5JVHQ

The crystal structure large ribosomal subunit (50s) of deinococcus radiodurans in complex with evernimicin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5jvhQ00
1JJ2R 2BOPA 1U6FA 2J8AA 3MI7X 3NNCA 2DNLA 3DXBA 5GAEU 1X4EA 3MUTP 4OZ0A 2KVIA 2CPXA 2JRSA 5DDPC 2FHOB 1NO8A 3J7ZT 1JMTA 1WG4A 5LXRA 3G71S 2DH9A 1WEYA 2KU7A 5H1SV 4PKDB 1N8RT 2CQIA 2LXIA 2XB2D 3BEGB 3J7YU 4RU2A 2M8HA 3L3CA 4V19X 3SDEB 4M5DB 3MUVP 2QFJA 1URNA 2CQBA 3UCGA 1OIAA 5LSOA 1Q82T 1KOOA 3I55S 2FC9A 2N3OA 3Q2TC 4QU7A 2RUGA 3SDEA 3TO8A 2J0QD 1FJCA 1WELA 1R8HA 2DB1A 1DBDA 4IO9Q 2MGZB 2AYEA 1WEZA 5DDQC 4CH1A 1NJIT 2KHCA 3NS6A 4U67Q 1X5TA 3ULHA 3R27A 3P5TL 2QEXS 1JJ4A 3P3DA 2DGXA 2LQ5A 5EN1A 2KT5A 2G0CA 1YHQS 2DH7A 3LQVA 2MGZA 1W2BR 1A9NB 2V94A 1X0FA 2N7CA 3VAFA 1YTYA 3CPWR 2O3DA 2LYVA 1NU4A 1X4GA 1M5KC 1WWHA 2HGLA 2MZJA 1HA1A 3THPA 2M88A 3OW2R 2MYFA 2LECA 5CYJA 2GHPA 1VQMS 4CQ1A 2L9WA 4TU8A 5DM7Q 2X1GA 3U1LA 3P49B 1YI2S 1VQLS 2CQ1A 2SXLA 2KXFA 2MKSA 5LSLA 1SJFA 4WFBQ 2G4BA 2FY1A 3CCSS 2J76E 5D78A 1VQ7S 3CC2S 3VAHA 1P27B 5IM0B 2CQGA 3H2VE 1D9AA 1ZZFA 2MZTA 3UD3P 4QPTA 3UWTA 1YIJS 1H2VZ 3CCMS 1X5OA 4CH0S 2CQ0A 5GMKa 2CPZA 5GAHU 2ZJRQ 3S7RA 3VF0B 3MD1A 2XSFA 2RRBA 1X4BA 2RS8A 2YH0A 3SXLA 2MKCA 3CCUS 2FPHX 3S01A 4P6QA 2MQMA 2E5GA 1D8ZA 2LKZA 2KXNB 1VBXA 2G1DA 5BJRA 3MURP 4QU6A 1PO6A 4J5OA 3VAMA 2MQLA 1JJHA 3EX7B 1XN9A 2XNQA 1KD1T 3U1MA 2DNHA 1FNXH 3G6ES 2KN4A 1VQ6S 3MXHP 5CA5A 1S79A 2DNKA 4LJMA 1HL6A 1VQNS 2DK2A 3EGNA 2JX2A 2UP1A 3G9CA 2YTCA 2MZRA 3MD3A 1FJEB 1M90T 2M9KA 5GAGU 2MJUA 1WHVA 5DDRC 2MHNA 4WKRA 2RQCA 1X5PA 4WFAQ 2DHGA 1U2FA 1X5SA 1U1QA 1U1NA 2KXHA 2DHXA 5D77A 3SMZA 5LJ5Y 1K8AT 2OSQA 1PGZA 2RS2A 1U1OA 1U1PA 2E5IA 1M5VC 2RT3A 3I56S 2E44A 2KRBA 3CD6S 3PIOQ 1YJNS 2MSTA 3BO3A 1WF0A 2ZJQQ 2JVOA 4PRFA 3RW6A 1RKJA 2DIVA 1VQKS 2CPHA 2DNOA 2DNYA 3N9UC 2MMYA 2DIUA 3HHNB 1R8PA 2DGQA 4YUDA 3PIPQ 1U1LA 2RRAA 4QQBA 4WCEQ 1SJ4P 3CMAS 2PEHA 2LMIA 3UCUP 1K73T 2HVZA 1SJQA 3S8SA 2MZQA 3CUNA 1U1MA 4ED5A 2D9OA 1UW4A 2RVJA 1YITS 2OTJS 4F02A 2E5JA 4CIOA 1FXLA 1H6KX 2CQCA 1H2UX 2A3JA 1O0PA 1N88A 2RQ4A 2HGMA 2ERRA 1KQSR 2LA4A 3EGZA 1OO0B 3CCLS 1KC8T 4BS2A 3FEYB 4IUFA 1SJRA 5GADU 1H2TZ 3BS9A 1IQTA 2CQPA 3UD4P 3CXCR 4EGLA 2EK1A 2B0GA 2DNZA 1YWXA 2U1AA 3IRWP 4YOEA 2E5HA 1KOHA 2RU3A 1VQ9S 4WIIA 3FEXB 2LEBA 2XS2A 2MY8A 4LIRA 3NMRA 2JVRA 1WTBA 1Q86T 1S72S 4TU9A 1WF1A 1X4CA 2MKJA 2OTLS 1WI6A 2KRRA 2D9PA 2HGNA 2MKIA 2MB0B 1FO1A 2DHSA 2CPDA 1U6BA 3Q2SC 2GO9A 2MKHA 1VQOS 2Q79A 2M7SA 3CCVS 3VAIA 1AUDA 3G8TA 2M52A 2CPJA 2OIHA 1YJWS 2QA4S 1FT8A 3ZZZA 4ERDA 2CQDA 2M4MA 2XS7A 1G2EA 1RK8A 5ITHA 2D3OR 1VQ8S 2DNGA 1WHWA 1X4FA 2OSRA 1FJ7A 1VC0A 4UY8T 5IQQA 3MOJB 3VAJA 3RW7A 2X1AA 2VONA 1QVFR 2K8GA 2EK6A 2X1FA 5DDOC 2X1BA 3S6EA 2VOPA 2M8DB 4WFNQ 2ADCA 1WHXA 2KM8C 2KFYA 2DGWA 1FHTA 2NZ4A 2N3LA 2F9DA 2DNMA 2FC8A 1WF2A 2L41A 1BY9A 5FJ4A 1X4HA 1QM9A 2DNQA 4C7QA 1B7FA 2MZSA 2MQOA 3ZZYA 1ZH5A 3CC4S 2J0SD 4Z2XA 1OPIA 1M1KT 1UAWA 1OWXA 5GVQA 2RNEA 2CQ4A 3VALA 3NNAA 2AD9A 2ADBA 4C0OC 1UP1A 1DRZA 1SJ3P 3JB9k 2HYIB 2MQPA 3VAKA 4W90B 3CTRA 2CPFA 2DGTA 2MY7A 1DHMA 3R1LA 2KG0A 2LCWA 3TYTA 5DETA 2LA6A 3V4MA 5DM6Q 2DHAA 2KI2A 1HD0A 2K3KA 3MDFA 2ZJPQ 2AYMA 3H2UB 5MLCV 2L08A 1VC6A 3HI9A 2KH9A 2DO4A 3IWNC 1U1RA 1X4AA 2CJKA 1N52B 3CCRS 2EVZA 2YWKA 1K9MT 5JVHQ 2DGUA 3UE2A 2CPEA 1WI8A 1X4DA 3THTA 1ZZNA 2NLWA 3CCQS 2MXYA 3MUMP 3UCZP 4UQTA 4A8XA 5HL7Q 5JVGQ 3TP2A 4YB1P 1CVJA 2YKAA 4Y00A 2N82B 2CQ2A 1SXLA 3LPYA 4FXWA 2DNRA 2U2FA 1DZ5A 3CF5Q 1WEXA 1A7GE 3CULA 1L3KA 2M0GB 4F25A 3NS5A 1VQPS 3K0JA 2KM8B 3BO2A 2CQ3A 2MKKA 1VQ4S 1UFWA 3G96A 2I38A 4OZ1A 4ZKAA 2CPYA 1U1KA 3R1HA 5IFMA 4IOCQ 2F3JA 3P6YC 2PE8A 2KG1A 1F9FA 1M5OC 2DITA 4FXVA 2DISA 2DNPA 4TLQA 4WF9Q 1QVGR 2F9JA 2MQNA 4PR6A 1WG5A 4F26A 3G8SA 2AYBA 1HD1A 2DH8A 1VC5A 2MPUA 4TU7A 3G4SS 1M5PC 2I2YA 4Y0FA 5HO4A 3CMES 3CCES 5CXTA 1Q7YT 2MJNA 3BO4A 2AYGA 2MZ1A 5IM0A 2OJ3A 2M2BA 4IOAQ 2M70A 2KYXA 1WHYA 1VBYA 2YH1A 2HZCA 2XNRA 1Q81T 1N54B 2CPIA 2JWNA 5LXYA 2LXUA 4C4WA 4LMZA 1YJ9S 2VODA 1VQ5S 2CQHA 2DGSA 1WG1A 3CCJS 2BZ2A 5LJ3Y 3CC7S 2XS5A 3NNHA 2MSSA 1P1TA 2DGOA 1VBZA 4W92B 3B4MA 2DO0A 2VOOA 2WBRA 2DNNA 3D2WA 2DGVA 3DLLQ 2LEAA 3B4DA 2MQQA 3VAGA 3US5A
chains in the Genus database with same CATH superfamily
2HLTA 2IVFB 1CSJA 4RO0A 5G4DA 5GAGI 2DNLA 3LP2B 1X4EA 2BXJA 3GCWP 4NMLA 3HFVA 1UA0A 2UVVA 1NB2A 4PKDB 2CQIA 2ZH2A 2VB6A 3KJNB 4ZJLA 2IYIA 1DARA 2B43A 3MAQA 3I6PA 1URNA 1S1XB 3KG1A 3O8WA 1FD2A 1DQAA 3HVAA 1XNQF 4K5RA 4WKYA 2NCKL 1HQ2A 5HK4A 2EFVA 3GSDA 3IAM9 2VPWB 4GKKF 3IRXB 4DFKA 3LH2S 3R27A 1S5ZA 4LR8A 3UD5A 4A8WA 4OX7A 3AD7C 3IMQJ 4ELUA 1X0FA 2CRLA 4I6AA 3W1YC 3CPWR 2JLEA 5DLFA 1X8DA 1FRKA 4EZ6A 4TN2A 3CJRA 1I5OB 3D0HE 5J1EB 3NGTA 2CQGA 1D9AA 3GG0A 1RUSA 4QPTA 5IZHA 1OY8A 4PABA 4B08A 2HQ3A 1NUEA 4MKAA 3MEEB 4U7UD 4RUHA 2BR0A 3H5YA 7AT1B 4O0NA 4YB7A 3MPYA 1RT4A 1D8ZA 1IUJA 2R7VA 4ETXA 2ZH9A 1L5UA 3VAMA 2XC9A 1FK9B 1Z4UA 4B9MA 4ECVA 1KD1T 4WTOB 1F2GA 1NCLA 4LBIA 5HP1B 1N0VC 4CH7A 1FWLA 3OR2B 2M9KA 3POTB 5ETTA 4DOZA 3K8WA 3EVMA 2YKQA 4TY8A 