5JW3H

Structure of medi8852 fab fragment in complex with h7 ha
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
228
structure length
222
Chain Sequence
QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSYNAVWNWIRQSPSRGLEWLGRTYYRSGWYNDYAESVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARSGHITVFGVNVDAFDMWGQGTMVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function Analysis of an Antibody Recognizing All Influenza A Subtypes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Hemagglutinin
total genus 43
structure length 222
sequence length 228
ec nomenclature
pdb deposition date 2016-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jw3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jw3H01
3QZWA 3WFDH 3MRMA 4K9EL 3AY4C 2Q8BL 5D2NC 2DQDH 3ILQD 2YD2A 1DE4A 5D2LA 2EC9U 4NGHH 2X4TB 5TQ0H 3TV3L 1HHIA 5BVPL 3MGTB 4OFYD 3O6FD 1R0AH 1XZ0B 5HGDA 3MGOB 3ECBA 4TQEH 1P1ZB 2X89D 1UZ8A 3AU1A 2Z35A 4Z77B 3QUXD 4J3XA 1S5IH 2EO9A 2YXMA 3U7YH 2H41A 3I2CH 1F02I 2V7HB 1FGNH 3QEHA 5TE4H 5T3ZL 5ID0B 3QEGL 4P9HC 1A9BA 3RGVD 3MRCA 1J1XH 4JY6A 1AKJB 2BDNH 3R8QA 3KPSE 5CD5D 1MAKA 4TVSa 3S3JA 3BZEB 1VADA 1M6OA 2XY1A 1RZ8A 5IMLA 1E4JA 1CGWA 5CCKH 5IB5A 2NY7L 4UOJA 3ZDXF 3PGFH 4Y5YA 4LSQL 4XPHL 1U8JA 2YUXA 2IGFL 1EGJH 4R2GC 4CU8A 4ONFH 3WIIH 2X9WA 3VE0B 1HHGA 2R29H 1YMMA 3O3EA 3S34L 1SEQL 2W60A 3QYCA 4JFEE 3U79A 4M3KB 4NQDB 1NGZA 2C3VA 1J8HE 4HUUA 3C5ZC 5JXEA 3BWUC 5KVGH 4WW2F 5DD1L 4Q58C 5INDA 2MPAH 3QDMB 2EDNA 4M1DL 5DMJB 4DUXA 2LABA 4U6HB 1G9ML 1OY3B 5A2FA 1IEAB 3MREB 2VC2H 2GK0B 1Q9OA 5K9KA 1PYWB 2A6DA 5HHQB 1CD8A 1C5DA 1XGUB 1U8PA 1A64A 4HLJA 1MHCA 1WT5C 2A83A 4UINH 3I6GA 5DYOA 3NPSB 3SCMC 1OTUC 1FP5A 1X5JA 2ZPKH 3IKKA 4F37F 3TZVC 4R4BB 3DSNA 1RZKL 5AG8A 3WDHA 2HN7A 3BXNA 3FB6A 3QDJD 2NY6C 4PP2A 4Y16A 1JUFA 5LG1A 5F6IB 5I19H 1L7TL 1C1EL 2A1WH 1JGLH 3V5HA 3QCUH 4WW1A 4KKAC 1A5FH 2ZUYA 4RMRA 4ONGH 4XP1H 1WICA 1X6NA 1A3RH 5EUOA 4NC2B 5DEFB 5GGTA 3CLEH 4FQQB 3VFSA 4CVWA 1HSBA 4NKDB 2IANA 3ECBB 2AKRB 4U1GB 1W72L 5CSGA 5I30H 4P5KB 1MEXH 3H7BA 4I3GA 1AI1L 1KJVB 2YC1A 1OGAD 3OKEB 1MI5D 4XPHH 5D1ZB 3BPOB 5L88H 1T22B 4BM7A 4RZCA 1U8JB 4FFZH 3LHPH 2EH8H 5IMOA 3V95A 5DZLA 4XNUH 3WO4C 1UEMA 1DQML 3HI6H 3NPSC 4JAMB 2H32B 2SEBB 1CE6A 3CXDH 3SDAA 4LAQH 3M07A 3ARXA 1CE1L 5F1IA 3GHBH 3PQYB 1TJIL 1B0GB 2F5BL 1KB5L 2HFFA 3MLTA 4P5TD 1F3RB 4NBZB 2EECA 1QUNA 1D5BA 4NFBA 1HI6B 3VFOB 3GSUA 4I77H 2B20A 5T5NG 5IT2L 4RNRB 1BZ7A 5F70A 1PYWA 2L4OA 4UINL 2H32H 5IG7B 3VWKA 3QG7H 3KPQA 1NCDH 4L9LA 2DQJL 5IVOA 1QEWB 3HE6D 3TCLA 2V17H 1RJZA 3V4PH 3ESVF 2FO1A 3RY6C 5EIIA 4B41A 4MQSB 3MRHA 5KVFH 5IHUL 1EO8H 3HS0B 4WW2B 5HJ3A 4EQ2A 3L3GB 4JY6B 2VE6A 5FCUH 5IFJA 2KPNA 2QQNH 4QRRE 2NX5A 1CFSA 5DK3A 2BOBB 3UZEA 1EAPA 4PJ7E 1B2WL 1JNHA 1T5WA 2DQFA 2GY5A 1YJDH 4MCYB 5DJDA 5EU5B 4OCXL 5HTSA 3V52L 4RAHA 1MCKA 1TQBC 1KCUH 12E8L 4JO3H 1SYSA 3KYMA 8FABA 3CNKA 1Y0LA 2XFXB 3O6FC 3RNQB 5E2VL 2NY1D 3MLZH 5I74C 3O2WH 4S0SD 3GMMA 2I9LB 3I3EA 4GAYA 1A9EA 4G8GA 4OLYH 3OKNA 4NJAL 4JM2B 3BGFB 4JFZL 3FT2B 1TZIA 3KVQA 1B90A 3OKKA 1QRND 4RGND 4ZTOH 1KFAL 4MDJB 4RMTA 3KHQA 4PGCB 3VXPA 1NGWB 3MCG1 1FZJA 3VW3H 2HLFC 4XP6H 4H5SA 3TO4C 1EO5A 5GGSY 2R2EA 5BZWA 2PKDA 1A4JA 4NRZB 3VRJB 2EYSB 1DFBH 5SWSD 1NEZA 2PO6B 3QUKA 5DUPH 4H0IA 4YHIA 3UTOA 1WFNA 4K7FA 3D2UD 5TQ2H 3BIAX 1TVDA 3KLSA 3AS2A 4OD3L 5TJWK 3VRLE 4MCZA 1KEML 2B4CL 1YYLH 5I8OH 3RIAF 3BQUD 2YZ8A 1D7FA 4BFEA 1Z9MA 4Z7UE 5I8CB 4MNQE 4U6XA 3OKNB 1QQDA 1F00I 3MUY1 4QNPE 4EZMA 4JG1L 3QHZL 5E2TH 3GNMH 2GI7A 2WZPD 4HWBA 1G7JB 2EH7L 1U42A 2LTQB 1J86A 4ZO9A 1SEQH 3WUZA 2VQ1B 3L7EA 5JIKA 4E5XA 1A7QH 4BQ8A 2GTWB 3C09C 4N9GB 5DEFA 4HKXB 1IGJB 4I18B 2WLYA 4RMWA 4JFHE 2NZIA 2HJFB 5IJKC 4YGVB 1DVFB 4QRUB 2ICEB 35C8L 4AM0A 2VL4A 4X6DF 3BDXA 2UVEA 5FGBC 3BUYA 3IJHA 3MRHB 5BV7L 3H3BC 4JO2H 1WGOA 3S4SB 3IFNH 1QZ1A 4ZFFA 2A9MH 2NR6D 2L0DA 1EJOH 1BFVH 3WNKA 5HVHB 3QULA 4HGWB 1DANU 2HT2C 3PDOA 5DK2B 4YDIH 3OX8B 4I0PD 4DZBB 3ULVH 1FO0H 1NL0H 3HNSH 3LKPA 5FHAH 3W39B 2DM2A 2XZQH 2YD7A 1OP5H 4OZHE 3MLXL 1A3QA 5F97E 1KPUB 4KJPD 1KIQA 1RUMH 1X3DA 2NNAB 5EFIB 3S88H 1KXVC 3G5ZA 3HN3A 2IG2L 3TBSA 4HBQA 4PRPD 1Q72H 2XWJA 3V6FA 2IPUK 3C5JA 2J6EH 4XBGB 3WDJA 3PP4L 1N7ML 4CW1A 2WAHA 5E0QA 3FQTB 3AREB 1ZT4B 3SO5A 2X2YA 1LK2A 3MUHL 1FFPA 4HQQL 1AI1H 1FG9C 1T20B 2AJZB 2CXKA 4E41A 4M7ZC 2ADFH 4KVNL 4LLAA 1H3UA 1EFXD 1UG9A 3EOAB 5AAMA 3C5ZD 4S1RL 1JV5A 1CDBA 1KB9K 2AEQL 1PG7L 3EDJA 4HZLA 3T0WA 2BC4A 1P84J 4ALAL 4P3DA 2IJ0C 2VO5A 1Z9OA 3E6HA 3QEQA 1RY7B 2EXYC 3W9EB 1U8IA 3LPGA 1J8HD 5BZDA 5EIVA 1KLGB 1D5IH 1IGFH 1GXEA 2DI8A 2UZYB 3N1GC 4QXTA 4PJEF 2G75B 3I02B 3AS1A 2X4NA 4OD1H 4OV6F 3TFKC 4APQC 2X4TA 5TFSH 2DQTH 4GRMA 1JTOA 2AI0H 2FBJL 4J1UA 4YWGH 5SWSE 2OJEA 5KOMC 1TNNA 4X4YA 3SDDC 4JZJA 1PSKH 3V6OE 3C6LB 3MMEA 3QDGB 5MI0C 4XPFH 4KKCC 1CI5A 2N7AA 3OF6D 3MLVH 3KDMA 1OD7A 4LAJH 1JMZA 1FNLA 4K7FB 4OZIF 4NQVB 4TNVK 2OTWA 5I66B 1CLZL 2VISA 1QSEB 2OSLB 43C9B 5CFHA 1GGYA 3WIHH 1WJ3A 4N9OB 1U6AL 4ZDHB 2Q7YB 4DGYL 2AJXL 4PD4K 4XNMB 4JDVB 1J18A 1WZ1L 3ZKXB 4PPTA 3RPIB 1EX0A 4PRIE 3P4MA 2ZG3A 5MP6L 