5JVHQ

The crystal structure large ribosomal subunit (50s) of deinococcus radiodurans in complex with evernimicin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
b'SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5jvhQ00
3HI9A 2O3DA 1SJFA 5LSOA 1UAWA 2VONA 2CQPA 1H2TZ 1H2VZ 1IQTA 3MD3A 1SXLA 2DNLA 1N54B 2CQDA 5DDRC 3NS5A 3MUTP 2M52A 2MZSA 1SJ3P 3IWNC 3CF5Q 1D9AA 3MDFA 2MQQA 2K3KA 5LJ3Y 2G4BA 4WFBQ 3NNCA 2K8GA 3SMZA 3U1LA 4Y00A 2CPIA 2FC9A 3CCVS 2YWKA 1ZZNA 4ERDA 2DGUA 2DGXA 1UP1A 1N8RT 2MKSA 2MQLA 2MHNA 3ZZZA 1M90T 2KRRA 1WG4A 2KXHA 2X1BA 2LA6A 2E5IA 2OJ3A 2E5HA 1QM9A 4Z2XA 2MZQA 1VQNS 3VAIA 2XS2A 2M9KA 2XS7A 1YWXA 2CQ1A 1WTBA 2CPYA 2MSSA 4UQTA 2QFJA 1P27B 2E5JA 1U1PA 4QU6A 2EK6A 1U2FA 1JMTA 2CQGA 3CMES 3IRWP 2AYEA 3G71S 3G9CA 2DGSA 4J5OA 4ZKAA 3CCRS 4F02A 2PEHA 1FO1A 3FEYB 3I55S 2CPJA 3OW2R 4V19X 4CH0S 2E44A 3TP2A 1PO6A 2CQ2A 1WEZA 2CQHA 3CPWR 1VC6A 2KH9A 2YTCA 1Q82T 1QVFR 1KC8T 2KXNB 4M5DB 2HGNA 3CC7S 3TO8A 2DHXA 1WELA 2J76E 3N9UC 5CA5A 5LJ5Y 1X4GA 2CQ4A 1U1RA 1WI6A 2AYMA 1O0PA 3BS9A 2Q79A 3BEGB 2KM8B 2GO9A 2VODA 4CH1A 2KN4A 1JJ2R 2J0QD 2YH1A 2DISA 2XNRA 2B0GA 1D8ZA 3CXCR 5GAEU 2PE8A 2MQPA 1XN9A 1M5VC 2DGVA 2LCWA 1HA1A 2MZJA 4WKRA 3J7ZT 5DM6Q 3I56S 2MMYA 5MLCV 5D77A 2DGWA 1SJ4P 2CPXA 3BO2A 1K73T 1X4CA 2XSFA 2MXYA 3VF0B 2CQ0A 4YUDA 5LSLA 4EGLA 5LXRA 3EX7B 2N3LA 2OTJS 3G96A 2BZ2A 1OIAA 2N3OA 2CQIA 2MZ1A 1FJEB 2E5GA 3SDEA 4TU8A 4WFAQ 1WI8A 5GMKa 2OIHA 2DIUA 2JRSA 2I38A 5LXYA 5EN1A 1X4DA 3R27A 3S01A 1YJNS 3P6YC 1VQ7S 2MZTA 2DGQA 3P3DA 3P5TL 3UE2A 2V94A 4W90B 1U1KA 2M2BA 1VQ6S 3VAJA 2X1GA 2JWNA 2RRAA 4PR6A 1Q81T 1YI2S 2MKCA 2MSTA 2KU7A 4PKDB 2DH7A 1H2UX 4YB1P 2KG1A 1JJHA 2CPHA 1S79A 3HHNB 2MKJA 1BY9A 2KG0A 4FXVA 2RT3A 4ED5A 2A3JA 2DB1A 1X5OA 3MI7X 2MQOA 3DXBA 1URNA 4IUFA 3CULA 2FHOB 1HD1A 1B7FA 2DNKA 2KRBA 2CQ3A 4LMZA 3S7RA 4QPTA 1U1NA 4RU2A 4CQ1A 3CC2S 2EVZA 3ZZYA 2RU3A 3THTA 2N82B 3U1MA 4CIOA 1U6BA 1PGZA 3B4MA 1K8AT 3V4MA 1WHXA 3MD1A 2AD9A 3K0JA 4C4WA 1RKJA 2CPEA 1VQOS 4TLQA 1K9MT 4QU7A 1VBZA 1P1TA 3CC4S 2LEBA 2QA4S 2LXUA 3D2WA 1WG1A 5CYJA 1NU4A 5BJRA 3RW6A 1HL6A 1WHVA 2J8AA 1X4EA 2MQNA 5IFMA 5DDOC 3JB9k 2KFYA 2N7CA 3CMAS 2XNQA 1A7GE 4IOAQ 2LECA 1M1KT 3VALA 1Q7YT 1FJ7A 3CUNA 3VAFA 3EGNA 2LXIA 2MGZB 2MB0B 2L08A 3LQVA 3MUMP 1M5OC 2M8HA 1UFWA 4C7QA 3CCQS 1FJCA 2SXLA 3SXLA 2DNYA 1M5KC 2DGTA 2DNMA 3NMRA 4W92B 3SDEB 1DBDA 1R8PA 1WHYA 4WCEQ 3VAKA 1H6KX 4LIRA 3G8SA 5CXTA 2EK1A 1L3KA 3NNHA 2HZCA 4FXWA 2M7SA 2LEAA 4PRFA 1X4HA 2KXFA 3UD3P 2DNZA 2AYGA 3G8TA 2KT5A 1S72S 2D9PA 3S8SA 2F9JA 5DETA 1KOHA 3R1HA 2M4MA 2MYFA 4Y0FA 1HD0A 2LQ5A 4IOCQ 1OPIA 3UCGA 2HYIB 2JVOA 2NLWA 4U67Q 2F9DA 1VQ9S 2RUGA 2WBRA 1YHQS 2MGZA 1CVJA 5FJ4A 3VAMA 2HVZA 2LKZA 2CQCA 3S6EA 2KM8C 2J0SD 1X4AA 2DNPA 1VBYA 2DNGA 3THPA 2DNOA 3MUVP 1QVGR 2OSRA 2DH8A 2FC8A 2KVIA 2DO4A 3BO4A 2HGMA 5DDPC 1WWHA 1U1MA 2MKIA 2X1FA 4F26A 1ZZFA 2LYVA 2CJKA 2D3OR 1OWXA 1R8HA 2RQ4A 2BOPA 1U1QA 3MOJB 2M88A 2MPUA 3US5A 5JVGQ 2DGOA 3NS6A 2RS2A 2HGLA 2VOOA 2M0GB 2CPFA 2KHCA 3B4DA 2AYBA 5ITHA 1SJRA 3CCJS 1YJ9S 4P6QA 3DLLQ 3Q2TC 3UCUP 1M5PC 2RRBA 4IO9Q 1WF0A 4OZ1A 1X0FA 2MJUA 2LA4A 3CTRA 1VQMS 3J7YU 1WEXA 2MZRA 3CD6S 1VQ8S 1DHMA 1NO8A 5GADU 1SJQA 2DHSA 1VBXA 2U1AA 3L3CA 1WF2A 1JJ4A 1UW4A 4C0OC 2VOPA 3PIPQ 2DNHA 3ULHA 3RW7A 2M70A 3H2UB 5DM7Q 1FXLA 2U2FA 4A8XA 2DHAA 2DO0A 2YKAA 3CCES 1FHTA 2L9WA 1VQ5S 2MKKA 2ERRA 1N52B 5GAHU 5IM0B 2XB2D 1FT8A 4BS2A 2KI2A 3UCZP 2ZJQQ 1YTYA 2DH9A 4OZ0A 2RNEA 2MY8A 5IQQA 1WHWA 5GAGU 2ZJPQ 2UP1A 3CCSS 1KQSR 1WG5A 4TU9A 1VQKS 3P49B 3PIOQ 2DNRA 3MURP 2G1DA 1VC5A 1YJWS 2YH0A 2JVRA 2LMIA 2DHGA 2DNQA 4UY8T 3CCLS 2L41A 3CCMS 3VAHA 1X4FA 2F3JA 2MKHA 1A9NB 2QEXS 3EGZA 1X5TA 2RVJA 4WF9Q 2RS8A 1VC0A 5GVQA 2MY7A 2ADCA 3H2VE 1X4BA 3FEXB 4F25A 1DRZA 4YOEA 3R1LA 2OTLS 3CCUS 1FNXH 2M8DB 2MJNA 2D9OA 3G6ES 1NJIT 2JX2A 5IM0A 3NNAA 2RQCA 1G2EA 2CPZA 2ZJRQ 5H1SV 5JVHQ 2NZ4A 1W2BR 2FY1A 4LJMA 2OSQA 2ADBA 1YIJS 1U6FA 1WEYA 2KYXA 2CPDA 2MQMA 2GHPA 2DK2A 1KOOA 1N88A 1X5SA 5DDQC 3MXHP 5HO4A 1X5PA 1VQ4S 2DNNA 5D78A 3Q2SC 2XS5A 2FPHX 1RK8A 2X1AA 2CQBA 2DITA 5HL7Q 4QQBA 1DZ5A 3UD4P 2DIVA 3LPYA 3TYTA 1YITS 2G0CA 3BO3A 3VAGA 4WIIA 3G4SS 1KD1T 1Q86T 2I2YA 1F9FA 1ZH5A 1VQPS 4TU7A 1U1OA 1VQLS 1AUDA 4WFNQ 1OO0B 1WF1A 3UWTA 1U1LA
chains in the Genus database with same CATH superfamily
