5JW4Q

Structure of medi8852 fab fragment in complex with h5 ha
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
222
structure length
177
Chain Sequence
QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSYNAVWNWIRQSPSRGLEWLGRTYYRSGWYNDYAESVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARSGHITVFGVNVDAFDMWGQGTMVTVSSASTKGPSVFCLVKDYFPEPVTVTFPAVLQSSGLYSLSSVVNHKPSNTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Hemagglutinin
publication title Structure and Function Analysis of an Antibody Recognizing All Influenza A Subtypes.
pubmed doi rcsb
source organism Influenza a virus
total genus 33
structure length 177
sequence length 222
ec nomenclature
pdb deposition date 2016-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jw4Q02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jw4Q01
2BP3A 4YDIH 1A6TB 2E7LC 1Z9MA 4NCC1 3E2HC 2KBGA 4QNPF 3GRWH 3NABL 2GCYB 4N8VB 1AE6H 1PY4A 5I75B 2XNAB 1TETH 5EU6D 1DUZB 1ZANH 2QTEA 1JNJA 1IGJB 5FYJL 5FYLE 3MV8A 1NFDF 3U9PH 3D18A 5T3ZE 1MFCH 1OTTD 3HR5B 3PWJB 4LLYA 5IR1A 4MLSA 2WWKO 3TFKC 5DK3A 4KKLD 4JO2H 3NAAH 5AAWA 4PJIE 3D3VA 1UB5A 1INDH 1FQ9C 2YD4A 2C1PA 3GMQA 2X5PA 3SQOL 1SJHB 3MCLL 1EZVX 5GRZA 4U7SA 3HC0A 4WW2B 4FFVC 1HDMB 3MUY1 1A22B 5DD3H 1CI5A 4G9FE 4JVUA 1FZJA 5BZDA 1MCWW 4JFFB 4C57C 3PNWB 4ZD3H 1BZ9B 4K7FB 3MA9H 3QWRA 4XP9H 2HLFD 5C0JB 5CJXC 1SVZA 1WEJL 3VFPA 1F4WH 3C5JB 4JQVA 4MD0B 1D5MA 2V7NA 1PW3A 3OKKA 1FIGH 4MX7A 4RAUA 2YRZA 1OF2A 1WIPA 3QQ4A 4G6JH 5C09A 1QKZL 1WK0A 1MRFH 3IDJA 4PLKC 4R7NB 4JM2F 4HV8A 5IB2A 5FYKH 5C6TH 4QY8B 1CZ8H 2E7BA 1NCDH 1JI2A 4PJIF 1LK2B 3RDTC 1HHGA 4LRNL 4I9WE 1WZ1H 4WW1A 4LDEB 2EDWA 2EIZB 1SJVA 4R8WL 4M02A 4NO5B 5CCKL 2XPGA 1AIFB 4OQTH 1RK0A 1B4RA 3HI5H 4RMWA 4U1SA 3GB7B 2MQCA 4ZUWB 2NYYD 1KCUH 2A6IA 1OT1A 4CNIA 1IL1B 2PCPB 4GKSB 3UTOA 4DGIL 3KPRE 4NWTL 1T03H 2Y1VA 2DYPB 1K6QH 3I3DA 5CHNB 4HWEH 2PTUA 4WNQB 3SGEH 1YEDA 4LHJB 1C5BL 3V7MA 3TNNA 3MRRB 1NCAH 1BOYA 3MGOA 1CLCA 4HFUH 2YK1H 4OUOA 4U6YA 2V2TB 3Q1SL 1BVKB 1Q8MA 3CVIH 4R4BA 1MLCA 1TFHA 5E5MA 2OL3H 3QXWA 1D3CA 2HJLA 3MOBH 3TNMB 1UG9A 1XGTA 1YECL 2JE8A 2VUYA 1AR1C 5H8DA 3C60D 1DP0A 4J6RL 3O8XC 3W11C 1GGBH 4PLJC 5A40E 3BSZL 2BXZA 4G8EA 3GJEB 1TQBB 2J8UB 1Z9OA 4XNZB 2K7PA 3QPQD 1GOFA 3MFFA 3V95A 1G84A 4P4KD 1OWWA 3GSOB 5EZOH 1UA6H 2N7AA 3PGFH 3IDMB 4PJ8D 2J88H 3TBYA 1YUHB 1MVUA 4P3WA 3CCHB 2E7MA 1CGSL 4GT7A 5F1IA 3O3BA 5K9OA 2CO6B 3KPSA 2XWBB 2GW5A 4PGCA 5BS0D 2G60L 3UZEA 1CFNB 2AVGA 3BP4A 4W6XB 1F97A 5E2VH 3KS0H 3IDXL 3LQZA 1XCTA 2XZQL 4F9PC 5CEXA 5B8CC 2A9NL 1W0WA 4F7TB 1Y0LA 2EDFA 1UM6H 2XI9A 4JFEA 1V7MH 4Z0XB 5K59E 4JFDE 2VTFA 4HWZA 3RZCD 3FOMB 1VGEH 3DXAB 4P2QB 5L8LB 3VRLE 1AO7D 4D9RE 1KYOJ 1T5XB 4ZOAA 5D7LB 3BVNA 1EIBA 4K55A 4JDTL 2NY2C 1IFHH 3S3JA 1DBML 1IGML 5EG6C 2R2BB 1PBYA 3QCVH 5EOTA 1N6QL 3RNKB 2ICEB 2ZSVA 4BH8A 3JTSA 5KS9A 4OLYL 4KHXH 1I8IB 4U1HA 2ARJA 1RZ8A 5KVDH 4C56D 1H3PH 4X6CE 1M71B 3O81A 3OAUH 4PS4L 4FFYH 5H2BB 2XG4A 1OAUL 1CK0H 4PTUA 4UTAL 1U8HB 4GMTL 3WFBH 5D72L 1EGJA 5I1DB 4UT6H 1OB1B 5HHXL 1X5KA 3HE7A 4I77L 3VGDA 4M3JA 5I18L 2D7TL 1L0XA 3HC3H 1PVHA 1QSZA 4N9GB 4PRIE 4YX2L 2OZ4A 1BFVL 1CF8L 4RMQA 3MUHL 4I0PD 5GS1A 5K59F 5HDQH 4NO0B 1EEZB 3SE4C 1BAFL 1BX2B 2APFA 1W72B 2RJMA 1MCFA 1OAYL 3VRLF 4YUEL 1HEZA 3MV7E 1M7DB 4RISH 2BC4B 4AT6B 3CK0H 4CN1A 1T2QL 5DJXA 3UTQA 2CPCA 1OAQH 4OZGA 5ALBL 4UIMB 1BGXH 4R7DA 5CJQL 1MAJA 1KIPB 2PYED 2FB4H 4MQXC 3VG9B 3PP3K 5F1KC 2VABB 3WUZA 5FAAA 4LPVA 3S35H 4X6CF 1R3LA 2Z35B 1J1PH 4FZEH 5LBSL 3INUL 1S7RB 2EDRA 2ITDA 4HJ0D 3RVXC 3TT3L 4I3SH 2H26A 5JOPE 4Y5XC 3BQUB 3L3IA 4HBCL 1D5BB 1UT9A 3X3FL 4LEOB 2V2XB 3QXVA 5DFWH 1FVEB 1KPUB 2ZOLB 5C0DB 2I27N 1TQCC 4FP8H 3L5JA 4JR9H 3DVFA 3TBWA 5DJ6A 2H1PL 4NNYA 3MRJA 4FQXB 4MDJA 2A6JB 3L3OA 1EUUA 4LLWA 1ZAGA 3G04B 5HYSA 3QUMA 3QG6B 3L3JA 4YDKL 1IRAY 4ODTL 1H5BC 1I7UA 4OIIH 5CZVH 1A64A 4P3CL 2XRAH 1MEXH 5DQ9A 3ZKXC 5GSRB 5BV7B 2YD7A 1X5FA 1NUGA 2FIKA 4CW1A 1PKQA 3IJHB 5BRZD 4PJBE 5DFTA 3W2DL 1YNTB 2DKMA 4NFCA 3MRDA 4H8WL 4M1DL 2H32A 2XG5A 4XXCA 4LCWD 1GZPB 1BIIB 3PABA 7CGTA 3W0WD 4PV8B 3OL2A 4TSCL 3ILPB 5D1XB 3T2QA 4C59B 4M7JL 3QR2A 1VADA 4MA8L 4GRMA 1LE9A 3X14B 4Z95H 5DK2A 3X13A 3WS3B 3VD4A 3P4NB 4X7DC 4OZ4B 2AJYH 1LEKB 2J7LA 2PO6D 5EUOB 1V3LA 1TITA 5GRVK 3N9GH 1JGDA 4G6KH 1TVBB 5HHVH 4Q6YA 4MJID 1GGYA 3RVTD 1I9JL 4K3EH 2YSSA 3BUYA 3LQMA 3W39A 4PJBF 5BCAA 5DVNA 3JWDL 4OKVA 5AYUH 5MEQB 3T0EA 2O5YH 4U1GC 1OP5H 1Q9OA 2F9BT 1N8ZB 2X4PB 4Y2DB 1CFTB 1E4KC 3CLFL 5FDWA 3JV6B 1QSFD 4EKXA 2WBJD 4F80A 4XH2A 1XGUB 3MXWH 4ALAL 2VSCA 3VG0L 4KDVA 4L5FL 1BREA 1AGDB 3OXSA 5DWUH 2RQ8A 3EOYG 4MXWL 1OGAA 3MLSH 3NACL 2ITCA 2AQ3A 3P4OA 4PY7B 4EN3A 3RA7H 3QDGB 4P57A 5CBEB 1XIWB 1P7QD 3SE9H 4RGND 3NFSH 4J23A 4KZDL 1PG7H 1U9KA 4GH7B 4V1DA 4XP6L 4CVWA 3NIFE 3FOLB 1R3KB 5HY9B 4JFXA 