3AA9A 1GFWB 5J2PA 2GW8A 3SMZA 1S99A 4WE1B 5C24B 4PWDB 3F0NA 4LSNA 4KO0A 2D41A 2HW3A 2R8GA 2BJ8A 4DQRA 2HBYB 2Y3YA 1HI8A 2YNHA 1JXLA 4DU7A 4CIOA 3AB4B 1QAXA 3GJTB 1N33F 1SKWA 5I3UB 2C2DA 4DFJA 2IMWP 3KG4A 2O66A 1VLYA 3MECA 5K8NA 4A8QA 4CLFA 5L9NA 3UD4P 4LF8F 2B4PA 2DNZA 5CD4H 1KOHA 2LQ8A 3BV8A 4USMA 3BDPA 3NAHA 3C15A 5BYSA 2HPUA 3L95X 1KWMA 1VRUB 2ZUGA 4Q43A 4CI0B 2NXUA 4HLBA 5HSPA 3VAIA 5KFSA 3CJSA 4IDKB 3D6MB 2WONA 5H9EK 1Y9OA 4ILRA 1HHSA 2HAIA 4DJBA 2RIJA 3KK2B 2JHEA 1QVFR 2NREA 5DDOC 4QIWD 1KKHA 3S6EA 4Y3CA 1PCAA 5BR8J 2PFDA 2XMKA 3IXQA 1NK7A 2ZBRA 1R8CA 1JQGA 2F9DA 2ZZMA 2AMCB 1BY9A 2F5GA 3N28A 2HMIA 4J91A 4NLDA 3OBIA 3KHGA 2EFGA 1B0TA 3IG1B 1BMQB 2R2SA 3VAKA 4OIXA 5D3GB 2DPIA 4J90A 4AL6A 3RAMA 2HFSA 1KSPA 4KHPF 4OV6A 2C2MB 4A46A 2IA0A 1VK3A 3QGHA 3H0PA 1VC6A 1GTEA 4IQMA 4N41A 4ED4A 1C1BB 2YWKA 1VFJA 4KGVB 3PKYA 3Q8QB 2DGUA 4F2SA 3Q86A 2POKA 2YQ3A 2WVFA 4K4YA 1AROP 3TP2A 4L3KA 3S1TA 1Y11A 1FFGB 3MM5B 1M5HA 3K2YA 1PAUB 1QUPA 2F8HA 2ZDOA 1HI1A 2LU1A 2KL8A 2F9JA 3QT6A 4FKXA 4NYPA 3E2EA 3GSIA 1EAYC 1VOMA 5HO4A 2OPRA 2LP4A 2M70A 5LXYA 2UXDJ 2I6WA 2VODA 4CLYA 2VFSA 1NXIA 3W5ZA 3RBDA 4OYZA 2HHTA 4DR1J 1NPRA 1SQFA 2CZ4A 3WIVA 3I4PA 3NGDA 3C3LA 2AGPA 3AFGA 5IV3A 4A8FA 1P8GA 3AJ1A 5DGAA 1GXUA 3MI7X 4U9RA 2WZ1A 2OEJA 2OMLA 3MEGB 3OTBA 4DN0A 1WG4A 4YR3A 4X62F 2LXIA 4D3GA 2BANA 3R2DJ 2ZC4A 1CJKB 2NPIA 1OIAA 1S6PB 1FVSA 3QNWB 1KOOA 2FC9A 4P7VA 3HT0A 4Q0BB 4DL7A 3BQ2A 4KPCA 4B3MJ 3KKFA 4U67Q 3QJJA 2GMLA 4ED8A 1JLAB 4GO5X 5KT3A 1PKUA 4PCQA 3OR1B 1VRQC 2N7CA 3U7JA 1MLAA 3KK1B 4B3RJ 3THPA 3Q83A 3L09A 4FF3A 3R6LB 2WOMB 2L9WA 4TU8A 4J7CA 1MMNA 3DNCA 2VG6A 3W66A 3CCSS 3C16A 4DX8H 2RHSB 3MMAA 2YPYA 4N5SA 3UWTA 5HI7A 3T5JA 4N47A 2PA3A 1C2PA 4OYPA 1S6OA 3TAQA 1ZM3A 1RT2B 4B3TF 4M94A 3M9MB 4DL2A 2O01C 1S76D 3A8JA 4QWDA 3MURP 3M8PA 3SQGA 3B8HA 1F9EB 3VGSA 4LJMA 2HNYA 2RKIB 1JLCB 4K4VA 1AFIA 2W9CB 2XLKA 5GAGU 5IWAJ 5DDRC 4DBQA 2CDQA 1RI7A 3GONA 4IOBA 4AXIA 4HYKA 4KH0B 4Q8EA 1TELA 2DIUA 3HD1A 1ZYQA 3AHPA 1D1UA 1U1LA 3ZC4A 3J7YI 2RU9A 1E6YB 1O6XA 4JI1F 2V8HA 2WTFA 2H51B 4H4MB 3C14B 2EPIA 4ES1A 2BDPA 4EBEA 1KC8T 2LEPA 1FX4A 4RBUA 1FRJA 4ES2A 3BDEA 4UUWA 2XMMA 2DKOB 3UDVA 2V8PA 5AXKA 4DX6A 4W98A 5EUHA 4U6PA 4HVZA 1P6TA 1UEKA 4DEZA 1ULRA 3Q8SB 2OTLS 1XNQJ 2W9BA 2DHSA 2I1RA 1UEUA 3Q2SC 3GIJA 3AOBA 4GKKJ 5D4LA 3G8TA 1YJWS 3UR3C 2AWZA 3KJVB 2NXEA 3OUYA 5ETNA 2B4OA 3OJSA 1VQ8S 3OL8A 3I4HX 5D4NA 1PJ6A 2J9DE 2ADCA 1JLEB 4LSNB 4BWMA 5HBMA 2DGWA 2QA2A 2N3LA 1X9WA 4KSEB 2BEFA 1RXOB 1S9GB 2CJQA 2LXFA 1GMUA 2AD9A 1RHMB 1SJ3P 4W90B 5KOWA 2CXEA 1TL4A 4TLRA 3R1LA 2EEYA 1FTRA 4EWTA 3R5GA 2HVDA 2KJWA 5LMNF 5EWFA 3H40A 1X4AA 2ZKTA 2DD8S 1OYEA 2ZNYA 1WI8A 2ZD1B 5KG7A 4BLGA 1YBAA 3K5NA 1MROA 4IFYA 2BV3A 2XO6A 3KTQA 4NLRA 3IR7B 2DTJA 4DL3A 1K0TA 3DU6A 3KOAA 2HHSA 3QJPA 2QL7B 1EQMA 3W8GA 1ZBTA 2P9EA 5L1LA 4RW9B 2F1FA 2QMXA 2DXDA 4WIQA 2UXCF 3DN9A 1SC1B 5IFMA 4ZVUB 3W9IA 4C8ZA 4MMOA 2FQQB 4CWBA 1T03A 4TU7A 1Q7LB 1N5YA 3GPAA 3CCES 4DV3F 1N33J 5L1IA 4J9OA 3TQ1A 4CYUB 1N54B 3A4TA 3DOLA 3ZZPA 2RJZA 2QL9B 3ZTRA 2G2YA 4LF8J 1S7HA 1T9TA 2X3DA 1NPKA 1Y3JA 3B4DA 2HMIB 4RNOA 4A48A 5EHHA 2C2OB 4NLXA 4FF4A 2HRUA 1PYOB 1JJCB 4MKYA 1X0PA 3ITHA 2VDHA 2V4QA 3ZTQA 4P2SA 3OL6A 4CZCA 5LXRA 2RAQA 3FQLA 2BVZA 5KFIA 4QOTA 5KFNA 3WHIA 4EU0A 3PV8A 2QT7A 4C2MA 2LQ9A 1QSLA 3W3SA 4Y2AA 2ZDPA 3IS9A 1H72C 5F8NA 2APOA 3NS6A 2BE2B 5CZVA 4RZRA 3P3DA 5EN1A 1PG5B 1FRIA 3NRBA 3KLHA 4ANDA 2V94A 3A8IA 3H42A 1BHNA 1FKOA 1FKAF 2C28A 1HNZF 1EKRA 2CQ1A 2O5DA 3M8QB 1SJFA 3BGFA 2FY1A 4ZJOA 3NGRA 5KFEA 4KHPJ 2GVZA 3F73A 2P6TA 1HBNA 1ZPWX 4YMEA 3J81j 5GMKa 3O44A 2BW2A 1TV6A 4O3OA 1IKVA 2YQ0A 3DDKA 1LV5A 1RDRA 4FXDA 4XK8C 3DRSA 3S01A 1VYAA 1YQHA 2HHQA 2G1DA 1NMEB 4QU6A 2CADA 3K8VA 4NI2A 5CHCB 2DNHA 3BSAA 1WKKA 4JI0F 3ZZ0A 4LRAA 4UZBA 1A0OB 1T9WA 5D0EA 4I56A 2MZRA 1UJ4A 2I8EA 2HFNA 1U1QA 4KY3A 1NK5A 2XMUA 5E5NA 4YN3B 3I0SB 3HJFA 2KRBA 1QE1A 1YJNS 1YLXA 2JSXA 3ISNC 3ENQA 2CUYA 4YUDA 3PIPQ 2C2KB 3HHLB 2AZ3A 2VICA 1TFYA 5DQHA 2CNOB 4X65F 1WC3A 2BMBA 4K4SA 3E8OA 3F41A 2WB1D 4GVBB 2IBOA 3FEYB 4IUFA 5JXSA 3VQTA 3LP1A 3QIPB 3N01A 4EO8A 4X62J 5A8KB 2NXNA 5HVGA 3BBFA 2HFUA 1H74A 1TMJA 4NE9C 1HNIB 1TL5A 8AT1B 2AIRB 3OHAA 2ZHAA 1X7VA 4USIA 4IRDA 5ITHA 1NDPA 1GX6A 4UQGA 4UY8T 1RBLA 1T02A 1LWEB 3DLBA 3PNIA 4OI3A 4AT1B 2X1BA 3SCJE 4TQRA 1RSCA 4N8OA 4BHQA 1ACMB 3GV8B 3ONQA 3OXLA 5KG6A 1TKTB 4WFZA 1NK9A 3R5AA 1E6VA 1VDHA 1NK4A 3DLGA 1NHUA 1IN0A 4RU9A 4J9RA 1CULA 2BACA 3GFHA 4B3TJ 3BPSP 2VL1A 3AXKA 5L46A 1HR0F 2LCWA 2LA6A 1JKHA 1HD0A 2ZJPQ 1LEOA 3D0GE 5MLCV 2HLUA 3CDAA 4UOHA 3ZNUA 3HDSA 1S10A 4I2QB 4I67A 3CD5A 5F8HA 2UUBF 2WAQD 4U7CA 4NA3A 2FTRA 3NCPA 2CQ2A 1YBTA 1FFSB 3HPOA 4TYAA 1RT6B 5HJXA 2NPFA 3C8YA 2HQIA 1F1BB 2PI5A 1V3ZA 3TUJC 4JI3F 4HDGA 1G7CB 1Y4ZB 1FFWB 2HWIA 3PW5A 1HKAA 1S1VB 3RTVA 3DRPB 2WVCA 4XTTA 5LMUF 2DH8A 4JI1J 5KFVA 3DLEB 2OPSA 1HBOB 3IBCB 3OXGA 2IHR1 1S57A 4ZK7M 2HNDA 1PILA 2BUNA 4OI6A 2BZ2A 1Q8KA 1AZSA 3CIZA 3TZWA 1GMWA 3I0RB 5A2QU 4ECWA 6AT1B 1SH3A 2V34A 5F0WA 2B5JB 3K57A 3R7BB 3GIRA 