4JLRA 3CDFA 1HINH 1I1RA 1IFHH 1DEEA 3BOVA 1N4XL 2EEDA 4LOUD 1G7MA 3ZYIA 2DDQL 4DEPB 5B21A 5L2JB 3ARWA 3C87A 1OVZA 3LKRB 3S5LB 3BKYH 4MNGB 3QO0A 4MXVE 3O6MH 1VCAA 1FCCA 5EN2A 5J06A 4WHTA 1DQQB 1X9QA 2FYYB 4MNHA 4X98B 3FRPA 2EDBA 1YEGL 4F15B 1HIMH 4HT1H 3GDBA 3GUTA 2EYRB 5C92A 1F42A 2DJSA 4QHUB 1HNGA 2L7JA 4L5FH 5IBUG 1ZGLM 1EEYA 4PJAE 4WY7H 1HOCA 1IKNA 1KC5H 1R5VB 3DSFH 3WIFA 4OBRA 4Y89A 1YMHB 4YXKH 1NC4D 4OBSA 4U1MA 4D2NA 5JQ6L 3U1SL 1INEL 1G7MB 5EULV 1P4IH 1MJ8L 4GUPB 4NO0B 2DMBA 2EKSA 3DUHA 2CDGA 3OWEA 5JW4Q 5D1ZA 2EXYD 2Y5TB 4R4BA 2AGJH 1L0QA 4RMQA 3G5YA 4FZ8H 4OGAC 4JG0H 5T3XE 2IFGA 4HWBL 4BSVA 3O0RH 4YHYB 1NCUA 4GW5B 1MCQA 3OR6B 2Y06H 2E7CA 3ULUC 2YMXH 2W0KA 1KB9J 1B6DA 2JTDA 3BP4B 4AENB 5HDBE 4PY7A 1X6LA 1SEBA 1I7ZA 4QHUA 4HLZG 1QKZL 4P3DB 2Q6WB 1T20A 1MIEL 3LQAC 2CD0A 3CXHK 5IT2H 4U1IB 5DQJA 3KYNA 3TA3D 3H6JA 2YD9A 4PJHB 3QXWA 1INQB 5JNYB 3GSWA 3PUCA 1H3XA 2DWDA 4XP9H 2GTZA 5TE7L 2P5EA 1ZLWK 4WUUE 2AJYL 5FYJE 2QQKH 1C16B 5IMOB 4Z7WF 3ELAT 2R0KH 1C12B 2HLAA 5C3LD 4X6CE 5L7XL 2DLFH 4UU9A 1BIHA 5IW1B 3GRWL 2GT9A 2DAVA 2X9XA 4Z95L 4YDJA 4PGJA 3CMGA 3D25B 4IOIA 1S9WB 4WDIA 1TETH 4JZNA 2YSSA 3SQOL 3QIBA 2K9UA 5DC4B 4JB9L 5I2IA 2WUBH 5DMKA 4O02L 4A6YB 1G7QA 1NANH 1NKRA 1IEAA 3MREA 5J6HA 3T77B 5HHPA 4U2YA 4C56E 3ARBD 3VRIB 1KPVA 3H8NA 4O58L 2Z35B 2B4CC 4PYHA 4KVNH 1MJJA 5FKAA 4O9HL 5GIRA 4KK5C 1ZVSB 2ZCHH 5C0RL 3BUYB 2MOVA 4KY1L 4UBDC 5INCB 2O61A 1WBXB 5EC2B 5DJ6B 3CIQA 1J10A 1F6LL 4UUJB 3EJJX 3WNMA 5E8DH 4A6YH 1DBML 4PRID 4GW1A 2HLAB 5D1XB 3PWNA 2PNDA 4ONOA 5E8EA 2F8VA 4AQOA 2IH3B 4OZGB 2VLRD 2EDLA 1CZ8H 3RZCC 1A6WL 4AH2A 2RB8A 3GKWL 1A47A 1QR1A 3C6SB 1MCSA 3BYTA 1BMGA 5C2UB 4HUVB 3QG6B 4AK1A 1FO0A 3DRQB 5EBMB 3REWB 1LNUB 1QHOA 3D0LB 5HYIA 4JQXA 1MVUB 2D7MA 2HVKA 3MJ7A 2EDFA 3BKJH 1PEZA 4OIIL 3FCTA 4ODXB 3O6LH 3IDYC 4OD3H 2IBZY 1NAMA 5D72H 4PY8J 5D8JL 3VH8A 4LKCB 1KJ3L 5JIPA 4TNWK 1S3KL 3BD5A 2J8UE 1CF8L 1QFUH 3S6CA 2OK0H 2E8YA 3VFRA 2GAZB 3D85A 4HS8H 4PLKC 3MR9A 3DPBA 4ZAKC 3MJ9L 4OFDA 3K8KA 1ADQA 4HX1B 5AWNL 4EXPX 5CINH 5ESQA 1MFAH 1WBZA 5D7JD 1E4WH 4YDKL 1KF9B 4P46A 4XMLL 4NNPH 4JDTL 4QTHB 4QWWC 1I8LA 3KYOB 1U6AH 1YN7B 3T4AA 4G8EB 1JK8B 1QBBA 1OM3L 1I7RA 3HZMA 3MBXH 4DKEH 4QNPF 1QFWI 3MNWA 1ZV5A 1SJVA 4MS8C 3V9FA 5BRZE 2NY1C 3BAEL 3UYPA 4DTGL 5BO1H 2FB4H 2JKXA 3PNWB 1X5YA 4YNYA 3T0XA 4XNYL 2XN9B 4AYFA 5J3HD 4M4RA 3RKDC 1FO0L 1NL0L 2Y07L 4XP5L 1M7DA 4HWUA 3OB0K 4OD2B 2AK4A 4P5MA 5CIPB 5EU3A 3U0TB 2OTUA 1EHXA 1FDLL 1TXKA 1BFVL 3GMLB 3ZKND 3IXAB 3QFDB 3QDHA 3TJEL 2IG2H 3U7YL 3T8XB 4B5EA 4ETYA 2BVYA 3LN5A 4Z5RB 1WUNT 2P8MA 3ILPB 4P46D 3QDGE 3J7HA 1IAII 4KKNA 4PJFF 3UTQB 4IOFD 3O3BB 2JCCA 4HK3J 1UM6H 2ESVA 5HHOE 2HFEA 3A6CH 1BAFL 1U2CA 4QRQB 3QJHB 4HC1L 3VGEA 4N0YH 3O9WB 4PJ9C 4MJ6B 1SJHB 5CILL 4TPRH 5EA0L 4ZDHA 2A0LD 3U6RB 1NMAL 5DS8B 5B8CB 4C83A 5IW6A 1Z6JT 2PCPB 3GJEB 3SDXB 3QO1B 4KDVA 2E27L 4IRZH 1C5BH 4KI5F 2GKIA 4WFGE 4ZG1A 4KRLB 3UJJL 3T8XA 2W91A 3QISA 4IRJC 3IU3A 2D0HA 1L9MA 4NDMA 1J8HB 1AGDA 3MV8E 4KKBD 5T1LA 3IAGC 3SQBA 4LSUL 1BD2E 2CMRH 3VXUD 5IKCB 5IM7B 1YEIL 2VLRA 4HWZA 4I0CC 5ANMA 4Y4FC 1DR9A 4OCYL 4CRPA 2VUYA 5DVMA 1CVSC 4X99B 4Q9RH 1HNFA 3F6IA 3HI1A 1JRHL 5DD6A 3WUWG 5CEZL 2YPLB 3BD3A 3AUVA 5EO0A 5C0GA 3FO0L 1H0DB 2QQLH 1QR4A 2W65B 3OR7A 5D93C 5E95B 1HXYB 4GKOA 1PKQE 3TO4B 4X4YB 4FQLH 2HRPL 4QTHA 4G7VL 4PREA 25C8L 1S78D 3MROA 3O2DL 1S7UB 4FTVA 1YQVH 4WI9A 2FLRT 2A1WL 1ZGLP 1LMKA 3ARFD 1F58H 5D5ME 1FO0B 3S4SG 1IM9A 4RFNB 4YHPB 2I27N 1K8IA 1DTUA 4I48A 2DQEH 4XAKD 3GGWA 1EA9C 5DFVD 5ADOL 4KI5E 1NJ9B 2A83B 4QRUA 1MCLA 3NCJL 5D7KE 4JFOB 1NC2B 1VPOH 4F58L 5TDNB 3GMQB 2CLRB 4M8VA 4XCNB 2ZOKA 5EA0H 4YHOL 2P5ED 3PV6A 5CP3H 1BFSA 5F88A 5J4MA 4XCYA 1PZ5B 4NQDE 4LEOB 3RDTC 1DUYA 1EEZB 3CU7A 5IEKB 3DMMC 3O11B 3HI5H 5E6ZA 4GG8B 5CEZD 1S8DA 5FFLA 1MHCB 1J1OH 5KG9B 4MHHG 4Z0BL 5C70A 5LGJA 4OCWL 4R7NB 4R2GD 4WUKL 4LSUH 1KGCD 4AT6B 3C5ZB 3SGEI 5CCKL 1T80A 1T66C 4QOKD 1DJSA 3B2VL 5C0FA 5GS1B 3OJDB 4FA8A 1RZGB 3BZEA 2JIXA 3DSFL 3HC3H 1AD9B 4KJPC 1L0XA 4EN3A 2DD8H 4QTIL 2G5BA 3O0RL 1QG3A 1FE8L 4TSBL 3RGVC 3W5MA 5AUMA 5IBTH 4C59B 4I18A 1NUNB 3QULB 4UQ2B 3VXTA 3LN4A 4Z7QF 2D4FA 1RIUL 4W6YB 2YXFA 3KPRB 4Z7UF 5I74B 3OV6A 5C6WH 5IMLB 3CC5B 4JVWA 1VFMA 2BZDA 4XMLH 4PRBA 4LVNC 2C3VB 4WHDA 4EI5C 5MEND 4NKIH 2VDOH 5C0IA 1V3KA 3N06B 1D5MB 1U95A 5IFHH 4QRPD 5BOZG 3ILQC 5T3XH 4UIMB 3LD8C 3RWGA 3SGJC 1VACA 3BD4A 4LCIH 2GJ6D 4K3EH 4I2XA 4J3SA 1A6UL 3MJGX 3GB7A 2OMBA 3SJVA 4PD4J 1OAQL 1NDMA 2EKSB 1FIEA 1FZMB 3ET9F 5SWZB 3CFJB 5C8JB 1CICB 1E6OL 3NIFF 4LLUA 1BQSA 5C71A 1LE9B 4XHQA 1UJ3C 4ELMB 4PJEE 1DQTA 3KDMB 2BVTA 1CGTA 4G43A 4ORZC 2F54A 2GSIA 4U6VL 4PUBH 4YX2H 3IAQA 3P11L 2DQUL 2J3SA 1NCBH 5MHSE 2AABL 3WN5C 1KN4H 4EUPH 2FWOB 2C3GA 5CD3B 2ZCHL 43CAB 3P0YL 5EZOH 4NM8L 1NGQH 3D9AL 1BWWA 1MF2H 1JNNH 3KPMB 2ENYA 3IDMB 3UPRA 4GLRH 4OCRH 2P46B 4FQIH 5DWUH 3WKNA 3MRMB 4RMVA 4KROB 1UADC 3ARGA 1NGWA 5KSAB 5C0CE 1P9MA 4TVPD 4XAKE 3KPTA 4DAGL 2H8PA 1FSKB 2H2SD 4NO5B 4FQXA 5FAAA 1CFVL 3KR3L 4Q9CA 1BBDL 3VI3F 1DANT 4G8GB 5F3BB 2D7TL 1FYTB 2O26U 4G5ZH 5F7EH 2MMXA 1BEYH 3FRUA 5C0BB 