1NH8A 2WONA 3CSKA 3NGTA 2O67A 3TVZA 2PI4A 3AFGA 1FJGJ 1SXLA 1J2VA 2I5JA 2P9EA 2HRTA 3LWMA 4DL3A 3E8OA 1ZAWA 2LQBA 2IC3A 4NPOA 1AYEA 1IBLF 2CNNB 2RF2B 3CDAA 3I4HX 2HVHA 1YJTA 4CO5A 3L4BC 3RTVA 4OLPA 3TA0A 2EBGA 3H0PA 1FDDA 3MF5A 3ITHA 4FS2A 2W1BA 3AB2B 3VGTA 3PX4A 2FGOA 2KTQA 4IH5A 2UXBJ 3HJFA 2DR6A 5CH7B 2XM3A 4ZIWA 3E3XA 1DTTB 3BH6B 4ECWA 1DY3A 3KJVB 4HT5A 2BKOA 4YY3F 1Q8LA 2R2RA 3MAHA 3DGVA 3PDNA 2YKNB 4ECZA 5BYQA 4ED3A 2JDJA 4IG0B 3LTOA 1YKWA 5KG3A 5CYQA 3VF0B 1FKPB 4YUDA 4GC7A 5AE2A 2BX6A 3M8PA 2LVWA 1S1TB 2GO8A 3SSQA 3KLHB 4MIBA 5HP1A 2OIHA 4XAKA 5A6WA 4HHUA 5HJXA 3W9IA 3KHGA 4W90B 3T1AA 4ZPDA 2X1GA 3JS9A 1JLFA 2KU7A 1H2UX 4DDFA 1JJHA 1KFDA 1UTAA 2QV6A 3C14A 1HD1A 4F3MA 1S7IA 3TUJC 5FLXU 3LP2A 2RQMA 2QT7A 3JTPA 5GAHI 4UOFA 3CJKA 5A2QU 4DBQA 3PKMA 1U8WA 1OY6A 2GQQA 1K9MT 3OR1A 1G1XA 2HPUA 3ENAA 3ENWA 2EFQA 2W7OA 5HMWA 1HL6A 3M2RB 2J8AA 3PW5A 1SL1A 1REVA 3ISND 3LGNA 1J27A 2YPZA 2MB0B 3LQVA 2G2YA 2VPZB 3MUMP 1CJTB 4NL5A 2FDNA 2E29A 4A8OA 3CCQS 4UOHA 2I9SA 3VAKA 3IGVA 4F0MA 5CXTA 4B9MA 5H9FJ 4LF6J 2XZDB 2HFSA 4LSZB 1ZOTA 4H4MB 3KNAA 2W2OP 4FN5A 2LQ5A 2J0XA 4IQMA 4RUAA 3QJJA 4WXWA 1O8BA 4AE5A 5J1NA 5KFVA 2QMXA 3MM7B 3TRGA 3KWMA 2LKZA 3S6EA 4OX9F 3W3SA 4B3SF 5D0RA 2GS8A 4NA1A 1R8HA 4KB7A 3I0SA 4ZLJA 3ILJA 1C0TA 3HD2A 3UCUP 3K8VA 5L1LA 2AWZA 3C8YA 4QWEA 4QJVA 3J7YU 3TX0A 3HHEA 1QAYA 5ETQA 1T9WA 4QWAA 3OHAA 2VJVA 3ZTQA 2RKIA 2YQ1A 1TK0A 5HN0A 4R5PB 5DM7Q 3DCAA 4PXDA 4E0DA 5F3ZA 3AB4B 3VQSA 2F8HA 4K4SA 1KQSR 4TU9A 2IVFB 3Q8UA 2LMIA 4MK8A 1BWEA 5J1EA 3N6LA 2GJFA 3MMCB 4HYKA 2K2PA 1AT1B 3BN4A 5GVQA 2ADCA 3DM2A 4CH7A 1IR1A 3IG1B 5KOXA 5CCLA 1NJIT 2JX2A 1U6ZA 5HVFA 1KLMA 3E2EA 4I2QA 3KLVA 1AB8A 2XY6A 4ID5A 4G6VB 1NZ8A 4QQBA 4DPYA 3C6TA 1HI0P 4LR8A 4P52A 4QPXA 1YITS 3BO3A 2CJ9A 1VGYA 1I94J 1QLNA 1XIQA 2V8PA 3WDOA 4ZPAA 1B7YB 1U1OA 4NXNJ 4KBIA 1WF1A 4F4AA 4DF8A 1NKEA 2O3DA 1JLAB 4NCBA 2QMUB 1S0MA 1PIEA 2Y1JA 1VIOA 1WDDA 4LRDA 4DQIA 3CF5Q 1S76D 4ILLA 2K3KA 3GFHA 3DLBA 4GVLA 2OEMA 3SCLE 3HSDA 3SSSA 4X4VA 1RT3B 3DOMA 1GXUA 5IS2A 1AXQA 4ENOA 2BEFA 2BM1A 4AXJA 1X0PA 1VMBA 1X9WA 3QRPA 4NLRA 1Q16B 3D66A 3FSIA 3CMQA 1F2HA 1QY7A 3E01B 1N5VA 4AFFA 4AQYJ 1UWBB 5D0GA 4EI2A 3A8JA 3KLIB 5C24A 2IVMA 2KXNB 1IKXB 1U4BA 3W2WB 4DV5F 3DYAA 4LRBA 2VFTA 4H4OA 4QBUA 3CO9A 5K14B 2B8PA 2KYZA 4RNHA 1T9YA 4QYZK 3KLEB 2OPSB 2LCWA 2H5EA 2QYGA 5JJBA 4NLXA 3NY0A 1HKAA 3SSRA 3MEDB 4DG1A 4M5DA 4EFAC 3SQOP 1VCTA 4Y2MA 3HZEA 4DWIA 4V19J 1L3TA 2R8IA 1X31C 2ZZMA 4QIEA 2IMOA 1U1KA 4B17A 4HDGA 2EI5A 3GJSB 3M2VB 5DGBA 1URNA 4FYYB 5C25B 4DZ6A 3BREA 4TQSA 2YNHA 3PVXA 3IP0A 1PGZA 3GCXP 4F4YA 1AW0A 1LW0A 2HK3A 2Z2ZA 5E3QA 5F9LA 1UEVA 3DRSA 2XWYA 2GGPB 1KRPA 2PGCA 3DLKB 4GRSA 3CUNA 4FNHA 4ECRA 4LF2A 5JXSA 4OFZA 3DOKA 4NLSA 3D3BJ 5F41A 2DT9A 4AL6A 3UR0A 5AJ3J 3TEHB 3WHIA 3R7SB 4LF5J 4RW9A 2XHWA 5KFFA 5DETA 4PPDA 5DLFA 1HD0A 3V6DA 1CJUB 2JVOA 1VQ9S 4RNMA 3DU5A 2QLXA 2CQCA 2KM8C 3NWGA 3KK2B 4WYWA 2HGMA 2IM0A 2CJKA 4ED6A 1RDRA 2ATLA 2NUUG 3Q0AA 3Q2TC 1RAJA 5F8HA 3T5KA 2D1CA 4RW6A 1VJQA 2DVIA 3KNGA 1KSPA 3AD9C 1JK9B 1WF2A 2NR0A 2GV1A 4IG3B 2A18A 2VOPA 3H2UB 4O4GA 3W65A 5IM0B 3DFEA 3DLEA 3J7A1 3G6VA 3EVWA 3PJXA 2W24A 3UNGC 3P49B 1SL2A 4ZDNA 2DNQA 1RAAB 3Q24A 4IO1A 3VAHA 4DR4J 2QEXS 2K1RA 3G82B 1U7LA 3H2VE 3OL9A 1HWIA 3CDBA 2ZD1B 3FK4A 4XO0A 2CG4A 2F7VA 1G2EA 2HFUA 5JVHQ 1LQ9A 2ZH8A 3AA9A 1W2BR 2R7RA 2UUAF 4M5NA 3OTBA 1TP7A 2HVEA 3PO5A 4LSLA 2HMIB 2ZH5A 4EWTA 1U0HB 4ZVSB 1JLCA 2JEFA 1B0PA 2IMWP 1IBMJ 1RT4A 5EWEA 1LEOA 1F0XA 4O3PA 2FD2A 4M5MA 4K4WA 4UOGA 1W2IA 3HI9A 1UAWA 3MTJA 1QE1B 4XIUA 4JV5F 1RE1B 1RYRA 1REGX 1T03A 3Q8VA 3PFOA 4M95A 3HSGA 3Q8SB 3MM8B 1VK3A 2G4BA 2B9YA 3U1LA 3T5JA 2BJ1A 5IZHA 2VQFJ 1QDUB 1M90T 2KRRA 2YKMA 3KK3A 2BJ9A 5F8IA 4LFAF 1BQMB 2MZQA 4P2MA 2EKNA 1N0VC 4ILMA 2XMKA 4TY8A 4ZJOA 2XS7A 4ELTA 4I6WA 2F40A 1YG0A 1HARA 4BWMA 2YBVA 2Z2YB 2JC0A 3MM6A 1N5YB 1TL1A 3IRWP 3HM9A 4ZKAA 3UR3C 4CO1A 4MH8A 1RTJA 4FPIA 1PO6A 2KZZA 5GMEA 3R5BA 2FJWA 2B9EA 4NLTA 2YPYA 3IBFB 4NCGA 1KC8T 3QNWB 4C11B 3MPYA 1N34F 4NI2B 3CC7S 3GSDA 2ZUAA 3M8QB 3PR5B 3LF0A 1VI7A 2V5HG 2LFVA 2WONB 3CXCR 2HZVA 3AODA 2F8MA 3KUEA 4DUZJ 2E5LJ 2LQ8A 1TVRB 5D77A 2H1YA 1XQIA 3ONQA 4FNIA 2RHQB 4MK7A 1NJYA 5IQ6A 1QTNB 4EGLA 4XDDA 3MR6A 2C2NA 3VGUA 4ELUA 3TI0A 2CQIA 2UXCF 3SDEA 1NB2A 4ZVHA 2CVEA 3V5RA 1X4DA 1VQ7S 1CC8A 2P2CB 4NLYA 8AT1B 1SJ1A 3ITHB 2RRAA 1WACA 4DV0J 4LF7J 1H72C 1YRUA 1SPBP 4KKOB 3KUHA 3CJ3A 1RTDA 5F8MA 2IBOA 4OZ2A 3CULA 2JEIA 2QN6B 2OUGA 4K7QA 2JEGA 1XMOF 1WC3A 3BDPA 1UJ6A 2ACYA 3EJMA 1FESA 3PHTA 4NE9C 3TR5A 1XMQJ 2NXNA 4LF4F 4USMA 2C42A 3VVUA 3D6MB 3SV4A 1Y4ZB 1NU4A 5KG0A 1FRLA 3FRZA 2N7CA 1EIYB 2BBEA 1ZM2A 5CYQB 2DR7A 2DRDA 4ZHRB 1FFSB 1M5HA 5HSPA 4OL8A 5HP1B 1WHYA 2UZAA 4WFZA 5A76A 4MMOA 3NNHA 5HQ8A 3GYGA 3GTYX 1X4HA 1JLFB 1D09B 1JXLA 1HLWA 4CLZA 4DV6F 2HAIA 2QG9B 4DJBA 2C3PA 1FWKA 2FY8A 4HKQA 3HX9A 1YBUA 4EYIB 3HT0A 3KMQA 4PXBA 4U95A 2ASJA 3HO1A 2FLNA 1XJWB 3MAAA 4OYXA 1UA1A 2V67A 1WWHA 1TKTB 3I9V9 3C3LA 4MFBA 3BGLA 3OL7A 4RLEA 1XNQJ 4P6QA 4MYTA 2HHQA 1RWXB 4MKBA 4J90A 1TL5A 1T3NA 2MEWA 3D1OA 4X84A 5CYMA 1VQ8S 1J5OA 3VTIA 4RX6A 4QIVA 1KFSA 2DO0A 2B51A 1Z1ZA 2MKKA 1BMQB 1JLEA 3G6YA 2KI2A 7FDRA 4QW8A 1RCOB 2R7TA 1FK9B 4O3SA 1APSA 2DR5A 3F56A 4EZ9A 1S57A 3CCMS 5B7WA 2CFXA 1I3OB 4P74A 1RAIB 1V9OA 1YZ6A 2YWWA 2HWIA 1NNDA 2W2MP 1J5EF 3NNAA 5A8KA 5H1SV 2AMCB 4C0HA 2FY1A 3KG0A 2AKWB 4OX7A 1F9HA 4TKTA 2FJEB 3TUZC 4DV1J 4KJIA 1VQ4S 5F8NA 2DITA 2RKIB 2AJFE 4DQPA 2E1CA 4PXCA 2XGQA 4CI0B 2WVEA 3PG9A 4QCLA 2CAJA 3M2UA 3ZC4A 3RUBL 3LPYA 2PMHA 3L7UA 1NAQA 4TU7A 4LRCA 1HYSA 2VFRA 3CJTA 4LBPA 5EGYA 1RBLA 3MEEA 5E7OB 2W4PA 2AGPA 1NKBA 4H4KA 3H5SA 3EYZA 4WFBQ 1DQ9A 3DM2B 4BDPA 2B4VA 2HFZA 2OEJA 2VIHA 1O6XA 2R2SA 1QM9A 4B9NA 2LLZA 5A0YA 1E6VA 1KLMB 2CQ1A 5C7PA 2MSSA 4I2QB 4IR9A 