3LGHA 2XM3A 4J9KA 2PSZA 2DH9A 4KGXB 1NJYA 4RW4A 3SDEB 4F3OA 1UZDA 5KFUA 2C2RA 3GFYA 4QIGA 3DI6B 2J0QD 2GIQA 3MMJA 4OX9F 2P5VA 2HQCA 1RABB 4FP9A 3R5BA 1YHQS 1W2BR 1DQ9A 3VQSA 2IRUA 3QZ7A 4NPOA 2E1AA 2HGLA 3CNQP 2MYFA 2EC2A 3V2UC 1RWNB 1WC5A 1TZ0A 1IXKA 3L7PA 3GG1A 3NGKA 3VZIA 1T03B 1M0SA 2BKPA 4HH1A 3DM2B 2G4BA 3D6HB 4K4TA 3BM7A 3CE8A 1P27B 3H2VE 2V2QA 5J2NB 3UDLA 4CH0S 4KHMA 5LMNJ 4OYBA 4H4OA 3TW0A 3HHLC 1AB8A 2ZJRQ 3S7RA 1CJUB 2XSFA 5LT5A 2VG5B 2Y1IA 4NOHA 1T9XA 3GLJA 3RZAA 2Q66A 1O8BA 2HEKA 4YHHF 3UR0A 1CQMA 2MQLA 5KFGA 4DWIA 2UZAA 4OI2A 4LF5F 3ITHB 1FNXH 4NZ7A 3G6ES 1VQ6S 1OQ6A 1QY7A 3HD2A 1MMDA 2UXCJ 5C2CA 2QC3A 3ZTPA 2RQCA 3MPDA 4HR2A 1K8AT 1KP6A 1K47A 2VBXA 4ZOSA 2R7QA 4EO6A 1N5VA 1ZA2B 2UVUA 5E0OA 3I5BA 2I9SA 4R5PB 3PIOQ 4P75A 4DQQA 4DV3J 4PRFA 4FPRA 1TUWA 4X4PA 2R2UA 3OD2A 2FLOA 1I94F 2OFGX 2YNFA 4WPAA 3CUNA 4XAKA 1HMVB 4Y28C 4KKOB 3QRPA 2PGCA 1KQKA 4ANCA 2HGMA 2RQKA 3DOKA 5B0FA 4ZMMA 2J9DA 1CJVB 2ZFHA 2LA4A 4LF7F 3MMBB 5B0EA 3FBEA 4A47A 1SCJB 5KFRA 4QIFA 1RWKB 3MM7A 2B0GA 1JLGB 1U47A 3Q8VA 1Y00A 1JB0C 2JVRA 1O51A 4CM2A 1T95A 2P6SA 2VQEF 2I5JB 3DRSB 3Q8PB 1U26A 1J5EJ 4DR7F 2D9PA 2QSWA 1U6BA 4K4UA 3I9V9 3K5LA 2KFNA 1FT8A 5F8IA 4CLZA 3M1VB 2UUTA 2V6AA 3V6KA 1AA1B 2DNGA 4XPCA 4W4MA 2IFXA 3H8YA 3QWPA 1HNZJ 2AP6A 1UVMA 3SCLE 2CVEA 3V4IA 5J2MA 3TANA 4CNYA 4I2PA 3C6TA 1TQLA 2Z2MA 1N5TA 3ENWA 5IT0A 1TVRB 2WVEA 4OFZA 4FPIA 3H90A 5J2QA 3R5JB 1IBKF 1LNQA 1RACB 4Z2XA 2J9EA 3BN7A 2ADBA 3G6XA 2AZ1A 4ZLNA 1SV5B 2BQRA 4WFXA 3DGPA 4DSFA 2H54B 3LO3A 5F3TA 4JI0J 2GFFA 1BQNA 1N52B 3KMSA 3LP1B 3HVTB 3I31A 3FMBA 3CCQS 3SSQA 3TQEA 2YKAA 2N82B 2OUGA 1SXLA 5E3RA 2E9ZA 3C19A 5KFQA 1YSJA 1U48A 5KFMA 4C9DA 3NS5A 4PQAA 8ATCB 3HX9A 4LR7A 2I38A 3PX0A 3T9ZA 4L74A 4L72B 4KJIA 2CZVC 4ZVPB 2VKRA 4QR2A 1TUGB 1WG5A 4F26A 5U47A 4FF1A 2KKHA 4X65J 4MJKA 4DN9A 3NGUA 2JJ4D 3ENAA 1ZM4A 4C11B 4DQIA 2ZBQA 2AYGA 2V63A 1GAOA 3D6FB 3MFHA 3RG6A 2KFZA 2CQHA 2VQFF 2YKOA 3M8WA 3PX6A 3KWMA 3QO9A 1RZMA 3DRYA 4ILMA 2CNKB 1EX8A 1LW0B 4QIEA 3V81A 3OLBA 1U6FA 1GXLA 2Z58B 2GAHC 2R3VA 2UUWA 3TA0A 1NDCA 2IM3A 2DCLA 3DLKB 5A0YA 1QTNB 3HT3A 1LQ9A 3DRRA 1V9OA 2HWTA 3RB3A 1RTIB 3JAMU 4LT6A 5KFJA 4K0KF 4QZVB 1WELA 1REVA 3PYDA 4LFAF 3KHRA 3ISND 3P5TL 1YDLA 2ZOGA 3TAPA 3RRHA 2MGZA 3LQVA 2XG8A 2ZVIA 1LK7A 5CYJA 4L3NA 4ATNA 1HW8A 2PD1A 3IFEA 2HIYA 4I0WA 2W2OP 4ZP8A 2KB2A 1YI2S 3M2UA 3HSGA 3MMCB 1QSSA 1HR0J 5KFLA 2C2NA 3ISZA 3VAHA 1T0TV 1HWJA 1TK0A 4DMZA 2UUBJ 3AT1B 3MD1A 2RS8A 2YH0A 4NASA 4QYRA 5DS7A 2GO8A 1KHWA 4I7FA 3U27A 6FDRA 2MKYA 3PACA 2GNKA 4M5IA 4DLGA 4JI3J 3K5PA 1TL3B 1FJEB 1S4EA 1RGVA 3W8PA 4USTA 4ECRA 4G6VB 2ALZA 2NQPA 4M5MA 2E5IA 5LMUJ 1RT3B 1HWKA 3CD6S 2FJBB 1IR0A 2AGOA 3KNGA 2ZJQQ 3FC9A 4F7VA 2YKMB 2MMYA 3UW1A 4C8YA 2M3DA 5E41A 1K73T 1NSAA 3QAEA 3CD0A 4DS4A 2ZE2A 2FVSA 2J0XA 3E01A 1DTTB 5M2RA 3QFHA 4O4RA 2CQCA 2EFPA 4J9LA 4IG3A 7FDRA 4B02A 4TYBA 4ECQA 3D28A 1HQUB 4FN5A 2EBGA 1WKLA 2COLA 3G86A 1VQSA 4CDIA 1KEKA 1I6JA 5CZXA 2QTWA 2MY8A 3NMRA 3KLIB 2MKJA 1NRKA 1DLOA 4NMXA 3OQ2A 5C25A 3MM6B 2B9WA 4FDFA 1RYRA 4OX9J 2M7SA 2FJDB 3NCRA 3CJQA 1LWCB 5I3PA 4CRJA 1I3OB 4N77A 4LVOP 2GJFA 1VJWA 3H4DA 4YEAA 4DSIA 2H5JB 2VJVA 4QWAA 4LRDA 1FJ7A 3ILOA 4IRKA 2RDIA 2KO1A 1TTHB 1TP7A 2AEMA 2NYHA 2FHJA 2W1BA 4HACA 4ZDNA 3LTOA 1IKWB 2I0XA 1FWPA 1Y0HA 5FJ4A 4C7QA 1B7FA 2IMOA 2J6SA 1ZH5A 1U0SA 2Y0BB 2RNEA 3NNAA 5K14B 2LU2A 4PG7A 3VVTA 4X4RA 3CTRA 1S9EA 1S97A 4YHHJ 2DR9A 5LSRA 4C3LA 4K2JA 3PFEA 4LF5J 3GFZA 4DL0C 3MR6A 4NLUA 2V8DA 3OJUA 3IWNC 3HLUA 4LF4F 3MOZA 4M5NA 3QLHA 3R8YA 2RD5C 1N48A 3ELHA 4Y2MA 1HBMA 4RLEA 2R8KA 5A6PA 5CH7B 2HS3A 4OZLA 4KIAA 1PC5A 3MCMA 3OFFA 5A76A 5ETVA 1U1KA 1NM2A 3IAS9 3QBCA 1R6YA 4A8OA 2DITA 1I94J 3KLEA 2W7AA 2FJWA 5A8WA 1EZZB 2MLYA 3BBBA 3GR1A 3EJMA 5HROB 1R31A 4ZVEA 3T1HJ 4ZPWR 1WHYA 1XK8A 4URGA 1Q8LA 4LQ9A 4C4WA 5KT2A 1RJJA 4K5SA 2DGSA 3TJ8A 4LF7J 2FDNA 3V4IB 4DG1B 5LJ3Y 1RT7B 3PRVA 4I2PB 2DGOA 2AJ2A 3LWMA 1B0VA 2WBRA 4TVAB 4WZQA 3HHLD 1VISA 3HXMA 2MQQA 2BJ7A 3GCXP 3PFOA 4L73A 4JV0A 1TAQA 3NNCA 2VQEJ 2DR6A 4NZ0A 5DDPC 4DR7J 3SCKE 1R0BG 3L9ZA 4DZDA 1WEYA 2W2MP 1SPBP 2H48B 1AXQA 3GE9A 4ECTA 1FXRA 2A6MA 2M8HA 4JV1A 4QPXA 1BQNB 4M5DB 2K7JA 1RAEB 1UZHA 3EYZA 4GVLA 1N6QB 2Q6CA 3I55S 2Q43A 4H54A 4ZVSB 4IH5A 3GJQB 2KZMA 2V9WA 4F4KA 2BJEA 2VC1A 1RTHA 1WEZA 4K4ZA 3NOGA 4RNFA 2W01A 2AEFA 1T05B 1RADB 1A9NB 1RCOB 2DR5A 3JSMA 4NCGA 1HNXJ 1WSVA 1IBKJ 4QW8A 1SBRA 3D1HA 5DM7Q 2X1GA 4P2FA 1RTJB 2SXLA 4OMFG 2MKSA 4EUVA 5HQLA 3MM8A 3PHEA 3NEKA 2YNGB 4LBPA 4ZCKA 2HFOA 1W26A 3DYAA 1TKXB 2JH3A 1Q78A 4ID8A 3BPDA 2RRBA 3PYFA 4ED1A 3FSXA 2HHVA 4Q2MA 1WC6A 3MM9B 2ASLA 1S6QA 4LR9A 4QBUA 3PX4A 4WTYA 2GHVC 4HT5A 3U1MA 2BM1A 5CQGA 1NLKL 4CLWA 1VQNS 3FBCA 2Y1JA 1S9FA 4OI0A 4P52A 1T3NA 3MPUB 2AV5A 2B4UA 2CFXA 3I56S 3ET6A 1I1GA 2E7VA 3Q8RB 5HMXA 5HMZA 1IKXB 3TUZC 4RW6A 2Z30B 3BB5A 1ZM9A 2GJ2A 1URRA 4USKA 4WCEQ 3CMAS 2VC0A 1DQ8A 1PSDA 4G1QB 3S8SA 3FFIB 1SKRA 3M2VB 4F02A 3ZFVA 4LRCA 2XGPA 2ERRA 2R42A 3M2UB 1OO0B 2CJXB 1H2TZ 1HWLA 4Y6IA 5T41A 1L3TA 4X66F 3BR9A 4PEOA 4RW7B 