5KOVC 5D7IA 2ZNWA 1EHLL 3TT3L 2E8ZA 4G7YH 3CVHH 4LCCB 4X6BA 3IT8D 2GJZA 5J3HC 1BOGB 2I60H 1IAIH 1P84K 3VXPB 3Q6FA 4K9EC 1HOCB 3NCYP 1MCDA 1MCPH 2O93L 4LU5H 2XQBH 4JHAH 4JM2A 1WWAX 5D9SA 1A3LH 1CGXA 4Y1AA 4DKFL 3EHBD 2FX9H 4LSDA 3KPRA 1A0QH 4X7DC 4ZS7L 1SVZA 4HCRA 4RGMB 1RQ5A 3IETB 5GISH 3ULSA 5KTEL 2P4AB 4P3WA 4LNVA 4O2CA 1I1FB 1J05A 2OBGA 1HHIB 1FVDB 4JGMA 3RI5F 1IC5L 1ZHKA 4DCQA 1TFHA 1KENL 1LE9A 1Q9LB 2YPLE 2Z8SA 3MBXL 4DKEL 5BS0E 5L0QB 2UV3A 3U6RA 4L4VE 5BO1L 4GRLC 4LPXA 3DROA 3QEGH 3DV6A 3PIQA 4QF1A 3BUTA 4JLRB 4YDKH 3QJHA 4U1JB 2NY3B 4YZFF 5F1NA 5EG6C 4LVEA 3RBSA 1HI6A 1LGVA 4NJAH 3VFOA 5C07A 4IDJH 4YBQD 4X4ME 1KT2A 4K94H 3D0LA 2FGZA 5E1HB 3VD7A 1I3GL 5GS1C 4WU5B 4FQXC 4UDUB 3SKNA 3QQ3B 3RWJA 1NBYB 2YWYA 4M4PA 3X3FH 3UTSB 1LO3L 4AM0B 3B2UC 3ZT5A 4G43B 4G3YH 3K46A 3RGVB 1EHNA 1EAJA 1NFIB 3QWRD 1IL1B 1RZJH 1I1YA 3GMLA 4KKBC 4JFEA 3E6FB 4KI1A 5F9WC 3B8SA 4KMTL 3OKDB 2VZ1A 1FZMA 4KU1A 1JBJA 4XT1C 4F7PA 2ZKHH 3TCXA 4P2QD 3HZVA 5KVDH 5EH1A 1M6OB 4EIZC 2CUHA 5E6ID 2X09A 3MLSH 1G9NC 3EOBB 3TH2T 3V6OC 1WEJL 5IVXB 1CTOA 3MPCA 4JM4H 4L3EA 3QUMB 2KBGA 4U6YB 5C0EA 5MEOB 4YHPA 3I75A 5F21B 4WWKB 1P5VA 5GGUB 1N3NB 1G6RB 3MRQA 3BKCH 3TN0B 5EOCH 3SGDH 2B5IC 2ICWJ 3AMLA 4QRPB 3BQUA 1JWMB 2D31A 4UV7L 5MHSD 3T2QA 3ULVC 1E27B 1BQHA 5GRUH 2BY3A 1MCRA 3UTTD 4OZIB 5FUOH 4UB0L 3HPJA 4J3OC 5ALBL 5I8CA 5GRZA 2HWZH 1KJMA 4D3CL 1KB5A 2DQHH 1Q94B 1UWGH 5DTFB 4X7FC 1LO2L 3OPZH 5FKPA 4WO4B 5F3BA 2F53B 5DURD 3JV0A 1EEUA 1MHHB 1NEZB 2PO6A 3L7EB 4E5XB 4OLWL 1IBGH 4OGXH 3H42L 4UI2A 5IB1B 3IJHB 4NO5A 4KJQD 4Q9RL 4YFLI 3S36X 3IS0X 3JSSA 4NYLB 1EO7A 1QA9A 3V5KB 1KOAA 4WI5A 4OTXH 4N1CA 5CBAA 5I8EB 3QWOB 1FRGL 2BP3A 3D3VD 5EDXA 1DBMH 2ADGA 2FZ3A 2ENSA 4OGAD 4NC1C 4DUWA 5D7JC 3TP4A 4TULH 1WWWX 3LQAH 2HRLA 4NJ9L 5I76A 5JA8B 5C0BD 3INUL 2E7BA 3TC9A 1NDGA 4U6VH 1N7MH 5IFJB 4K71C 3JTSA 2VDML 1TQCC 3ME0A 2OZ4L 3DGGB 1VEMA 4YQXH 5T1KA 1UXSA 1H5BB 4HGMA 4HHAB 1DVFA 5A3IC 3MV8D 5F6HJ 4OI7A 3DRTB 3PIQB 3DV6B 3NIDE 1OL0A 4S1QL 1A7OL 3LB6D 2MCG1 1WWCA 3PJSA 4D0CB 3LEVH 3VDBA 5DJ8B 4PRHA 4R4FL 1SQ2N 3DVFA 3U48A 4DCQB 3THML 5FGCB 4Z77A 2BNRE 2PTTA 3MLPA 1OSZA 3RKPA 3V7MA 2NPLX 4LQFL 1ZTXH 1AP2B 4KK8C 3FAWA 4JN2B 3S88L 3VFRB 3RNKB 3PWLA 1G6RL 5EUKB 4NQCA 1SBSL 3LKRA 4LCUA 3QEUB 5DFWH 5DJ2A 3CDGA 3OZ9L 3U9PH 3Q1SH 4EDWH 4L8SB 3VXMD 4FNLL 4R97B 1YN7A 4HS6A 3QCVH 3CH1A 4NQDD 4LKXA 4OD1L 4NZJA 3DTXB 1EPFA 4OQTH 3L3JB 4ODVL 5C0BE 3IU4H 4HC1A 2CDFA 3CFJA 3MZTA 4F9PA 4QXGL 4P3CL 3DNKA 2W0PA 3VWKC 4PJBE 3D85B 1OGAA 3ZE2F 1K2DB 5CJ8A 2V5RA 4TVPL 3WD5H 5JW4M 2Y5EA 4K8RL 1FDLH 4NQED 2BCKA 2YA0A 1GAFH 1KB5B 2BOBA 2IAND 3OAYH 1PLGH 2LE9A 3GBMH 4RMSA 1FVEB 4PJAB 1MRDH 2YKLL 3P73A 3MRLB 4DGYH 3ARTA 4OM1L 1WLHA 4V1DB 2CDGB 1RUPH 1UENA 1DUZB 2ZUTA 3CVIH 2DICA 2Z93B 4YO0B 5GGVY 5C08E 3FFDA 1XF2B 3GSVA 1MY5A 2QHRH 4MB4A 1Y18B 3MRKA 3GSOB 2EIDA 3R1GH 1NLDH 2IBBA 1J8KA 1N26A 5F7DB 1JGVH 2HFGL 4JRXA 5TQ0L 4PJDA 3O3AB 2JB6A 5J89A 1V7NL 4M6NL 3E8UL 5ECJE 4MA3B 3O4LB 2XN9D 2AQ1A 1JHTB 5JIHA 2X05A 1I3RA 3VFVA 1B4JL 4PV9A 3P9LB 5CJOH 15C8L 1JHLL 2C4FT 5B39B 3GMOB 2YBRB 4MD5B 5EWIL 2J8UA 5FEBA 5IB1A 5ID1A 2C3HA 1X4XA 4MNQD 3ZKMC 1CL7H 2B1HL 1U3HC 3GBNL 4JFXA 2IPKB 2GITB 3RVVD 3DVNB 4NQSB 5DVKA 2XZAL 3MV7D 3VD5A 3OB0H 4JY5H 2EDEA 2R1XA 3RTQC 4GW4B 1UCBH 3SGKC 1XFPA 2VXVL 4ZTPH 1VFAA 1FZKA 4QXGH 4LSQH 1A7NH 3FQNA 3F6LA 2AEPL 5IOPB 4RX4D 4P2OB 4E41E 4YXHL 1RZ8B 1CXKA 2HN7B 3QIBB 1J7VR 4H1LH 2YPVH 5FA4A 5C0GB 2VYRE 4R9HA 1BGXH 1V3MA 4ZFZB 2D03L 4YFEA 4XVSH 3C5SA 3M1BB 4U1GC 5GS0L 3KJ6L 4OLZL 1I8MA 2QJDA 4W6WB 5FYLE 2IPKA 5D1ZC 2XQBL 4JHAL 4JDTH 3TJHD 5FYJL 4NHUA 2JJUA 2BNRD 2GJZB 4HSQA 1HSBB 1EHLH 1Y18A 2CSPA 5I1GL 1ZHBA 1K4CB 4LHJB 3MUGB 1LILA 4RISL 3QUXA 2Q3ZA 3QUYB 4XNZB 1YMMB 1OSZB 1QFPA 4P9HL 2GCYB 2CRIA 3EDDA 3DYPA 3VI3E 1I3RB 3VFVB 1R5WA 4OFYA 4KJYB 3TNMB 5D70H 1OB1B 3SGDI 2XI9A 3I6KA 3EOBA 3WBDA 1ZWIB 2H2SC 3F62A 2CO7B 5KSAA 5KN5B 3SDYH 2HMID 1EEZA 3P9MB 1DSFH 2XKUA 2ZSWA 3QAZC 3ZDZE 4OJFL 2CRZA 4KKLD 3ULVF 2B2XL 4GS7B 5MEPB 2P44B 1ZHLB 4QRTB 3U46B 2I07A 2AV1A 3MV8A 3RTQA 5JOPE 5D1XD 3RAJL 4XH2B 2DWDB 3GJFA 5EOTB 1DN0B 5T1KD 3UJIH 1JHTA 2Q20A 5H94A 2JJTA 4U33A 1RMFL 3RZCB 1JF1A 1ZA3B 5DUPL 2YOCA 4L8SC 1XF3B 1S7TB 2BVPB 3Q6FB 1G9NL 3ZDYF 5KVEL 5I1JL 2AXFA 2NMSA 1G7QB 1LDPH 3PP3H 1LK3L 4EBQH 2ARJQ 5DEZA 4DEPC 1OPGH 1KJ2A 3U4BL 3QI9A 2CIIA 3MV7A 4Z7VA 4ZPVA 5BQ7A 1QBLH 1E28A 2VUOA 4K8RD 1RUQH 1RULL 4L3CB 4X7TB 2R1WB 3C60B 1OHQA 1MCOH 5SX5K 4U7MA 3SDXE 4X7CC 4S2SA 1AO7B 2LAGB 4U1NB 3QCUL 5HVWA 5EU5A 4NQXB 3C9NA 3ALPA 3B2UD 3QP3A 4Y8DC 1S7QB 4LVHC 2FEDC 1FBIH 1ZLWH 1GPOH 4QRRB 1I8KB 3UO1L 1NMBL 3GMRA 2W9DL 2RCSL 2A77H 3WFHB 5F7MC 1KJ3H 1HWGB 3JWDH 2VLME 1HINL 1UYWL 4AZ8A 2X1XR 5DMGD 1NCNA 3TV3H 5ICZB 4UQ2A 3EYVB 2V7HA 2FZ3B 3KPQB 3GSNH 4GRLD 4QXUH 3GEWB 3C6LA 3NFPA 5SV3A 4JHWL 4LQ1A 3VH8B 1FLRL 3KS0H 5IP4A 3GIZL 1E4KC 1TQBB 4ZUVB 5A43C 4X7TA 3GSXB 1S5IL 2NY5H 3O6ML 2EDXA 2UWEA 1ETZB 3MJ7B 3T0DA 3DGGA 2JJVA 3B6SB 1ZHBB 5SV4A 1QKZH 4N0CD 4PJBB 4PRAA 4J3UA 3DURB 2BY1A 5GGVH 1QFHA 3L5WB 4GW1B 4M62H 5JR1L 2PTTB 5F96L 3O3DA 4M7LL 3BAEH 