4DUYF 3P8BB 2EK6A 1FKOB 2ZC3A 3KOAA 3AAWB 4I7FA 2PEHA 3D1QA 2DXFA 3UDLA 4IDKA 2C3OA 1VC6A 1HR0F 2KH9A 2EG1A 4PWDA 2R7QA 3AQPA 4PYDA 2PO4A 3KMSA 4P9SA 3DXSX 4JP8A 4ED7A 3B78A 3DLHA 4RBUA 4B3OA 2VG5A 2OO4A 2ZE2A 3R5DA 5HANA 2MHEA 4YQWA 2ZWPA 4DR7J 4HH0A 5J2PB 1HI1A 4LR9A 3T1YJ 2GIQA 3R9LA 3N5FA 1K73T 3HHLC 2C2KB 4DV4F 3G96A 2F4FA 1OIAA 2R7WA 4ED2A 1GXTA 2PT0A 3R5CA 4OZJA 1PG5B 4WFAQ 3CCZA 2BMBA 4F2RA 4O3OA 4WU3A 1QSLA 2NREA 2DGQA 4K4ZA 3VAJA 3MPUB 1YRXA 1IBKF 4PQUA 2WRMA 4L6V3 3VGSA 2CZVC 1HHQA 4W4MA 4OIXA 5BYSA 3MI7X 2J9CA 5C24B 1SIWB 3NBPB 2FHOB 2F8EX 4QPTA 2XCAA 3V6JA 2NXEA 2OI2A 2N82B 3B4MA 3DYAB 3A8EA 3D1HA 4RPFA 4QU7A 1FWPA 3OQ2A 4OYOA 1OSCA 2QA4S 2BV3A 4DR2J 4OZ3A 5KFJA 2KKHA 1X4EA 1KP6A 1RU2A 4ZCIA 3GYNA 4M5IA 4OLOA 2HQ3A 1T9TA 2EFVA 3VAFA 1G3OA 5CHCB 4DG1B 2G1HA 3M32A 2BVZA 5C5JA 3MZIA 4ETXA 3TNVA 3IS9B 1H73A 5I42A 4DR6F 3G8SA 2GMLA 4ZVOB 3I0RB 4NLGA 1RWKB 1RAGB 2V8HA 2RJZA 5C2CA 3UD3P 4EBCA 3RRHA 1IQZA 4B3MJ 4NLPA 1JKHA 4I1TA 1OPIA 2FJXA 2NLWA 1S6QB 5D4OA 1LFWA 4TYBA 3VAMA 1X4AA 2CJXB 1TV6A 4IFYA 2EWHA 2XO6A 2IM3A 2YNHB 1BD6A 4U7UD 2PD1A 4EYHB 1N36F 1LW0B 2VUGA 1U1MA 3GWCA 5ITHA 3L7PA 3DRSB 1SJRA 2DPIA 1BE4A 3W5YA 3R5AA 5IC6B 5JUMA 3K5NA 3HVTA 4PPZA 5D6GA 1SIZA 2VFSA 1WEXA 1DHMA 4OI6A 2DHSA 1OJ4A 2VJUA 4X4RA 4DSLA 1KR4A 5B0GA 2U2FA 4N47A 2EXUA 1YJ7A 2AIRB 4AL7A 1FT8A 3NLCA 4RW9B 3IXQA 1R6YA 1VQKS 3V6DB 1NK5A 3PIOQ 4JI5F 2G1DA 3FZBA 5LM7E 2DRAA 2YVSA 1IBLJ 1VR6A 1YVFA 2ZM6F 3UI3A 1D9DA 2HQCA 1X5TA 2MY7A 2HSEB 1Y5LB 4I2PA 1IXKA 4A4JA 3CVKA 2PN6A 1TAUA 1RABB 5CZXA 3TW0A 3V2UC 3I32A 2G2OA 2ZJRQ 4IRDA 1XBWA 4ZN1A 2ZHAA 4YR0A 1VRUA 3BBCA 4DCPB 4Q2LA 5DO2A 1RWOB 4RW6B 2HHHF 4LFBF 4KT0C 1Y9OA 2DNNA 2RMLA 1SQEA 4V1Ak 3DOLB 4PWUA 1LV5A 4JYAF 2D74B 3MEGA 2PFFB 2ZBQA 1Z4UA 4O4GB 1L3UA 1S0NA 1HNZF 3K2YA 2Y0BB 3TYTA 4YY3J 5DG9A 1S9EA 3GB0A 2JSXA 3DKDA 3DLEB 3J81j 2I1RA 3BBBA 1WDTA 5H9EJ 1U09A 1JLBB 2XZWA 2UVWA 2VG6B 2FHJA 1AZSA 3OR2B 4C8ZA 1ZM9A 2JL9A 1N54B 3GSIA 2M52A 2AQ4A 4J9OA 2K1RB 1GTEA 4R8UB 1LKZA 3CCVS 2DGUA 2VPYB 5CCMA 1RACB 3D6HB 4I69A 1BC6A 2CXEA 2A10A 4ZVGA 3OVAA 1QJHA 2P6TA 2XULA 3V81B 1NMEB 4J9PA 3FDSA 2Q66A 2AX1A 4LSLB 4J5OA 2B8QA 2FZCB 4CLFA 3QPIA 4AL5A 2RIJA 2WSCC 4FBUA 1RT4B 4UUXA 2BOAA 4EU0A 4NLOA 1XNRF 5KFSA 1HWUA 1G6BA 1O0PA 2GO9A 4YP3A 2J0QD 1Y10A 1H74A 4I6YA 1HNVB 1RBAA 2PE8A 3BGRA 1T03B 2G13A 3MM5A 2MMYA 5CAAA 5L46A 3IR5B 1S1WA 3KJNB 5B0DA 2V69A 4Y2KA 2UUCF 2BZ2A 3KK3B 3B82A 5B0CA 1HQEB 1WI8A 2AHOB 2I38A 4TY8B 3R27A 4OV6A 2B6AA 2HNZB 2UVUA 2V9WA 1NHVA 4W98A 3MM6B 1TL1B 2YQ3A 1WC6A 1F3VA 4UT4A 2C3YA 2VBWA 4OX9J 4B3SJ 2HHXA 1L3VA 3QJPA 2OPQA 1B70B 5AT1B 3R6GB 1T11A 1HNIA 3NGUA 1RWNB 2AJ2A 2GAHC 1TKZA 1RUSA 3TJ9A 3QLHA 3DNCA 4ZJQA 1Z2ZA 1Q7YT 3EGNA 3JTNA 2XMMA 3QGIA 2MGZB 4G1QB 4MK9A 4C8LA 5A8WA 3I87A 1HPZA 1ROFA 4Z7CA 3NMRA 2Q6CA 3A3NB 3SDEB 4W92B 3BDEA 4PG4A 2W4DA 5FDLA 2UV8G 2V4JA 2XI3A 1RB0A 1GMWD 2LEAA 4KGMA 1AA1B 1SVDA 2RH3A 3TUIC 4JI1F 1JX4A 1W25A 4IOCQ 4YHHF 4X4OA 2BQ3A 2VC0A 3ZXWA 1M1HA 1FEHA 2Y1RI 2J0SD 3BJYA 3I5AA 2PI5A 3PV8A 3I82A 1WOPA 3A4TA 1NLKL 2GQ2A 2M88A 5JVGQ 1MWQA 2VOOA 2KHCA 4B9VA 2XCPA 3QGGA 1DTQB 3R6LB 3DI6B 5KFIA 2MZRA 4O0NA 1LWCA 4Y2CA 5HVHA 4WP3A 3Q89A 1FI4A 2HS4A 3AJDA 1BGXT 3PCOB 4CNZA 3D0IE 3LP0A 1U8SA 4AUKA 3RW7A 2M70A 3GR1A 4ZPTR 1S97A 3CCES 4WP9A 5IT4A 2UUBF 4OJHA 4DL7A 2ERRA 1K1QA 4LF8F 4M63A 5IWAF 1Y3KA 4R0EA 2E9TA 4NA3A 1S10A 1CJKB 4DFKA 1O5JA 2G0IA 3JXOA 3SQGB 2VH7A 3CJ5A 2H4WB 4X4QA 3EGVA 3MAAB 1EQMA 2BANA 5IT9U 1TK5A 2NPFA 3U27A 2BQRA 2E9ZA 1GMWA 1T3OA 4MFBB 1GEHA 3KJQB 1WEYA 2AEFA 3R3TA 3WIVA 3U02A 3PZPA 2W9AA 5M2PA 3RG6A 1U49A 2UXDF 5HO4A 4XTTA 3UD5A 4QIGA 3LALA 3BF4A 1J5OB 4KGZB 2ALZA 4IH7A 4DV5J 3D3CJ 3DHXA 5E3AA 2P5VA 4B3TF 4PG8A 4ZS6A 1F9FA 1JLEB 1Y11A 4CLLA 4Y34A 2V4RA 4K5RA 2W9CA 2VONA 1FTCA 2MLYA 4I68A 2DNLA 2UUWA 4ECXA 3ZNJ1 4LBIA 3IWNC 1TAQA 4A8KA 1BWVA 2C2OB 3IAS9 3KKFA 1XK8A 4OYPA 1S6PB 1ZZNA 3D4JA 1NJXA 3A12A 2J7WA 3I96A 3QGHA 2DHHA 5A8KB 2GA7A 3D7SB 5E41A 1GMVA 3NL0A 3M6WA 3QT8A 3KK1B 5GAGI 2RU9A 3FUYA 2APOA 4GC6A 4X65F 4DV3F 2HWHA 2MQ8A 3FEYB 3UN2A 1NXIA 1ZAVA 2BJ7A 1UVMA 3M2UB 7AT1B 3MCMA 4U7CA 5CA5A 5A2QY 1S1UA 1Q7LB 5K8OA 1QAXA 4A8YA 2Q79A 2KM8B 2V50A 1HYSB 2VODA 3RB0A 3HD1A 3AHPA 1OQ3A 4C48A 4F2SA 1SKUB 1HA1A 3MEEB 2DGWA 4A46A 2BE9B 3BO2A 3BSAA 4F8RA 2R7UA 4EMDA 1NPPA 1VFJA 1LFPA 1RQ0A 3JSMB 4X64F 3VVTA 1RWVB 2ZFHA 4B9TA 3Q83A 1YJNS 1GAOA 3IA0A 3P3DA 2JWNA 3HHKA 3FQKA 4ATNA 1YI2S 1SQGA 5D4NA 2CPHA 4I7FB 2QIFA 4FXVA 1GNKA 2VBYA 3FMWA 3QYYA 4PWWA 4RBTA 4ZCLA 4IDKB 3MR2A 3THTA 4CIOA 3MD1A 1FF2A 4B3OB 1A6LA 2CJAA 4HLBA 2QL7B 2VG5B 1T8EA 2ZE2B 3HVWA 1TELA 1VHFA 2A6OA 3JYTA 9ATCB 3FBEA 5J2MB 3KLGA 3RW6A 1PAEX 3LH2S 1SH3A 2LECA 1KONA 1S59A 1NDCA 4ECSA 1UZHA 2IYIA 2KJVA 5L8RC 4EUVA 1U47A 4NLUA 4IR1A 3FC9A 3TA2A 4P10A 3ZZTA 3M05A 2G9OA 3R8YA 4PQUB 4S0MA 4GVBA 2M4MA 2B5JA 3QRQA 1LWFA 1FJGF 5LT5A 3MCNA 3QSIA 1UPMB 1TMMA 1SV5A 3D6FB 1YQHA 2KDOA 5KFYA 1VBYA 2G0JA 2DCUB 4NLDA 3PHEA 3CB4A 3ILLA 5K9FA 3W9JA 3GIKA 1I1GA 1EZZB 2LYVA 3SFGA 2UUAJ 