4WIIA 3UPFA 2H1YA 2GHWA 4C8NA 2HQFA 4ICLB 3TUPA 4IH6A 1X4CA 4X4QA 4OHWA 4CLSA 4K0KJ 5IQ6A 2H65B 2YPZA 2Z2LA 4A8YA 1RT1B 2GO9A 4UF4A 4XDDA 3TOQA 4LFAJ 1RAHB 1HPZA 2L3MA 3TA2A 4RW8A 5JMNA 2QYGA 5RUBA 3LALA 3KMQA 4DUTA 2UUAF 2YKNA 3VAJA 4XIUA 1N0UA 4I4BA 5LM7E 4B9VA 2G1HA 1IKYB 4EYHB 2RF2B 2BRLA 4OX8A 3K5OA 1KQGB 4QYZK 2DRDA 2N7YA 4CO3A 5GAEI 4DSKA 1HYSA 1Q16B 3P8BB 2HIQA 1SKSA 1UAWA 2W8KA 2NS1B 2V8VA 5DG7A 2HYIB 1JIHA 3NMAA 1SUQB 4F4WA 1TK8A 5ETOA 2MY7A 4YFUA 4O0IA 4HL9A 1WDDA 1VBKA 4WU2A 4IG3B 4O3SA 1RWVB 5A2QY 3RBXA 5KFXA 1OSCA 5JVHQ 3AAWB 3FVYA 1T9YA 3CULA 1T3OA 4C0BA 1DLOB 3BO2A 2Y8YA 2IM0A 2C2ZB 3MCOA 4DV4F 1UVIA 3ZTOA 5IXUA 1X9SA 4DX5A 1NKBA 3DHWC 2FHJD 3G8SA 1TK5A 1TMMA 2GIFA 4DCOB 4FVCA 3RR7A 3GJRB 4QJVA 1RBAA 2MZ1A 1SI9A 2HBQB 2YH1A 3GIKA 4QR0A 1Q81T 2P8IA 2ALYB 1RP5A 3QPIA 2DY9A 1JLBA 2DEJA 4IG0B 4TQSA 2C3PA 4C98A 4AYBD 3SCIE 2FJEB 5B0BA 2FZCB 5SZTA 3US5A 2VFVA 3DXBA 1G1XA 4CCHA 4DR6F 4E98A 2Z56B 4A8KA 2HNZB 3M2RA 2YXLA 2BKNA 3NBPA 1MU2A 4UOGA 2WB4A 1Z1ZA 2K06A 3WDOA 4ER8A 3TI0A 4ED0A 2ACYA 3W65A 3UFCX 2B6AA 2V9KA 2V67A 1NDKA 4M8LA 3F56A 1LW2B 5AXMA 1YTYA 3LGNA 4OZNA 1MN7A 3KLEB 4CLKA 4LRBA 5HLFB 4O4GA 2DXFA 1EP4A 2JL9A 1KDNA 3P49B 4X4TA 2KHDA 1IBMF 4NL5A 4KPYA 2IVYA 3H5XA 2NR0A 1KQFB 2D74B 1VQ7S 3W5YA 3DMJA 3ICLA 4DX7A 1H7WA 3LWLA 5ETSA 2ATLA 5KAKA 2CPZA 5HQ8A 1P1LA 5F8MA 4LF4J 3MCNA 3RGIA 4R8UB 5D0HA 3HVRA 1NSKL 1UVJA 4ZPVR 1VBXA 3MEDB 2VDIA 3EX7B 2R7OA 4NLGA 1B3TA 2JZ5A 4DF8A 2DK2A 3EGNA 2QA1A 4Q7AA 1BQMA 3FCHA 1C0TA 4IFVA 3NWGA 3EUNA 4XPEA 1S1UA 2BE7D 3MAAB 2G2OA 1T7PA 3HFZB 3OTCA 4EMDA 4HHJA 4CLTA 2MSTA 1TL1A 2JVOA 3RJMB 2DNOA 2DNYA 3K89A 2R7TA 2WK4A 3I5CA 4YDXA 2D3O1 1HLWA 2PMHA 1F60B 2D9OA 3AJ2A 4MT1A 1HQEB 2XYPB 3MR5A 1RTDB 3DU5A 3ETOA 4LFCF 3UDCA 1DAXA 5DG8A 4L6V3 1XQIA 1Y5NB 2JFDA 2KYZA 3MM8B 1NH8A 4LREA 2OO4A 1JLQA 4LIWA 2VV5A 4OI1A 1QAIA 2JLGA 3BKUA 4RUCA 1YWXA 3BYRA 3J7AN 5A8RA 2YBVA 4WYLA 1OSDA 3FGVA 1JLFA 3TZZA 2W2PP 3KUEA 2AU0A 1Q86T 3L7OA 3CD7A 3KLVA 4DL6A 3MAHA 4MKVA 4UZCA 3GYNA 3FNNA 2EI5A 1L3UA 1V5VA 3EWGA 4PUOA 3CDEA 4ERDA 3LA0A 3CJ8A 5C42A 2M4MA 1JX4A 5DQGA 1CBKA 1VC0A 5IQQA 2ZH4A 1XTZA 2X1AA 1NJWA 2R4FA 1LKZA 1VIOA 1EJ7L 1SH2A 2NSCA 2YX7A 1KLMA 5HMYA 5CYMA 2L41A 3HHDA 2MZSA 2QLXA 1HBUA 3NAIA 2YWWA 2RILA 1QSYA 2ZH6A 2XBPA 3JYTA 2RRNA 1UW9A 1R6VA 4K59A 1MW7A 1RWMB 2DGTA 1DHMA 1N36F 4KGZB 3V4MA 1CS4A 2GVDA 3KJFB 5H9FJ 4OZ3A 2X7IA 3RB0A 2EVZA 4KFBB 1S1WA 1A6LA 5K5MA 3MUMP 3R9LA 3W2WA 2ASDA 2EKYA 5KG0A 3HJVA 4YB1P 4MFBA 3BGRA 5CD4A 5DO2A 5EX0A 4ZS6A 1EETA 3EVWA 1BGXT 2MKKA 2F4VF 2GS8A 2QSFA 1UFLA 3CJKA 2CPYA 3IC1A 3HP6A 2F3JA 1UTAA 3JAMY 2C3YA 4M63A 4NA1A 4FNIA 1HPZB 3TEHB 1EQ0A 2MQNA 2ZZTA 1D09B 2DEIA 3M32A 3QYYA 3KLFA 4NRTA 3FSYA 2VG7B 4EI2A 2W2NP 2KDOA 2EFQA 1YJ9S 2QN6B 3OFHA 3KK3A 2VPYB 2UXBF 2DO0A 5G0RB 3DOMA 4X66J 2W7OA 3HZEA 3IWLA 1RAGB 4K50A 5GAEU 2CPXA 1NO8A 4ELVA 2O1PA 3C6UA 3TNVA 4M5JA 1HNWF 4DUYF 1AYEA 5H1SV 3JTOA 3HSZA 3BEGB 4RU2A 3KLGB 3D66A 4ZLJA 2CQBA 2BJDA 5L1KA 3T6BA 3RU0A 2CZ9A 3A3OB 1N4LA 2JOQA 2UUAJ 5CYQA 5KFAA 3N5BA 4OV1A 4PPDA 2R8IA 4IO9Q 1F0XA 2AYEA 2KHCA 5D4PA 3OSPA 3R2CJ 3C2PA 1VGYA 1HFEL 2GC8A 2EFOA 2IC3B 1NU4A 2XMJA 5GADI 1IWAA 1HIYA 1BD6A 1VQLS 2AHOB 5T7LA 5KTQA 9ATCB 1LWFB 3G82A 5D6GA 5FDLB 3UD3P 4O44A 1UWBB 1X5OA 3M8RA 1D3WA 4Q8FA 4DL4A 1S12A 4LSLA 1KNZA 1JLBB 1FWKA 3D1QA 1TL7A 4NXMF 2HQDA 2FPHX 4P6QA 2AJQA 1WC4A 3O1LA 2FHMA 3G87A 4PG5A 3CJ4A 5D8HB 4OYIA 4DFMA 3GP9A 1JJHA 2V2ZA 3RAXA 1S79A 2DNKA 2IJNA 4U95A 3BSOA 4DV4J 3PEHA 2YTCA 2FYXA 4FNHA 4TXSA 3BQ0A 4ECXA 4IRCA 1X5SA 1V5IB 1NPPA 1ZAWA 1PAEX 5LOQA 4OLPA 3UNYA 3NXZA 4DR4F 3EGWB 1OJ4A 3RW6A 3HHNB 4KHRA 4OYMA 4Y2IA 2DGQA 1C1CA 3PJ9A 1UCNA 1FNOA 2B6AB 4FKYA 3VV2B 1C0UA 3BN4A 1FDBA 3UVJA 1FKPA 4RWXA 1SJQA 1UW4A 1NK8A 3JQJA 3IR6B 1YITS 4ED3A 2A3JA 2RQ4A 4CLLA 1LK5A 3EGZA 4DR6J 5KG2A 1Y7PA 1IQTA 4KGMA 4LF9F 2YNIB 4F4YA 5ETRA 5F8LA 5ETMA 1NSPA 4WXWA 1GTHA 3PO5A 2XYHB 2ZWOA 2YQ1A 1WI6A 4ZLLA 3Q8UA 2GGPA 2MB0B 5KG3A 3TEGA 3T1YF 1U09A 4KE5A 4OZJA 3GIIA 3DXSX 2DBBA 3FZBA 1R7IA 3QAUA 3M4XA 3ZTSA 2XS7A 2RHQB 1YX2A 1G2EA 1WJ9A 4NYOA 1HNVB 3VGUA 4AL5A 2IVMA 1CJTB 5DQIA 1BQXA 2K8GA 3DLHA 1PBUA 3PR5B 2OPPA 5B0GA 1R43A 1IBMJ 5ADZA 1VR6A 4ZVTB 3JSYA 1WHXA 2XULA 2OPQA 2NZ4A 1DTQB 1KS2A 4PYDA 3X1LB 4PAAA 2W8LA 5K8MA 1L3SA 4ZIWA 1UPPA 2MQOA 3M30B 4BDPA 1VHFA 5AE3A 1C4AA 2CQ4A 2CWXA 1MWZA 1LXJA 5E33A 1KTQA 2ZH5A 1XR7A 1EKSA 3UO0A 1FDAA 2KI2A 2H5IB 1BXNA 3H2UB 4P9SA 4FYWB 4KQZA 2KH9A 2WW4A 4PQUA 2DO4A 4B3SF 1T9VA 2QLJB 1AFJA 2B9EA 3UCZP 4UQTA 2XLIA 2ZM6F 3IWXA 1CPZA 5L1JA 2U2FA 3OTOF 3CF5Q 4CP5A 4LF6F 2CA9A 2KM8B 1G3OA 1JXEA 3BZQA 1S77D 2IAJB 1RA6A 2OGUA 1TKZB 3R1HA 3LW5C 4UT4A 3CDUA 1HD1A 2N4DA 2ZC3A 4C8MA 4R0JA 1FJGF 2AW0A 2XGQA 3BO4A 4ID5A 3T5HA 4LFCJ 4PXBA 4YDDB 2XSJB 1GH8A 4Q2LA 3OVSA 2QJ3A 1WG1A 3CCJS 3QIDA 2OD6A 4B9TA 2IRXA 3CC7S 3OT9A 3W2VB 4ETZA 2PEBA 4KTQA 3QATA 4B17A 4F0HA 2W9AA 4FZVA 3VTIA 2KVQE 3BGOP 1H98A 4B3OA 2FHOB 3DFEA 1CS4B 2AX1A 2IYGA 3VGTA 3LP2A 4YB6A 1M1HA 4E2FB 1S1WB 1SH0A 4QU7A 1FD8A 