4H8WL 4I2XE 4TSAL 2Q8AH 3P9WB 4P9MH 3PGDA 4Y4KB 3O4LE 3UTTB 3PJSB 3QQ4B 2BSSA 3FHAA 4KJYA 4K7PH 2IWGA 3KPLB 3B43A 5IHLB 4XXDB 3VXNA 3LZFL 3QFJE 3DX7A 4LVHB 1NEUA 2NY7H 4JN1L 1FSKC 5EU6B 4JZOA 3OAZH 4FQIL 1UKTA 4JFED 1DEDA 5D5MB 1TVBB 3IJYA 3DHJA 1BQLL 2BVOA 1M4KA 2ICCA 3HMXA 3RDTD 2XA3A 2HT3C 1ULVA 1RVFH 1RAMA 1BVKA 3L3KB 2BNQA 3EJZC 3SDAC 4FG6C 4P5TB 1SMAA 2X9YA 2ADGB 1AO7A 2NW3A 4EOWH 5C09A 4Y2DB 4YHKL 1C12A 4EEEA 1P4LA 5B4MC 2MPAL 5CLTA 1ORQA 1T1WA 3OKOB 2UUDH 2DKMA 4JANA 2D7QA 4YDJB 3BKMH 4LPTA 5IB3B 1KCVL 5I17A 1LEIA 1M1SA 1X5KA 3N1PC 4JR9H 3ULUF 1MHHA 1OCWL 3QWQB 4J4PC 5JHDE 4D8PA 5C08B 4FQQA 1A6ZB 4D0CA 4M43H 2ORBL 2YWZA 4N0FB 3RWEA 4Y1AB 3WE6B 1VSCA 4NFCA 3VMNA 4Q9QH 4TTGA 1NBVL 1FNFA 1V8HA 2R8SH 2AV1B 3MV8B 5CJ5A 4FFVD 5JPNA 4QOKB 4ZUWB 4ELKB 3QB7C 3TBWB 4LSRL 4XWGH 1I9IL 2NY3C 1T1ZB 1R24A 4PP2B 3VMOA 5DRNB 1PZ5A 2FEEL 3KYKH 3OKDA 3TH4T 3L3IB 1KTKE 3LEYH 1CDUA 3NFNA 1DLFH 2MFNA 3MOAH 1K3IA 1LWRA 4PV9B 3OZ9H 2ZUWA 1I9JH 5ENWA 4KUZL 2HKFH 5IR1B 4JKLA 2XV6B 2GITA 3O2VH 2E7HA 1MCIA 1MWAB 2OP4L 3B9EA 1CF8H 5FV2A 1RZ7H 4NZUH 1QPPA 4IRSA 3DURA 1GZPB 3LCYA 3QXDA 2O5YL 5DURB 2P5EE 5IV2B 4ISVB 4IJ3C 3BDYL 1T0NB 4U1JA 1T1ZA 1J9CT 4NC0B 1KJ2L 5C09B 3UJTL 4DVBB 3LB6C 2CGRL 3WEXA 4U0RC 3KXFE 1FFRA 1EXUA 4LCUB 4Y5YC 1JFQL 3GKWH 1K8IB 3CVIL 1YMME 3VFUA 3T3ME 4ZUSA 5SWZD 3TO4D 4OIBA 4WI3A 5CEXA 2VLRE 5CD5C 2LVCA 1KTLB 3IETA 3RIFF 1PJ9A 5C08A 1T66D 1U3JA 3D39E 3HCVB 3WJLA 4KROD 1Z9LA 4F3FB 1FNHA 4YBLB 3EFDL 1L6ZA 1XR9B 4HKBA 5IEHB 4QRRD 5E5UB 1G9MC 3BO8A 3HTLX 4JVPA 1WBYB 4M00A 4ODTL 3FO2B 4H0GA 1KIPB 4OCWH 4BQ6A 3VJ6B 1LO0H 4IRJA 2WIMA 1G7LA 5EWIH 2KKQA 5H37G 3JTTA 4YDVA 4QT5B 3EO0B 4MWFB 4QHNB 4AIXA 2FECL 2F8OA 1DBAH 1XGQA 2AVGA 3QWRA 5LQBH 4Z7NE 1IT9L 4POZC 3L3KA 4NNPL 4OKVB 1DUZA 3JTSB 1MRCL 4IMKC 4Z7OE 1S9YA 4KHTL 4APQB 2DIBA 3MO1A 4FZEL 3X3GH 3BPLC 2E6PA 4LPVA 4IM8A 1VPOL 4QY8B 3AC0A 1KCLA 1XGRB 5MENA 4ESKA 1QEWA 2XA8H 1T7WA 2AI0L 4LK4A 3RX5A 4GRLB 4AIZA 5JOPD 5D6DA 1AD9A 3SPVA 3I50L 5FYKD 1JMXA 1F4WL 4IHOA 1A4JB 4NRZA 1WBYA 5EU6D 4L4TD 1FYTA 3O8XC 3FT3A 1HILB 1OGTA 1MWAL 2O5XH 3I9GH 1FH5L 3D39D 5D2LF 3KLHC 2I9TA 4E0RB 4S1DD 3RY5A 2NR6C 1PVHA 3BT2L 4L8BB 5BS0B 4IMLA 3QSKB 2AJXH 2N1KA 2X4OB 4FQCH 1P7KB 1YEKH 4XCFH 5C0AA 2OZ4H 2H45A 1NUDA 2M8XA 1TITA 4MXVF 4YQXL 1FL5A 3BDBA 3L5IA 3B3IB 5C0ND 3IDMA 2Q76B 1BZQK 5IG7A 2EE9A 1NGXB 4FQHB 3NZHL 1CWVA 3Q2CA 1NAMB 5ITBL 3H3PL 3SE8L 1ZEAH 1SBBA 4QOKE 4QRQA 5CILH 1V05A 3GI8L 2VDLH 4W4NA 4WVRA 1DBKL 2DBJA 5DA4A 5DJ8A 3CAFA 4OZFA 5IQ9B 3L5XH 5DHYA 5F7FA 2B7DT 2BSTB 1JYVA 1D5MA 1KCKA 3SGJA 3MLXH 1AXTL 4LLUB 3LRGA 2NYYD 3OHXB 3ARBC 1JYWA 4PV8A 5GRVL 4Y5XB 3MNZA 1E6JH 3F7RA 3QEQE 3QJFB 5I2IB 1T2QH 2V2XA 1NCDL 4LF3A 3K8MA 1JPSH 5D7LA 1IGTB 4AY0A 4WEBH 1CFNA 1DZBA 3MLRL 4XVJH 1NFDF 3K4DA 1VERA 1K3ZA 1WF5A 4JM2F 5DVLA 4X9GA 3FB7B 4DAGH 3BKJL 1ITCA 3GIVB 3ZTNH 4PJXB 3BKYL 5A2LH 3MV7B 2VXUL 3SDDA 2ED8A 3WNLA 2J2ZA 2LU7A 1AGCA 1IKNC 2OLDA 1S3KH 3J8F7 4I9WE 5T33H 4F3FA 4ETQA 3IDNA 1IGJA 2Y4SA 2VXQL 5J12B 1HSAA 3NACH 1GGCH 4ZS6C 5FIEA 4G6JH 2CK0L 3HMWL 5IESH 4HUVA 5DZOA 4M1GH 2QSTA 1M7XA 1J0KA 3CSYB 4BZ1H 1J88A 2Y36L 4MD0B 3RVWD 4W70A 3VXUA 1Q0YH 5JW3H 3QDME 1BECA 4F37K 3B3IA 3L3HB 1DN2A 1V7MH 3KPSB 2AS5M 5JPMB 1IM3B 4TUJB 4YIQB 4BSWB 3KPOA 1IBGL 3D69B 5B3JF 1IC4L 3C2AH 4QRPA 4PRNB 5DS8A 2CKBB 2DLHA 2FX7L 2H2PD 3E6HB 1WQVT 5DHVB 4NZRH 4Y88A 2I9TB 4XCNA 1T04B 1GHFL 3BRDA 3QUMA 1G1CA 2CJUL 4PJ5E 1JGEB 1OARH 1DFBL 5TF0A 2EDHA 3ZSTA 1OW0A 4P23A 3QH3A 2X6MA 1IAIM 5FA3B 4R96B 1NGYA 1C7SA 2HJFA 3SOBH 1INQA 2D0FA 4O2CB 5M95B 2NY4D 3BPCA 3CX5J 4UNTA 1R5IA 5F9OL 3VGBA 2J7LA 3V7AG 1N59B 2XTJE 1HXMA 4WWKA 1IGYB 4H26A 2XT1B 1MEXL 4JJ5B 3TVMA 4P2YA 1YEHL 2BSRA 1UZ6E 1J11A 3K3QA 4S1QH 3PGCA 4P5MB 5CIPA 4MQ7B 4XNXH 4QOKA 3FFCE 4CU7A 3O9WD 3X13A 1JPFB 5FO8A 4WFHE 3F7PC 1N8ZA 4EI6B 5F7NC 5HYJE 3FMGH 1SYVA 2F53D 1BWMA 5KVDL 1T7ZA 1YNLH 3DMMA 3MGTA 5FGBA 1MREL 2FSEA 4JO4H 5GS0C 4G6JL 4UNUA 3ZTJH 2VDQL 3NCEB 4WGWB 2JCCF 3VGDA 4ZNCD 3GSRB 3PGDB 4Y4KA 1QHPA 1BPVA 1FORL 2EDQA 2YD5A 1P4IL 1XF5B 3SKMB 3N1FC 1EFXB 1MI5E 3Q6GL 1K8DB 3LOWA 5HDQH 3D85D 1CGSH 4KRMB 1I8IA 3S8WA 3NCMA 2VDNL 2X7LA 1YEFH 2J4WL 4I4WB 4JFDA 3KYKL 2UYLA 5I1DB 3N9GL 2Z4QB 3DRQA 1EV2E 3REWA 3BVNA 4U3HA 3LKQA 2NCMA 1YMHA 4RNRA 3QO0B 3OAZK 2EDOA 1CZ8L 4FMFA 1EH9A 1TJIH 2EE2A 4UTBH 2R2HA 5C9KA 3OGCB 4ZD3L 2HKFL 4BSVB 3MRPB 1FVCA 1GC1L 1NCBL 2NX5B 4X6CF 3GJFB 5EOTA 4LASH 4CVUA 1TQCB 1FZOB 1NUGA 4NO2B 1J5OL 4XXCC 4WO4A 4NQEB 1CK0H 4NC1E 2R2CA 2VB5A 1UM5L 3N50A 1HEZB 1BBJB 3E3QC 4HX1A 1MJ8H 3LPWA 1T4KB 1GOHA 3PGFL 3QHFL 3O2DA 3EYSH 1KENH 2Z31C 3NFPB 1ZAGA 3W0WE 3MLWH 3LS4L 3VGGA 4CNIA 3RX8A 2FO4B 2ZCLH 1LHZA 5EU4A 1IGYA 4JB9H 1MSPA 2VITB 3BDYH 1U8KB 4XX1G 5JTWA 5K9OB 3WNOA 5JZ7C 4XPGL 3MFFB 2XWJB 1DDHB 4OZGF 1DBBL 3CFBB 2XZAH 3D69A 4CJ0A 1TCRB 5BOPA 1NMBH 5F1OB 2AK1H 1ORSA 4NN5C 3X13B 3R4DA 2ADIB 5ISZE 2XKNA 3FN3A 4TPRL 1FNEA 5ABDE 4IMLB 2DYPB 5LXGL 1KLFA 3VFTA 3IRPX 2AJZA 4R97C 2GEEA 4ZODA 3U83A 1T89C 2ZPKL 3P9MA 5ID1B 4FFZL 1HXMB 1I8IB 4RGNE 5HI3C 3RY6A 3GKZA 5DJAB 4JFZH 4CMMB 4HGWA 