA 4WFBQ 2R7RA 1NK0A 3TUIC 4BC7A 1T95A 4EGLA 2H5EA 2VONA 2DPIA 1D9DA 1SJ1A 2I1RA 2WSFC 2OTJS 4ED6A 4HEA9 4TKTA 1EETB 2W9CB 4U6PA 2DR9A 2JFKA 2VG6A 3RRHA 4L6V3 1LFPA 4LVOP 5KFHA 1TKZB 2CPEA 5I3PA 2OTLS 5BYSA 3ISND