4EUPG 2H3NA 5C1MB 1JGUH 4HUWA 1U8OA 4GRWE 5ALCL 2APTA 4ORGB 3P9MB 2IF7A 3AREB 4Q2ZA 4OM0H 1EAPB 5KANG 1OP9A 3LN9A 5A16A 3IDGB 3OHXB 3QH3B 4LSTL 1VEPA 4U6VL 3MOAL 4ZO8A 5GGTH 4DKEH 2BNRB 3L3KA 4UDUA 4MJ5A 3VH8G 4S1RH 2ZJSL 1G7JB 4NT6B 4W6YB 3VXUE 1RUQL 3MRGA 5IVXA 3BHBB 2VXUH 4XBEL 4RGOL 4YFLI 1NCBH 4LF3B 5I1KH 3N1MC 1GGCL 3UTTD 3OKOA 2FYYA 3QNXB 5IM7B 3EYUH 5GRVL 2GTWB 4MZ2A 3VDAA 1S8DB 1JPSH 3BDYH 4K3GA 4XCNA 3NIFF 4Z7UA 5EU3B 4MXVE 2V5TA 3BJLA 4KJQD 5IF0A 2FH8A 4TQEL 3L6FB 2YUWA 4ZPTA 2F53D 2GY5A 2B4CH 2F74A 4GRWF 1BQHB 2IBBA 2AJUH 4QWWD 1P6AB 4KY1L 3KYMB 3VFNA 2FJHA 4JG0H 1JYVA 2ED9A 4ODXB 4WEMB 3I6LE 3DX9B 1VENA 4LHUG 2PTTB 2A77H 2QSCH 1RD6A 3OKNB 1FC2D 3BMVA 5E7BA 1KENL 3MRFA 3D39A 1FNGA 3MREA 5H37G 4N5UA 1U6AH 3LHPL 2OBGA 4EXPX 1EJOH 3QFDA 4JY5L 4UQ3B 4MMXC 3S4SG 2FD6H 4JDZB 5I8EA 5HHOE 5JDSA 4U1MB 1C16B 3I6GB 4J8RA 3TGXA 2C4FT 1E6OL 5IBTH 3EYQD 2AJZA 5HVGB 1CXEA 3NBNA 1T3FA 4MXVF 3BT2L 5EU5A 3KYNA 1Q1JL 1VKXB 2DOCA 4HX1B 1EAJA 1H0DA 4MB5A 3K81A 2AV1B 3FB5A 4DGVH 5DMKB 5HGDB 1P4BL 1TJIH 4NO3A 2XTJB 3D9AH 3MJ9L 4JO4H 4LPUA 5F9OH 5DJYB 3QIBA 4E9LA 3GBNL 3MLUL 5DUBA 1YEIH 5E6IC 3OQ3B 3B2UD 2IAMC 1FBIH 1MWAL 3DRTA 4KVNL 4ZO6A 4YK4C 1RUKL 1S5IL 4CL7A 4HKBB 3RZWA 2Z31D 1C5CL 4UAOC 1XF2A 2CDGA 4LCCC 5ILTL 5JZ7D 3QDMB 2ZPKH 1CTNA 1T5WB 1EEYB 2XZZA 5GGVL 1QLFB 1NL0H 3DETD 3OGOE 1NMAH 3O2VH 3UC0L 4YBLB 4WUUD 4LSQL 1KJ2L 4LCIH 7FABH 3KYOA 1ZHBA 3AXLB 3TN0A 5GRJH 3VFRB 2WUCH 3OZ9H 3L7FB 3I6KB 3TH2T 4HGKC 4K8RC 5JDJA 3KJ6H 4HLJA 4C83B 4AEEA 2YPLB 3S34H 2AXGA 1OL0A 1ZHLA 5D1ZB 2QR0B 1XF5A 3EHBD 2OXGA 1SBSL 5E9DB 3LKRA 1CFSB 1UCBL 1S7VA 3V0WL 5DFVD 1QA9B 3G6JF 2IPTL 4JPVH 2ID5A 2OK0H 5DMJB 4EOWL 4ZUVA 3C60A 1EK3A 1QG3A 1KG0A 4J7RA 3EJZD 3LEXB 5AG8A 5D5MB 2VDLH 3VFTA 2FSEA 4PRNB 1HZHL 4KFZC 4QHKI 1R0AL 3CVHL 1IM9D 3MMEB 1S9XB 1K9TA 1S7UB 4WIQA 2VRAA 1CS6A 1RZ7L 1YDPB 3OGCA 4KMTL 4PJ8A 2WINB 3HLAB 4LSPL 1U95B 3VWKC 4MHHI 3HTLX 3FB7B 4ELMB 2FDBP 3CX5K 5KSBE 3QIUC 4IOSD 4U6TA 4PJCA 2DLTA 4O2CA 2YC1B 3DYPA 4I18B 1IT9H 5EBLB 4JZNB 1CTOA 4NZJA 2WUBH 4N0FA 3HI1A 4HGWB 4OD1L 1YC7A 5GRXG 3S36X 4P9HL 3ZTJG 4JJ5B 5GGRY 4PJXE 3DYMA 3D5OF 5E08H 1UXWA 2H2SD 1MJJB 5IBUG 2PW1B 3RZCA 3BN9C 5DURB 4PY8I 1JPFA 5HPMA 4HAFA 4QTIH 3V0VB 1AO7A 3HZVB 3KPSE 3HS0B 3NCBB 2QJDA 3EFDH 1PAMA 4HS6B 4NYLB 4XTRC 1SYSA 4AM0A 1NCWH 4P5TD 2R0KH 5DVMA 2JCCB 3SKOA 1TTGA 1A7RH 1ZMYA 3HZYA 1N5AB 2A0LC 1MHPL 4JFEE 4WFGE 4C58B 3H9SD 4RFOL 4ZXBC 1A7NH 5CLTA 4FQPA 3VXNA 4C56A 1RV6X 3GO1H 1A21A 1CLZH 2OL3B 1M6OB 3IB4A 1JPTH 5KSBF 5HTSA 1KJMA 5FCUH 3UCRA 5L2KA 5KS9E 4OGAC 5F88B 1CU4L 2UZIH 2A73B 4NZTH 1C5DB 4PJXF 4B7IA 5HYFA 4LSVH 5C0BD 3KDMA 2AKRB 1W0VB 1DLFH 3C6LC 3LDBC 3JTTB 5ETUB 5MEOA 1ORQA 1NDMB 3V7AG 4GLRH 1E27B 4JFYA 4IOIB 5D1QC 4TVPH 4TSAH 3NCYS 3T0XA 1QYGH 2HLAA 1C7TA 3RP1A 4NQEA 1T7WA 5KSVB 1S9WA 2DWDB 3RWDB 4ESKA 4DGYH 4YHYB 1QR1A 3LCYA 1I1CA 5FUZL 2W60A 1E28B 5DMIL 3BGMA 4RFNB 1ZT4B 3GSVA 1NMBL 1AXTH 1F3DJ 1MJ8H 4ENED 5C0CD 2CK0L 5HGGS 1RMFH 3BPOC 4KUCF 4U6XB 1CDJA 3U79A 5IJVA 2XWJB 3O0RH 3WFCH 1XF4B 2J2ZA 4LBEA 3U0TA 1F58H 1JWUB 4NZRL 5KS9F 2SEBA 4QRTB 3U36A 5GJTH 4PGEA 1KELL 5IFHL 3V5HA 1A1OB 2BOCB 1TCMA 5GHWH 2VN7A 4H1LH 1Q9LB 3CZJA 1BQSA 1OSZA 3JUZA 1SBBA 1RUAH 3UTSB 4GRLB 4UIKL 4LHQB 4LP4A 5GGRB 4MD5A 4LVOC 2AJVL 3LH2L 3GMMB 1HQ4B 2EDYA 5CIPA 1FDLH 5EULV 5HGAA 2XXCB 4HZLA 3U6RB 5FB8B 4BUGA 4MCYA 1UWGH 1A14H 5MEND 1FVCB 1JN6A 3I9GL 4HT1L 4LCCA 5BRZA 3EYFA 1LEGB 2B0SL 5JOEA 1CXLA 3RGVD 3H6JA 4DW2L 2W91A 3BH9B 2ATPB 4OFDA 3RRQA 1B2WH 2JIXD 4G42B 1JZ6A 1KB5H 4LCWA 3FHAA 3RY4A 3W0WA 1MFDH 2BX5A 4NZUL 3IDYB 4ZAKD 2VXVH 4OT1H 2Q86A 1PKQE 4ZO9A 3DHMA 4BK5A 5GS2H 5HHQB 5HGBA 4C4KT 2ARJQ 1NLDL 2XN9B 5KBNC 2NNAB 5IMMB 1UYWL 5HYJD 1QSVA 4I3GA 2IJ0C 2NXYD 1ERNA 3JXAA 1AFVL 4HW6A 3B8SA 4P48A 2KKQA 2G5RA 4FABL 1G1CA 2NY1D 3B9DA 3SBWC 1WBYA 1WJ3A 2IPKB 2PO6A 2Y6SD 4PREA 3UROR 3B8YA 4LCYB 3FN0H 3ZKNC 4MJIA 1UWXK 4AK1A 3QXDA 2HG5B 2WSKA 4XWGH 5DQDL 9CGTA 2YPKA 2Y7QA 3VXSB 3ULUH 4M43L 3TV3H 4XBPA 1V5JA 5JOFB 2W0FA 3FMGH 2ERJB 5C0AD 3VCLA 1G7IA 3QXTA 2R39A 5L6YL 1WWWX 3ETBF 1WBZA 3EYOA 3WN5C 2WBJA 3KGRA 3JWOC 3C5ZB 4H20H 5D6DA 4Q6IA 1GCFA 4FRWA 1EGJH 3RKDD 1KLGA 3F58H 1GOGA 1KN4L 1B9ZA 2HYMA 3T0EE 3ARDC 1DBAH 3P73A 4TNWF 1QFUH 4N5ED 4OV5B 1EFXB 2HJFA 3MLWL 4HCRL 2AXFA 1BD2E 1P7QA 1FL5B 2BVPA 3GIZH 4N8VG 2AJSH 4JO3L 1F6AB 3DMMD 2ZG3A 2WP3T 1TCRB 2MKWA 1MUJB 1OGAE 3DRQA 1IGTB 1T22A 4Z76A 4AIOA 4AEIL 5FYJE 2HVJA 2JLLA 3O6FC 1D7FA 3EKCA 3NFNB 5FM5O 1VFAB 3T4YA 3BGFC 4NQSA 1RSFA 3GUTA 4V1DE 5CUSL 1NFIA 3G5YB 4JHZA 5SV4A 4MJ6B 3CD4A 4NM4L 5F1SA 4CBPA 6FABL 5IROA 4BQBA 1W8NA 2F54E 2QQNH 1AGBA 4QOKB 1I9RL 3D69A 4D9QD 5FKAB 4L8CA 3TBSB 1KB9K 1U93B 1K8DB 1BM3H 5ACLA 3B6SB 2BDNH 3QHZH 3T4AA 1PSKL 4QRPD 3UTTA 4G80A 4M6MH 4NM8L 1DQDH 1M05B 5DJ0A 1B3JA 