1NZ8A 3W63A 1WACA 4WYWA 4CH1A 3ULHA 3W61A 3A3PB 5C7PA 2PO4A 3IRXA 2V5HG 1NK6A 1J2VA 3R7NB 2UUCF 2HKEA 2MZJA 1HA1A 2M88A 2AEJA 3OSNA 1Q53A 1FXDA 1N36J 5AJ3F 1B64A 2ZH1A 2EW9A 3JQMA 5J1EA 4JV5F 2VIHA 5KFBA 4RNHA 1RT4B 2UU9F 1RISA 2FJVA 2AJ1A 1WOSA 3MEEA 3D0IE 4CO5A 2XZTB 2HRTA 2WW8A 4X4VA 4WP3A 1N34F 2R7SA 1HL6A 2ILZA 1Z2ZA 3TUIC 3OPKA 2F4VJ 4TY8B 5J2PB 2HHUA 1GQEA 3UDEA 1WHVA 5FLXU 2LLZA 1G4CA 4NYZA 3H5SA 5D77A 4KO0B 3QGGA 3OR2A 1PGZA 1RA7A 3POTA 2RS2A 4PG4A 4K4WA 4CT9A 5HVFA 4WXOA 3BO3A 1S0MA 5LL6d 5C24A 3WC2A 5B0DA 4PWDA 2YNHB 3A1YG 2UXBJ 1GMVA 2W25A 1U1MA 3R5DA 4CO1A 4AXJA 2OTJS 5JJBA 4F4AA 3RR8A 3MECB 4FYYB 4MK8A 3NS7B 4LQ3A 1RQ0A 1T9UA 4BS2A 5KFHA 5GADU 5I3UA 2B9YA 3EVOA 3CXCR 3O2IA 4DUYJ 3MR3A 3C15B 3W62A 2LEBA 4LSLB 2QFIA 1R0AA 2WCXA 5CCMA 2Y8WA 5HATA 1S72S 1CEZA 2WONB 1VHIA 1B7YB 3P96A 2MKHA 3KXDA 2BKOA 1NAQA 4KV8A 2OIHA 2CPJA 3ENVA 3TWZA 1KVJA 5JUMA 2ASYA 3UN5A 3PRBA 1RK8A 4IDKA 5KFYA 2H9ZA 3FRYA 5H9FK 2NSBA 1WHWA 3H59A 2E7XA 4JI7F 1YBUA 4ZVQB 2VONA 4KRWA 2HHHF 1FCAA 2HK2A 4Z37A 5E3QA 5KT6A 2M8DB 4M5GA 1JK9B 3KK2A 2XO7A 2KM8C 1LOUA 2DNMA 2DJWA 2B4VA 1WDTA 4P72A 2J0SD 2DRBA 1YRTA 1FKPB 1NJXA 4LUBA 2MQPA 3RRGA 4NXMJ 3F44A 5K8OA 3IG1A 4RL1A 3OTEA 3VCDA 2K3KA 5D3GA 2VPZB 1QAYA 1CC8A 1R0CB 5K9FA 3EZ5A 2CPEA 3BKFA 3THTA 2MXYA 3BJYA 2ZKUA 1SC4B 3LF0A 2GJIA 2VFRA 4DR4J 2DNRA 4QWCA 3I5AA 4ECYA 4UY85 3K0JA 3QZ8A 3BF4A 1YRXA 2ZVSA 3M9NB 3MM5A 3LGMA 1V3SA 2JDJA 2HBZB 3I96A 4HHHA 1QVGR 2OPRB 3SYZA 2DRAA 4PR6A 3ILLA 3WZ0A 4NCAA 2VH7A 3DC2A 3IR5B 5B08A 3T3FA 1ZTWA 1Q7YT 1TFWA 3AJDA 1GNKA 2JEGA 2WSEC 3DLJA 2PN6A 3NNHA 1VBZA 4LF9J 5C2GA 5C5JA 4JB8B 3DLLQ 3IGVA 4MTPA 1JJ2R 3TZYA 3H5UA 4P71A 4FBTA 3MCSA 2KVIA 1SVDA 3FMWA 3PZPA 2BANB 1F3VA 1XMQF 1XBWA 3T1YJ 3MEGA 1KLNA 3OVBA 1RAIB 2V0NA 3UCGA 5E3CA 2G2ZA 5LSOA 4YP3A 2ROEA 2V68A 1CJKA 4I1TA 4ZCIA 1F5BA 1S6PA 5F8GA 3D1OA 2VD3A 2E29A 2W2QP 4Q0BA 4OX6A 2QEXS 1D9FA 4YS2A 4Y2CA 2LYVA 1WWHA 1LFWA 2VFTA 3DHXA 4HI2A 2VG6B 1JLAA 1SC3B 2JEIA 3C16B 3OR1A 3MMAB 2OEKA 4GO7X 2IDEA 3KK1A 4FS2A 4U8YA 1YKWA 3TZXA 5B09A 4WFBQ 3IBWA 3G6YA 2WOMA 2ZUAA 4X84A 1FTCA 3CC2S 1RT5A 5KG5A 1YIJS 2JC1A 1KFDA 2R2TA 1RU1A 4B3SJ 4NA2A 3I9ZA 4IYQA 4DUZF 2FGCA 3BH7B 3M8PB 3SQGB 4YR2A 3FRZA 3PW0A 2HVHA 2HS4A 2Q3PA 4U8VA 2PFFB 2ZM6J 2HNYB 5KFTA 3OTOJ 2Z2ZA 1RT2A 2WHOA 2QLWA 4RWWA 2XNQA 3LANA 4RUBA 4LF6J 1SL0A 4O3RA 5A6WA 2GA7A 4MAKA 2JX2A 2ZHOA 3N6MA 3G9CA 4OHVA 3W64A 3GILA 2K2PA 2MJUA 2Q1LA 2RKIA 1JLCA 2PI4A 1GEHA 2KXHA 2XEXA 1NKCA 1VS3A 2W9CA 3W9HA 4O23A 1J27A 3CWJA 1U1PA 3TVKA 4PPZA 1FJGJ 3EDRB 4PG8A 2XZWA 3SZ2A 5I4MA 1VQKS 3W9JA 2QL5B 1ZS6A 1SIZA 1J5OA 3J81U 3H25A 4UUXA 2IPOB 1SQGA 3TA1A 2NXCA 4ZPDA 4QQBA 4JI8F 3FDSA 1BUXA 1U4BA 4ZPTR 3SFUA 4USWA 3ZZOA 2DY1A 1RLDA 3AOCA 2XCAA 4NEYA 2EC0A 4ITSA 4FYVB 3PO4A 5DZ7A 1E6YA 1H2UX 4A8MP 2ROPA 2B7BB 4H4MA 3CW2C 1YGYA 3C14A 2E1CA 4EGLA 2BYCA 2FY8A 1U2RA 2U1AA 2IM2A 2XS2A 2W9BB 3BGUA 4QCLA 1WF1A 4ZVFA 4F50A 3D5MA 3TX8A 4LRFA 5IC4B 3I82A 1VQOS 2FHKA 2Q79A 3OUYB 2W7PA 2HHPA 3R6GB 2D3OR 4ALZA 2L9DA 2UUCJ 3KJVA 5EGYA 4OZ2A 4F0MA 3BH6B 5HBMB 1K44A 2IM1A 4R25A 2FUG9 3TJAA 1OS5A 1XJWB 2VOPA 3HSDA 4IR1A 4MIBA 2CJYB 3V5RA 5AJ3J 2RSQA 1FHTA 3UN2A 1JLEA 4NLYA 5IT9U 4JV5J 1L3VA 5EDWA 3AA8A 2UU9J 3N6LA 4EBDA 1S9GA 1ITPA 2RDDA 2XI3A 4QWBA 4ZP9A 1FEHA 3VVUA 3MDFA 2NZCA 5BXIA 1N34J 4QW9A 3FEZA 1MROB 3FKBA 3PW4A 4IFYB 1U1RA 1S4FA 1DJ0A 5AXLA 3WX4A 1PYSB 5FD1A 2B9XA 1X4DA 1XNRF 1RU2A 5HL7Q 4ZHRA 1VRTA 2CNNB 3PW7A 1TKDA 3HK2A 3M8ZA 2RQMA 1R0AB 2ZD1A 5HN0A 1V6HA 1L3KA 4F25A 5KFWA 1RAAB 4IO1A 5K8PA 4USJC 1QLNA 2ASJA 2ZBCA 1KBRA 1MNEA 4KV8B 5AE2A 4CO0A 2XY6A 1N5YB 4RW9A 2B8PA 2XWYA 1KVIA 3HFKA 4CLUA 4JOUA 3DOLB 3CMES 4DR3F 4LF2A 3A3NB 5IM0A 5L39A 1PJ5A 2KYXA 3HSJA 5KFFA 4NLVA 2QLBB 5HJYA 4YQWA 4CYUA 2WVBA 2VOOA 2LQBA 4FYDA 4DI6A 2DGVA 4USUA 3C46A 2D69A 1Q79A 2G0JA 2OMOA 2BOPA 3G6VA 1SL1A 2J8AA 2FVPA 4LVNP 2RUSA 1WC0A 1T94A 2DVIA 4Y65A 1JMTA 1JWWA 2KU7A 1YJTA 2ZEJA 3QSIA 5L38A 4UOCA 4RJVA 2HG4A 2VUGA 3PR4A 3IS9B 3Q2TC 3ZZTA 3PM9A 5EWGA 3PYEA 4DQPA 4IQXA 2MEWA 4JI7J 2Z57B 1FJCA 2JC0A 2DB1A 2HHHJ 4ES3A 2NYIA 3KLHB 1B0PA 3EZOA 2FZGB 1X5TA 3M6WA 3CCTA 4GKJF 3V6DA 4KYZA 2FVRA 3NOCA 1UA1A 2ZZNA 1FKOB 3WIUA 2C1EB 2FGOA 3A8KA 3CT9A 3N4WA 2BE2A 2O3DA 1ZPVA 2PA8D 1X4GA 2BABA 4DPTA 4JYAF 2N4CA 1D8YA 2B3TB 4BC9A 5J1PA 2GHPA 4DHVA 2NXJA 2GVZB 4JI5F 1HBNB 1UETA 2CG4A 1TV6B 4F04B 1IKVB 5DGBA 1X31C 3M8QA 3JTNA 3ETMA 4J9NA 2H4WB 4DCPB 2IJRA 2VJUA 4R0EA 4Z7YA 5AE1A 4NI2B 2XY7A 2LKZA 3MPWA 3EPIA 2VBYA 3MXHP 2VBZA 1YZ6A 2J0WA 3R97A 1QE1B 2DHXA 4MYUA 2X3GA 1NNDA 3A8EA 1VI7A 1UVLA 2CAJA 1M5VC 2HFZA 1WD6A 5DZ6A 2DIVA 1H73A 3EZUA 3D67A 3I0SA 2GMJA 5E3PA 1N5SA 4K2XA 2BA9A 3UCUP 5KFCA 4Q5VA 3MPVA 3HHLA 4P73A 4BWJA 2FLLA 4F0KA 5E3AA 2FB0A 3QQCD 1NK0A 5B7WA 4BCAA 2FIUA 4P74A 1APSA 2BE9B 1F5AA 1TUVA 2E9RX 1SJRA 1O5JA 1XMQJ 1RT5B 2V4RA 3B78A 1OMSA 4GVBA 1TR0A 2G9OA 3HF5A 1GT8A 4JI4F 5THWA 3FZ2A 4OYOA 1RKIA 2BQUA 3QIPA 1U8WA 4PWUA 1OY9A 4DR2F 5A8KA 4NWBA 4CO2A 5KT5A 5HANA 3NL0A 1NHVA 1KTVA 1AUDA 3QT7A 