2IBKA 2HGLA 3Q8RB 3CCJS 1YJ9S 3CDUA 1B99A 5I3UA 2GJIA 1Q78A 3HSJA 2HNDA 2XMWA 4C8OA 4L74A 2VU5A 3M32B 5HK4A 4A8FA 3PIPQ 2KT3A 3M30A 3CCTA 1B0TA 2XTJP 2L9WA 2HK2A 1RJJA 4MTPA 4QOTA 3GZ7A 1MU2A 3PNIA 2XB2D 1JKHB 2EPIA 4JV5J 1S9GB 5KT3A 2HNYB 3FGVA 4N7TA 1XEZA 2E7XA 4FYVB 2YH0A 5ETMA 2DHGA 4UY8T 4IFYB 4ZJLA 1NPRA 4LFAJ 2EG2A 5KOWA 2IM2A 3AXKA 2MJNA 5K20B 4FVMA 1FRHA 3CEDA 3W2VA 3QWUA 4KO0B 3NAHA 4U96A 2PEBA 2CPDA 2F1FA 2H5JB 2XS5A 4ZP9A 2CJQA 2HHVA 1TUGB 1N34J 1RT6A 1R8CA 2W8LA 2OGUA 3H25A 1RT1B 1Q1KA 1RA7A 4DN9A 3TZZA 1C0UB 4RW8A 1MROA 4N8OA 4RJVA 3IN5A 3QIPB 4CP5A 4JI6J 3EZUA 3PKYA 2EBEA 3CWJA 3MPDA 2WVFA 3MD3A 4XPCA 2R2UA 4ECTA 2FZGB 3GV8B 3I31A 5T7LB 3TWZA 2MHNA 3ZZZA 2YNGA 4WYLA 3QRRA 3VAIA 3ISNC 4ED4A 1K0TA 4DFJA 4UQTA 2WZ1A 2O66A 2J8SA 4EBDA 4A8SA 5KFLA 3AA8A 4CZCA 3G9CA 2ABYA 1HFEL 3W62A 2WVCA 4P2SA 2YNIA 3B6BA 2DHXA 1ULRA 3GPAA 4ANDA 2HW3A 2KN4A 4M5JA 2DISA 5KFOA 3FFIA 2VFVA 2B0GA 4QWCA 2DTJA 1AZSB 1XN9A 4GO7X 4NLWA 2J7UA 1U0SA 2JH3A 5DM6Q 2XI2A 5DQHA 3TZYA 4CRJA 2MXYA 5GMDA 5J2QA 3TA1A 2JEJA 5EX3A 2FLPA 2V4QA 1FFWB 4K4XA 1HIYA 4LSNA 4KR0B 4WXOA 3S01A 3DRRA 1KTVA 3PYDA 1ZBTA 2A2CA 3VQTA 4DV6J 1ZTTA 2DH7A 1Y00A 1GXLA 4DX8H 3JQMA 1WC5A 1WNEA 3FCWA 4KHRA 4YEAA 4J9NA 2DNKA 2CQ3A 3S7RA 3U1MA 2IFXA 2GJ2A 3DRPB 2HQIA 1HBUB 2QLBB 4CCHA 2ILYA 1S1VA 4A47A 1S48A 5KTQA 3HKWA 2DXEA 2J5AA 3IM8A 3BGRB 3MM5B 1D3WA 4JI8F 1K1SA 2IPOB 2C2MB 5HJYA 3I5CA 5A8RA 2L08A 1M5OC 2QSFA 5HROA 2OFHX 4DZDA 3NXZA 2YX7A 2L48A 4XK8C 3KHRA 1Q0NA 4ZVFA 2YKOA 2H51B 1I94F 3TVKA 3PR4A 4NXNF 4N8NA 3W64A 1LOUA 3MAQA 2DPJA 3ZTSA 3R1HA 1EETA 2QL5B 4ALZA 3O3LA 1F9EB 4ZVQB 2JOQA 1CVJA 4ZOSA 1JB0C 3QAUA 3MM9A 2FJBB 4NZ0A 1YJVA 2BDPA 1K44A 2JLGA 4Y2AA 1DLOA 2BW2A 1J5EJ 3POTA 2GAGC 3FCHA 1TL4A 2AU0A 4OHYA 5KAKA 1T9XA 2LU1A 2VA2A 1KVJA 3NAIA 4DL2A 1F5CA 3EXCX 4WTYA 3OFGA 3DLLQ 2IJNA 1TKZB 2RRBA 6FD1A 3CTRA 1PJ7A 2IRUA 3ZTPA 1UPPA 4F3QA 1JJ4A 1TKDA 4FF3A 2JLEA 3UO0A 3G8QA 5ETPA 3MTKA 4Y6IA 3C6UB 4WP8A 2V4JB 2GVDA 3PX0A 1AFIA 2CNOB 1G4CA 5ADZA 4XDCA 2D7SA 2XMUA 2LP4A 2QGFB 4OZLA 4E2FB 1EP4B 4IRKA 3EUNA 2C3UA 3VHQA 3G87A 3W9HA 2W7AA 4RL1A 2RQCA 4DUYJ 4KSEB 2JZ5A 3HHLB 1MN9A 5G4DA 3CO0P 6AT1B 2OPRA 4X4SA 3W7BA 1PILA 2WVBA 1NHUA 2UV8A 3MMAB 5EWGA 1S4FA 3L9ZA 4ICLB 2B4OA 5D78A 3Q2SC 1SKSA 1HR0J 1LK7A 3LP0B 5ETNA 3MECA 2DIVA 3W8PA 4X4NA 2XMTA 2ZH9A 1FRKA 2NCKL 1QAJA 1AUDA 1SI9A 3ILIA 4NYZA 2BKPA 2W01A 5F3TA 5KG4A 1HW8A 5LSRA 3UVJA 2Z58B 3AXMA 4NMLA 1KVKA 4WZQA 4HVZA 3ELHA 3H59A 4Y28C 2BR0A 4URQU 1Q8KA 2BE7D 2K8GA 2FC9A 4CM0A 3IRXB 2K7KA 2ZEJA 3BV8A 2XGPA 2WTFA 3W5XA 4ZVUB 1X8DA 3EZOA 2HKEA 4NLVA 3WX4A 2M9KA 1IBKJ 3G86A 3OL6A 1RISA 1VS3A 4CO3A 1Q8IA 2EFNA 4C3LA 5KT2A 4DOZA 1B64A 4Q8EA 2DGSA 2WOMB 3I55S 2CVIA 3OW2R 4P7VA 1NCLA 1NDLA 3M9NB 1HHTP 1P8GA 2RF2A 4BCAA 1WSVA 4WKYA 3R7NB 1RAHB 2Q1LA 1I6JA 1Y3JA 3ZZUA 4PEOA 3OXLA 3AY0A 2OELA 1BUXA 4CH1A 3JTOA 2YH1A 2Y0SD 3AOCA 2W9CB 2XNRA 3GR0A 5DS7A 3OHBA 4Q43A 1LWEA 3I56S 4YB7A 4K2XA 3OFHA 1QD1A 2CPXA 1N56A 3BYPA 2KL8A 1JLQB 3OUYB 4YDDB 3PEHA 4DR6J 2N3LA 1EAYC 5AE1A 2X3DA 4OJ1A 3TAPA 4DFPA 1ZA1B 4J7CA 4OHVA 2HG4A 1FXRA 2GIRA 4HEA9 2MKCA 3CIZA 4IG0A 1FFGB 3RR7A 1R0AB 2IAJA 2D3O1 4ECVA 2MQOA 2DB1A 1FKPA 1V5VA 2XO7A 2J6SA 2KRBA 1N36J 3EPGA 4RU2A 2JC1A 3HT3A 1S1UB 4C3KA 4B9SA 4C0BA 5F0WA 2M5YA 2UVRA 4O44B 2BACA 1P1TA 3I5BA 3K5PA 3SFUA 1T95A 1M1KT 3VALA 1CG2A 3QO9B 1NH7A 3IWXA 1NDKA 2GHWA 4FS1A 3Q23A 4LF9J 3KFWX 3M8ZA 2IIHA 2SXLA 2DNYA 2DGTA 3KTQA 4RW7A 1IBMF 4I0WA 1Y0HA 3FZ2A 2YWGA 5HQMA 2HZCA 2CADA 1N4LA 2G2ZA 3Q8YA 3TX8A 2DR9A 1C4AA 3C15B 4HI2A 3M2RA 5GAEI 3FVYA 1U26A 2HFOA 2YWEA 1U24A 2ZM6J 1OY9A 3CJ4A 3CCWA 5D8HB 3ICLA 1RTHA 1CJTA 1YLXA 3MOZA 3EVOA 3MUVP 3QGPA 1FEEA 3PXGa 2VQFF 4DSKA 2VBZA 4C8YA 1UZDA 1MG7A 5G0RA 2D3OR 5FIIA 2RS2A 2M0GB 4LRAA 4OZ5A 5HBMB 2GVZA 3KLGB 2HHHJ 1M5PC 3R5GA 1SKWA 4JV1A 4IO9Q 4HACB 4M5HA 3MM7A 1EB0A 2QA2A 1LK5A 4A8WA 1HNZJ 4C0OC 2IA0A 3ULHA 2XBPA 2GFFA 4PXEA 1FXLA 2RB7A 1FNOA 3PRVA 1P9YA 1UFKA 3K57A 2ZZNA 2CUYA 5KFCA 4Q8FA 3H7HB 3T9NA 4BS2A 4MT1A 3SCIE 3PO4A 4GVBB 1XTZA 2RNEA 3I4PA 2XY7A 1U48A 5IQQA 1WHWA 2ZJPQ 1LWFB 1WD6A 4KH1B 2EC0A 1FNMA 2E5LF 1SV5B 2VD3A 3GG1A 3CCLS 1RHQB 1ACMB 3EGZA 1FD8A 1VC0A 3NKYA 1LW2A 4FPRA 3BSCA 1XWLA 1SKRA 4JI2F 2FZKB 3H2LA 3G6ES 2UU9F 1BHNA 2KJWA 1C1CB 1YIJS 4DV0F 4LF7F 2DK2A 5I3UB 5L39A 2JNJA 5KFUA 3MXHP 4EO8A 4X4UA 2BXJA 4DLGA 2HHPA 2DD8S 5HL7Q 1KHWA 4ZA1A 3QJLA 1UVLA 3KHHA 1XNRJ 3M30B 1O51A 2R7OA 1WSRA 1RWWB 1FRIA 4CLKA 3UFCX 4C97A 1MU2B 1Q86T 4F4ZA 2V68A 3KLFA 3QFHA 4G1IA 1T94A 3UWTA 1N33F 5B0EA 1SUQB 2QLFB 3HCXA 1N6QB 2HIQA 1H2TZ 3QT6A 1S1XB 2NXJA 2YKPA 2UUCJ 4Z37A 3H40A 3FEZA 2CPIA 1KQKA 3K59A 4DEZA 4IFVB 2DGXA 5D0HA 3V4IA 3MCOA 4WTOB 1W7WA 2MDAA 1RTZA 2X1BA 4Z2XA 3L95X 2DY9A 3ZFVA 2AV5A 3JQKA 2FLLA 3O1LA 4OHZA 5RUBA 1VISA 3T6BA 4J9KA 1U1PA 3BR9A 3T5LA 3ZNUA 1RU1A 3CJ8A 3G71S 5E3RA 4HI1A 3W66A 1SBRA 4UZCA 4ZLNA 4ZPCA 2E66A 3VZHA 3TJ8A 2HHWA 4F4KA 1NK4A 2XYHB 2COLA 1WELA 4RW8B 1MROB 1CULA 4LBHA 3VR1A 5KG7A 5DLGA 1IKYA 4QYZJ 4NMXA 2I0XA 1NBEB 1VQSA 