4WWID 2VXTL 3LV3B 3TJHC 2VERN 5BMFH 4NJ9H 4QHUA 3IKCB 4WHTB 4G8FA 5IVXE 4TULH 3PGCB 5GZND 2VNCA 4O58L 2J1KA 3IF1A 4YAQA 4JRYB 1FG9C 2F53A 1AC6A 1T66C 5EPMB 4HHAA 4M7ZB 1TNMA 1K2DA 1LK3L 4PRHD 4IIQC 1QEWA 3SE3A 1FNEA 4I1NB 1JF6A 4RMRA 3U46A 2N4IA 3R1GH 3CLEH 4KPHH 4OUUA 1S5HA 4Z7UE 5EU6E 4NUGL 3JZ7A 5ID0B 1NBVH 2EDBA 2H32H 4G8GD 4GAGL 4HIHA 3CDGA 2C26A 1KACB 1DLHA 2HRLA 1FFPA 4X6DB 3RFZC 1OM3H 3BEVA 1IZJA 2Y36H 5EBMA 3P2TA 3VI3E 1JRHL 3DSFL 4K3JH 4UDTB 2AI0H 4OKDA 2XZCH 3EGSB 4UINL 3VWJB 3TA3C 2GJZB 3SKUD 2NY5L 4KROC 1AKJA 1JFQH 1LO0H 1CGXA 4RAVA 4Y5VA 5I15L 4Y2OA 3RIAK 4XP5H 3MX0A 1NCTA 5GS0L 5I17A 2G75A 5E2UL 3FRPA 5JW4R 3SDDA 3TESA 4FXGA 5IVXF 1CICC 1CD1A 4UMGA 5D8JL 1CFBA 3R4DA 1JYNA 4OLWH 1JNNL 3N1QC 5DGRA 1GC1C 2YN3A 3BISA 4YDVA 3TIDB 2Q8BH 3PWUB 4ZS6D 4XBGA 4EI6B 5EUKB 5J3HC 2UVEA 4OZFH 3ET9F 2DQCL 1T1XB 4NNXB 4L4JA 5AEAA 1LD9B 5L9DL 2FR4A 3GSNA 4AIZB 1KCKA 4Z7UF 4X5WA 3MXVL 1FZKB 1DE4B 3AGVA 2IQ9H 5MEPB 4O2FA 3K1KC 1E4WL 4JQIL 3TWCL 1NUDA 4Y4KD 3KPNB 3VI3F 1F3JB 3GKZA 3BKYH 3GSXA 2HJKB 3CZFB 2DDQL 1A3RL 4JJHA 4XWOD 4AQ1B 3HC4H 5FA4B 4YDLB 15C8L 4EI5B 3T0BA 5D2LA 1NPUA 3VRIB 4O4YH 5MP6L 2GITB 3G6DL 1MREH 3UMTA 4QRRD 4WUUA 4HKJA 2DRUA 5I30L 1HKFA 5D7JD 2V2WB 2DBJA 4YHPB 3QULB 5KSAB 3U2SB 5CEZD 1G9MC 4OF0A 1BWMA 4Z7WB 1T83C 1KTLB 1J0KA 3NZHL 1KLUB 1DDHB 5EOQH 4LU5H 3QUXA 4P2OC 4Z9KB 1QFWH 2YBRA 5A2FA 4FQCH 4XGZB 1F90H 4FFWC 4IOFD 4R0LA 3VFUB 1YY9D 2IC2A 2A6DB 2YD8A 25C8L 3V6OA 2Y9RT 2N1KA 2UY6A 2VLRB 2GEEA 4P23C 3VXRA 1DFBH 2W9DH 3ES6A 2EE6A 2AEWA 3ZE0E 5E8PA 3WNKA 2CGRL 4CJ0A 5C0RH 1HXYA 2EO9A 5FFLA 2W0PA 4EUPA 2QQLH 3PJSB 3QG7L 1A2YA 3DIFB 1MJ7H 3O41B 4GSDH 35C8H 5EB9A 3IU3B 4P0DA 5C2UB 1Q9WA 5IOPA 1P4LA 1JVKA 3TVMC 3O2WL 3WIHL 4UU9B 1WIUA 3UYRH 1OPGH 5H35B 1K5NA 5DI8B 4FQ1H 3VH8A 4MVBC 2X4QB 5ACZB 1INQA 3BDXA 2AXJA 4JFFD 4XC1H 2GTZB 1EEUA 5C0ND 3MNZA 5FOBA 2HFGH 5BOZG 5C0FB 4HUUB 4Q9BA 2X4NA 3S7GA 4M7LH 5DHXB 1IQDB 5CWSB 5HHMB 2NY4B 2Q3AA 1EMTL 3RAJL 4OFYD 5BS0E 2FEDC 1NDGA 1YNLL 3ZE0F 1J1OL 4P5TA 1U8QA 1FO0A 1F6FB 1RIVL 3AB0C 1WGOA 2D0GA 3FTGB 5D2NB 1JHKL 3DROA 1MCSA 4PJAB 3SKJH 4JN2B 3CX5J 4JB9L 3H9SA 5J1SC 3ZE2E 4DKFL 5EZJB 1RULH 3D0VA 1AO7E 1JCKA 1T2JA 1VPOH 3LMJH 3BGAA 4H26B 4FFZH 4LHUA 1G9NC 4GMSL 1JZ7A 1RQ5A 3ILQC 1IQWH 4XVTH 2V5SA 1EA9C 4C56E 1SEQH 2BCKB 1YMHB 3HRZA 3S4SA 4YGVA 4NZDA 1BBJB 1D5IH 3RBGA 2DYPD 1AQDB 3SGJC 3NGBB 4N90D 1MCCA 2EIEA 4QRSB 5SWSB 3PHSA 4K71C 5KW9L 5IJKC 2F19L 2VQUA 3ULVD 1QLRA 1S78C 4OZHE 4UV7H 4X4YA 5EIIB 3ZE2F 1CE1L 1I7RA 4X6BA 1TZHA 3SEPA 5LG1A 3MV8B 5C0CA 3ZMRA 1OLZA 2ZOKA 3NPSC 3S36L 3BRDA 4F57H 2FHBA 5IK3B 2EE3A 2J6EH 3S88L 2CIIA 2VB5A 2P5WA 2WW8A 3FQWA 1XFPA 2R4SH 3OKEA 3GIVB 3D3VB 4APQC 2E9IA 2PYEE 3U30B 1MAMH 3E6HA 3VD3A 2PW2A 1ZXQA 1NCUA 4QXUH 5I66B 5JIIA 4M6AA 1V7NH 2ICES 3DJ9A 1FH5H 4GBXB 2Y06L 2QADC 4R90H 3ZL4H 1KSRA 4X98B 5D96B 1ROWA 4GUPA 1OTSD 5EZIL 4G9DB 3KLHD 2GFBA 4B5EA 2X6MA 5DYOB 4JLRA 3VFPB 2P42B 3MSPA 5I6XC 3U82B 3OAYK 1D5MB 1XGPB 4KKAD 4RDQF 4OZHF 4KAQL 2Q8AH 5MENA 1WCBB 1T0NB 2Z92A 1I3GH 1GXEA 1T1YB 3P11H 5C09B 1CL7L 1A5FL 1J0YA 4P2RB 2ZUVA 5FKPA 3DXAD 4P2QD 2O93L 4EDXA 4R4FL 5E94A 5GSVA 1F8TH 3PQYB 3ULVL 1U92B 4R9HA 3RGVA 5CD5D 2WK2A 5KOVC 3L9RA 4WO4B 2JIXA 3O4LB 1DQMH 5F7LB 1F2XK 4UBDD 3OMZA 4K7PY 1R5WA 1HYSC 5F96H 4U6HA 4ZAKA 2DQEL 3BP6B 1IC7L 4MNHA 5FHBH 3PWNA 5BRZE 1C08B 4HJJH 5ICXA 1A3LL 4Q9RL 3VFGL 4PJHE 4Q9QL 2VXQH 2EIDA 2XPGB 1JGEB 5T1MB 3V4UH 4U1SB 5AG9A 2OMNA 1HIMH 4LCWE 4RNRA 3W0WE 5CP3A 4MQ7A 4WWKA 2DQGH 4NKIL 3IXTB 4RMUA 3RVUD 2DLIA 5F7UA 2X4TA 1UKQA 2OR7A 1ZEAH 4YE4L 4IRJC 3MR9B 4NQUA 1ND0B 4MNGB 4NO0D 3BMWA 1OTUD 3TNNB 1FL6A 4NKOA 3ELAT 4H1LB 3CSGA 4P99A 4JAMB 1KIRB 2QL1A 5JPMA 4Z7VA 4D94A 5C0AA 2LABA 3S37H 3UZVB 2ZUUA 3RWJA 3ZDYE 2EKSA 4R4BB 3LB6C 4MJIE 4QTHB 5E5MB 3RTQA 1IGYA 1SY6H 3EOTL 1SM3H 2DKUA 4PJHF 3BEWB 4OCSH 4G8EB 2OQJA 4KKLC 3BZFA 3MFFB 3MLXH 1FAIL 1QSFE 1XGYL 4ODUB 3RY6A 3IU4H 3DMMA 3QFJB 3NA9H 4MAYB 1KB5B 3TBYB 1QRNA 5I1IL 2IANA 4NC2B 5LGJB 5CD3B 3WNNA 3UDWA 4M7KH 5HSFA 3BE1H 5IBLC 3O3BB 4FQXD 4GOSA 1JBJA 4CMMB 1DSFL 4OFIA 3QJFB 4PGCB 3BP4B 3MNWB 3WIIH 5C8JB 2DTSA 2HLFC 1ZE3C 4M03A 4RGNE 5F3HA 2JJSA 2FJFA 4KQ4H 3RX7A 1W0WB 3ZDYF 3GFUA 4RBPH 1O0VA 1IGFH 4RRPG 1VFOA 3HMXA 4ZUUA 4DVRL 3WXVL 4JHWL 4IS6B 4M5YH 4D8PB 2BJML 4P5MA 3VFVB 4FS0A 1BIHA 5F6HJ 4JG1H 2I24N 3WL9B 4GXUN 4N0YH 3AM8A 4WI3A 4OLXL 4HMDA 4LQ1A 3MRBB 3EDFA 5T1DL 1UM4L 1MFAL 2W07A 2PF6A 1CGVA 1MLBB 3MODL 2B7DT 5K93A 3PHQA 1CGUA 3DVGA 1NAKL 3E2HB 5D1XD 2YD5A 1AGCB 5DK0B 4ZFFB 1IAIL 1MOEA 3MO1B 4U4BA 2BNUB 3UTTE 1LNUB 3HE7B 3EO0A 4ERSH 2E9WA 4MHHG 3QEUA 3FT3A 4PRHA 1ZTXL 2HWZL 5ESQB 5J1AA 2VXSL 1KB9J 1U3ZA 5ABDE 4HFWB 3KLSA 2F53E 4AZ8A 2YUZA 2DWEA 1J87A 4DTGH 3QP3A 4K8RH 3LIZL 4OZGB 4BFEA 4Y2DD 5FYKU 4R7DB 1EBPA 2GYSA 2XQBL 5ICZA 4CMHC 