2M52A 1KONA 3ZZZA 4OLOA 4I6YA 1HNIA 5KFKA 4GC6A 4YY3F 3TARA 2ZOMA 1X4FA 2LVWA 3KDNA 3DCAA 5KOXA 4EZ9A 3TAMA 3PG9A 5CAAA 3EXCX 4TY9A 1E6VB 4IKAA 3BR8A 1LWEA 3QRQA 5M2PA 3Q23A 3DLGB 3LAMA 2VHGA 1J5OB 1CULB 3NLCA 5DG9A 3EPGA 1VQYA 3UQSA 1TKTA 2F4FA 3IGNA 2QIFA 2A18A 4DUZJ 4K4XA 1JKHB 1UP1A 4F8RA 4I68A 4DXLA 4HH0A 4PG6A 1UJ5A 2CPFA 1MWQA 3M8YA 2DXEA 1V3RA 4ZPBA 1D0EA 3GIMA 4P2XA 3QT8A 2GQQA 3R7SB 4K7QA 4FS1A 3MHYA 3QJLA 2OHDA 4M5HA 2NLWA 4I2QA 5JVGQ 2ABYA 5HMWA 1CVJA 3GFXA 1H0HB 3K59A 1RYSA 1FVQA 4DV6F 1Q95G 2VASA 5DJBA 2OEMA 4ZJQA 1RT6A 1JNRB 4ZKAA 3P6YC 1F9FA 4JI8J 1M5OC 4FXVA 4F3QA 2DNPA 1H3DA 2OPSB 1RE1B 1IBLF 1S1VA 3E51A 2I2YA 3T1AA 1K0VA 3UI3A 5GAHI 2MJNA 2HNDB 3DRPA 5IS2A 3B6BA 2M2BA 1AZSB 4JV2A 1FX2A 3DLEA 1HBOA 5I42A 3HHKA 2GX8A 4DPXA 4HTIA 2DNNA 1F2HA 2W24A 2IY5B 3KG0A 1XIQA 3I0RA 2PT0A 2K7KA 4OZ0A 2B5JA 2LDIA 2E1MC 4RW4B 3D9BA 1X60A 3VHQA 4OJHA 1N8RT 3AXMA 3EDQB 2B8QA 1XR6A 2BRKA 3MUVP 3H20A 2J6UA 4B9NA 5KFZA 2R8HA 5FIIA 2Y1LB 4ZHRB 1VRTB 3SDEA 2R2RA 4OHZA 1YJRA 1S6UA 5FLXY 1WORA 3DI6A 4KC5A 2F8EX 4DV1F 2KT5A 3NWRA 3NY0A 5B0AA 2PC6A 4USHA 2MLZA 3KFWX 4F4XA 1QUVA 1H38A 4EYIB 3T9NA 1HHQA 4ZP6A 3PJXA 1M1GA 3WX8A 1UL3A 1N56A 1XMBA 1QJHA 3QGIA 4H4OB 2RDJA 4DV2F 5IM0B 3MF5A 1NZAA 3DM2A 3RYLA 5KT7A 2AJFE 2XI2A 2YWEA 3BGLA 4C6AA 5KFOA 5J2NA 1XNRJ 1HI0P 2HHWA 1Q4RA 2CJAA 1RAOA 2MQMA 1CJUA 5BJRA 2VG5A 2G0IA 1S0OA 2YVSA 1QDUB 1ZAVA 3ZZUA 1AT1B 2KN4A 5CA5A 2CDRB 1F5CA 2KT2A 4BBYA 5IT4A 2R9LA 3MD3A 3T5LA 4B9LA 1Q5VA 4CO4A 2XHWA 3SI8A 3HKWA 4DR3J 2JEFA 2MDAA 2YNFB 2R7RA 5D4OA 1R8BA 4R5PA 3RB6A 2RRAA 1SJ4P 1J5EF 1U02A 4OJGA 4RPFA 3V6DB 3HZGA 3E3XA 2C3UA 1CQNA 3PHTA 3DOKB 2UVWA 2BOAA 3C66A 2E5JA 1UKUA 1RWOB 2H3EB 3JTPA 4I64A 1HMVA 4KKOA 2A6OA 3MM7B 1DFDA 3MR7A 4PXDA 2XZDB 4UOFA 2EK1A 3GV7B 1CJVA 2GZOA 2V69A 3MMBA 2XLJA 2RU3A 2VA3A 1GX5A 1NB7A 2RE1A 4QR1A 2YX4A 1U49A 1WTBA 1JLGA 2QMUB 4X64F 1F6TA 3J7Z5 1Q1KA 2V4JA 4YR0A 2P9CA 2C42A 1OY6A 2I5JA 2AGQA 4GKJJ 6FD1A 2UV8G 4DV0F 1ZM2A 4D3HA 4JYAJ 1NKEA 1YZ7A 3J80U 1VIXA 3M1VA 3KYLA 3RW7A 4ENOA 5J2MB 2LDYA 3WQPA 3C6TB 4JI5J 1EB0A 2EK6A 2X1FA 2QLFB 1RWPB 3BQ1A 2OLWA 5J2QB 1ROFA 1M5SA 4DDFA 2KFYA 2XWXA 3GB0A 1XEZA 4HKQA 1F3FA 3CJTA 2MLXA 1KR4A 2HAFA 3CC4S 4ZN1A 4TKTA 4PYAA 2QZ8A 3CJ0A 3DGPB 1TVRA 2OP5A 4OL8A 4RNMA 5IC6B 1DRZA 2KJVA 3Q0AA 3SIPB 2WSFC 4XO0A 5DETA 3AQPA 5ETLA 5DM6Q 2AJ4A 1SV5A 3CEDA 3M8SA 1RHRB 1S0NA 2L08A 3BBCA 1BE4A 4KB7A 1IM6A 3SV3A 4CLPA 3UE2A 5GMEA 4FXWA 1FA0A 4B9SA 2V2KA 1DZ5A 2XY5A 3HVTA 5HAOA 1WEXA 1A7GE 4JI2F 4NLOA 1XERA 4DCJB 2CQ3A 4MIWA 1WTFA 2YWHA 4DZ6A 4J37A 3JXOA 1XMOF 3GTYX 2KG1A 2ATCB 4X4SA 4JBCA 2DISA 4AUKA 2XYGB 4WF9Q 3NKYA 3LOUA 1REGX 2CKWA 2IDLA 3CIMA 1M5PC 2QMWA 2RMLA 3TAMB 1VBYA 3QWUA 3CSKA 3QO9B 4WP8A 1VQ5S 2VPXB 4C11A 4LBHA 2HZVA 4MK9A 3BKTA 3V81B 1KRPA 2C3OA 4J9PA 3N5FA 1B70B 4JI4J 3ILIA 4WJBA 2A2DA 4K8RA 5HQMA 4DR2J 3MUTP 1VMBA 2IRYA 1LW0A 5A0YB 3J7ZT 4KR0B 1ICEB 2ZH3A 1EIYB 3DRRB 2K1RA 2XB2D 3J7YU 2P2CB 3EXYA 4AFFA 4YY3J 3O3LA 3PXGa 3AODA 4ZVHA 3DLKA 1REVB 3EGVA 3SQOP 3HM9A 1SB6A 2VQFJ 4EK2A 3FQKA 2MGZB 1RTIA 5DDQC 3BSNA 4ZITA 4X4OA 4J9VA 3VAFA 3L4BC 1MWYA 2HVEA 4RNNA 2V2VA 2ZH8A 3J81Y 2J6TA 3PTWA 3CCWA 2FJXA 2CVIA 5D78A 3ADAC 3PW2A 1AUSL 4GRSA 1EHWA 1U24A 3MMCA 1VK8A 4N7TA 5GAHU 4I7FB 4DPOA 5I42B 4G3IA 2MKCA 1IM4A 2YX1A 3MWBA 2HVIA 1JXVA 1FE0A 2KXNB 2JLFA 1PO6A 4NZ6A 4PWWA 2F40A 2YWFA 5KFPA 4DV6J 1Q8BA 2HSEB 1XN9A 2Z0GA 4AD6A 4OJ1A 3FK4A 3QRRA 4PXEA 2EWHA 2HK3A 2MHNA 3QT5A 2E1RA 1EARA 1U1NA 1JNZB 1CG2A 1TL3A 3JQKA 4C3KA 1IBLJ 2XTJP 4DQSA 1U1OA 2RT3A 3FBFA 3CDWA 2E44A 4ILLA 2ZHBA 3FCVA 4NXNF 4DSLA 1RT3A 3MZIA 3FCWA 5B0CA 1SQEA 2ZE2B 2NUHA 4CM0A 3E01B 2YKMA 4S0MA 2E5LF 1RWWB 2BW7A 2OAUA 5D15A 3K7RA 1FXLA 3Q24A 1DTTA 2E7WA 3B82A 1RWXB 4DR5F 5IT9Y 4Y2KA 4RBVA 1HHTP 3KUGA 2QA4G 4C0HA 1HQUA 4HI1A 4OI4A 4KAIA 4OQJA 4EFAC 5C25B 5F9LA 3IBFB 2MKIA 1BC6A 2XMAA 5K20B 3D7SB 3KLIA 2FJAB 4AL7A 1LXNA 4DV1J 2XMVA 3MM6A 3H2LA 3KDOA 4J9MA 3IO1A 1LWCA 4V1Ak 3MTKA 1QTMA 3N79A 4HACB 3CCZA 3HCXA 3UN3A 7FD1A 5F8JA 3AB2B 4OYAA 4P7TA 4DV2J 4RBTA 3OLAA 2L48A 5ETKA 1IBCB 4MYTA 2EKNA 2DNQA 4C97A 1S9EB 1OPIA 1IKWA 4AQYF 4GMKA 2PIIA 3VALA 1PBAA 5EWEA 1MMLA 1W7WA 3CJ3A 5K14A 3IM8A 2DHAA 2AYMA 3QLHB 2FVCA 4ZPAA 2GCFA 3HI9A 3T1HF 1HBMB 2R7UA 3CCRS 1K9MT 4OJ3A 3D6TB 3CO0P 1XWLA 5DRKA 1UVNA 3TVZA 3CO9A 2GQ2A 1UPMB 4AE5A 2PDAA 1U2CA 3R3TA 1WUUA 1S1TA 4RKUC 4C3MA 4LSZB 4JUZA 1UFWA 2V4JB 4ZPCA 1W2IA 5A8WB 4OYXA 3RAQA 4E0DA 3M05A 4TLQA 1KN6A 3SBMA 3R5CA 1CLFA 3GQCA 2CWKA 3D4JA 1VC5A 1RCXB 4Y0FA 3RB4A 3B54A 3M9OB 1IR1A 5CXTA 3OTDA 5D0GA 1HWIA 2DCUB 2D7SA 2FLNA 2JFKA 2CPIA 4ZP7A 4LMZA 5HROA 3I32A 3ILJA 2L9NA 8RUCA 4W92B 1RAJA 3CMQA 1UMJA 2QG9B 1SIWB 2LEAA 2ZWPA 4DG1A 1RWUA 1RT7A 1R27B 3BREA 4NLTA 2GIRA 2PMWA 1HNXF 4DL5A 3LPEA 3AD8C 4X64J 1MG7A 2JRSA 3TVYA 3G71S 4H4KA 5KG1A 1HARA 1LFPA 1Z2LA 3L3CA 4LFBF 2BJ1A 3T5KA 5MAOA 1FNMA 4DV0J 1NHKL 5IOLA 1RTHB 4M5DA 4V19J 4J9QA 1R8HA 3THVA 1N6QA 5F41A 3JSMB 2ZBPA 4NCGB 2DGXA 2LQ5A 3O6QA 2G0CA 2J7UA 1U0HA 1YJVA 1U7LA 3DRXA 