3HFVA 1EKRA 5IXUA 3DRXA 5KFXA 2Z56B 5C42B 1SC4B 1JWWA 3D9BA 4IOBA 1X4CA 3QIDA 3A8KA 1IKXA 2YNGB 2ZZTA 2QL9B 2ZWOA 3W2WA 4DCOB 3BKUA 3DLGB 4LVOP 5GMKa 2OD4A 1GX5A 3JSYA 1IN0A 5K14A 4JI1J 2V94A 4TYAA 4YHHJ 4NEYA 4H4KC 1Q81T 3QAEA 2AP6A 1GTHA 5L1JA 1YX2A 1R89A 1F2GA 3H4BA 1S79A 1RAEB 1FX4A 2EFPA 1YBTA 5KFQA 3MEDA 3HHDA 4CLTA 3WBZA 3RJMB 2AZ3A 3H5YA 2YNIB 2PMZD 1HBNB 2J9EA 1CLFA 1ZTWA 2ASYA 4TNOA 1WUUA 3BH7B 1WHXA 4DR3F 4C4WA 3M8WA 1BQXA 1TKXB 3K5MA 1WG1A 3M2VA 3PW0A 1U2CA 2V34A 2QO3A 5KFRA 1IKWB 5IFMA 1H3DA 5D3GA 5F8JA 4DV1F 2VA3A 1NM2A 4DXLA 1YJUA 1HMVA 1Y5NB 2M8HA 4N77A 1HNWF 3OFEA 1OPZA 2UUBJ 3SXLA 2V8VA 3M9MB 4MIWA 4KV8A 3HULA 2O01C 1DBDA 4NLQA 4LF8J 4WCEQ 5IWAJ 1T9UA 4LIRA 3DRRB 4NOHA 4Y3CA 3G6XA 1NZAA 2GZOA 3OTDA 3ZZ0A 1PC4A 1S72S 1RT2B 1NSAA 3ZZRA 1KOHA 4QYRA 2HVDA 4TN2A 3BQ0A 2R7VA 4J37A 4OX8A 3PYGA 2L9NA 4F4WA 2HVZA 3QBCA 4F50A 2XWXA 1QVGR 4K4TA 3DC2A 4KE5A 2DO4A 2Y9HA 1IKVA 4DU7A 3ILOA 4YFUA 2MPUA 3NS6A 1S1VB 4MAKA 4NWBA 3KG4A 1KQGB 2AJ0A 3Q8PB 1JJCB 2UXDJ 4CT8A 4A48A 2IJFA 3UQSA 1WF0A 2MJUA 2Z30B 1FDNA 3L09A 1SJQA 4GMKA 2Z4PA 5HROB 1PYOB 1VQYA 4DS5A 4B3TJ 2XLKA 4F7VA 1FE4A 3OD2A 5C2GA 3KG1A 3OXGA 1VDHA 3OT9A 4MKVA 1PKUA 3RZAA 2WK4A 2FYXA 4X62J 2BE2B 3F73A 3AT1B 1S12A 4QR0A 1EETB 4TLRA 1FE0A 1KWMA 3BKFA 4ETZA 3MM9B 1F60B 4IG3A 2ZH3A 2RSQA 1DLOB 4WF9Q 1NJWA 3HLUA 3MFIA 2P8IA 3NG8A 4TQRA 2D9OA 2NPIA 5IM0A 3OXFA 4OYZA 5LOQA 1Q8BA 3ZZPA 3MCSA 4CDIA 1U6FA 4JI4F 4X65J 1UWAA 4DV3J 1KOOA 1URRA 1CEZA 5KFDA 3JAMY 2I5JB 4FP9A 1RSCA 2FPHX 4MJKA 1NK8A 3O44A 3G82A 4B3RJ 1DZ5A 2IC3B 3BN7A 2RUSA 2J9DE 2ZD1A 1KTQA 3G4SS 1VK8A 4C9DA 5KT6A 2AF6A 3O6QA 1TMJA 4OYMA 1GH8A 5HLFA 3QZ7A 1RYSA 3H4DA 3PM9A 5BR8F 1H2VZ 2IM1A 1U0HA 2FJAB 3D28A 4I67A 2RHSB 5EHHA 2YWKA 3CD7A 3GU0A 3M4XA 1HNXJ 1OYEA 4OX6A 3EMTA 1NKCA 3C16A 3OLAA 1YSJA 3O8WA 3ETMA 2F5GA 2CPYA 2LDIA 2OPRB 1QE1A 1P27B 3OFFA 4YMEA 1S6OA 3MM8A 3X3UA 1S5ZA 4M94A 1MMNA 1D9FA 2LQJA 4DL6A 1RHUB 5HATA 4QR1A 5MAOA 4FF1A 2PA8D 4ZVTB 3M8PB 3TO8A 3Q22A 2CQ4A 2W7PA 3TQEA 2FGCA 2D41A 1NJZA 1D8ZA 1IUJA 2H54B 4D3GA 3GJRB 2UUTA 2PSZA 3J7ZT 5EX0A 4ECUA 3IAM9 2B9XA 1PC5A 2ZOMA 2CWXA 1RI7A 4C11A 1OMSA 2YWFA 3C14B 4NRTA 2MZ1A 3LP2B 2RDDA 2DIUA 5LXYA 2RDJA 2XYGB 5EN1A 4Y2IA 3CJKB 1C1BA 2M2BA 1VQ6S 3OR1B 1HBMA 4OI4A 4ZIVA 1TVRA 4DPOA 3DN9A 4WK3A 1REVB 4ED5A 2B7CB 1VHIA 4CQ1A 2RU3A 1I51B 2WBMA 4J9SA 4OJGA 1CC7A 1T02A 3FJ2A 4KGVB 3GE9A 3K0JA 3N0VA 3HFKA 1JXVA 1GFWB 4KKOA 1EKSA 1UVNA 2K06A 1LWEB 3BPSP 5ETKA 3IBWA 4KHPF 5HAOA 4WE1A 1X9MA 2CNLB 4KQZA 4UOCA 2R8HA 2R9LA 4ED1A 5B08A 1R8PA 4X4PA 1NHKL 1AFJA 1E6YA 3RYLA 3MWBA 5H9FK 1B4SA 3MMJA 1RWUA 1NSQA 3I0SB 2KT5A 3LAKA 1T05A 2D9PA 3S8SA 4N76A 1RHKB 1C0TB 1MLAA 4Y0FA 2N7YA 2R8KA 4DN0A 2IAJB 2VQEF 3WC2A 2HYIB 4U67Q 4EZ6A 5LMNF 1X7VA 2BKNA 4WU2A 4ZHRA 2IDLA 4J9LA 3THPA 2FB0A 3K5OA 2HFNA 2OSRA 2N4CA 3NEKA 4USIA 2OPPA 4DSIA 5IT9Y 3BO4A 3LGHA 4F26A 4FKYA 2BOPA 4NASA 4WFXA 1RT5A 2R8GA 3BYRA 2H48B 1R31A 4RWWA 1KDNA 2LA4A 1IWGA 3VV2B 2GMJA 2U1AA 2KVQE 5J1EB 2DNHA 1MW7A 4RW7B 3AQOA 5I3PA 1TKTA 2AGOA 1R27B 5T41A 2DHAA 4GKKJ 4DSJA 2V9KA 4DX6A 2E1AA 3UCZP 2ZJQQ 3DGPA 2V8DA 4ES2A 1FRJA 2IVYA 1KLNA 1RAFB 3KJFB 5DZ7A 3OV7A 1RTHB 3HVRA 2P9CA 5DRKA 3OTCA 4ID5B 2KT2A 1DQAA 2RS8A 1SC1B 3OLBA 2ZKUA 4F25A 1DRZA 2OTLS 3C6TB 1FNXH 5G0RB 3S1TA 3CT9A 2OH2A 8ATCB 5B0BA 4ZMMA 1UL3A 2GVZB 4LJMA 2HURA 3A3OB 5BYRA 2ADBA 1FK9A 1GMUA 1YBAA 2W2PP 2V2QA 2FVCA 9RUBA 2GHPA 1X5SA 2ZH1A 3KHLA 2HLTA 4A8QA 3DDIA 3LP1A 1HQUA 2FJVA 2ZHBA 4CM2A 1YDLA 4LF1A 2XHCA 3UD4P 3G2XA 1TU0B 2KO1A 3DOMB 3HZGA 1OQ6A 1KD1T 1P9QC 4RUBA 3T19A 3TQ1A 2QLJB 3LGMA 1RLDA 2XQCA 2GHVC 2EFOA 2ZDPA 3MMBA 4URSA 1UVJA 5DG8A 4QR2A 3MUTP 1R8AA 2HRUA 4KFBA 3MDFA 2MQQA 2DJWA 4N56A 1OS5A 2C3MA 3LO3A 3GYXB 2J6TA 5SZTA 1KBRA 1LW2B 1UEKA 3UN3A 4ERDA 1VYAA 2V6AA 1UP1A 1HW9A 3R2DJ 2LA6A 3M7VA 1XC9A 3OTEA 1UEUA 3D0GE 3IO1A 5B09A 4H4OB 5DGAA 1RLCL 3NRBA 4CLYA 4U6PA 4KAIA 1R3NA 8RUCA 3GJQB 2Q6BA 2ASDA 2F4VF 1U2FA 3RBDA 3CMES 3PW7A 4IKAA 3A8IA 4DSEA 3KYLA 1RHRB 5F8GA 3FNNA 3CPWR 1UJ5A 2FVSA 2L3MA 2YTCA 4BBYA 4M5DB 1BQNA 3R5JB 2J76E 3N9UC 5LJ5Y 4K59A 1WI6A 3KLFB 4USUA 4FKXA 2PA3A 4O0IA 2QX0A 4DQRA 4JI8J 4F67A 2MQPA 1MNEA 1FKOA 2Y1LB 2M3DA 4JI0F 1B0VA 2ATCB 4WKRA 4Q0BA 3C46A 2LQ9A 2AW0A 5T14A 2QA4G 1YJRA 5LSLA 3V4IB 5LXRA 2OTJS 2VV5A 2ZNZA 2CDQA 5KT4A 4QZVB 3P6YC 4CLPA 3IBCB 2VICA 4Q45A 1MMDA 4RWXA 4YB1P 5J2PA 2POKA 2MKJA 4ZVEA 3NGSA 3T1HJ 2A3JA 4HH1A 4IUFA 1GK8A 2NSBA 2F65A 2CWKA 2HLUA 1N5SA 3RRGA 1S77D 1IBCB 5HMXA 1CULB 3DOKB 2XMAA 2MLXA 1U45A 1UCNA 4NYOA 1IKYB 4IH6A 2QE5A 2LEBA 2XEXA 4KYZA 1H7WA 4F36A 2WHOA 2IA6A 4QIWD 3NBPA 4E8UA 2IYGA 4FYDA 3CD0A 4LUBA 1M5KC 4Q7AA 5AXLA 1IM6A 1KN6A 1IJFB 1TUWA 2VG7A 4KPCA 2WW4A 5AE3A 4FXWA 2ASLA 3LANA 4RZRA 4MKAA 2VHGA 3EE3A 1MMLA 5CZVA 3GIMA 4PAAA 1IVZA 2YX1A 1FA0A 1U25A 2X7IA 2RUGA 2WBRA 5AXNA 4DR5F 2R7SA 4RUCA 3GIJA 3IS9A 1KKHA 4N41A 2JFKA 2GX8A 5DDPC 3I0RA 3VWSA 4XPEA 4J91A 5IV4A 4X66F 4ZP8A 5ETVA 1TK8A 1GX6A 1S9FA 2AYBA 4UTGA 2W4CA 5D3GB 1S6QA 1VQMS 4DPXA 5ETLA 3GG0A 1HMVB 4X2BA 