4HWBL 5DMYA 4DQOH 3RWCA 5D6CB 1F3RB 1HHKB 5CEYA 4U49A 5L88H 1SJEA 4X7TA 5IIEB 5J89A 3KNBA 4M1GH 4W6WB 1JV5A 1ZWIA 2MHAA 4EEEA 3DO7B 2FX7L 1MPAL 3QPQC 4QF1B 5I71C 3LN5B 3QAZC 3QUYA 3V0AC 4P4KC 4PIRF 4X80H 1XIWD 4U1KB 2J4WH 2R9HC 2ICWB 2YKLL 3SGKC 4PJFB 2A83A 3CSPA 5ID1A 3NOIA 4PG2A 3RWIA 1MJUH 3TCLB 4XNUL 5DUML 4B50A 5A3IC 5AZ2H 3MACL 5EO9A 4Z18A 2PKDA 4XPAL 1YEHL 1A02N 1MRCL 3RDTB 1I1RA 3S8WA 3HZKB 4PJEE 5BVJA 4P9ML 2OM5A 3IJYA 4HQQH 1ZLSH 3OX8B 1UWEL 3UPRB 1IEBB 3C9NA 3ARED 3EJYD 3WE6B 3MBED 4HUNB 3CFBA 3VE0B 3CFDA 4XNXL 1KJVA 3P0GB 4QRRA 3R8BB 4CW1B 4OLZH 4HDIA 1JK8A 2W0LA 1S9YA 1PX3A 1YEEH 2BNRD 4GW5A 5IT2L 2WWMD 3CFCH 5KVGH 2XY2A 5TE7L 1OAZL 5JHDB 2FBJH 1IGCL 2H32B 4GG8A 4OCLC 1I8LC 1FCGA 1HWHB 4EZMA 5D2LE 5GGQH 1F4HA 1QQDA 5FM4A 3REVA 4F7EA 5EBWA 1A6TA 3LQAL 5JTWA 4X4MA 4WUUE 3V4PH 3GM0A 4DCQA 2HFFB 1UZ8B 5CJ5A 1BECA 3FL7A 5CZKA 5EOCH 2GCYA 4N8VA 3DGGB 1PFCA 4OGYH 4F37K 5I1GL 1DUZA 2APWA 5JUEL 1IGJA 4PJDB 3X13B 3GHBH 5IVNA 5D70H 4PG9B 1MF2L 1PG7X 3HR5A 3OB0K 4PJEF 2C4FU 2VR4A 4XP4H 4LAQL 4M62H 1BVLA 5FA3B 2GK2A 3EYSL 3O8XB 4I0PC 4RMSA 2HT4D 5HXMA 5I1EH 3WO3B 4W81A 5BOPA 1U8MB 2ZUQC 2ICWI 5TE4L 4OZFB 2YSSB 1UKSA 5IWLA 1TJGL 3W39B 1E4JA 3QCUL 5DJ8B 1JGVL 5J7CC 1OCWH 4OCRH 4OKVB 3TLRA 1OSPH 4LASL 1Q9OB 1KCVL 1X44A 1HDMA 2VN4A 3O2DH 1N0XH 4HUMB 1DQLL 3IFOA 4H8WC 4UTBL 5FDWB 4NRZB 4JFFA 4AG4H 5D2LF 1TJHH 3QQ9D 32C2B 3OTTA 4KV5E 4K7FA 1AD0B 2C3WA 2WM0A 1X5YA 3C5JA 1RFDH 4J3XA 2UWEE 4MD0A 3ZYJA 1F4AA 1K8IB 4ZFGH 2XV6B 3KYKL 1I3RB 1YA5A 2GAZB 2R1XA 4P57B 3FONB 5FDYA 3RU8H 3PWPA 4R7NA 4M9OA 4O02H 3CX2A 4S1QH 2VDML 3QB7C 2VMFA 4GW1B 4QY8A 2XTJD 5HD8D 3WJLC 3BUTA 4D3CL 2V9TA 2NY2B 4AENB 1IKNC 5C0GB 2J8OA 4UQ2B 1YEKH 4YXKL 4I3RH 4WJ5B 2YWZA 2EIZA 4HLZH 2JB5H 3GMLB 2WAHA 3JWDC 5M95B 3S5LB 1MCWM 3GB7A 1HXMB 3H9SE 4ZUWA 4KTDL 3UO1H 4KV5F 4KK6D 5SX5K 1IBGH 5E4EB 1JHTB 2PCPA 3CSBA 3RIFF 4QXTB 4GKSA 3O3AA 4UDUB 2CLZB 3VXTB 2UWEF 5FGBA 1XEDA 3MRGB 2DYPA 3HA0A 5CHNA 2DQUL 4WNQA 4OBSA 3WHXB 5C9JA 3MRRA 2ZUSA 1QFOA 4Y4HD 3NH7H 4L9LA 1YYMH 2YPLD 5DLMH 4JY4A 4XI5D 5D1ZD 1IAOA 1DUYA 4JRXB 5E9DD 2V2TA 4PRAA 5C0BE 1BVKA 1CGWA 2F5BL 4NN5B 3HCVA 1MIEL 4GQ9H 1YJDL 3ZKMC 2V17H 4U0RB 1DBJH 1MHEB 3FFCA 3GJEA 5C0EB 2J8UA 3O3DB 3STLA 2CUIA 4X9FA 4JHAH 4K2UH 5ITFB 1MFEL 3CXDH 2FATH 5F97E 3WD5H 3T0AA 3RVTC 4YDIL 1B0GA 4FQLH 4HIEB 3IDMA 3GRWL 5FYKD 5C0CE 4F8QA 5DJZB 4U3CA 4Y5XB 1AE6L 4FQHB 2C3HA 1YUHA 3D39B 4ONFL 5FEBA 3IGAB 3CCHA 1K4CB 4KMLB 4S1DD 1ZANL 2G9HB 4JKPH 3U9PL 4GKZB 1MFCL 5T5FH 2BRRH 2Y5TB 1TQCB 2XWBA 1MCIA 1CFNA 4JKWA 2OP4H 3MUGA 3WYRA 2XIDA 4A6YA 5I8EB 2VISB 4GAYB 3QEGH 5JDSB 2NY0B 3SDYH 4C4KO 1EFQA 1FE8L 1INDL 3STBA 5C3TA 4X9GA 1XCQB 3JWOH 4Y16C 4Z0XA 1A47A 2RIKA 5DURD 3DXAA 4P2QA 4E41B 4XPGH 3GMNB 1NGPL 3KYNB 3PDOA 1T5XA 5D7LA 3ZKXB 1H0DB 3FB5B 4J2XA 5DD3L 1N5YH 3BIKB 1P2CA 1QLEL 2R2BA 2VLJB 4ZD3L 2AEPH 1IILE 2O26U 4XP9L 5MENE 3RNKA 2ICEA 5GPRA 5I0DA 3BZEB 1I8IA 4DN4H 5LGKA 5J12B 1FIGL 1U8PB 4KJWD 4NQDB 2AEQH 1QSED 5DJCB 3VD9A 5K9JH 3FN3A 4G6JL 4NDMB 5TDPB 5H2BA 1N64H 5EORL 1XF2B 5T33H 4ZTPH 2CDGB 1I9EA 1BJ1J 1D5ZA 1U8HA 3SOBL 2NW3A 1F4XH 3MLRH 1OB1A 4M48H 5DHVH 3O6LH 5LCVL 1CDIA 1OARH 1I3UA 1YEJH 2YUXA 4J4PA 5C6TL 3RX5A 1CZ8L 4OF6A 1JZ8A 4N9GA 3RWEA 4YPGB 1KCRH 1ZHBB 2NCMA 4F7MA 5HYJE 2UVFA 1WZ1L 1EJ6A 4NO0A 1EEZA 3GMPA 1BX2A 1W72A 5EIQA 1A7QH 4DAGH 5IVZB 1T6WA 2X4SB 1ZHLB 2DMCA 4GXVH 5FOJA 1XF5B 2O5ZH 4AT6A 2CXKA 2WP3O 2FGWL 1KCUL 3W9DB 4UIMA 2JJTC 4GFTB 1BQLH 4U1GB 1KIPA 5LKNA 4GW4B 4RAHA 4HIXH 2FHCA 1TLKA 4M6NH 1GAFH 2I07B 3MLYH 2VABA 1T03L 3IAQA 2C5DC 1K6QL 2Z35A 1KIQA 4HWEL 4QCIB 5H37H 3VFTB 4F9LA 4PP1D 4Z7VE 1NGWB 5C0AE 2HP4A 4L8BB 1KC5L 3HB3D 1NCAL 1T1ZB 1KXTB 4M5ZH 3BQUA 3MPCA 3B9KC 2DAVA 3OGCB 2I5YL 1D5BA 3BD5A 2IEPA 2PUQT 2V2XA 3C8DA 1FVEA 1KPUA 2FECL 2ZOLA 4BKLB 3MRNB 1EUTA 3MOBL 3HG1B 4OM1H 3WLBA 3OWEA 1J8HB 2R8SH 4FQXA 1EVUA 4ODVH 2XOTA 2A6JA 3UTSD 4O2CB 4GRLD 1GGBL 3G04A 3GSWB 1FYTB 2EEAA 5B4MD 2MQ3A 4M93C 4N0FB 3PGDA 4ODWB 3LY6A 1RURH 1U8LA 4HIIA 4XNMB 3W5MA 2WWKT 2X1WL 5EZOL 3QHFH 5J13C 1UCTA 5DD5H 5GSRA 5GIRB 4PJ5B 5FYLL 2J88L 4Z7OE 4Z7VF 3DPBA 2BHYA 5CJBA 3SKOB 3HMWL 5ISZB 3VGHA 2HMIC 1U8NB 1BF8A 1GC1H 1A6UH 1J0ZA 1ADQA 3ZKSD 5E2VL 1TTUA 3E8UH 2DM3A 4AH2A 4PV8A 3OG4B 4HD9A 1XT5A 2W9EH 5SWZA 5K33A 1BOGA 1UM6L 4RGMC 1H8SA 1V7ML 3ILPA 3J7HA 2XICA 3KXFB 4D9QE 2Z31C 2AV7A 4LNVA 5D1XA 4U3HA 2XN9D 2M1KA 5JZ7C 2A9ML 4NWUL 2DQJH 3RY5A 3U7AA 4QRPE 3X14A 1F11B 5J57B 1KCSH 1IFHL 3JVGC 5L2JB 5L2KB 3TM6A 3P4NA 2AGJH 1S7XA 3QPXH 3K80A 3SDAC 1UH2A 5EUOA 4WDIB 3UZQA 4OCYH 3DLQR 1TVBA 4P9HC 4XAWL 3KDMB 4KHXL 3GKWH 1AQKL 4LVNC 1NQBA 2OYPA 1H3PL 4YDJB 5MEOB 3EOBB 4XNQB 2C1OA 2YD1A 3OAUL 3VXSD 1G9MH 4FFYL 1GVIA 4Z7OF 4YO0B 5MEQA 3LN4B 3WFBL 4PRHE 3P0VH 5BXFA 1N8ZA 4UT6L 2X4PA 1PLGH 3VXPB 4NQEB 1CFTA 