4QYZJ 2QGFB 1M5KC 1T05A 4KBIA 4UTGA 2HWHA 4OYWA 4CQ1A 2MQ8A 2P9GA 4U7UK 2F65A 3DYAB 4FVMA 5LSLA 1FESA 1RHQB 4NX9A 2RB7A 2EXUA 2HS0A 1WNEA 1ZZFA 2HURA 3P5BP 1RTJA 3LP0A 4ECZA 2CQ0A 2YNGA 4G65A 3GU0A 3H98A 3VF0B 5I3QA 3CGIA 1S6QB 1X4BA 4M95A 1TKXA 1FF2A 4ZVRB 4CT8A 1S59A 3SXLA 2EBEA 2E5GA 3EE3A 4KGKA 1NEEA 4JI2J 1ZTTA 1Q5YA 3MM9A 1TU0B 2HQGA 4URSA 1XMOJ 2Q6BA 4ZCLA 4WKRA 2K1RB 2VBWA 3ET6B 1U2FA 3M6XA 2KTQA 4ZIVA 2FD2A 2Y0SD 4N8NA 4RW6B 4C48A 1WSRA 2HFVA 5D0RA 3OHBA 2XCPA 2ACMA 3O5TB 1RBOB 1YJ7A 1IKXA 2HVZA 2V8GA 2MZQA 1WC1A 2EFNA 2CJBA 2RVJA 4G1PA 1H6KX 4G1QA 3OL7A 4QIVA 1B99A 1KQSR 3FFIA 3M2VA 3D3BJ 1BWVA 2WRMA 2GAGC 4L75A 3BS9A 1YG0A 2CQPA 3GMGA 4FYXB 1GMWD 3IRWP 3GYGA 2E5HA 3FEXB 2G13A 2AKWB 1N32F 3PY8A 3LAKA 4BC7A 3GYXB 5L9XA 4TU9A 3HMJG 1T8EA 4RW7A 1D9DA 3NGSA 2XHCA 4FF2A 4ICLA 1RB0A 4F4ZA 4RW8B 3D54A 4NLSA 2LQJA 2QA4S 4MKBA 4J9SA 1B4SA 1RT1A 1Y5LB 2YKNB 2LFVA 3G2XA 1UVKA 4I69A 2CNLB 1PIEA 2BJ3A 1RAFB 4DPYA 4E8UA 5SUHA 3MOJB 1F9HA 1OYDA 2VF3A 3TR5A 4WFNQ 2VKZG 3TRGA 1HYSB 2B56A 2DPJA 1IKYA 1P9QC 2GMHA 1MN9A 3CB4A 4F2RA 4X4UA 2RF2A 2J9CA 1M1KT 4CNZA 3M6UA 5GVQA 4DV5F 4WK3A 2W4DA 1UFKA 2HZAA 3P45B 3MR2A 3OVAA 3IM9A 1SUQA 3X3UA 2BQ3A 5HVHA 4DU8A 3JS9A 3LPYA 5E7OB 2GV1A 1ELOA 3PYGA 3AOAA 2PMZD 3IA0A 4NXNJ 2WSCC 2UVRA 1PYTA 4WP9A 1G6BA 2YKPA 1RLCL 2E5LJ 4KH1B 3ZXWA 2AYBA 3MEKA 2MPUA 2W4PA 4Z7CA 4IOAQ 1CC7A 4JI6F 2HZCA 2KT3A 1C4CA 4DR5J 4EBCA 3BYPA 4UW2A 5T14A 4WFYA 2ROGA 1Y10A 3AQOA 1DURA 3RBZA 3M7VA 2IIHA 4IG0A 2A2CA 2Z8QA 4IR9A 4NEZA 3DDIA 5KG4A 4HTJA 3M2RB 3N0VA 4RX6A 3NBPB 4N76A 1MU2B 1SL2A 4L76A 5J1NA 2HNZA 3EM1A 2N3OA 3CDBA 1K1SA 3KJQB 4X2BA 3TO8A 4DLEA 3W60A 2ZBIA 3NG8A 2CJ9A 2CIMA 1NJIT 1S1TB 1PJ7A 1JJ4A 2VU5A 5BYRA 1NH7A 3QFWA 3QMQA 3ZO7A 4O4GB 1N5QA 1EP4B 4DS5A 2FVQA 2A1BA 1LW2A 2LECA 4AQYJ 3QGPA 3Q89A 1WKJA 2KXFA 4FBUA 3DMJB 4M5KA 4PZVA 2HBRB 5HLFA 2J76E 4OHYA 2ZNZA 5GMDA 3CCMS 4KT0C 1FEEA 4RUAA 1MSWD 1ZOTA 1U25A 1YJUA 3MFIA 1FERA 4DV7F 3WBZA 1RHUB 3HVWA 3GR0A 3HHEA 1IJEB 4R8UA 3D3CJ 3OFGA 1BQMB 1C0TB 4IFVB 3MEDA 2OH2A 4WZMA 1S1UB 3JSBA 1S7IA 3J7A1 2Y1RI 2HHXA 1TL1B 4MK7A 2D1CA 5F3ZA 2MHEA 1RHKB 3MAAA 2J7KA 2XQCA 1RKJA 3TX0A 2VA2A 3N9UC 5E2QA 3SFGA 4M1KA 1LWXA 3J80Y 4M5LA 3DKDA 1FI4A 2LMIA 1S48A 1U0HB 4ED5A 2DYAA 3GZ7A 3T41A 3V6HA 2QX0A 4OHXA 1IR2A 4ELTA 4N56A 2J8SA 2QO3A 3A13A 1NSQA 1O0PA 2X51A 4EEYA 1JLQB 1HQEA 3AD9C 2F63A 3K17A 1RTDA 3CCLS 3HO1A 2IBKA 5A8RB 3Q22A 1JLFB 4Q44A 2E9TA 3LP0B 4DSJA 4MH8A 1VQ9S 2F8MA 4LFBJ 1VLOA 4ECUA 1RTZA 1S49A 2EG1A 2ZITA 3T19A 4PUOB 3OL9A 1FO1A 2CPDA 3EMTA 5C42B 5KT4A 1R8AA 5DLGA 4CTAA 2FZKB 4XDCA 2OSRA 4O3PA 5BYQA 3RRKA 1KLMB 2J7WA 3I87A 5CYMB 1R3NA 4F36A 1HBUB 1S0VA 1NDLA 2FC8A 1AW0A 3JYTB 1X4HA 1QM9A 3H7HB 4F3MA 5M2UA 4DFPA 2B51A 1UJ6A 1OWXA 1XR5A 1NJZA 4C0OC 2IA6A 3SEOA 2GVDB 2VFUA 2GQCA 2KG0A 3L7UA 2QE5A 3PRDA 1FDDA 4O3QA 5H9EJ 3DGVA 3Q8YA 2DHHA 4IH7A 2C3MA 4HEA9 2WBMA 3W2WB 3P4UB 4MFBB 5AXNA 3BGRB 3A12A 3U1NA 1S1XA 3JSRA 5ETPA 1IQZA 1EETB 1FRLA 2F7VA 5IV4A 4Y00A 1UEVA 3H4BA 4KFBA 4GC7A 4ED2A 3CJKB 3GJSB 2M0GB 1WOPA 5CCLA 1VQ4S 3PJWA 4NLWA 2DT9A 3VR1A 3M32B 4ZLPA 2CG8A 3KLFB 4WK1A 4PXCA 4NRUA 3FSIA 3W5XA 2KZZA 3G4SS 4URQU 5EX3A 2VZ9A 3KK3B 2OJ3A 1I51B 2QRRA 2XNRA 4B9UA 4NLPA 3HKZD 2VG7A 3KUHA 4LF1A 3DOMB 4ANEA 2BJ9A 2UV8A 4NLQA 3K5MA 2XS5A 3B4MA 4USVA 4YB5A 1K1QA 1SJ1A 1T11A 5KFDA 3D2WA 2OKQA 2E1PA 1N32J 3C6UB 3IP0A 3VWSA 5G0RA 1FK9A 2FLPA 3CJ2A 1W25A 4OZ5A 1KHVA 3IN5A 5HP1A 1BWEA 3VGVA 1SC6A 5CYQB 3N6NA 4V19X 1KFSA 2QFJA 4WE1A 2IJFA 3PCOB 1XC9A 2K3IA 1Q82T 4Y34A 1Q0NA 3KLGA 2RUGA 4ZN3A 1GK8A 1DBDA 4QWEA 4C8KA 3OV7A 3ZZRA 2ZOFA 4MIAA 3D68A 2DH7A 2AQ4A 5F9NA 4H4KC 5T7LB 4ZVOB 3SSRA 3OW2R 4WWSA 1VQMS 4J9UE 3GV5B 4ED7A 1H7XA 3G82B 1FRMA 2IC3A 4DV5J 3U1LA 1HNWJ 2CYYA 4HDHA 4TNOA 1ZA1B 4O44B 5BR8F 2W4CA 1R89A 4DSEA 1SKUB 1NBEB 2MZTA 1TL7B 1H2VZ 3M6VA 1U45A 1LWFA 3FJ2A 2D3ZA 1IJFB 5FDLA 2XMWA 2R7XA 1UWBA 3CCUS 1Q8IA 1VRUA 3UNGC 1IWGA 4J5OA 2J5AA 1GXTA 2M5YA 1Y3KA 4O3NA 2HRYA 4P2MA 3TJ9A 2UP1A 1FRXA 1BLUA 1M90T 4P10A 1KVKA 1X5PA 4WFAQ 2DHGA 2Z4PA 1OQ3A 2R7WA 3T6JA 5LJ5Y 1U8SA 2OSQA 2WVDA 5ETQA 1OPZA 2JNJA 1C1CB 2Y9HA 4ZA1A 1WF0A 1C0UB 2CPHA 2YY3A 3UVJB 1R8PA 4JI6J 2BBEA 3RUBL 2E66A 3FBBA 3QSYB 3AH6A 2PEHA 4I6WA 4G1IA 3MTJA 3RBEA 3NP5A 4A8SA 2ZH7A 3PDNA 3BSCA 4NCBA 1N88A 2R8JA 2C22A 2UXDF 2QYCA 9RUBA 3GWCA 3EICA 1C1BA 2D3UA 4DR1F 3K58A 1UWAA 4YOEA 1YVFA 4LIRA 2GGPB 4DPWA 1RHJB 2YNIA 2RH3A 4Q45A 2KRRA 2HGNA 3ZNJ1 2B7CB 1FE4A 2C2EA 4C8OA 3CCVS 4A4JA 3SSSA 5L8RC 2CQDA 3OXFA 1ZAXA 2OPPB 3PVXA 3CVKA 2EG2A 1PC4A 1HNVA 2XMTA 2OPQB 1P9YA 1VJQA 4B3MF 2ILYA 3KNAA 1CJTA 1FDNA 2BX6A 1ZETA 2AX0A 1WF2A 2OI2A 2H5EA 2O67A 2Z2YB 1IVZA 4B3RF 3ZZYA 3W7BA 1DTQA 4WU3A 3WC0A 2A10A 4ED6A 3AY0A 4DV7J 3JB9k 1U6ZA 2NUUG 3M30A 2YWGA 3FUYA 3TYTA 1DY3A 1YRUA 4ZCMA 2DR7A 4PQUB 3KHLA 3V6JA 2JEJA 4F67A 3LUYA 1HW9A 1HWUA 2CJKA 3OFEA 4ZVGA 4C8LA 1VCTA 1Y5IB 4JP8A 1ZZNA 4A8XA 3KHHA 2V50A 2QV6A 1TAUA 4HT7A 3NCQA 2OELA 2A0FB 3CJ5A 1VQPS 4DPUA 3G96A 4OZ1A 4IOCQ 5IWAF 2H4YB 4RR5A 2PE8A 1QD1A 5F0UA 2IAJA 3U02A 2AF6A 1QAJA 4CTAB 4ID5B 1TKZA 2BM0A 2OFHX 2MTLA 5AT1B 3SV4A 3G8QA 1X9MA 3DDNA 2OD4A 2AJ0A 2JWNA 4U96A 2LXUA 2AT1B 1WOOA 5CABA 3PEJA 4WBFA 3PKMA 1YK9A 1FRHA 1P1TA 2MSSA 4HHUA 4ECSA 2XSJA 3VZHA 4DF4A 4X4NA 3HULA 4B3OB 3W2VA 3VAGA 2DR8A 3MGJA