3DHWC 4DCJB 2FJDB 3RBZA 3H5XA 2QMWA 4KV8B 4C8KA 2PMWA 3K89A 4RW4A 1DFDA 1RHMB 1X9SA 3UDCA 1VQ5S 3DLJA 1RHJB 1R7IA 3RBXA 1N32F 2BW7A 4ZCMA 4DX7A 4P73A 1N48A 5GAGU 5J2NA 2VBXA 3KXDA 3SCKE 4K2JA 2W25A 5AXMA 1H38A 1DJ0A 3R2CJ 1EJ7L 2F3JA 3JAMU 2HBRB 1RXOB 3J81Y 3M1VA 2WB1D 3FEXB 1IKVB 1UJ4A 5JMNA 1JLCB 3BM7A 3NP5A 3GV5B 3K8WA 2BA9A 2CPZA 4ZLLA 4USVA 4D3HA 4LIWA 4Q2MA 1ICEB 3OPKA 3FCVA 2EKYA 3GONA 2GC8A 3JQJA 4IQXA 5HI7A 4U8VA 1VBKA 3I9ZA 3TAQA 5CQGA 3ENVA 1YZ7A 3CDWA 1S99A 3R7BB 1QSSA 4DL5A 4DPUA 3SIPB 2BRKA 2ZOGA 4B9UA 2ACMA 2YKMB 2HEKA 3CJ0A 1VQLS 3MPWA 4WFNQ 2KFZA 2FHMA 2C2DA 1S6UA 1HWLA 3CD5A 5LSOA 2PC6A 4YN3B 1RADB 4DPWA 5M2RA 3OTOF 1IQTA 3J7YI 3MHYA 5KFHA 2CQDA 5DDRC 3DOLA 1PAUB 2ZBRA 2HIYA 3HSZA 5LJ3Y 3EICA 1RTJB 2VKRA 4BC7A 3P45B 2W9BA 2MQLA 3QSYB 2ZH6A 3SI8A 4PABA 4NCGB 2E5HA 4NRUA 3MPVA 4C2MA 3GIIA 3OL8A 2HHUA 4M5KA 1RT7A 2IJRA 1JLBA 1VLYA 3PTWA 2VG6A 3IMQJ 3OR2A 1QSYA 2H65B 3QATA 1DQ8A 4QU6A 3LAMA 2CQGA 5L1KA 2VKZG 4F02A 3O2IA 2CPJA 4R8UA 4V19X 1WOSA 2E44A 4G3IA 1HWJA 2CQ2A 1TL7A 2CNKB 4C98A 1S0OA 3DMJA 3GCWP 6FDRA 2NUHA 3BB5A 3V81A 1JJ2R 5HLFB 5KT7A 1M5VC 4PQAA 2MZJA 1RTDB 2AGQA 4F04B 1KHVA 4KY3A 4P71A 1UETA 2D69A 2JJ4D 2N3OA 3N6MA 2E5GA 3C16B 1HWKA 1EARA 4ES1A 1V6HA 3HXMA 1HNVA 2ZH2A 3RBEA 5B0AA 1ZA2B 3QT7A 4O3RA 3HF5A 2I6WA 2KG1A 2BJ8A 4M5LA 4F0HA 2KG0A 2D3ZA 4OJ3A 1B7FA 2HQFA 4CO2A 1U2RA 1R8BA 5KFAA 3TAMA 3CC2S 4UY85 1DURA 1HQEA 2DEIA 1M5SA 2RILA 1K8AT 1RKJA 4EO6A 3PYEA 2CPEA 2HNZA 1FDAA 4JUZA 3GMGA 3CC4S 2H4YB 2OAUA 2WAQD 4J9QA 3CW2C 2R2TA 2K7JA 3JB9k 1M0SA 1A7GE 3THVA 4DPTA 2VPXB 1KS2A 1FJ7A 3ADAC 1RWMB 2LXIA 5E0OA 3PX6A 4B08A 4DMZA 3GP9A 2PDAA 3N5BA 4DV2F 1UMJA 3J80Y 2CJBA 4DX5A 5DQGA 1C1BB 1CJVA 2EK1A 3D0HE 1L3KA 2Z2LA 3RB6A 2C2RA 1N5TA 5KFGA 1HBMB 2DNZA 4HT7A 5HVGA 2HWTA 4JI6F 1X60A 4JOUA 2NXUA 3UCGA 2F9DA 2MGZA 4G1QA 3GQCA 4HTJA 2OLWA 3M6UA 5CYMB 4MIAA 4JI2J 4DSFA 1YRTA 3BGOP 2DNOA 3RGIA 4UF4A 2UU9J 4JI7F 2NYIA 2DH8A 1FVQA 4RNOA 2MKIA 1U1QA 2CDRB 2DGOA 1R0CB 4GKJF 3PRDA 3K17A 4ER8A 3DU6A 2HHTA 1VRTA 1S49A 4OZ1A 3CIMA 4NX9A 5GADU 4WE1B 4WWSA 1VBXA 4NXMF 4DR1F 1BLUA 5IT0A 4ES3A 4DV7F 3PJ9A 2D3UA 1QUVA 2XZTB 2VDIA 1E6YB 4PG5A 1N33J 3RAXA 2B3TB 3ETOA 2O5DA 4Z7YA 1T05B 4WFYA 1DTQA 2CZ9A 4HDHA 4HHHA 3DI6A 1EHWA 4PZVA 2QYCA 2VDHA 1PCAA 4NEZA 1VOMA 1X4FA 2MKHA 4DL4A 2HQDA 1IM4A 2OPPB 2GIFA 4R0JA 3TZXA 4ZVRB 4KPYA 1FKAF 1CJKA 2OSQA 2BJDA 2K3IA 1RT5B 4KH0B 2L9DA 4FYWB 2XY5A 3SQGA 3VZIA 5E3CA 2XMJA 5D15A 3NWRA 1S0VA 1N5QA 2YKQA 2H3EB 4WIQA 1B3TA 3VAGA 4K0KF 5LMUF 3MR5A 1UA0A 4LFCF 3LA0A 3F0NA 5A0YB 3GFXA 1E6VB 1R0BG 1FCAA 3DGPB 3NGRA 2NS1B 3NCPA 5J1PA 4Q5VA 4TXSA 4JI3F 1ZS6A 5E3PA 1FTRA 2GNKA 3NS5A 4KIAA 2R7XA 3M6XA 3AJ1A 4ED8A 2MKSA 2W2NP 4PWDB 2BUNA 3NOCA 1VJWA 2KXHA 1JNRB 1PBAA 1QUPA 3K5LA 1NK9A 2B4UA 1VQNS 3QMQA 4CYUA 3AH6A 2HS3A 2MTLA 1WTBA 1RP5A 1KEKA 2WSEC 2QFJA 3P4UB 3MFHA 1P1LA 4JBCA 5L9NA 3D6TB 3LP1B 1HQUB 1ELOA 2AYEA 3B8HA 4RKUC 4CH0S 2XLJA 1S6PA 1TZ0A 2RDIA 4DR3J 2J6UA 4NZ6A 1U1RA 3KK1A 3H90A 5EUHA 3T5HA 4P75A 3EM1A 1MN7A 3MMBB 3C19A 2OKQA 5DJBA 1Q53A 4KFBB 1HNWJ 1BXNA 2LXFA 2VZ9A 5KT5A 1NK6A 3FBCA 2Q3PA 4H54A 3CJQA 1A0OB 4YB6A 2LU2A 3WQPA 1UW9A 2ROGA 1VLOA 4HL9A 3EWGA 2DXDA 4J9MA 5KG6A 1MWZA 2J9DA 4PKDB 4URGA 2WSFC 2Z0GA 3HHNB 4FYXB 2GMHA 4NCAA 2CIMA 3GV7B 3H5UA 2V63A 2Z8QA 3JSMA 1BQNB 1EQ0A 2UXBF 4CT9A 3ZZYA 1EX8A 4WZMA 5KFZA 2V2ZA 3QFWA 5I42B 4LQ3A 2FVRA 1WJ9A 1VQOS 4TLQA 1NK0A 3F44A 2NXCA 1ZM4A 2DY1A 2I8EA 2XSJA 4RBVA 2HAFA 3D68A 5DZ6A 4Q0BB 2CZ4A 4DLEA 1QTMA 2HRYA 2WCXA 3HKZD 4ANCA 3LUYA 3UDEA 2WW8A 4C7QA 1FJCA 1TV6B 1JLGA 4QWDA 2QRRA 1H98A 2BQUA 3NS7B 1FRXA 5J2MA 3EZ5A 2AYGA 1SCJB 2DEJA 5E2QA 3HVTB 1JNZB 4JV0A 1F3FA 2BJEA 3OVBA 3IR6B 3HVAA 3RB4A 1LWXA 2EC2A 4JI4J 3NGKA 3SEOA 4YR3A 4I4BA 4LVNP 3BSOA 1HHSA 2IRXA 5HQLA 2HHSA 3BPDA 4CLWA 1RAOA 3RRKA 3VGVA 3KUGA 4NYPA 3SV3A 1IR0A 1UW4A 4KHMA 3R97A 4K50A 2DRBA 2VG7B 2UXCJ 4I2PB 3PEJA 2YKAA 3J81U 5IOLA 2E1RA 3TARA 1N52B 1LXNA 5GAHU 3A1YG 5BR8J 4LF6F 3W61A 4AD6A 3DDNA 2MY8A 4CLSA 1WG5A 4IYQA 1S4EA 1VC5A 1VRUB 1TL3A 3BGFA 2GQCA 1A9NB 1GT8A 2EEYA 2RVJA 2UVVA 2ZBCA 3MEGB 4ECQA 1XMOJ 1X4BA 1IJEB 3R1LA 3BQ1A 1WKJA 1S9EB 5THWA 4LF4J 1S9GA 4ID8A 2HNYA 1XR5A 2FVQA 2KYXA 2MQMA 4KTQA 4CTAA 1KQFB 1X5PA 2X1AA 1WKKA 4B02A 4RW4B 1RTIA 3PY8A 2PIIA 3PYFA 1OYDA 4USTA 4HR2A 2I2YA 4MKYA 4KO0A 1UVKA 1ZH5A 1D0EA 4ZN3A 3KDOA 4U8YA 1SJFA 5J2NB 2FHJD 1V3ZA 3ET6A 1RBOB 5H9EK 2AJ4A 4HTIA 1WORA 4ZP7A 5BXIA 1SJ3P 4ANEA 2ZH7A 3NNCA 4M5GA 3M1VB 3SMZA 4LF9F 1RT1A 2YX4A 1HBOA 4MYUA 1N8RT 4RO0A 4NZ7A 3M8YA 1C0UA 2R42A 2E5IA 4USKA 1SB6A 2IY5B 3M6VA 3QIPA 1T7PA 4N5SA 3M8RA 1NEEA 2DBBA 3EDQB 5M2UA 3LPEA 5KFWA 2E5JA 2QA1A 3NOGA 1KVIA 1JMTA 5T7LA 2X3GA 2YNFA 4DQQA 3SYZA 5EWFA 1S1WB 3P96A 2CQHA 3IGNA 4OI3A 3CNQP 1FXDA 1QVFR 2ZOFA 3AOBA 2C28A 3ZZOA 1JXEA 1SC6A 3OJUA 4QIFA 5LL6d 2XYPB 3BZQA 3T41A 1H0HB 1NUEA 2KFNA 2B6AB 5GAEU 5KFNA 4P7TA 4KHPJ 1C2PA 3OSNA 1ZYQA 4CO0A 1V5IB 3TEGA 2W9BB 5K8MA 2CQ0A 2PFDA 4JV2A 3UNYA 3GFZA 3TANA 1CS4A 1AROP 4TU8A 2NZCA 3DRYA 3WC0A 2OPQB 1RT7B 