1BVLA 3EO1A 1UACH 3VGHA 4KXZH 4P5KA 5KAQG 4DK3A 2FR4B 4EKXA 4K2UH 3WIHL 1IL1A 5F89A 2XZCH 4WJ5A 4KKLC 1GVIA 3RVXC 4DQOL 1G7IB 2VSCA 3KS0J 2QKIA 1JNLL 5IB4B 1JN6B 1YEJL 5EZIH 5DUMH 3IDJA 4LMQI 5FDWA 3UYRL 3ARDB 3U9UB 1PBYA 1BFTA 3AREA 2O61B 4Y5VA 4IOIB 1MCWW 1Z9SA 5T3ZD 1ND0A 2R15A 4KK9C 1P53A 4OZFG 5DLMH 3QT2A 2N4IA 2APWA 1N8ZB 2DIJA 1TENA 2VQ1A 5AUMB 3WS6A 4PB0H 1LD9A 2W0LA 4MJ5B 4WWID 3SDAB 4DFHA 4WWKD 3SN6N 1KPVB 2R0ZH 5D1ZD 3R0MA 5IBLC 1R6VA 1FPTH 1Q9WA 1PQZA 3QIUB 2XWTA 5FGSA 4P2OA 3BPOC 3FQTA 1CBVH 1MIML 4WDIB 4R3SB 3SOBL 3I9GL 5LWYL 1EMTL 1IAOB 2G2RB 5JLZA 3BP6B 4MDIB 3S4SA 4ZFFB 5JQ6H 4J4PA 5FB8A 1IAKB 2EXWC 3GSVB 3SBWC 2VLKA 3HB3C 4PJDE 4OKDA 5DJ2B 4CKVX 5E9DB 1QYGL 5BRZD 4JRXE 2G9HB 2ADIA 3KWWB 1CICD 2PTVA 5D96C 4KQ3H 5J1AA 2BJML 1HQRA 3GSWB 5LBSL 5MEOA 3TBTA 4JQVA 1HHJB 4ZFZA 4MJIB 1A6ZA 5JQHC 1ZEAL 4XBPA 1VESA 4FQ1H 1KFAH 1BVLB 3EO1B 4PJ7F 3D3VE 1RUQL 1GZPA 3O4OB 3U30B 1CXEA 4HJ0D 1YNLL 1F90L 3U4AA 2OL3A 1JZ4A 3TPUB 2HJKA 3C08H 2VDMH 5ITFB 1AJ7H 2H3NA 4GQ9H 4K23L 3WXWH 3VXUB 3PG2A 2XKNB 1LEKA 3PL6C 1YJDL 3ARSA 3KPRE 3KPLA 4XCYB 2ARWA 5ETUB 2JJSA 4WHYG 1HCVA 4M48H 1O5DT 1DQLL 3R06B 5ANME 1R3KB 1X5AA 2VZ3A 4DWHA 2D0GA 4P57A 4XVJL 4FRWA 1F3DH 5C7XL 3E1F1 3IJYB 3HMXH 3F7VB 2Y07H 4R90L 4NQCE 2NY0B 4CMHB 4HUNB 5DUBB 1NH6A 5E8PA 5TGBA 2NY4B 4OGYH 1XGYH 1YUHA 4UQ3B 3GRWA 1JTTA 1HCFX 3BH9B 3MFFA 2PW1A 1X4ZA 4W81A 3FJTA 3EDFA 4P4KA 3SKOB 3Q1SL 2V2TA 3L5HA 5TDOA 3WFHA 3GRWH 3HUJE 1S7VA 3JVGC 4OKVA 2P24B 3V0WL 4X4XB 1Y0LB 4BFBD 1A7NL 3UP1A 2NQCA 3VFUB 5CEZH 2Y36H 1IJ9A 2EDWA 5GGRB 3MC0A 2F58H 5E56A 1JWUB 1MRFH 5J13C 3HRZA 2PO6C 4F7TA 1IKFH 1NLBL 2X1QA 1CFQB 1J05B 1T1YA 1NSNL 1FNGB 3FT2A 3TBVB 1PLGL 1K9TA 1GH7A 2ZOLA 4PJEB 2FBJH 1DEEB 4UIKL 4YWGL 3I2CL 3BYYA 1F6AB 3IFLL 4X9IA 3VCLA 2G2RA 5JLZB 5IVXF 4G6AC 1ADQH 5ESAB 4TTDC 2WWMC 1REIA 3LS4H 3ESUF 5AZ2H 1WBZB 3QDMD 1G7HA 3FQXB 4FOMA 3QIWC 3LIZH 5JW5A 3SJVE 3U0WH 3QUZC 4NKOA 3P77B 4ELMF 1IVLA 1FYTD 5D1QB 4MX7B 3BH8A 5MEQA 1QLEL 2A6KA 4KJWD 4U31A 2Y25A 3ARDC 1XR9A 4H26B 3ZE1F 1NBZB 3IKCB 3KLHD 4CVZB 1OAUL 4L29B 1R3KA 1BZ9B 2J8OA 3UBXB 4XTRD 5E94B 5BV7H 2WQRA 1W0WA 3DX9B 3IFNL 4OD2A 1UWEL 3OB8A 3HE6B 2UWEB 4S1RH 5D5MF 3TH3T 3ZMRA 4N5EC 5EPMB 1R0AL 2NY6D 4Z8FH 5D72L 3GBNH 4J3WA 3I3DA 4G42B 4MVBC 1KCSH 1XF3A 4M3JA 1TZGH 1AKJD 3DWTA 4ZSOA 1BX2B 1A1MA 3QIUC 1G0DA 3PHQB 4PUBL 5DI8B 4F7CA 3UJIL 3PQYD 3AS3A 1D5BB 1OWWA 2I26N 3UPCA 1SM3H 4LRNL 4RGMC 2WQ8A 1KTLA 1LNUA 4POZD 1FNAA 2OR9L 3UX9B 2MHAA 4PJ8A 2X42A 4XRCB 1PGRB 1AQKL 5DO2D 4ZXBC 4HG4J 2F53E 3C9NB 4GW4A 4HFUH 2FB4L 4YBHA 5ICXB 1Q0XH 4L1DA 1Q9KB 1RD6A 2W38A 3DV4A 4HJ0C 5E5RB 4J2XA 1BQHB 5HYJA 2OQJB 2R39A 4G9FE 2R9HC 3MBEB 3S37H 1J0JA 2AGJL 4PY8I 4LSTH 1MJ7H 1OP9A 4OZIA 5F96H 5L7XH 5FA4B 5K9OA 5HGGS 2NY5C 1A5FL 4H8WH 3L3IA 2FD6L 3X14B 4NKIL 3BN3B 3X12A 4D9QD 3MRDA 4GXVL 1RI8A 5EFIA 1GPOL 2CGRH 3RWFB 3GMNB 1RU9L 3DTXA 4PR5A 1EHAA 1HH6A 1QLRA 4N8VB 1MQKL 1T22A 4JKPH 5J11C 1AFVL 1BQLH 2VMFA 5F9WB 4BZ2H 1UM6L 5F7WC 5KW9L 2HVJA 2ZJSH 5BVPH 1TPXB 4BELD 1T3FB 4JPIA 4URTB 4YE4L 1QRNA 1IZKA 3T4YA 2R1YB 4OZIE 4LAQL 3BE1H 5LGHH 2QKIB 3MRJB 1YC7A 5IR1A 3N85L 1EK3A 3WHXA 4MJ5A 1H3WM 4R7NA 5HYFA 5J9PA 3DO7A 4HKJA 1NFIA 2VXQH 4QRPE 4JO1L 3UCRA 4OM0L 4MLIA 1KN4L 2DQFB 2VITA 5IVXE 3SE3C 3QQ3A 3ZE0E 3UBXA 3DECA 1MJJB 1WTLA 3VDAA 2HFEB 1OPGL 4NO3B 3D39B 1AQDB 2BVQA 3RVXD 4XBEH 4ZNEA 3JV4B 2DYPA 3G9VA 2YPKA 4ELMA 1AGBB 1JZ7A 3WIFB 4LEOA 1ZLUH 1A1MB 5FHAL 5DJYB 2DF3A 3UDWA 1EGJL 3LEXA 1TZIB 3OXSA 4QHMB 3FB5A 4Q74A 4GKSA 3MQIA 4Y0GA 4MHHI 3D5OF 3ARGB 1TTFA 5I1IH 1UACL 3SJVB 1AE6H 1NBQA 4G80A 2J5LC 5AYQA 2EDRA 4L3CA 4BKLB 3VFGL 4HH8A 5GJSL 3HE6A 4MJIE 2FSEB 2IPTL 4RA0C 2AJSL 3NCJH 4P4KD 2FECI 4IJ3B 2RCSH 4L29A 1HHGB 1FCGA 2QTEA 1U95B 3O2VL 2L7UA 5ISZA 3T0EA 1OQOA 2OP4H 2NW2A 7FABL 5I1AA 5CEYA 2DWEB 2DLEA 1A3LL 3B83A 3VG0H 2ESVE 2AJ3A 4Y5YB 5HHOA 1WTGT 4XVUD 1L7IH 3BZ4A 4FFYL 4XWOD 1A14H 4MJ6A 3T4AB 3VWJC 4X6DA 3A67L 3F7QA 1G7PB 1V7NH 3NZ8B 4M6NH 4PTUA 5IJVB 2XRAL 2HT3D 1J1PH 1YJDC 3MRGA 1XZ0A 4PB0L 4HV8A 1KCRH 4MXWL 5GS2H 3CZFA 4YBLC 4QT5A 2QADC 1MI5A 4MXQC 4ODWB 4HK0A 2R29L 4PG9B 5E8OA 4HKXA 1U58B 3FL7A 5HGBA 4GMTL 4QLRA 1T6VN 1NCAH 3AU1B 1U8MB 4GAYB 2EZ0D 3IFOA 3QUYA 4L4TB 2PETA 1MIEH 5D7IB 3C6LD 4F15C 4NHCH 4N0CC 1QPXA 5FGCE 1P6FA 4O58H 1NCWH 2V7NB 4KZEL 1OAKL 2WIIB 4H20L 1UCBL 3D2UA 4JPVH 4JRYB 4ZTPL 2ATPA 4JAMA 4X6EA 2BY2A 3K74B 1OLZA 3JV5A 2H8PB 5CAYB 1QRNE 4Y16D 1CICA 3GSNL 5DJYA 5E8DL 5BRZA 1JF6A 3BO8B 1SJHA 2P8MB 3ILPA 4V1DE 1TZGL 4WU7A 5IBTL 4C58B 2G5RA 2Y7QA 1PFCA 2IMNA 2VR5A 3MA7A 3TN0C 4DGVH 3NCYS 3GHBL 4YHLL 1Y6MR 4YXLL 2R4SH 4PLNC 4JJHA 3EO0A 4MZ3A 1WWBX 4QHNA 4R26L 5DJ0A 4L8CA 1H8NA 3RVUC 2QADB 4HWNA 3MRIB 4R0LC 5DDHB 5DZNA 4R90H 2EIEA 4G8GD 3FO2A 4ODUA 5E2UH 1JYXA 1CD0A 1TTGA 2DQDL 1T1YB 3GIVA 2DWEA 2ORBH 2VLKB 4GXUN 2I5YL 2MNUA 3QG7L 4NOBA 3RHWF 2WBWB 4P57B 4JN2A 2ZUXA 4POUB 4MA7L 1I9RH 3MTRA 4KRPB 1IGTA 1U3YA 1XGPB 4XWGL 3VXSB 1LO0L 3FOLB 3N1QC 2NX5D 3M45A 1T03L 4HULB 4YFDB 1E4KA 2Y72A 1DSFL 1MAML 2GUOB 2FH8A 4RWYH 4NCC2 5FYLH 3QNXA 2UZIL 3EDKA 1MRFL 5DRZB 4G6KL 