5DFVC 1E4XL 1CDUA 3JV6A 4HH9B 1L9MA 2VYRE 5TGBB 1XGUA 1AP2B 3C5ZD 4G8GE 4HMEA 1QHPA 2NR6C 3EJZC 1AGDA 4OF3A 4LVEA 3JSSA 3DWTA 4IBLT 3Q48A 3ARFA 1EFXD 2BY1A 3S6CA 3QDGA 4RISL 4LLMB 5CBEA 1E4XI 1QPXA 5F7EL 4ZYKA 1XR8B 4JGJA 1FHGA 3SO3B 3V5HB 4HF5H 4XMPL 3ZTJH 1BGXL 1JYXA 1I8KB 5F7DA 6CGTA 5JHLH 5DC9B 3CDYA 1DBBH 2FB4L 2NLJB 3FOLA 1R3KA 3S35L 1J1PL 5IP4A 4PGBB 5HY9A 3BESR 4MQSB 3O6KH 3P30L 4MD5B 1OP5K 3F7PC 5LQBL 1I7TA 2IAMB 1OY3B 3ARYA 1I1FB 4ORGA 1L0QA 4HZLB 1BQUA 3P9MA 4PRDB 4K7PX 4YK4B 1S7QB 3QCTL 1EAPA 4KTEH 4ZFZB 4NJAH 3QO1B 1EO5A 3QWQB 2CR6A 4UAOB 1PEZA 3OHXA 1PD6A 3VFOA 2O5XH 4LCCB 1SYVA 2E7HA 1FRGH 2BNRA 4FP8L 4HUXB 2X4UB 1N3NA 1BFOB 5HDBF 1G7JA 4NT6A 4B53A 4QOKD 3BHBA 2VL5B 2V7HB 4I4WB 5B39G 4LF3A 3EJJX 2BSRB 4OIIL 3HNVL 2B5IC 4QRRE 4HZAA 4LOUD 3QNXA 3VMOA 1U91B 2GTWA 3PP4H 2XACC 5CEZE 5HGBB 1S8DA 3H42L 1A9EB 4HS8H 1MY7A 5FGCE 4LIQL 2DI7A 4JRYD 3FFDA 3MLZH 4U31A 2YA0A 1G9NH 1BQHA 4PREB 2XKNB 1NUFA 3MLTB 3MV7B 3KYMA 2RFXA 2GSIB 1Q9KB 3X3GH 2VIRB 4ODXA 4O9HH 3K1DA 4OFVA 3MRIB 3WXWH 1CCZA 2GI7A 4Z6AT 3NA4A 1A7OH 2FO4B 2PTTA 1HKLH 3K0WA 1ETZA 1KTKE 4XPTL 1R24B 3RIAF 1AI1H 3OKNA 4XBPB 2DL2A 4XC3H 3HPJB 5LWYL 5IB3B 5GGSB 2W0FB 4Z95L 4UNVA 1W2KT 3UAJD 4UQ3A 3VWJD 5FUOH 2AJYL 1GGTA 5I1AB 3JV0A 3QIUB 5C08E 5C70A 1RUPL 1KLGB 4U1MA 2GK0B 1C16A 1AY1H 3MYZA 1GGIH 4D0CB 1ES0B 5F1NB 3T0DA 1IAMA 3B4NA 4B41A 1MFNA 3U7YH 2AXFB 1QBLH 4K94L 4LSDA 5EDXA 2YD6A 4JFFE 4XHJD 4ZO7A 5AYUL 2O5YL 5J6GB 1VKXA 2AV1A 4W4OC 3Q2CA 5DMKA 4FA8A 2QHRL 3L5IA 5FHAH 2I25N 3JUYA 1WSST 5DJYA 3SJVD 1FPTL 3LAFA 4DVBB 2CDFB 2ZUWA 5GGUB 1L7TH 1T22B 4KRPB 4HKZA 5DWUL 1T0PB 3GRWA 3O11B 5C2BH 3MLSL 4ZXBB 3T4YB 1QBAA 4HKBA 4U33A 4NQSB 2ICCA 3QDMA 1OVZA 1T5WA 5FO8B 3BPNC 4EI5D 3MOQA 1A6VL 3ZT6A 2Z8SA 3RGHA 4P49A 3SCMC 4QXGL 5EU7C 2NY6C 1PG7L 5JNYB 5I2IB 1ZSDB 1OGTA 3I2CL 1AGBB 3AXLA 5KSAD 4WW2F 3VFRA 1RJCA 1EXUB 3L7FA 1WFNA 3I6KA 1JGUL 3T4AB 5FYJH 4C83A 3KJ4C 2BVUA 4L8SA 2YPLA 4IMKC 2QR0A 2FX9L 3C6LB 3LDBB 3W9EB 4OM0L 5E9DA 3TYGL 2ZCHL 1CFSA 1YEGL 2R4RL 5D1QB 1HK6A 3GHEL 4G8FB 1QA9A 1G7LB 4DKEL 3MCLH 2VLRD 2VAAA 4YAQB 4N90E 4MZ3A 2Y07L 2NY1C 2VXUL 4HHAB 1NCBL 2HTLD 3ULVE 5I1KL 4PRNA 3H3PL 2L7UA 3MMEA 1S9XA 2IMMA 3BPOB 1S7UA 4JN1L 3CDCA 4LP5A 1YDPA 4QHNB 1A6WL 1WEJH 1JNHB 2WINA 1JPSL 2CKBA 1U95A 3WNOA 3RL1B 3BDYL 4Y8AA 4ELMA 2BFVH 2FWOB 4OLUH 3ME0A 3L3DB 1U0QA 3FT2A 5BJTA 2YC1A 2HH0L 5DRNB 4JZNA 4G7VL 2AJUL 1QBBA 3MV11 4RAVB 4OQTA 3GSUA 5IB4B 3RKDC 5E24E 4JG0L 4JJ5A 3SDDB 2B1AL 4FG6C 3X12B 1Z5LB 3ARGC 4ZFOB 4H1LG 2PW1A 2E3VA 2NY4D 4LRNH 3V0VA 3HZVA 4HS6A 4NYLA 4R8WH 3BJ91 5CCKH 3DNKA 3HR6A 1X4XA 3ULVF 4HSQA 3D6GA 3LRGA 2JCCA 1RHFA 1N5AA 1JUFA 3QI9A 2FD6L 4R97B 1ZLWH 5D71L 4X5WB 5JQHC 1ZOXA 3NN8B 3DXAE 4P2QE 5CP7B 1JF1B 1MQ8A 5IBTL 4O2FB 4WHYH 3KHOA 3QA3B 3QHTC 2R0ZL 2OL3A 1M6OA 1R6VA 4XCFL 4DGVL 1TJIL 4MAUL 5DVKA 3QQNA 2UUDK 5F88A 4JO4L 4ZPVB 4ONHB 1NANI 4HKJB 3ARBA 3E0GA 3UPCA 2A73A 3Q1SH 5GS0C 1C5DA 3UJIH 2HTKD 4WHCA 1YEIL 5IG7B 2AKRA 4P5KB 1W0VA 3JTTA 5ETUA 3LS5L 4NQVB 1NDMA 2OTPA 5F1OB 4J6RH 4MS8C 3GI9H 3F5WB 5SWSD 4IOIA 3BSZH 4NFBA 5I9QC 2ZPKL 4OF7A 4Q97A 1S7SA 2V9QA 3MV9A 4PJ7B 3L95B 4LLVA 1LVEA 5KSVA 2G2RB 3DBXB 2DWDA 3RWDA 4OQ1A 4XPHL 5IHBA 4LGSB 5KVMC 2M26A 4N0UB 1ZT4A 7FABL 5GRJL 3KS0J 3MV8D 4EVNB 2EDLA 4W4NA 5E8PB 3WN5B 4U6XA 5I76B 4G8IB 1HXYB 3AU1A 2XWJA 3K2UL 1VHPA 3S34L 1XF4A 3ARDB 1XH3B 3HAEH 1JWUA 2R1WA 2ZG1A 3D3VD 3V8OA 4QRTA 3IDXH 5IOPB 1Q9WB 2XZQH 3WS6C 1A1OA 5DA4A 1F4YH 4NKQB 2OK0L 2NTSP 1Q9LA 1FGVH 4GBXD 4LFHD 1RK1B 2Z8RA 5IEKB 4GRLA 1MSPA 3KPPB 4E5XB 4JQXC 4JDTH 4O2EB 3GMMA 3MNZB 2GJJA 1DBMH 1IGMH 3O6FB 5FB8A 5DHVB 1NH6A 1FVCA 3QJHB 4OLYH 5I1JH 2X89D 4CVXB 5C09D 1MAKA 2X9YA 1LEGA 3G6JB 1IEAB 4ZS6C 1U8QB 3PQYD 1BMGA 4JZJC 4PS4H 1OAUH 3BH9A 4HK3J 4UTAH 4GMTH 4RFEB 4WO4D 4HJGA 3ZDXE 5F7HA 4G42A 3O4LD 5HHXH 2WUBL 4I77H 4TVPD 3WFEL 5JLZB 5HI3D 1FORH 5I18H 3D0VB 5EH1A 1BFVH 2R2CA 3I3BA 1VEMA 2COQA 1CF8H 5E08L 4WUKH 4Y4KC 1UXSB 4JPWL 5HHQA 5CAYB 1C12B 2XN9A 5J06A 2NNAA 4A6YH 4QTIL 4HKXB 2CDEB 1FSKC 1BAFH 4BELD 3EFDL 4HC1H 4QGTA 5E2JA 1CDBA 4Y19B 4FNLL 3MNVA 2BHUA 1VERA 1T2QH 5D7JC 1CD0A 4LCYA 3S4SB 4YGVB 1A7NL 4D2NA 4MCZA 2HG5A 1GPOL 2ATKB 1VDGA 4LCUA 1EO8L 4K23H 3VXSA 5KVFL 5LBSH 3RHWK 3INUH 1ZLVH 5JXAH 5FCUL 5EUOE 3RWHA 3SE8L 3TT3H 3ZDXF 3VFSB 3QXUA 5I8KH 3AS1A 3LKSB 4X4YB 4G7YL 2EH7H 2H2PD 1JNLL 2I60L 3FN9A 3TIEB 3C5ZA 5JORB 4NZTL 3X3FH 4CDHA 3TA3B 1WISA 4KROB 1DLFL 3FQWB 4K3HA 4RCAA 4TSAL 1CICB 3VXMB 5DD1H 1FL5A 1FIEA 4Y7MA 3MGAA 2PW2B 4MA3A 4DZBB 4P3CH 1F6AA 1MHHB 3A67L 4MAYD 4WW2C 1P69B 1TCRA 1U8JA 1MUJA 5CGYD 1AXTL 1MJ8L 1R5VB 1RMFL 1DBKH 3QYCA 5GS2D 1YY8B 3NFNA 1VFAA 2HA1A 3O0RL 4EBQL 3REWA 1PGRB 3WFCL 3TJEH 4H8WH 4M1DH 5EUOF 4M1CD 1NBZA 4OZFG 1F58L 1LDSA 3FCTB 1F3DH 3G5YA 5GJTL 4MJ6A 3FAWA 3U4AA 4TSCH 