1WKLA 2C1EB 2MZTA 4OV1A 3CE8A 1U02A 2VQEJ 4PR6A 1HNIB 5LMNJ 5F0UA 3FKBA 3BSNA 2V0NA 2V2KA 3QLHB 2A1BA 4AQYF 4M8LA 2IRYA 1LNQA 1TL7B 2QSWA 5A8WB 1D8YA 1V3SA 2GW8A 2EVZA 1HPZB 4GO5X 3DMJB 3ZO7A 1U6BA 4C3MA 4P72A 3V4MA 4ILRA 3A13A 1PYTA 2V8GA 3J80U 1M1GA 1DAXA 5FDLB 1VBZA 2HBQB 2LXUA 5CYJA 4P2XA 2ZUGA 3WZ0A 5DDOC 3SBMA 2KFYA 3UW1A 3X1LB 4BC9A 4I64A 4DFMA 2QZ8A 1MWYA 1YK9A 2KZMA 4USJC 2Z57B 2W8KA 4ZP6A 1UFWA 4UZBA 2HBYB 2VC1A 2DNMA 3DRPA 1IWAA 4ITSA 5CD4A 4CO4A 1HBUA 3MGJA 2E1PA 4L72B 4PUOA 4Q44A 3G8TA 2R8JA 4O23A 5KFKA 4CNYA 4EK2A 3ISZA 1XMBA 1YHQS 3TZWA 4A8MP 1LWCB 3PW2A 3QQCD 5EDWA 1F5AA 2DNGA 3TAMB 4R25A 3EPIA 2FC8A 1TUVA 4O4RA 2KVIA 1TFYA 4E98A 4OQJA 4K4UA 1RKIA 3TJAA 4WBFA 1OWXA 3OBIA 3MOJB 1S7HA 3AJ2A 4L3NA 3HHLD 3NMAA 1Q5VA 2RE1A 1PSDA 2O1PA 4DQSA 4OYIA 3PACA 1NO8A 5HMYA 2EW9A 3L3CA 3PW4A 5A6PA 2E1MC 2Y1IA 2A0FB 4DV4J 1CJVB 1ZETA 3NCRA 1FHTA 1UVIA 2BANB 4ECYA 2FHKA 1JIHA 1YTYA 5KFBA 5AJ3F 1PJ5A 2UP1A 2E7VA 3CCSS 2DCLA 4LF5F 3KDNA 2B43A 2ZHOA 1H7XA 2QFIA 2JVRA 2OFGX 2VF3A 4QWBA 3HP6A 3PJWA 2L41A 2ZBIA 3IWLA 4RU9A 1GQEA 1G7CB 2XG8A 1YGYA 4YOEA 3QT5A 2AEMA 3CCUS 3C6UA 3RAQA 3OJSA 2E7WA 3MR7A 1DARA 5ETOA 1Q79A 1NK7A 4OI1A 3CJRA 2F4VJ 3T3FA 4FXDA 1VRTB 5ETTA 4CLUA 3LW5C 1TR0A 1ITPA 1RZMA 3MR3A 2FTRA 1WC4A 1N0UA 1EP4A 4OHWA 4OZNA 2G0CA 1DTTA 3VCDA 3HK2A 3KJVA 1TQLA 3HHLA 5D0EA 3GIRA 1LXJA 4JI0J 1KNZA 4RNFA 4F3OA 1Q4RA 1K0VA 3MMAA 5KG2A 2YKNA 4ICLA 2OD6A 3BQ2A 1L3SA 2MZSA 1FVSA 2F63A 1D9AA 2OEKA 2ILZA 4Y00A 1PBUA 4UQGA 4DR4F 1S1TA 3TUPA 2BRLA 2OJ3A 3T6JA 3KLHA 1T9VA 1YWXA 3EDRB 5KFEA 2VB6A 2YQ0A 3GLJA 3NCQA 2H9ZA 3UDVA 3CCRS 3QZ8A 1FO1A 4ZPVR 3TP2A 2AX0A 2H5IB 1WEZA 3IRXA 1Q82T 2CYYA 4OYAA 2FUG9 2DYAA 2ZVIA 1F1BB 1SQFA 4IRCA 3BEGB 3P5BP 4O3NA 5IC4B 5D4PA 3RR8A 2AEJA 4JI5J 2WOMA 3HDSA 1C4CA 2RAQA 4I56A 1W26A 1SJ4P 2CG8A 5L9XA 1RA6A 2XSFA 1TFWA 1OY8A 4KRWA 2GCFA 2JHEA 3EGWB 4OYWA 1CBKA 4G65A 2B56A 1NPKA 1FX2A 1WC0A 2YWHA 1NB7A 3HJVA 4CYUB 4OHXA 3UE2A 2XLIA 4X62F 3N01A 3K58A 4H4MA 4FBTA 3JYTB 4DR5J 4U9RA 4LFBJ 1X5OA 1JLQA 3OUYA 4JYAJ 1F5BA 1U1NA 4RNNA 2HBZB 4X66J 2A6MA 2ZKTA 2AJQA 3N6NA 2CKWA 4LQ9A 1ZM3A 3FSXA 1R43A 3D2WA 3JSRA 3EVMA 1FERA 2AT1B 3D5MA 2MQNA 3OVSA 1R0AA 3CJ2A 2B5JB 2Q43A 2B7BB 2OMOA 5FLXY 4DUZF 3M8SA 1XERA 1ZPWX 1NSKL 1NSPA 4B3RF 5SUHA 4K5SA 3W5ZA 1AUSL 1N32J 3IFEA 4R5PA 1H6KX 4O44A 2ZNYA 1CPZA 2BJ3A 2Y8WA 4PRFA 2KXFA 3J7AN 2RRNA 1Y7PA 1UFLA 3AD8C 1T0TV 2B4PA 1I5OB 5I4MA 2MYFA 3FQLA 3QO9A 4PG7A 2J7KA 2ZITA 2B9WA 2HNDB 1MSWD 1VRQC 2DNPA 3H98A 3MMCA 3CGIA 2ZDOA 4U7UK 3JSBA 4ZPWR 3FBFA 1XR6A 3E51A 1HNXF 3WX8A 2DR8A 3IG1A 3O5TB 4P2FA 2RQ4A 5HMZA 3US5A 2IDEA 3C15A 2CPFA 3B4DA 5F8LA 2XSJB 1NDPA 3IC1A 1XMQF 2QJ3A 3A3PB 4DUTA 2ROPA 1X0FA 4ZPBA 2NYHA 1CSJA 2Z2MA 4K4YA 4ZLPA 1JLGB 1K47A 2RQKA 2HVIA 4YS2A 1FRMA 4A8XA 4WK1A 5HBMA 1JQGA 2VFUA 1CQNA 3RU0A 4JB8B 4C8NA 3W2VB 3OTOJ 2XC9A 4B9LA 4HACA 1SH2A 5K8PA 1JLAA 1ZAXA 5E5NA 1FWLA 1YJWS 2RD5C 4ED0A 3RB3A 2KHDA 2DKOB 4I6AA 2OP5A 3T9ZA 3J7Z5 3N28A 1RT6B 4TVAB 1P6TA 5AXKA 1RT3A 3OSPA 3SCJE 3BKTA 4USHA 5L38A 2AJ1A 3ZTRA 4EEYA 4L76A 3W8GA 3V6HA 2LEPA 3E01A 1XNQF 2V2VA 5DDQC 4BWJA 3D54A 2QTWA 1RK8A 3GFYA 4OI0A 1PJ6A 1UWBA 3DDKA 3KLIA 4F4XA 1L5UA 3HFZB 4K4VA 1TTHB 2VL1A 4OI2A 3CJSA 1C1CA 3HMJG 2KB2A 3BGUA 1OO0B 1HQ2A 3IR7B 4DHVA 2CQPA 1TL3B 3H8YA 1PYSB 3KLEA 2OPSA 4NA2A 4HHJA 1IR2A 2R4FA 2NQPA 1SC3B 4BLGA 4KGXB 2FIUA 3F41A 2X51A 2YXLA 3QWPA 1WG4A 5ETRA 2C2ZB 2XS2A 3H42A 1SUQA 4DL0C 2P6SA 1CQMA 4WPAA 3Q8QB 1N6QA 1NRKA 3FFIB 2IHR1 2ZH4A 4CTAB 1S1XA 4TY9A 4USWA 2N4DA 3V6KA 3N79A 1SH0A 2NSCA 4DS4A 4KC5A 1RTIB 4C6AA 4IFVA 4L75A 5C25A 5K8NA 4F0KA 2FVPA 2WB4A 5J2QB 2HGNA 1X4GA 4LREA 4LRFA 5CABA 2AYMA 3BS9A 4LSNB 3FRYA 4L3KA 2HFVA 2ZC4A 4CWBA 3ET6B 4OMFG 2QC3A 2GGPA 2ZVSA 2DGVA 4ZVPB 3B54A 4FF4A 2FQQB 3DLKA 2HS0A 5MLCV 2LDYA 2AZ1A 4DV2J 3TVYA 4EBEA 1HBOB 3BBFA 3AD7C 3EX7B 4Y65A 1FJEB 3K7RA 1D1UA 4GKKF 3CDEA 1WC1A 2JRSA 1OSDA 1Y5IB 4RUHA 3P5TL 4C8MA 3U1NA 4UW2A 2MSTA 5GADI 4AT1B 7FD1A 2A2DA 5C42A 2YNFB 5FD1A 1BY9A 1CJUA 2RT3A 3ZTOA 3DXBA 2OHDA 4JI7J 2P9GA 2Y3YA 2YY3A 5A8RB 2CA9A 1HI8A 4ZK7M 3ENQA 2MLZA 4AYBD 3M9OB 4LMZA 4LR7A 3KK2A 4J9RA 4LT6A 3C66A 3DLGA 3SZ2A 4DU8A 5IV3A 3EXYA 4GKJJ 2AD9A 3W1YC 3N4WA 2E9RX 3UPFA 3PFEA 3C2PA 2CJYB 3LWLA 2C2EA 5BJRA 1WHVA 1FD2A 2W2QP 4NXMJ 3CMAS 2XNQA 3W60A 4DR1J 4IOAQ 4DV7J 4AXIA 5ETSA 4DR7F 4K8RA 1Q95G 3HPOA 3L7OA 1HBNA 2ALYB 3T1YF 1CS4B 1Q5YA 5U47A 2Y8YA 4ZCKA 3POTB 4X4TA 1VIXA 5I3QA 2EFGA 5KFPA 4ZITA 1TKXA 2M7SA 4OYBA 4J9VA 3RAMA 1SL0A 4KGKA 1IKWA 5K5MA 2F9JA 4ELVA 4PYAA 2C22A 5FJ4A 2BYCA 4DI6A 5DG7A 4FVCA 4G1PA 1R6VA 5KFTA 4FDFA 3NGDA 1WTFA 2MKYA 3BR8A 3WIUA 3TOQA 2J0WA 2X1FA 1ZZFA 1RWPB 4L73A 1RCXB 5F9NA 3U7JA 3GJTB 2GVDB 1RT2A 5KG1A 3D67A 4WJBA 1ZPVA 2ZBPA 4FF2A 4J9UE 3PRBA 4DR2F 3CD6S 3Q86A 2WVDA 3W63A 2R3VA 5KG5A 2HMIA 3I6PA 1WOOA 2QLWA 5DQIA 2VASA 4K0KJ 5LMUJ 3LOUA 4O3QA 3FMBA 4X64J 4LFCJ 2BM0A 1UKUA 4RR5A 4PUOB 5L1IA 4PG6A 5CD4H 4JI3J 2FLOA 2DH9A 4OZ0A 5D4LA 4YDXA 5B0FA 1F6TA 2DNRA 3MURP 4B3MF 2VPWB 2BABA 1RGVA 3UN5A 2CRLA 1XR7A 4DF4A 3IM9A 3MECB 2M8DB 1V3RA 2ROEA 4UUWA 1QAIA 3MEKA 1BQMA 2NZ4A 3FBBA 2BE2A 3AOAA 4M1KA 4PCQA 3GILA 1N88A 4YR2A 3UVJB 1FDBA 4BHQA 1N5YA 5KFMA 3T1HF 5E33A 2CQBA 4YB5A 2HQGA 2HZAA 3FSYA 2XMVA 2JLFA 2OMLA 3H20A 4FZVA 1Z2LA 4NI2A 4QW9A 4WIIA 3M8QA 2JFDA 1VQPS 1U1LA