2CMRL 2YPKB 3QUXB 4ODUB 4HBCL 4ETQB 3OMZA 5IHZA 1A6VH 4BH7B 3IU4L 5EIIB 4GG6B 3GSOA 4PJIE 5LXGH 4DUVA 5DA0B 5C07E 5I17B 3MJ9A 1MUJB 1I9EA 4FTVB 4K3GA 4NRYA 2V17L 4DOHB 3CXHJ 5DT1H 2ZUVA 5I8KL 3VFWA 4MA1C 4H1LG 1BREA 2NW3B 4FQLL 5LVEA 3TYGH 2NTFB 5F88B 1AIFB 1AXIB 2H2PC 4M5ZL 1LEGB 5KSVA 2ZWLT 4OZGA 3V6FB 4YHIB 2QADD 4EUPB 1OOAA 3MOBH 3HZVB 1WVZA 3MA9H 4PJ8B 2XY2A 5L9DH 4Z78B 4L4VA 4Y5XA 4Z6AT 1AR1D 2IFFL 3FAXA 5T5FL 3HHRB 3R1GL 5KANI 1GZQA 5MERA 1N0XL 2C1PB 2P5WA 2PXYB 1NAKH 4E41B 5ELIA 5DSCB 1QSVA 4JQIH 4TSCL 4JO3L 4ZPTA 2IADB 2AP2A 5HYJB 1I9JL 3MV9B 4P4RA 1YPZB 3JWDL 5J1SC 1ZT7B 4IIQB 3DBXA 4HQQH 1LO5A 1WFOA 4XI5C 5JOEA 1A8JH 3CCHB 5H35A 4OTXL 2D03H 1X5IA 4IS6B 3QHZH 4PLKD 5E2TL 5E7BA 5FF6A 3FQWB 5KAQF 2PN5A 4L8CB 3RA7H 5DJXB 3LKSB 3EJYD 2BHZA 4N1EA 5DC9B 3OL2A 3ZYJA 3DXAB 1HQ4A 4NJ9H 3QXVA 1YNKH 4XNZC 3K4ZA 3PDDA 1A3RL 2XWTB 3CX2A 1ZA6B 2ESVB 4MNQA 1KJ2H 5I1CL 1AXSA 4JFQB 5GGSB 4DN3H 1QSFE 2A73A 2HYMA 1SJEB 4LPUA 5MP6H 1I7RB 4NKOB 4N9GA 2GYSA 2VE6B 1AGDB 3D6GA 2DJ4A 5E00B 5CMAB 5HGDB 3KPMA 3UPRB 4LARL 1IGIL 1TJHH 2GY7B 2CIIB 1OAZH 4MJ2A 4NPYA 2ICEA 4WGVB 1J0YA 2FATH 3RJDA 4G6AD 5F3HB 3QEHB 1VFUA 1HIML 3CDGB 3OKKB 4Y4KD 2YUWA 3PL6B 4LHUD 5GS0H 1RU9H 3CVHA 4IIQC 4K8RC 2EH7H 3MRIA 2DM3A 1KG0B 4PRPB 4GW5A 1OGTB 5E24E 4Y8AA 2F54E 3T3MF 2QR0A 4XZUA 4GRWE 2A74A 5T1KB 2ZUQB 4NQEA 1BFOA 3BP5A 4OCSH 3HZKA 4BYHA 2P1YA 2DQJH 3FFCB 5EZOL 1ONQB 3EO9H 5EBGA 3C60C 3SGKA 4OQTL 4UAOC 5KN5A 5CJXC 4LLYB 4P9HH 5C7XH 3VXSD 2NY4C 4ENEC 1AGEB 1JPGA 4WUUD 3LQMA 3SGEH 3HRZB 1XEDA 5KVFL 4FZ8L 4Z76A 5FUOL 5I8EA 3RTQB 3K8LA 3TVMD 3BVNB 3I50H 2EDYA 2X70B 1WBXA 4P49A 2GJJA 3CFKA 5IMMA 3PWUA 4PJ9A 5HHXL 1CL7L 3F58L 4N0UB 4DGVL 2LU3A 3BE1L 4PTUB 2AAVA 1EVTC 4G6FB 1OAXL 4GKZB 1MJUL 3MZGB 4C56B 1MLBA 3RVTC 1CR9L 4Y4FD 4HF5L 3T3PE 2ARJB 1MH5A 2M1KA 2BVUA 2VC2L 1XGRA 5K9QI 5MENB 1BF8A 3CMOL 3O6FA 4H1LB 5DVOA 5I16B 3MCKB 4HK0B 1JHKH 1UA6H 2HFGH 1UYWH 2VABA 3G6JA 4Z7WB 4LARH 4LCCA 2OR7A 3CFEB 3PXHA 4YXHH 1XH3A 3BPNB 5K9JL 1AQDA 2BVQB 1BLNA 4KK8D 4Y16B 5FCSH 4OIAA 5GISL 5KTEH 3WJJC 3P0VL 2A0LC 1YY8A 5FUZL 5EU6E 2YRZA 2ZCKH 2QBWA 4LLMB 4FABH 3MV9A 5GGSA 2CK0H 3RX7A 1G0YR 1MAMH 3L3GA 3U36B 1KIRB 2YK1L 3DMMB 5D93B 2P42B 2ID5A 1WITA 2AXGA 3LKSA 5I1EH 2AKRA 4NT6B 3BSZH 4U1LB 4I4WA 1UM5H 3CC5A 4NQTA 4UV4H 4YUEL 2IBGA 4LL9A 2CLRA 4HLZH 1CGSL 4KJWC 4KTDL 4JFEB 3ZT6A 4NN5B 1FFQA 4KY1H 4Y2DC 4CGTA 5ICXA 1F2QA 3NA9L 1S7SA 3UJJH 3QUZD 3NFSL 4OZGE 1G6RH 3VXMB 2JB5H 3FHQA 3O11A 4OQ1A 2X4QB 4Z8FL 4X6CA 3CXDL 1B0GA 3SKNB 5FO9A 3FQRB 2QQKL 3VG9C 3F8UB 1QSFB 4FTVE 3BP7A 2VDRL 4TTDD 1KB5H 1D3CA 3G9AB 4LDEB 5KS9F 5C07B 3QCVL 1MFNA 1MVUA 2R0WH 3NACL 5GRYA 5EIQA 1VACB 4XC1H 2NY0C 3ZDXE 2DQGH 5B3NA 3W9EA 4L5FL 1JV5B 4RQQA 1RFDH 2V6HA 2GUOA 2OXGA 1CXFA 3CK0L 1PKOA 4BJLA 1FFNA 1D6VH 1T83C 1TZHB 3BW9A 4FMKA 1LP9F 4DK6A 5B38B 1KYOK 1VGEL 4RMUA 3FOLA 1J87A 1IM3A 1OSPL 5IGXL 1UB5B 3VXRD 1DQQA 3ROOA 3ARYA 4RFOH 1MRDL 1MREH 4CVXA 5TE4L 1YDPA 3IJSA 2OQJA 4S1SH 2ADJA 3HR5A 3PHQA 3T2NH 2E9IA 3WE6A 5AZEH 1U0QA 4PV8B 4QHKJ 4MDJA 3TFKD 3HAEB 3IGAA 3RAJH 2ZG1A 2DN7A 3BEWA 4OF0A 2MCPH 4X7SH 4OLXL 4PJCA 1JHLH 4WY7L 4L4TA 4G6MH 4JE4B 4KQ4H 5KVEH 1XF4B 4KTDH 3OJ2C 1JPST 3B5HA 4EIGB 4H1LA 3O6FB 2H1PL 1ZK9A 5E03A 4Y4HC 3QZWG 1NC2D 5GXBB 5DWUL 4U0RB 3TYFB 4TN9A 2PW1B 4IEFB 3S97C 5KVGL 4RAUA 5E2WH 2UUDK 2C5DC 1P69B 4WIQA 4RIRA 3ULUD 4X6BB 4PJHA 3GMRB 1FHGA 3INUH 4MGXA 4PJGB 4XGZB 2AQ3A 4ONFL 3MA7B 5KJRL 3G6JB 3IFPB 3FB8A 2F8XC 4U1HB 5TDPA 3ARRA 1J5OH 5D4QA 3DXAE 4YHZL 4HC1H 3H7LA 1N6VA 2HAZA 2Z91B 3HC0A 4X6FB 3O3AA 1QLEH 2NXYC 3HG1E 1JP5A 2VZSA 2EC9T 3OG6B 3KPRD 2MKLC 3ULVE 3CLFH 4OGXL 1UXSB 2AK4E 3HC4L 4JM2D 4XNYH 4X0KA 1ZT1A 4DKFH 1SMOA 1F90H 3GNML 5TH2A 3GZKA 5DMIH 1A6TB 2XKSA 4DW2H 1RV6X 1ZVHA 3VXRA 5C0RH 4FQJL 1DBJL 2JELH 5A2JH 4OAWB 1HXYA 1INDL 1QD0A 5FV1L 1TMCB 4M93C 4XP1L 3UROR 3O4LD 4QHMA 3QRFM 5HI5C 1BHGA 3VU2A 4OB5L 4JFDE 1IT9H 4F7TB 1FL6B 1QBAA 5GIRB 2VKXA 4JQVC 4RISH 4PR5B 1AR1C 3U7WH 3WDIA 1OWRM 3MBEC 1EERB 3DX6A 1JHKL 3MA9L 5L9DL 4F7MA 1KLGA 1TETL 4PP1D 4C54A 3L7FA 2OR9H 5IB2A 1GOFA 5C0FB 1CD1A 4I0PB 4X8XA 5F7LB 5I71B 4XCEA 3ARGD 1L7IL 4PJCE 3X11A 2EH8L 3MSPA 3OKMA 3VXME 3BZ4B 3FB5B 4C4KO 4X0KB 1U8NB 4ZYKB 4F2MA 4K71B 1D9KB 1O7SA 2FX7H 4BH8B 5CEZE 4NZRL 3DO7B 4PGDB 3LKQB 1HYRC 1ZGLA 3HUJB 2H6PA 1JTPA 2R0LH 4WI4A 2CKBH 4FQCL 1N6QL 2BFVH 4KZDL 4A6YL 1QFWM 1U36A 2DIAA 3QDJE 1W8NA 2W59A 1DQMH 5GHWL 5IVNA 1HILA 3FN0H 1M7IB 2R2BB 2FH6A 5E6IB 1LDPL 4EI5A 3W81A 2ZOKB 3MYJA 5DLML 3NA4A 5F7UA 5DC0A 5IBUB 1DQLH 5ITBH 1JI2A 2YD6A 4HH9A 4LFHD 1AGBA 1S5HA 5DSCA 3IS1X 3VGFA 4CVXB 3PHOB 5D1QC 3SDCA 4HJJH 5DEGA 2CXGA 4HKZB 3Q5YA 1S8DB 2GJ6A 3HE7A 1R5WB 1I85A 5IROC 5F7DA 5K9QG 4B53A 2BC4B 5DK2A 5DRNA 4HPOL 1NBVH 1XCQB 2D7TH 1P5UA 5F7EL 4YO0A 3H9SE 4K07A 3ARVA 4MAYC 3RWHA 4KK9D 3AXLB 1Q94A 1T2XA 3LQAL 1WAAF 1E6JL 1RULH 4WTZA 1I8MB 1MFBH 4LMQE 3QWOA 2APXA 1Q9KA 3U7WL 4M5YH 4LVOB 4MD0A 4Y19A 2HFFB 3HNTL 1WT5A 5DQDH 3BP6A 3OPZL 3V7AE 4M7JL 1VENA 3RDTA 2HVJB 2FX9L 4KUZH 4OQTA 3BGMB 5CSZA 1D5ZB 1Q8MA 4QHLB 2SEBA 4U49A 2C7UB 2FDBP 5HI5D 