5FKPB 2YOCA 5TJWK 5E94B 1WF5A 3B5TA 2CR3A 4QOKA 2APBA 5FKAA 4KJPC 4M7JH 3TBSA 4XVJH 1ZGLB 2A38A 1K8DA 4LKCB 4UILH 1ZLUH 3B6SA 3ULUD 4TTDC 1FDLL 3ROOB 3IDUA 2YR3A 1L7IL 4P2OB 4WI8A 2BNRE 4Y1AA 1M05A 1A14L 2OSLA 2FEEI 3FO9B 4P4RB 3SDXA 3CFKA 3IKCA 4WHTA 4XCEA 3PGCA 3BWUC 5GJSH 4BFIA 3MBXH 4HXAL 3PP3H 2Q6WA 4JRYA 1MCHA 2OXHA 4MQ7B 4P59H 3JWDH 3HE7D 4JRWA 5GRUH 5EPMA 4P23B 1U41A 2X4TB 1HNGA 1KEGH 3CLFH 2Q3ZA 1X5IA 4OT1L 5J9PB 4OSUL 1PZ5A 1JZ5A 2PXYC 1FL6B 2W9LA 3KG5A 3PL6A 4POYA 3VG0H 5ID0A 3TFKD 1ADQH 4NKOB 2O61B 1X5LA 1OW0A 2WIIA 4X6DA 5IBUB 4TSBL 5BQ7B 4PTTB 3ULVC 4MDIB 4UDTA 1IGIL 3EGSA 2EKSB 4ONGH 3VWJA 4QHLB 1F5WA 2GJZA 2EXWD 2OTWB 5J8OA 4FFVD 3RTQB 5JW5B 1BZ7A 4XXDB 3JV4B 4U1IA 4K7PL 2H9GA 1TQBC 2RCSH 5F9JB 5GGTA 3BZFB 3TV3L 3CPLA 4WEUD 4QGYA 4WFED 2P47B 1S9VA 3PWUA 5ALCH 3AMKA 2Z9TA 4EI6A 3C6SB 4PJGB 5EUKA 2YRPA 1QRNB 2VQ1B 1DL7H 1T1XA 2NTFB 2IANB 3HRPA 1LD9A 4K07A 4H20L 4OGXH 3AB0B 4U6VH 3MOAH 4M3KB 1EGJL 3F58L 2D4FA 3V4VH 5DC0A 2ZJSH 1DE4A 5MEPA 3DX6B 1QFUL 3KPNA 4XBEH 1F3JA 3T3ME 1WC7A 2FJFB 2HJKA 3CZFA 4RGOH 3U4EB 2XTJE 4X83A 4K3DH 3ROLB 5FA4A 3ZHLA 4XVUD 1S3KL 4UUJB 3VRIA 5DZLA 2GITA 3IDIA 3LD8C 1ZVHA 1FN4B 2DMBA 2XKSA 4XMKL 5JW3H 1LWRA 5KSAA 4YHPA 3QULA 5CD5C 2B2XL 4Z7WA 5JHDD 2RR3A 1KLUA 4S11A 1DDHA 4GKNA 4F37F 3RL2B 3GK8L 1KBGL 4UBDC 1QPPA 4TOYL 4CADB 2YWYA 5DO2D 4IRSC 4KY1H 4B7LA 2ADGB 3VFUA 2A6DA 2D7PA 1MFBL 4K71B 3W5NA 3DV4B 4M4PA 5F7NC 1FFRA 5DC4B 2QQNL 4KUZL 4E0RB 4HULB 2K9UA 3EO0B 3LRSA 2D03H 5IB1A 3BAEL 3S98A 4J3SA 1BM3L 3T3MF 4KDWA 3DOSA 2BDNL 3QHZL 5E9DE 5J1AB 4JY5H 3NPSB 3PJSA 5EZLB 2PN5A 1RUMH 3O8XD 4M6ML 3W11D 4PLJD 3K46A 3DIFA 3O41A 1OTUC 5FK9A 1H3WM 1UEMA 4OGZA 4P46C 5F6IC 4APQB 1Y6MR 2C3VB 4TULL 4I48B 4UU9A 4OTXH 5E00B 5D5ME 4FQJH 5H35A 1X3DA 1TZIB 2VSDA 2XA8L 3BT2H 5DI8A 5I19L 3NPZB 2QKIA 1Q1JH 5ACZA 2QADB 2AK4B 3GJFA 4X5XB 3SKMB 1P4BH 3P77B 4ZDHB 4KH2A 5FYKE 5C0FA 5B39A 1SJEB 2Y4SA 4HUUA 4KQ3L 1S7WB 2NX5A 3R1GL 4X4ZA 4JPKH 5A2LH 3GBNH 1IQDA 5CWSA 1LP9A 3CFEB 3MLUH 2H6PB 1NBVL 5I6XB 3DV6B 3QUYB 5BW7C 2CRIA 4TUKH 1OM3L 4KVNH 1P9MA 3K4ZA 1WUNT 1X5ZA 1G7PA 1RUKH 1S5IH 2Z0BA 5I73C 4K3JL 2AI0L 5EIVA 5C0IB 1KV3A 1C1EL 5D2NA 3FTGA 3K7UA 4X7EC 4PJAA 3O3EB 4JN2A 2NY2D 1I4FB 1JFQL 2MJWA 2UZXB 5EZJA 5F70A 4GS7B 4NFDA 4XCYB 5F7FA 4GAFB 1GSMA 4LSQH 3HNSH 4KDTA 2VDKH 4L3EB 3B3IB 3SO5A 1KIUA 4F2MB 5D5MF 3Q6GL 4H26A 5CBAB 5E8NB 2HT2D 3CH1B 4LRIC 2Q8BL 1RHHB 2DM4A 4MWFB 4O51B 2YMXH 1OLLA 1SBSH 4HDIB 1JK8B 4X7SH 1UCBH 3V0WH 1QSEE 3DO3A 1BBJA 3A0OA 2IPTH 3SDCA 4TN9A 3WLWD 5CJOL 2WQRA 3AY4C 43CAA 4GG8B 3AS3A 4EOWH 1MCBA 2VDOH 3REVB 4F7EB 2CJUH 5SWSA 3TZVA 1FZOB 4RMVA 5EBWB 1U42A 1F02I 4DCQB 4DEPB 1R0AH 2DIAA 4JRXD 3CVHH 4UB0H 5GISL 1J11A 2E6JA 3STZB 1MREL 1RZ7H 2JELH 5EIIA 4ZUTB 3LKOA 4KMTH 4XMLL 3H9YA 2YD3A 4LSPH 1HWGB 3HHRB 5EOQL 3QIWA 1KNOB 1I1YB 1UEYA 5IK3A 1WCQA 1BVLB 1P6FA 1QFWL 2AXHA 1OP3K 3GIVA 3TO4C 1NFKA 4LGRB 1F90L 2X1QA 3HE6C 3RVXD 2AERT 5I66A 4P9HH 4PJ9C 1I9IH 3F12A 3G08B 3IYLW 2IPUK 3D39D 4GBXA 5FXCH 2W9DL 4NPYA 4Y2DC 4X98A 2GJ6B 3IFOB 3I3EA 4QT5B 3T0WA 3EZ8A 5GRYA 1MCQA 4G9DA 5C0RL 5DYOA 2FGZA 2LAAA 3X17A 3LQAC 1INEL 2NY0D 1XGPA 1MJ7L 5I16B 3TT1H 4GSDL 1WCBA 1T0NA 4RFOH 1SMAA 1NBYB 1VSCA 2QSVA 3QRGL 1T1YA 2X89A 1N26A 5SV3A 2R1XB 3UTSE 4P2RA 4UT7H 3UYRL 1OPGL 1X6LA 1XIWC 3PWPB 3PQYA 1U92A 1VACA 5IMOB 4WO4A 2VDRL 3O4LA 2CKBH 1KTRL 4Y89A 4ODHL 2VLJD 1J5OL 3QIBD 4ZOEA 1WAAA 1FYHB 3PE9A 3UYOD 3BP6A 1D9KA 3O9WC 1C08A 4M7LL 1AHWC 1Q72L 4Z7QE 5C92A 4NQDD 4DN3H 1JGEA 3WNPA 4XX1G 5T1MA 3TPKA 3AREC 3MBEC 3FQXB 4X99B 4BYHA 1HOCA 3IXTA 1CWVA 2Q76B 3O3AB 2WWMC 3SKJL 1I85C 2VLLB 1A4JA 3CH8A 1T1WB 3TN0D 3HAEB 2CRMA 2XN9E 2YEZB 3CC5B 3MR9A 3CSYB 4LL9A 1ND0A 4MNGA 5BVPH 3NCYP 5CJ8A 5C9JB 1KT2A 1T04B 3SY0B 3BIBX 2CK0H 2DQIH 4L9LB 4FFZL 4JY4B 2Z91B 4H1LA 1IAOB 4JAMA 1DUYB 1KIRA 5KTEL 4PRAB 1ZS8B 2PYFB 4NZRH 2ED8A 1UVQB 4QTHA 4XVTL 1SHMA 2EYSA 3HCVB 2N56A 3GZKA 4WEBH 4MB3A 3VXSE 4CMHB 4TRPL 2C3XA 5BO1H 3BEWA 4Z7QF 3MRKB 5DRXB 3FFCB 4OZIB 4NC1C 3STLB 5DUPL 2WZPD 3O6MH 2VR9A 1B0GB 1CN4A 3MJ6A 4XRCA 4ODUA 2AJVH 1IC5H 5I71B 3OPZH 2CMRL 4P4KB 3QFJA 2XQYG 4MAYA 1KB5A 5DS8A 4CU6A 4IMLB 2WBWB 3I9GH 1I3VA 5LGJA 5CD3A 2CLRA 3HG1D 2DQFB 4HT1H 4GAJL 4I8DA 1J8HD 2X4RB 4LIQE 1CG9B 3QQ9C 4WV1C 4CMMA 3QJFA 1RVFH 1FYTD 1W8OA 2HAZA 3MNWA 3MUGB 4YLQT 5C8JA 4A6YB 3D2UB 1H3XA 1T2XA 1WWBX 4HBQA 5C7XL 2R4SL 2C7UA 3WFHA 1MAML 2P8LB 3LKPB 4NP4L 4YHZH 4RA0C 1X5JA 3EUUA 3QUZC 2EDTA 4KHTL 4PJ5D 1RJLA 3PDOB 1V7NL 1YJDC 4IS6A 1NLDH 4R90L 2CQVA 5E2TH 3ZL4L 4D8PA 1UYWH 3VFVA 1P2CB 3MZGB 2XT1B 3FQTB 5HD8C 3WL9A 2J3SA 5ISZD 3MRBA 4V2BA 3VD5A 4NHUB 4FABH 1JPGA 2APVA 1EEQA 2GIYA 2IH3A 2BMKB 4ZTOL 5E1AB 3DVNB 1MLBA 1MCEA 4TNVK 3NCMA 1VGKA 1E6JL 3KXFD 4QOKE 4EDWH 3FHQA 1I8MA 2E7LA 4GQPH 3MGTA 1D5ZB 3MRLB 1AGCA 1H3VA 5DK0A 