chains in the Genus database with same CATH topology
5J1PA 1NH8A 5H9EJ 4Q5VA 4TXSA 1U09A 1JLBB 2XZWA 2WONA 2UVWA 3CSKA 2VG6B 2O67A 3TVZA 1N6QB 2FHJA 2HIQA 2PI4A 4JI3F 1H2TZ 3OR2B 5E3PA 4C8ZA 1SXLA 1J2VA 1S1XB 2I5JA 1ZM9A 2P9EA 1FTRA 2GNKA 2JL9A 1N54B 3NS5A 2M52A 2AQ4A 3LWMA 4DL3A 3E8OA 1ZAWA 2YKPA 4KIAA 4J9OA 2LQBA 4Z37A 2K1RB 3H40A 2R7XA 1GTEA 4R8UB 2IC3A 1LKZA 3FEZA 4NPOA 2CPIA 1KQKA 3K59A 3CCVS 3M6XA 4DEZA 2DGUA 4IFVB 2DGXA 1IBLF 3V4IA 2RF2B 3AJ1A 2VPYB 5CCMA 4ED8A 2MKSA 3CDAA 3I4HX 4PWDB 2MDAA 2BUNA 1VJWA 2KXHA 2HVHA 2X1BA 1JNRB 1QUPA 4Z2XA 3L95X 1YJTA 3K5LA 1NK9A 4CO5A 2B4UA 3ZFVA 1VQNS 2AV5A 4I69A 1BC6A 3QMQA 3RTVA 4OLPA 3AH6A 3TA0A 2EBGA 2FLLA 2A10A 2HS3A 3O1LA 4ZVGA 3OVAA 1QJHA 1FDDA 1RP5A 2P6TA 2XULA 1KEKA 3V81B 4OHZA 1WTBA 2WSEC 2QFJA 3T6BA 4J9KA 3MF5A 3ITHA 4J9PA 1U1PA 3BR9A 1P1LA 3MFHA 3FDSA 4FS2A 4JBCA 5L9NA 2Q66A 3T5LA 2AX1A 4LSLB 3LP1B 3AB2B 1HQUB 1ELOA 2AYEA 3G71S 3PX4A 4J5OA 2FGOA 5E3RA 3B8HA 4HI1A 4RKUC 2KTQA 4IH5A 4CH0S 1SBRA 3HJFA 3QPIA 2XLJA 4AL5A 1S6PA 2RIJA 2WSCC 1TZ0A 5CH7B 4FBUA 4ZPCA 2E66A 2RDIA 3E3XA 3VZHA 1RT4B 2HHWA 1DTTB 2J6UA 4NZ6A 4UUXA 1NK4A 4ECWA 4F4KA 2COLA 1WELA 4EU0A 3KJVB 4RW8B 1MROB 4NLOA 1U1RA 4HT5A 1XNRF 5KFSA 1HWUA 1G6BA 1O0PA 4YY3F 1Q8LA 2R2RA 2GO9A 3VR1A 5KG7A 5DLGA 3KK1A 3MAHA 4YP3A 2J0QD 1IKYA 5EUHA 4QYZJ 4I6YA 3T5HA 2I0XA 1HNVB 2PE8A 3PDNA 2YKNB 4ECZA 3MMBB 1VQSA 3BGRA 1T03B 2OKQA 2G13A 3MM5A 5BYQA 5IXUA 1N33F 5DJBA 4ED3A 1Q53A 3DRXA 5KFXA 2JDJA 2MMYA 4KFBB 4IG0B 5C42B 2LXFA 2VZ9A 3IR5B 1JWWA 1S1WA 5KT5A 4IOBA 5KG3A 1NK6A 5CYQA 1X4CA 3QIDA 2Q3PA 5B0DA 4H54A 3VF0B 1FKPB 4YUDA 4GC7A 5AE2A 3M8PA 2LVWA 1S1TB 4Y2KA 2UUCF 1IKXA 2GO8A 2YNGB 2BZ2A 3KK3B 3W2WA 4YB6A 3B82A 2LU2A 3SSQA 3KLHB 5B0CA 4MIBA 1HQEB 1WI8A 5HP1A 3DLGB 4LVOP 5GMKa 2OD4A 2OIHA 4XAKA 5A6WA 2I38A 4TY8B 3R27A 2ROGA 1GX5A 3JSYA 1IN0A 4HL9A 5K14A 3KHGA 2B6AA 2HNZB 2V94A 2UVUA 4TYAA 2V9WA 4W90B 3T1AA 1NHVA 4ZPDA 2X1GA 4J9MA 4H4KC 5KG6A 1JLFA 3QAEA 1Q81T 2AP6A 1GTHA 5L1JA 2KU7A 1MWZA 3MM6B 1R89A 1TL1B 2J9DA 4PKDB 2YQ3A 1H2UX 4DDFA 4URGA 1JJHA 2WSFC 1KFDA 1F2GA 3H4BA 1S79A 2Z0GA 3HHNB 2EFPA 2C3YA 2GMHA 2QV6A 5KFQA 2VBWA 3MEDA 4NCAA 2CIMA 3GV7B 3H5UA 3HHDA 3WBZA 1HD1A 2Z8QA 4F3MA 3H5YA 2YNIB 3JSMA 2PMZD 2HHXA 1BQNB 1HBNB 2J9EA 3TUJC 4CT9A 3LP2A 2RQMA 2QT7A 3ZZYA 1ZTWA 1L3VA 2UXBF 1CLFA 2ASYA 3JTPA 5GAHI 4TNOA 3QJPA 1WHXA 4WZMA 5KFZA 3CJKA 2OPQA 4DR3F 4C4WA 5I42B 4LQ3A 4DBQA 2FVRA 1VQOS 3PKMA 4TLQA 2GQQA 1K9MT 1BQXA 3OR1A 3F44A 1NK0A 1G1XA 2HPUA 1TKXB 1HNIA 1ZM4A 3K5MA 2I8EA 3ENWA 2XSJA 1WG1A 2EFQA 3M2VA 4RBVA 3PW0A 2W7OA 5HMWA 2QO3A 1HL6A 3M2RB 5KFRA 1TKZA 2J8AA 1IKWB 5IFMA 3PW5A 3QLHA 1SL1A 1H3DA 4Q0BB 1REVA 2CZ4A 5D3GA 3DNCA 5F8JA 4DV1F 2VA3A 4DLEA 3ISND 1Z2ZA 1Q7YT 1QTMA 1YJUA 3LGNA 2HRYA 3EGNA 1HMVA 3JTNA 2WCXA 2XMMA 3QGIA 3HKZD 2MGZB 4G1QB 4MK9A 2MB0B 4C8LA 1Y5NB 3LQVA 5A8WA 2VPZB 3MUMP 2M8HA 3LUYA 4N77A 4NL5A 3I87A 2FDNA 1HNWF 1HPZA 1ROFA 2E29A 2WW8A 3OFEA 4A8OA 4C7QA 1OPZA 1TV6B 3CCQS 1FJCA 3SXLA 2V8VA 1JLGA 3M9MB 4MIWA 4KV8A 3NMRA 2Q6CA 4QWDA 3SDEB 4W92B 2O01C 2I9SA 1DBDA 2QRRA 3BDEA 4NLQA 4WCEQ 3VAKA 4PG4A 3IGVA 4LIRA 1H98A 2BQUA 2W4DA 5CXTA 5FDLA 2UV8G 4B9MA 3DRRB 5H9FJ 2V4JA 2XI3A 4NOHA 4Y3CA 2LEAA 4KGMA 3G6XA 1NZAA 1FRXA 5J2MA 1ZOTA 4H4MB 3EZ5A 3OTDA 2AYGA 3KNAA 3ZZ0A 1PC4A 1S72S 1RT2B 2RH3A 3ZZRA 1KOHA 3TUIC 4FN5A 4QYRA 4JI1F 1JX4A 1W25A 2LQ5A 4IOCQ 2J0XA 4IQMA 4RUAA 5E2QA 4YHHF 3QJJA 3HVTB 1JNZB 4TN2A 4JV0A 4X4OA 4WXWA 1O8BA 3BQ0A 4J37A 2R7VA 4AE5A 2BQ3A 2VC0A 5J1NA 5KFVA 4OX8A 2QMXA 3MM7B 2L9NA 4F4WA 2BJEA 3TRGA 2HVZA 3OVBA 3KWMA 2LKZA 1FEHA 3S6EA 4F50A 2Y1RI 2J0SD 2XWXA 3BJYA 3IR6B 3I5AA 3HVAA 1QVGR 2PI5A 4K4TA 3PV8A 4OX9F 3W3SA 4B3SF 3DC2A 3RB4A 4KE5A 3I82A 2DO4A 1IKVA 4NA1A 1R8HA 4YFUA 2GQ2A 2M88A 3NGKA 2MPUA 5JVGQ 3NS6A 1S1VB 4KB7A 4MAKA 4NWBA 2VOOA 2KHCA 3KG4A 3SEOA 3I0SA 1KQGB 2AJ0A 4I4BA 4LVNP 4YR3A 4B9VA 3BSOA 1C0TA 3Q8PB 2XCPA 1HHSA 3UCUP 3K8VA 2IRXA 3QGGA 4A48A 4CT8A 2HHSA 2IJFA 5L1LA 1DTQB 3UQSA 1WF0A 2AWZA 3C8YA 2MJUA 4QWEA 1FDNA 4QJVA 3DI6B 5KFIA 3RRKA 3J7YU 3L09A 2MZRA 1LWCA 3HHEA 1QAYA 4Y2CA 4NYPA 3SV3A 1SJQA 1IR0A 4GMKA 2Z4PA 2HS4A 5HROB 4QWAA 3OHAA 2RKIA 1UW4A 1BGXT 1TK0A 4KHMA 1VQYA 4CNZA 3D0IE 4DS5A 3LP0A 4K50A 1U8SA 4AUKA 2DRBA 3RW7A 5HN0A 2M70A 3GR1A 2VG7B 2XLKA 4R5PB 4ZPTR 5DM7Q 1FE4A 4I2PB 3PEJA 3KG1A 2YKAA 1S97A 3CCES 3OXGA 5IT4A 2UUBF 3DCAA 4PXDA 4E0DA 4OJHA 5F3ZA 4DL7A 2E1RA 2ERRA 3TARA 1N52B 3AB4B 1K1QA 1LXNA 5GAHU 4LF8F 4M63A 3RZAA 3VQSA 2WK4A 5IWAF 1Y3KA 3A1YG 2F8HA 2BE2B 4R0EA 4NA3A 1S10A 2E9TA 4LF6F 3F73A 4K4SA 3DDNA 4QR0A 1EETB 2MY8A 4DFKA 1KQSR 1WG5A 4TU9A 1O5JA 4TLRA 2IVFB 4IYQA 1FE0A 3SQGB 1VC5A 1VRUB 1TL3A 2LMIA 4MK8A 2VH7A 4ETZA 3MM9B 1F60B 1BWEA 4IG3A 5J1EA 3BGFA 3N6LA 2ZH3A 2RSQA 2GQCA