5DHVA 4R7DB 5DJAA 4WFED 2VKWA 3THMH 3SE9L 2RBLA 4XPBH 2Y9RT 1W2KT 4GOSA 5J1AB 4UZGA 4PGCA 3RWDA 2KZ1B 1FZKB 5J0BA 3WMSA 1UQSA 3VMPA 2DLFL 2BNQB 1H3PH 2YD3A 1CDGA 5JXAH 1Y6NR 4PLOB 4L9LC 5GZNC 5DR5L 1UZ8B 3LKOA 1IAMA 1T1XA 1LE5B 4ONHB 5C6TH 4JVUA 3GI9H 5IV2A 4H88H 3X11B 2R2BA 1KBGH 3RQ3A 5BMFH 3DO3A 3KHOA 1I7UA 4HFUL 4PYGA 2UWEF 1IFHL 4TSAH 3QUML 6FABL 1XR8B 4P9ML 2DS4A 4LRIC 3QA3B 2HT4C 4JPKH 2BNUA 5LCVH 4G3YL 4U1MB 3V6ZA 4PG2C 3PDOB 2CJUH 2A38A 5I18H 4NBXB 5I15L 3L3DA 3U4EB 1S7XB 1M7IA 4P48A 5D71L 4JFFB 3QXUA 1YEGH 4XVSL 3TIDA 3IXAA 5T1LB 1NC4B 3GFUA 1R24B 1IM9D 1OQXA 1D9KA 1KXTB 4HJGB 1DBAL 2VR9A 4E9LA 4YUEH 3QUZA 3VFPB 4QGYA 2EEBA 2AJUL 3AVEA 5I73C 2NZ9C 5I1AB 3GSNA 4KK6C 3PHOA 3SDCB 1G7LB 3G5VB 1X4YA 1ZLVH 4NM8H 5JW3L 1FVEA 1JGVL 5L2KA 3ZL4L 1U8NA 1G84A 2OJZL 1BBJA 3O6LL 3UZVB 4R6UA 4OGZA 5EOCL 1XIWA 2VLJA 4P2RD 5IIEB 5HD8D 4K3EL 1OCWH 4GKSB 1RUAH 5CJBA 1HN1A 4WHTB 1DBJH 1CYGA 1CFQA 4NUGL 1MCOL 4JO1H 3O8XD 2XYCA 4JO4L 3HG1B 2WLZA 3B5TA 4RZCB 3WS3B 5ILTL 4Y2DA 2R8SL 1OGAE 4PJBA 1EEYB 1IAIL 4MMXC 3QEUA 2VQUA 1YEKL 4RGNC 1D6VL 4KRPC 1QSZA 2Z31B 4WV1C 4LU5L 5L8KB 4JKPL 2J12B 3U7AA 1BJ1H 1IQWL 5I1LA 3DBXB 4PJHE 1IEBA 1QVOA 4HW6A 5KSAD 5EBMA 4EI6A 9CGTA 2BMKA 1I7TB 4JCMA 1S7RA 3PWVA 1BJ1J 1NGQL 3D9AH 5HI4D 1OAZL 3HC3L 1XF1A 2EICA 5TGBB 1JYNA 4KDWA 4PRHB 4WW2C 3TPKA 5I1IL 4TVPE 4NPYB 4NQXA 15C8H 3MMEB 1FNSL 1W0WB 3FO1A 4XGZA 2BY0A 3AY4A 5D2NA 4LKCA 1H8OA 4PRBB 3K1KC 5D71H 3OJDA 2OL3B 5I1KH 2HG5B 4OCNC 4P59L 4OSUL 5AD0A 1G1YA 4PJ9D 2DRUA 4HIEB 5DRXA 1CFVH 4APQD 4OV5A 3AFLA 3G08A 1PG7H 3TGXA 4KVCL 3SCMB 3WKML 5JHLL 5ETUA 5FDWB 1KJMB 1WCQA 4LDOB 3STZA 4O5LL 3VFSB 3W9DA 1NKOA 2BNUB 5K9KB 4P46C 1JRHI 4YPJA 4XHJC 3WN5A 3NH7L 3R0NA 4ERSH 1GIGH 4YAQB 4OUUB 4LDLB 4RGNB 4BKLA 4Q0XH 4PJEA 1JI1A 4LSTL 5HYSG 4NYLA 1HSAB 3LN4B 5L88L 1N3NA 1DL7L 1GC1C 4MAUH 3MLWL 3NCFB 3OTTA 2XOTA 1LE5A 1MAJA 3DV4B 5CJQH 3HFML 3ZKMD 3EOAA 3EIFA 1B3JA 4QCIB 4AH2B 2B2XH 4M9PA 4L3EE 1T7XA 3UBXI 1A4KA 1UB6B 4M02A 4AMKL 2A73B 3ZYOA 5D7JA 4QKXB 4HAFA 2ED7A 2AV7A 4RWHA 4R8WL 3X12B 4U1SA 2GIYA 4U1KA 1GGTA 3VXOB 1CFBA 1N5YH 4XPAL 5GJTL 4I2XB 3V8CA 1N64H 3ZE1E 1OB1A 1MRCH 4LLWB 1YY9D 3STLA 1F4WH 3NABL 3BQUB 3FO0H 1PY9A 3FQNB 5IOPA 4V2CB 1IC4H 2XWBA 3C2AL 1ZLUK 4CADB 3HMXL 5GS3A 5JHDB 4Y4FB 1T5XA 1QFUL 3TLRA 4HH9B 4G8FB 2HH0H 2BK8A 4FP8H 5IVZB 3BT2H 4H0HB 3ZZ1A 5HBBA 1QBML 4J1UB 3HNSL 1RUPL 4ISVA 1MHPH 4FQJH 4GO6B 5D96B 5E6YA 3IXTA 1YNTA 4GMTH 3ARDD 1YEJH 3NIGF 1WISA 2BRRH 2BOCB 3QUYD 4Q2ZB 4K94C 3MYZA 1TVHB 1Q9OB 3CJJA 1VHPA 4NHCL 1U9KA 3U30C 1U8PB 5EZLB 1NCWL 4HDIA 1AGFA 1FYHB 4YHOH 1T0MA 1I9RL 5B4MD 5JORA 1QFWL 5IFAL 4LLMA 3AM8C 5T3ZE 4GG6F 1HK6A 3RL2A 3ARBA 4QXUL 4HIEA 4GKNB 1JUFB 4U05A 4WTZG 2NTSP 5C0JB 4X83A 3ZDZF 3FMGL 3QIBD 3VXMA 4TNWF 4YLQT 2Q86B 4D9RE 4FXGB 5CGMA 2R4SL 1PX4A 5F9DC 4R26H 3MLUL 4J3TA 1FLTX 3MCKA 3FRPG 3WS6C 4X5LA 4BFIB 1KN2L 2EDKA 5C2BH 2WM0A 1XH3B 1BIIA 4KROC 4YHNB 4GAGH 1FIGL 3DYMA 4FS0A 5EO9B 4HS6B 1R3JA 1NFDA 1P7QD 3EO9L 5ESVA 4X9FA 1D5XB 5D2NB 5EB9A 2AJYH 3KPPB 4MNHB 3BRGC 5SWQB 1HHKB 3PHSA 5E70A 1FQ9C 4MWFA 1HKFA 5C0CA 2WWKT 3QBTB 3MJ8B 4LNRA 4PJ7B 4KGJA 4F2MB 1DVFD 3HAEG 3SCMD 4S1SL 1D6EB 4M1GL 43CAA 4XI5D 2X4RA 5DHXB 4QY8A 3QI9C 2BNRB 4PREB 1F11B 4P2QB 1YYMH 1FZOA 1MIMH 1RPQA 3BP5B 2EYSA 3QJFA 4NSKB 3VA2C 4QRTA 3U46A 4KXZI 1JWSA 3FRUB 5C0BA 3WJLC 4ZXBD 4JFFE 2R23B 3PV7A 1GC1H 5HXMA 1KCVH 4YDVB 3JUZA 3RZWA 1YZZA 1SM3L 1OGAB 1JPGB 2BSED 4M61A 4PJBF 4F57L 3GSQB 5CIPH 3C09B 3BEVA 2VAAA 2WUBL 1RZGA 2HJKB 5ITFA 2A74B 1A14L 4F8TA 3QEQB 1FV1B 1NC4A 1N5AA 1EVUA 5E08H 4N0UA 3EDEA 1DVFC 5GGQL 2FHBA 1AH1A 1D6EA 5DD0H 2Z93A 1QTYT 3LDBB 1I9IH 2NY3D 4TRPL 4N5ED 4UMGA 3SE4C 1A7PH 5IWLC 4PRHE 3C6SA 5EZLA 2DLTA 3K81A 2XN9E 4AQ1B 1FGVH 5D1QD 3BI9X 3KPNB 2EXWD 1ZT7A 2VLLA 4XTRC 4LSPH 4BFGA 3UTZB 3HE6C 4NP4L 5JUEL 3ULUE 4M6OH 4OIIH 1KC5L 4MNQB 4YGAB 4RFNC 1VKXB 1FFPB 3E8UH 2YUVA 1JE6A 3VG9B 4YHNA 4L8DB 4M6MH 4LIQL 3WNPA 5MERB 3PDGA 3ROOB 2FJFB 3H0TA 3BGMA 4U7SA 4LGSB 2HKHL 4ZFGL 3TA3B 5HSFA 5FXCH 3V6ZB 3WS3A 3WIIL 4HMCA 5FKPB 4U0QB 5TE6H 1FJ1B 3LRHA 1AXTH 4G8IB 4L9DA 3U36A 4HIHA 3RPKA 1IM9B 1IEHA 1BZ7B 5FF6B 4OCXH 3V52H 4OB5H 2COQA 1FH5H 4UUJA 3UJTH 1F11A 4P2QA 3BN9C 4OCSL 4YHMH 1ZHLA 4O00A 2I60L 1YEDB 1BF2A 3OF6A 4YC2B 4UTAH 2Z8WC 4OZHB 2A77L 4U7KA 3EOTL 5JORB 3PQYA 8FABB 3VGAC 1E4WL 2JK5B 4XCCL 4HD9A 2H9GA 3P40A 1BLNB 3L3HA 1HWHB 2YRLA 1E4XH 2OTPA 1U41A 5EBLB 1AKJA 3RY4A 4I13B 3PGCB 3S96B 2X5PA 2GFBB 3CUPA 1S5HB 4F33B 4CUCA 4JHWH 3I75B 3LEVL 1H8SA 2OJEB 3N9GH 4FQ1L 3TYGL 4LBEB 5E08L 5H37H 3SE4A 3TO2B 1H5BA 2AEWA 1Z5LB 4Y16C 3VH8G 1OAXH 4PJGA 4ZO7A 4NOFA 5GGVL 3WO4B 3LSOB 5GZND 4PJ5A 1XIWC 1J8HA 3MGAA 3X14A 5J1TC 4I3RL 4RFEA 1FGVL 2AXGB 2K1MA 4P23B 4WO4C 2G9HA 4W6XB 3O3UN 3RWFA 5HHMD 4KK6D 1YY9C 4NWTL 1ZVYA 3VD3A 3OR6A 1R3LB 2ZUSA 4BUHA 1DCLA 3RL1B 4HMEA 4NNXA 1CIDA 5HYSA 1ND0B 1QLFB 3G5YB 4D9LH 4WNQA 5IROA 4FG6D 1GZQB 3P0VH 3QDMA 2RFXB 2NY2D 4KQ3L 5HPMA 1U8HB 2OS7A 5LJYH 2VH5L 4U1SB 1EGJA 2MHAB 3LD8B 5IHZB 4G9FA 1U3HD 3KPSA 1CDHA 5BZWB 1F8TL 1UB6A 3GJFK 1RUKH 4M61B 3I6GB 3LKPB 