1K4DB 5DHYA 2NW3B 5DQDH 2CH8A 4ZFFA 5FUCE 3MO1A 2BNUA 1LNUA 1WTGT 5L2KD 4D9LH 1UENA 4JKKA 2VO5A 2W65B 3P40A 3JWNC 3CAFA 4L1DA 3RWEB 5HI5D 5ESQA 4N1EA 2QQKL 4RBPK 5I1HL 5L6YH 3C09C 1UM5L 5C07B 5F96L 4F7MB 3NIDE 3DHJA 5FHBL 1HN1A 3BKJH 3GMPB 5MHSD 2X05A 4HFWA 3BN3B 3KPLB 1YQVH 4JRYE 4OZHB 2P5EB 4Y4HC 3U0WL 2ZKHH 1KN4H 1U3YA 1WICA 5D1ZC 3TO4A 4EIZC 5FECA 1EHXA 5AZEL 2EE9A 1HIML 1ZHKB 2ORBL 1G0XA 3MLWH 4HCRH 5HBBA 2DQGL 4NQED 1Q0XH 1IZKA 1RZFH 1LILA 3RKPA 2PNDA 1ZVYA 5D6CA 1HHKA 1CQYA 5IIEA 1KIQB 3X11B 2LTQC 2XYCA 5CJXA 3DO7A 1NAMH 4QF1A 5ANMB 5GXBB 2Y5EA 3LN5A 2MNUA 4Q9CA 4POZC 4A2MA 2LV4A 4U1KA 3KLAA 2ICWA 2ED7A 1YC8A 4BSVA 4PJFA 2OTUB 3L5XL 1MRDL 4S1DC 3NIDF 3WLBB 1SY6L 4NM4H 1M4KA 3TCLA 1SM3L 3L1OH 3BYTA 1P53A 2QEJA 4N9OB 4I18C 4KK5C 3RDTA 1I9RH 3LZFL 3HZKA 4HIJA 1NUNB 3PGDB 3MLXL 5JMRA 3OX8A 2IAMD 3UPRA 1IEBA 1U8LB 4HIIB 5HJ3B 3ZTNH 3SJVE 3WE6A 3BDBA 3VE0A 4WI9A 2GKIA 4WTZG 4NM8H 1QD0A 3NA9L 3BOVA 1CLYL 4M8QB 2YZ8A 2VXTH 1UWXH 4M7KL 4HLZG 1LO4H 5E1HB 5JHDA 3UBXI 2H8PB 4O58H 3VGFA 3WIIL 2NZ9C 1N7MH 4AH2B 1L0YA 2MWCA 3GM8A 5SWZB 4K8RD 1BOGB 2R1YB 2HFFA 5B38G 1OT2A 1UZ8A 2EIBA 2EZ0D 5DEFA 1QO3B 2BOBA 4JFZH 2AV7B 2DQHL 4Z7WE 4IJ3B 3DGGA 4UV4H 2NW2A 2MMXA 5F21B 4M5YL 1EHLH 4PJDA 3RUGA 3UJTH 4PG9A 5KAQF 1S7XB 3RVWD 4I2XB 3K74B 4N0YL 5FV2A 5LGHL 1MQKL 5FGRA 3C08H 2X2YA 3ALPA 5FA3A 4C54A 3O8XA 3S97C 5IESH 4N0RA 2VLRE 4XNYL 1XF1A 1U8MA 1KULA 4OZFA 2C1OB 5GS0H 5DJ8A 4JM2C 3B43A 5BXFB 3P0YH 5DDHA 4LEXH 2HKFL 4NGHH 1JNNH 4NRZA 2E9JA 4EQ2A 1X5XA 3M45A 32C2A 1AD0A 4PV9B 1KPVB 4X7CC 3QIUD 4YFDB 2DQCH 4CU7A 4ZSOE 1K8IA 5L9DH 4Z7WF 3T3PE 1FFOB 3HB3C 2OR8A 1I3RA 3B2VL 1U58B 1K3IA 3ARFB 2DLHA 4FMFA 3B9EA 1EZVY 2GAZA 3MXVH 4N8PA 5B8CA 3C2SA 4OD2B 3FONA 3D48R 2A74B 4JQIH 4Y16B 4ZYKB 5DMGD 4YHML 3RPIB 3BN9D 3PV7A 4GW1A 1A3RH 5F7DB 4XTRD 3BW9A 4U1LB 1DVFC 4Y0GA 1JGLH 2IBZX 4AENA 4LK4A 2DD8H 3G6DH 4BM7A 5L88L 3FT4B 5C0GA 1N2RB 4UQ2A 3MROB 4M1GL 4KRPD 1N59A 3H9HB 5I30H 1CDCA 2A0LD 4WJ5A 5B4MC 3GMLA 4ZXBD 1I7TB 3FO0L 2CUMA 5E95B 2FBOJ 3S5LA 4PBVC 1GZQB 3ORJA 4XP1L 1IAKB 5D2NE 4X80L 5I8OH 5DD0L 2J4WL 1HXMA 4PRPB 1Z3GH 3VFOB 4YHKH 1SYVB 4PGDB 1JHTA 3U1SL 1H3UA 4QXTA 2CLZA 4NNPL 1N3NB 1S7TB 3VXTA 1CXFA 1IMHC 1NC2B 25C8H 4ZNEA 3T3PF 3OAZH 4KZEH 4U3XA 3WHXA 4CGTA 1Y6NR 1ZLSL 5HHPB 3OXRA 3TPUB 3LEYL 3SE4A 3C6LD 1VFBA 2ARWA 5IW6B 4JRXA 4PYGA 3QG7H 2EICA 5D1QD 5CINH 2QHLA 2MSPA 4CVUA 2CK2A 4M6OL 3BZ4B 5KVGL 1M7XA 1VESA 3CFCL 4LLDB 3TH4T 3FFDB 5SWSE 2FBJL 1U8KB 5E99L 1F42A 3E3QE 3WHE0 5IHZB 1MHEA 3NTCL 5C0EA 3O3DA 1OWRM 5ITFA 5GGQL 2RFXB 4LQFH 2HVKB 1HCFX 2R29H 3V4PL 4HIEA 1ETZB 1WT5C 5D7IB 3MV8E 1QOKA 5EOCL 5DJZA 4Y5XA 3VMPA 4FQHA 5JA9A 1T20B 3B9KB 3WIFA 3IGAA 3V79C 1K4CA 2E6PA 2G9HA 5AUMB 1T7ZA 3GHBL 4GKZA 4NO2B 4OCWH 2Y5TA 3D3VE 3BXNB 2ZCLL 5F8RC 1AKJD 2VISA 2DQTH 4GAYA 3F7VB 2MCG1 1ED3A 1NGXA 1EO7A 4JB9H 3ARVA 3FZUC 3QDJB 1H5BA 4Y5YC 1XCQA 4IRZL 3SDDD 4M93B 3OJDA 3U83A 4E41A 1OCWL 4OCRL 2GSGA 5J13B 3GMNA 5IB5B 1OSPL 5E8EA 4UOW0 3O2DL 1N0XL 4Q7DA 3U7WL 3BIKA 4GMSH 1ACYL 1LO3H 5ADOH 2D7MA 4MLIA 2VLJA 4PJEB 1RJZB 3PIQA 4YWGL 4EXKA 1WWCA 3BZEA 5C09E 1RFDL 4YJZL 3WJJC 2MFNA 4HKZB 3NZ8A 2EH8H 3CVHB 1U8PA 1YEFL 4NQDA 3PQYE 5DJCA 4ZOCA 3GJFH 2VQTA 4NDMA 1T7YA 5TDPA 3WFZA 4NBYB 4WRLA 2VZUA 2VDNL 3RWFA 3O4LE 2BERA 4RGMB 1D6EA 4O02L 4S1QL 4TVPE 5KW9H 4PP2B 2F19H 2J6EA 1OGTB 1HINL 4YPGA 1IC4L 3RVVD 4M00A 1T21B 4JDVB 1A6ZB 3SDAB 4I3RL 4R2GB 3QUXD 1FG2B 4QO1A 3DARA 3JV5A 4L8SB 4K94C 5IVZA 3S36H 2X4SA 5GZOC 2V5MA 4WVRA 2IFFH 4LVNB 3RIFK 5LJYH 3G9AB 3S88H 4HH8A 3W9DA 3UO1L 1B4JH 3ZSSA 3CNKA 4QRUB 4GW4A 2VAAB 4NRXB 4MNGE 1KLFA 3VXRD 5EN2B 3GNMH 1E4KA 2I07A 1DN0B 3N06B 3OJMB 3LEVL 4QCIA 1KJ3H 1NGWA 4L8BA 2VKWA 3NH7L 1YYML 4A2LA 5EZIH 5HI4C 3GSNL 1T1ZA 2AS5M 4S2SB 3ARDD 2NY3D 1R3JB 1NSNL 3T08A 4G9FA 2DJ4A 12E8H 5CSZA 1FV1A 2CKBB 1UC6A 2CUHA 4KAQH 4BKLA 3MRNA 1AXSB 1Y18B 3HG1A 1J8HA 1CL7H 1LO2H 1A5FH 1UADC 1UQSA 3UAJC 1CDGA 2VLKB 3FT2B 1A6AB 5BJTB 4R4FH 2V17L 3GSWA 1FYTA 1DVFA 3QDHA 1UJ3C 3GSUB 4K2UL 1RZGB 2D2OA 3CXDL 4ODWA 3WD5L 3RPKA 4XNMA 3O6FD 1I7ZA 4D0BA 3EDKA 1CR9L 2HKHL 3EDJA 3VA6A 5GIRA 2DQEH 1OD9A 4M61B 4PJ5A 3EO1B 4Q9RH 5E70A 5D7SL 4Q9QH 4TPRL 1CBVL 2ESVB 2FNBA 2M8XA 2BRRL 5DQJB 4J3WA 5ISZA 4JE4B 2E9BA 3I50L 1U8NA 1JUFB 3QI9B 3QO0A 4CVZB 3QEGL 3T8XB 3SDYL 4YIQB 1H3TA 5IQ7L 2IADA 3C2AH 3KXFA 5T3XH 2B5IB 3QEQB 4WFFD 4LHUD 1SY6A 2BY3A 3KPRA 3ULUE 4EI5C 2W38A 1F11A 5L2JA 4L1HA 2QLVB 4AMKL 4Y19D 3RHWF 2RBLA 2YS4A 3IAGC 3ARBB 1U3HC 2AEPL 5TFSH 3N50A 4WDIA 5DJDA 1T66D 3BH8B 2DM2A 4DN4L 3ZDZE 1LDPL 4YDJA 5C0BB 3EOBA 3IS1X 3EOTH 4XNQA 5HYSG 2R0WH 5K9JL 1CIDA 4JY6B 1N64L 2B20A 4QEGA 2JB6B 4XCCH 4ZTPL 4D0DB 4YO0A 3VD7A 3LN4A 3T04D 5F93C 1F4XL 1S7SB 3ZHKA 3MV9B 5MI0C 3VXPA 1FAIH 4LLVB 1YEJL 1XGYH 2L4OA 1FL3B 3EO9L 5DXWA 4HH9A 3GGWB 