chains in the Genus database with same CATH topology
3OLBA 2HLTA 2IVFB 2W9AA 4FZVA 1U6FA 3VTIA 1CSJA 1GXLA 5G4DA 5GAGI 2DNLA 3LP2B 1X4EA 3MUTP 1H98A 1VMBA 2BXJA 4B3OA 2IRYA 2FHOB 1LW0A 5A0YB 4NMLA 1UA0A 3DFEA 2UUWA 3J7ZT 3TA0A 2UVVA 4KR0B 2IM3A 2DCLA 2AX1A 2IYGA 2ZH3A 3LP2A 4YB6A 4PKDB 3DLKB 2CQIA 3DRRB 5A0YA 2ZH2A 2K1RA 2XB2D 3J7YU 2VB6A 2IYIA 3EXYA 1DARA 2B43A 3HT3A 4AFFA 3MAQA 3O3LA 3PXGa 3I6PA 1URNA 1LQ9A 1S1XB 4ZVHA 3DLKA 1REVB 1S1WB 3DRRA 3KG1A 1V9OA 1SH0A 3O8WA 1FD2A 2HWTA 3RB3A 1RTIB 4QU7A 1DQAA 4LT6A 3HVAA 3HM9A 1SB6A 5KFJA 4K0KF 1FD8A 1XNQF 4QZVB 1WELA 4K5RA 1REVA 4WKYA 2EFVA 3GSDA 3FQKA 3IAM9 2MGZB 2VPWB 1WACA 1RTIA 4WYWA 3IRXB 4GKKF 4LFAF 5DDQC 4CH1A 4DFKA 3LH2S 3KHRA 3ISND 3ULHA 3R27A 3P5TL 2ZOGA 3BSNA 3TAPA 4X4OA 4A8WA 4OX7A 3RRHA 2PO4A 2MGZA 3LQVA 2XG8A 3IRXA 2V5HG 1NK6A 4ELUA 1X0FA 2CRLA 3VAFA 1J2VA 4I6AA 1MWYA 3CPWR 2UUCF 2JLEA 2MZJA 1LK7A 1HA1A 2M88A 5DLFA 1X8DA 3OSNA 5CYJA 4RNNA 1Q53A 4L3NA 4ATNA 1FRKA 1HW8A 2PD1A 3IFEA 4EZ6A 4I0WA 4ZP8A 2ZH8A 3J81Y 2KB2A 1YI2S 2J6TA 3CCWA 4TN2A 1FXDA 2FJXA 3M2UA 3MMCB 3D0HE 1QSSA 2CVIA 5J1EB 5AJ3F 5D78A 5KFLA 3VAHA 3ISZA 1B64A 3PW2A 2CQGA 2ZH1A 1D9AA 3GG0A 4QPTA 1U24A 3MMCA 5IZHA 1VK8A 1HWJA 2EW9A 4B08A 2HQ3A 5J1EA 5GAHU 4MKAA 1TK0A 4DMZA 4JV5F 4I7FB 3MEEB 5KFBA 4RNHA 4DPOA 1RT4B 5I42B 2UU9F 3MD1A 1RISA 4RUHA 2FJVA 2BR0A 2RS8A 3H5YA 2YH0A 4G3IA 2AJ1A 2MKCA 1IM4A 2YX1A 3MWBA 2HVIA 4QYRA 5DS7A 2GO8A 1FE0A 1KHWA 4I7FA 4YB7A 3U27A 3MEEA 3MPYA 1RT4A 1D8ZA 2KXNB 1IUJA 6FDRA 2R7VA 4ETXA 2JLFA 1PO6A 3D0IE 4NZ6A 2F40A 2YWFA 5KFPA 2ZH9A 1L5UA 4CO5A 1Q8BA 3PACA 3VAMA 2XC9A 1FK9B 1Z4UA 2GNKA 2WW8A 4B9MA 4X4VA 1XN9A 4ECVA 1KD1T 1F2GA 1N34F 2R7SA 1HL6A 2ILZA 1Z2ZA 2Z0GA 3OPKA 3TUIC 5HP1B 4TY8B 4DLGA 4OJ1A 1N0VC 5J2PB 3K5PA 2HHUA 1TL3B 4PXEA 1GQEA 4CH7A 2EWHA 1FJEB 3OR2B 2M9KA 3POTB 1WHVA 4DOZA 3K8WA 1RGVA 2LLZA 2MHNA 2YKQA 2E1RA 4TY8A 3AA9A 4NYZA 3H5SA 1U1NA 4ECRA 4G6VB 5J2PA 1JNZB 1CG2A 1TL3A 2GW8A 5D77A 1S99A 4KO0B 3SMZA 2NQPA 3QGGA 4WE1B 3OR2A 4C3KA 1PGZA 1RA7A 3POTA 2RS2A 4DQSA 5C24B 4PG4A 2E5IA 1U1OA 2RT3A 1RT3B 3CDWA 2E44A 4K4WA 1HWKA 4CT9A 3CD6S 4ILLA 4PWDB 2FJBB 4WXOA 2ZHBA 1IR0A 4LSNA 2AGOA 3BO3A 1S0MA 3KNGA 4KO0A 2ZJQQ 4NXNF 2YKMB 5LL6d 4DSLA 2MMYA 5C24A 3WC2A 1RT3A 3MZIA 3UW1A 4C8YA 5B0DA 4PWDA 5B0CA 2D41A 1SQEA 2M3DA 2ZE2B 2HW3A 2NUHA 2R8GA 2YNHB 3E01B 5E41A 3A1YG 2YKMA 2W25A 2E5LF 4DQRA 1K73T 3QAEA 3CD0A 4DS4A 1U1MA 2OAUA 2ZE2A 1HI8A 2FVSA 3R5DA 2J0XA 2YNHA 3E01A 1DTTB 3K7RA 4AXJA 5M2RA 4CO1A 5JJBA 1JXLA 2OTJS 3RR8A 4O4RA 4CIOA 3MECB 3AB4B 1FXLA 1QAXA 2CQCA 2EFPA 1N33F 1SKWA 5I3UB 4J9LA 2C2DA 4DFJA 3Q24A 2IMWP 4IG3A 4MK8A 1DTTA 7FDRA 2E7WA 3B82A 3KG4A 4B02A 2O66A 1VLYA 3MECA 4TYBA 4DR5F 4ECQA 5K8NA 1RQ0A 3D28A 4A8QA 4BS2A 1HQUB 5KFHA 5IT9Y 5GADU 5I3UA 2B9YA 4Y2KA 5L9NA 4FN5A 4RBVA 3UD4P 3CXCR 1HHTP 2EBGA 2COLA 3G86A 2B4PA 4LF8F 2QA4G 3O2IA 1VQSA 2DNZA 4C0HA 5CD4H 3MR3A 1HQUA 4HI1A 1KOHA 4OI4A 4KAIA 1KEKA 1I6JA 2LEBA 4LSLB 4OQJA 5CZXA 1R0AA 2WCXA 2MY8A 5CCMA 4EFAC 3NMRA 5C25B 5F9LA 3BDPA 1S72S 3NAHA 3KLIB 2HPUA 3L95X 5BYSA 2MKJA 1NRKA 1DLOA 3OQ2A 1VRUB 2ZUGA 1CEZA 4Q43A 2MKIA 1BC6A 4CI0B 2WONB 5C25A 2NXUA 3MM6B 3P96A 2B9WA 4HLBA 1RYRA 2MKHA 3KLIA 2FJAB 2M7SA 1NAQA 2FJDB 5KFSA 3VAIA 3NCRA 4IDKB 4KV8A 4AL7A 2OIHA 1LWCB 2CPJA 3ENVA 5I3PA 2WONA 4LVOP 4N77A 1LXNA 2XMVA 5JUMA 1KVJA 3MM6A 3H2LA 1Y9OA 1VJWA 4J9MA 2ASYA 3PRBA 3H4DA 3IO1A 1RK8A 4YEAA 4ILRA 4DSIA 1HHSA 4IDKA 5KFYA 2H9ZA 3FRYA 1LWCA 2HAIA 2NSBA 1WHWA 4QWAA 1FJ7A 3MTKA 3H59A 4DJBA 2E7XA 1QTMA 2RIJA 4JI7F 3KK2B 3N79A 2VONA 2JHEA 1QVFR 3CCZA 4KRWA 2HHHF 1FCAA 4IRKA 4Z37A 2RDIA 2KO1A 2NREA 5DDOC 4QIWD 5E3QA 1TP7A 3S6EA 5KT6A 2M8DB 4Y3CA 1JK9B 7FD1A 2FHJA 3KK2A 5F8JA 2XO7A 2XMKA 3AB2B 2KM8C 1LOUA 3IXQA 1NK7A 4P7TA 4ZDNA 4RBTA 3OLAA 1IKWB 1R8CA 2L48A 2F9DA 2DJWA 2DNMA 2I0XA 2ZZMA 2B4VA 4MYTA 1BY9A 1Y0HA 5FJ4A 4C7QA 2DNQA 1B7FA 2IMOA 4C97A 3N28A 2J6SA 2HMIA 1ZH5A 4NLDA 2J0SD 1S9EB 2DRBA 1OPIA 1IKWA 1YRTA 3OBIA 4AQYF 4GMKA 1FKPB 3KHGA 2EFGA 2PIIA 2RNEA 1B0TA 3IG1B 3VALA 3NNAA 5K14B 1NJXA 2LU2A 4LUBA 2MQPA 4PG7A 5EWEA 2R2SA 3VAKA 4OIXA 3RRGA 5D3GB 4X4RA 3CTRA 2DPIA 1S9EA 1MMLA 3F44A 1S97A 4AL6A 5K8OA 3RAMA 3CJ3A 1KSPA 3IG1A 4KHPF 2DR9A 5K14A 3OTEA 5LSRA 2DHAA 3VCDA 4A46A 4C3LA 2K3KA 2IA0A 1VK3A 2AYMA 5D3GA 2VPZB 3PFEA 3QLHB 3QGHA 2FVCA 3GFZA 1VC6A 4DL0C 4ZPAA 2GCFA 3HI9A 1QAYA 3MR6A 4NLUA 1CC8A 2V8DA 3OJUA 1GTEA 4IQMA 3HLUA 5K9FA 3T1HF 4N41A 1HBMB 3IWNC 2R7UA 3CCRS 4LF4F 1C1BB 2YWKA 3EZ5A 1K9MT 3MOZA 1VFJA 3QLHA 4OJ3A 3PKYA 3Q8QB 2RD5C 2DGUA 4F2SA 2CPEA 3THTA 2POKA 2MXYA 2YQ3A 1XWLA 5DRKA 3BJYA 4K4YA 1N48A 1UVNA 2ZKUA 1AROP 3TP2A 3TVZA 3LF0A 4Y2MA 1HBMA 2GJIA 2VFRA 3S1TA 3CO9A 2GQ2A 2DNRA 4RLEA 4QWCA 4AE5A 2PDAA 2R8KA 3I5AA 3R3TA 4ECYA 5A6PA