3W39A 1YEEL 4ODTH 1BJ8A 4AEEA 4OT1L 2FX8H 4ZSOE 3MRNA 1CLCA 2R23A 1B0RB 3AXLA 3WLWD 1X5HA 3DVGA 3FOMB 4PJ5D 3IDIB 4ERSL 4O2FB 5IW1A 4GMSH 4KUCF 5LQBL 1CD1B 4I0PA 1T7YA 4PJIF 2W9EH 4Q7DA 3CFIC 5DQDL 2DOCA 5CJXA 1U91B 2PYEE 4ORGB 4EBQL 2F58L 4U3XA 4XPGH 3KPNA 3WFEL 1NMCB 1N5AB 4V1DA 3V4PL 5B39A 3DX7B 3V5DB 4E42B 2W65A 3OR7B 2QSCH 4QO1A 3BPLB 2A9NL 2BCKB 2X40A 3RWHB 5CJOL 1MFCH 4Q0XL 4YDIL 1I3VA 2WBJC 3PWPB 1FL3A 5DD3L 2BVOB 5TDOB 4HHAA 1CFTA 1B6UA 4WFEE 5T1MB 1KEGL 2VDPL 1KSRA 3BMVA 5DJXA 3O41A 2I25N 4D0BA 2F54D 2Q76A 5DXWA 2HMIC 5I1EL 4PJFE 2R2HB 5FO7A 1Q9LA 1QACA 4I0KA 1HH9A 3NIDF 1GGBH 2OX5A 4PGEA 3VD4A 1P7QB 2Q86A 4M1CC 2HP4A 2A6JB 1SY6A 2JJWA 2ITCA 2G60H 5IM7A 4NO2A 1DLHA 3UTPD 5F7HA 1RMFH 2XTJB 3WJJA 3GM0A 3FFCD 4NO0A 3EFFA 2DBLL 2Z4QA 4MB3A 1NLBH 1MHPL 5CP7B 2JB5L 4PB9L 1JCKA 4OFIA 2CUMA 1XF5A 3SKMA 1ES0A 4B50A 1JWUA 4WU7B 3LV3B 1N2RA 2B0SL 3VFGH 1R3HB 4XP6L 1LEGA 4HS3B 4UT6H 5SWQA 5D1QA 3SDCC 5EBWA 1MNUL 1AXSB 3CMOH 4QYOB 5IMKB 5CHNA 4LSPL 2XXCB 3S37X 3PWLB 4J4PD 3FN0L 3RWIA 3LMJH 4Y7MA 3BHBA 1F13A 1T2QL 4YC2C 5CMAA 1V7ML 2XG5A 3B4NA 4S10A 3ULUL 1CGVA 2IAMA 2VIRB 4CDGC 3HAEA 3B2VH 5E4EB 1UQSB 4HUWA 5HHME 4NWUH 3ZKXC 4CN1A 3TWCL 3ZSSA 3QDJB 1CFSB 3ZKNC 1VDGA 5FECB 2EDJA 4J12A 1EUTA 3M17B 3Q5TA 3IDIA 1H3TA 2V5YA 2XTJC 1FE8H 3U0TA 5SX4H 3MNWB 3C5JB 1QSED 1UZ6F 2X70A 4HEME 4WV1B 3ARED 3WUWB 4L3AA 4KV5F 1EDQA 2RFXA 3F65A 2X4OA 3STBA 3PXJA 3OKYA 1EXUB 4NM4H 4UT7H 4YPGB 5ESQB 3QA3A 1M71A 5F9OH 5I0ZA 3K0WA 4WFFD 1N0XH 3HRPA 1ZSDB 1T04A 3GB7B 5FGRA 2I07B 3RVTD 3HNVH 3H7BB 4NCDA 1XGYL 1JF5A 1Q0XL 4LCWB 4PB9H 1XGTA 4O4YL 1TIUA 3MRDB 2ZSWB 2J8UF 5FK9B 1PG7X 3UDWC 1HHHA 1ZLVK 1NEZG 2RJMA 1CLOL 4YXLH 4NIKB 1FGNL 3P11H 4XCFL 5L8JB 1X44A 3T4YB 1N0LA 3QCTH 1DN0A 3QNXB 1T0NA 3T3PF 1S9VB 1LEKB 4WHYH 3A6BL 4OV5B 3RVVC 1MF2L 3QDAA 3VFNA 4MA1B 3PQYE 1NUFA 1HYSC 3UTSE 4BH7A 4GG6A 1EBPA 3CLFL 3QUMH 5E6IC 4UV4L 6FABH 5JPMA 3HE7B 1HZHH 1OP3H 1TCMA 4MA7H 3PWJA 3MRQB 3TN0A 1LO4H 1WK0A 4JPKL 2V5TA 1ERNA 2F74A 2P5EB 5B22A 4CADA 3CFCL 2KL6A 4JG0L 3IF1A 3NCBB 5ID0A 5CZVL 3LS5H 1UVQA 4JDZA 3DI2B 4UBDD 1HE7A 3Q3GB 4G42A 4OT1H 2D4DA 1I1AA 4Q6IB 1J1OL 4RWYL 1IAKA 1JPTH 4XCEB 2AXJA 3ARDA 2ATKB 1KPRA 1Y6KR 5T1LD 5F9JA 5FO9B 4MAYB 4HUXB 4LIQH 1I7ZB 1AY1H 3QQ9D 1V3JA 2LAAA 1OAYH 1DE4B 1QO3B 3SEPA 3VG0L 2ICWA 2YA1A 3VA6A 1N64L 4NP4H 5JUEH 4QYOA 3QDJA 1A7OH 5FHBL 1U3HB 3H9ZA 2BJMH 4IOFC 3WFCL 3L1OH 4PJDB 5TFSL 2DD8L 2NW2B 4XP4L 1RZKH 1MCPL 1YA5A 5D7LE 1YECH 5L8LB 5KS9B 3RUGA 1A2YA 2IQ9H 3EJYC 1KPUA 2R0KL 2YS4A 3B6SA 4Z7VB 2C3XA 4GRWF 3VFMB 3MRFB 4LGPB 1C5BL 3GGWB 3OGCA 4UTAL 3TZVD 2PXYC 3QNZA 3S3PA 2E7LA 2W07A 3HZYA 5EZJB 5J8OA 1FZJB 1ZLSH 3W0WA 4CJ1A 4IOSD 3OJVC 4LLDB 3LEXB 3OXSB 4YHKH 5JXED 1S7UA 1G0XA 2AQ2A 4HG4K 2LV4A 5FYKE 4Q6IC 3UC0H 5FYKL 2FGWL 3N0PB 4JFFA 4OLVL 4HZAA 4NBYB 4KJQC 1F6FB 6CGTA 3VD9A 4JKWA 1CVRA 3RVWC 4XCCH 4PLJD 4IHOB 1JRHH 3JWOH 2YN3A 1U8MA 2AK4D 1KGCE 3ARFB 4D0DA 3FT3B 1H3PL 1OW0C 3P30L 2LVEA 3TBVA 3LS5L 2HFTA 5C0AE 5DT1L 5I8KH 2UY7A 1GCFA 2O5ZL 2N56A 4EVNA 4M8QB 4YDLB 2IF7A 5I1KL 4RRPA 4EXKA 1CTNA 1S9YB 4APQA 3O6KH 4X4XA 4YEEA 1P4BH 2JJTC 3FZUD 4IBLT 4YK4C 4R2GB 5L2KB 3CPLB 4HIJA 2NXZD 4LKXB 5B39G 1MFDH 3SY0B 2DLIA 3TZVA 4ZUVA 1L6XA 5D6CB 1IARB 1FNGA 2X89A 2V2TB 4BQ9A 1CDJA 4DVRL 3UEZA 3QXAA 1V3LA 1W8OA 5I15H 1JIBA 4UQ3A 4OFPA 1KIUA 3QUXC 3KLDA 1SY6H 3WYRA 3D0VA 1A2YB 4UT9H 4MAYA 2VISB 1MVFA 1I7UB 3DETC 3EZ8A 3BKCL 3VXNB 4BQCA 1TLKA 4XNMA 1B4RA 4WEMB 5IHBA 2VZTA 5D7SH 5HGAA 5E99L 5LWYH 3OQ3B 4LLDA 2C1OB 1KCUL 5BMFL 3RIAK 1A6AB 3ES6B 4XBEL 3O8XA 3O3DB 2FIRT 3ALWA 1U93A 1KJVA 3GSNB 3LAFA 1HHKA 3L3DB 3U4EA 4C57C 3QHTC 4XRCA 3DIFA 3RGHA 1CXLA 2F9BT 2YR3A 3TVMC 5AYUH 4I3SL 3TN0D 2P8LB 2H32A 2W9LA 2HVKB 3ARPA 5FYLD 5AG9A 2V2WA 3D18A 3KXFA 4ENED 1EAPB 4X9HA 4KPHH 1MFCL 1L7TH 1PSKL 2D3VA 4ZQKA 4X5XA 1A7PL 1F3DJ 4OUOA 3HNTH 1N6QH 2K3TA 2VDPH 4HPYH 5D7LD 4U1LA 2FBOJ 5FA3A 4FQ2H 2VXSL 4LLWA 5I1GH 4O2FA 2IPTH 5IJKA 5KSVB 5HHNA 3QRGL 3TA3C 1KEMH 3MBEA 1WZ1H 3SE9H 1P2CA 3L9RB 1T5XB 1QFWH 3W11C 4MZ2A 4PG2A 3CUPB 3IDYB 5HY9A 1J0IA 5JXAL 2Z8RA 2H3NB 1KJ2B 5CGYC 3NN8B 4PGZA 5CGYD 4IRSB 3RWEB 4OI9A 3QPQD 3HI6L 2B1AL 3DMMD 1J1XL 3A6OA 3CCHA 2BDNL 2F53A 3PP3K 4X5XB 5JPNB 2GJ6E 4X80H 4JHBA 1F4HA 4Z7WA 4Z7NF 3LPFA 4U1KB 4XWOC 5H94B 4LP5A 4YHML 1A9BB 4OCYH 5JIIA 2EIBA 5C0AD 4UDTA 1BD2A 4JR9L 4XBGA 2HTLC 5A2IH 3PABA 1CICC 3UMTA 1GYAA 2GTZB 4TSCH 2XWBB 4NO3A 4CAGA 5K9JH 4D94A 5HVGB 2P7TA 3NA9H 1RHHB 2IAMD 1NGPL 2Y06L 4Q9QL 4PRIB 3ARFC 5EU6A 4PGDA 2GT9B 4UAOB 5D9SB 3EHBC 3B9DA 2QLVB 5AWNH 1K4DA 5KG9A 1AC6A 3KR3H 3FTGB 4R8WH 4C56D 1QNZH 5ACZB 1AO7E 4YDLC 5IBLD 1BVKB 4KTYA 4HS3A 5ALBH 5GPRA 2VERN 5HI4C 3MRKB 3MOAL 2Q87A 3NABH 4KRNA 5KSAC 1LQSR 5JMRA 4XP9L 2APVA 5CD3A 1ORQB 2W92A 3AAZB 2FHCA 3U0PB 3P4LA 1NCCH 2ZOLB 4FHBD 3OAUH 3KJ4C 4XP5H 2MTPA 3VFTB 1URLA 2ERJB 2HH0L 4FP8L 4XB8A 1FN4A 4NO0D 5BW7A 1CLOH 1W72B 1ONQA 3GSXA 1II4E 4OAWA 4P0DA 4LPCA 1F8TH 4WU5A 1G7HB 4YE4H 4EI5D 3BMWA 5DD1H 4FFVC 5FM8A 5C08D 1UFUA 4Z7OF 1D5XA 3LVEA 3CLEL 4KGLA 3O3EB 3SBWA 3KYMB 3C8DA 3TO4A 1JZ6A 3FB8B 5HD8C 3SDDD