1T89C 5TGBA 1AP2A 4YC2C 3KPQA 2ENSA 5T5NF 1BJ1H 3TA3D 5CKAA 2HTLC 1FO0L 5I1IH 4KROD 5DJAB 3OKDB 4LPCA 4X9HA 3AU1B 4ETYA 5AD0B 4OZGE 2P5WD 4J3TA 3ULUF 2VH5H 3HNTH 4GXVL 2OR9H 1DSFH 3CMOH 4LLMA 4PLNC 2R1WB 1CICD 3VXMD 5IQ9B 1VFUA 1XR8A 2EDXA 2DIJA 5TE6L 4OJFL 1I8KA 1BQLL 1I1AC 3C87A 5DVOA 1DJSA 4HIXL 2FIRT 5CZXC 2Q87A 4OLVH 2NLJA 1GAFL 4M6NL 3RNQB 3ZDZF 1ZT7A 4DUXA 1BPVA 4PGBA 4DVRH 1ORSB 5FYJU 4HK0B 4WFEE 2BJMH 5E6IA 1QVOB 1RIUL 2IAMA 1QNZL 5HVHC 1I1FA 5ITBL 4PJFE 3K8MA 4PRDA 4M5ZL 4Y4FC 1S7QA 4ZFZA 2B1HH 5F7YC 2Z8VC 5T1DH 3QO1A 1R5IB 1NEZB 1UGNA 2NY4C 1MFAH 3V52H 2QBWA 4HUXA 2X4UA 1BFOA 3SCMB 4JGMA 3D0LA 4Z78B 2NY6B 4RQQB 2VL5A 1F00I 2V7HA 4HJGB 4OZGF 5T1LA 4I4WA 3RQ3A 2BVQA 5CSBA 1IAIH 3ULSB 2BSRA 3MQIA 4G3YH 2ZCKL 1RURL 1RZJH 1U91A 2HWZH 4P2OD 3QHFL 3WDHA 1A6PA 5JHDE 1A9EA 3G6AB 3PWLB 5CILL 3BWAB 3IFNH 4ODSH 2OX5A 2VC2H 3MNVB 4CUCA 1JWMB 1L9NA 4WWKD 1WITA 1NAMB 3H7BB 4POUB 1RIHL 4P23D 2XKNA 3LIZH 3MLTA 4LPYA 5DZOA 4PJFF 3MV7A 1TDQA 2YXMA 2R0LH 3E8UL 2XQBH 3QEHB 4MCZB 2GSIA 1TNNA 1Q9KA 2VIRA 3MRIA 3NGBC 4LCUB 2FO4A 1MI5B 5DT1L 1R24A 4PJDE 5DSCB 3VMNA 3WUWB 3IXAA 3HPJA 3BKMH 5IB3A 5GGSA 2FX7H 3RWHB 3VWKA 4KVCH 1H15B 4F8TA 5JQ6L 1C7SA 3DTXA 4G5ZL 4BQCA 2BK8A 5FO9B 5I1AA 3RTQD 3QIUA 5ECJE 4BH7B 5JPNB 1KPRA 4F15C 1NJ9B 4OCYL 3T2NH 4MVBD 2GK0A 3FQRB 4LSSH 2BSSB 1DEDA 4JCMA 1LEIB 5EO1B 4D0CA 4XNUH 1AJ7L 1ES0A 5F1NA 3MACH 3O4OC 4YXLL 4LMQE 4XPAH 1YEHH 3LKNB 2X1PA 2EXYC 3ARGB 5J6GA 3P0VL 4P9MH 4MB4A 3MRHB 4MA3B 4DK6A 1PLGL 4OFKA 5LXGH 2FEDD 5HHNB 4NBXB 1QRND 3GBLA 1U8JB 5C86A 3TBVB 4DVBA 2IAND 3VA2C 2CDFA 4MGXA 5GGUA 2LQRA 4YR6B 1GHFL 3UP1A 4PJDF 2DI8A 2A6KB 1FFNB 3O11A 3P4MB 2BNQB 5TE7H 4ZXBA 1OAZH 1B0RB 3REWB 5EOCJ 1IGCH 4JQVC 1NBZB 4PJBA 4XPBL 5JO5B 5L7XL 2D0HA 5FO8A 3CMGA 4XAKD 4HF5L 3B9AA 3MZTA 5JNYA 2IGFL 4FQIL 1B90A 1U2CA 1KOAA 5JHLL 5I2IA 1NMCC 1ZSDA 4HXBH 3UTPD 3VGBA 4WHYG 3KYAA 1EXUA 5I1CH 3O6KL 3MRQA 2EC9T 4X6EB 1MF2H 3SPVB 3C6LA 3W9EA 4LAQH 3O2DA 4KTEL 4Y1AB 2OSLB 4IDLA 1IKFL 3SDXB 2ZNXA 3CFKB 5D1QA 5C6PB 4XCEB 2O5XL 4ZNEE 2F15A 1G7LA 3MJGX 3IRZA 4BFIB 5HDLA 3BKCL 2Q6WB 1PJ9A 5E7FA 4PB0L 1KXQE 1S78D 3QCUH 3CIQA 3V6FA 3T1FB 1FJ1A 1KCVH 1BVZA 1V3KA 1R3HB 1DQLH 4UTBH 1NKOA 4L29B 2EDDA 3TH3T 2R2HB 2CLVB 4QHNA 1PZ5B 5LVEA 3PL6B 1JNHA 4PGZA 2FX8L 3RL1A 2WIIB 3H9ZA 4APQD 1A3QA 4OF5A 1YNKL 2DTMH 2FWOA 1EBAA 1HSAB 3L3DA 1A1NA 5TDNB 5JR1L 1T4KB 2AW2A 2H2PC 1BLNA 4DZ8B 5DRNA 3HAEG 1BZ7B 3HMXL 2QADD 2AK4D 4HPYL 2VDMH 4WTWA 2KQNA 4AYFA 5IB4A 3LPFA 3LS4H 4U1IB 1XF3B 3VI4E 4KJYB 3WXWL 2H9GB 3D39E 1A7OL 4MA7L 4YZFE 3ARXA 3X12A 1Z5LA 1JRHI 1HKLL 5IVOA 4ZFOA 1MHCB 2D4DA 3QUYD 4Y4FA 3CPLB 3WDJA 4JFPA 3V6BR 1D6VL 1S9VB 4FN0A 1P4IH 3FO1B 3D85B 5F6HI 5FYJD 3PV6B 4JZJB 5GQBA 2DL9A 5CGYC 5FF6A 2OI9B 4QNPE 2V5YA 3NN8A 5CP7A 1SQ2N 1JF1A 4JM4L 4KKBD 2ZUTA 1HYRC 4L3ED 1HYSD 3QA3A 4Q58C 1WC7B 2DQUH 3QXAA 1FFQA 1QBLL 2UY7A 2VLJE 4YXHL 3IDIB 1FSKB 3UJJH 3F6LA 2HFEB 3AMLA 4ZPVA 4ONHA 3MUZ1 2XZAH 2X44D 1DN2A 3CFJB 3VI4F 2Y23A 4JHBA 1N4XH 4NQDE 1IE5A 2F5BH 4YZFF 5IG7A 3BZDA 3SBWA 5D7JB 4P5KA 4GKNB 2ADFH 4KGLA 5C2BL 1FAKT 4NQVA 5ADPH 4JZOB 1YJDH 4LSRL 1OHQA 4PUBL 3F5WA 2YPVH 3O45B 4BZ2L 1SEBA 3R8QA 2LVEA 3GBML 1MFEH 2JKXA 1D5XB 2RHEA 3M8OH 3MUJA 4IDJL 4PJ7A 3L95A 3KWWA 1ZLWK 2G2RA 3DBXA 1BP3B 1A1MB 1G6RH 4YHLH 4F7PB 4N0UA 4JFQA 4U1JB 4DJMA 3LB6D 3HE7C 4EVNA 1TPXC 2QV2A 3LRSB 4ONFH 3WN5A 5IB1B 1G9EA 4M9PA 4FHBD 3PF2A 1J86A 1G7MB 5I76A 4G8IA 1ZVSB 5F7MC 4R26H 4MNQB 1KGCD 3NFPA 5GS1C 4DWHA 3ARDA 4ZOBA 1XH3A 2JJWA 5FK9B 2QQQA 3P9LB 3I02B 2DKSA 1FE8H 3E6FA 4H5SA 1LGVA 2J5LC 5C08B 5ENWB 5HHOA 3MLPA 1NGYB 3IETB 1RK1A 3BD4A 5IEKA 2GJ6D 5JW4Q 4PBWD 2QKIB 1NGPH 2DB8A 2EXWC 4H88L 3KPPA 4E5XA 2D31B 3GJFB 4O2EA 5ICYB 3UBXG 3N1FC 5B39B 5IBLD 4G6AC 1QLEH 4KRMB 5CEZL 5JXEC 1SMOA 2IG2H 2NX5B 3O6FA 2FHFA 4RDQG 4XB8A 5DHVA 2VE6B 1LP9B 3VFMB 3HG1E 5SX5H 3QJHA 1J8HE 3V6ZA 4CVXA 3NCCB 4PJCE 3G6JA 1G7PB 1FYTE 4CDGC 3PWPD 1IEAA 2BFVL 4Z0BL 4OLUL 5EORH 4L9DA 4DQOL 1KTDB 3SOBH 1F6LL 4RFEA 2BSTB 1CLOL 2DQDL 5LCVH 1QFWM 5JLZA 4PJ5E 1A0QH 3V2AR 4N0CC 5T1KA 1UXSA 4JREC 2XWTB 3Q6FB 3SGDI 2F58H 1X5AA 1C12A 5BZWA 4HKXA 2CDEA 1CFQB 5ISZE 2VDPL 4XVUC 1O7VA 2BVOB 3CU1A 4Y19A 4IEFB 1MCOH 4XZUA 2FGWH 3KXFE 5D4QA 3HI6L 3SDCB 3HPLB 1NGQH 4MJ2A 43CAB 4NHCH 2AAVA 2ATKA 4IIQA 1II4E 4PJCF 4XXCC 5DTFA 1KFAH 1UZ6E 3FB6A 5DO2C 5L2KE 5DR5L 4E42B 2E8YA 3TZVB 1ZK9A 4FMKA 2PXYB 2NXZC 1KC5H 1K3ZA 1M7IA 3C8KB 3VFSA 1PDKA 3SN6N 2ENYA 3LKSA 4ZS7H 4HG4K 3LKOB 5MHSE 3QQ3A 3TIEA 4JVPA 5JORA 2I5YH 2P8MA 3UJIL 1HH6B 3TA3A 2BY2A 3QIWB 3FFCD 4HWNA 5DRZA 4P3DB 2GQHA 4NQEE 3GI9L 4S1SH 2AABL 2EECA 1U3JA 1CICA 3VXMA 2OJZH 4LLUB 5KSBA 3BD3A 3R06B 3OB8A 4OAWB 1JMXA 4DZBA 1MHHA 1JHLL 4WGWB 3F12B 3T0EC 5JW4M 2R9HD 5CSGA 4NPYB 1CT8B 3QZWG 5FYLH 1R5VA 4FQQB 1FLRL 5T3ZH 4PJXA 3QNYA 1UZ6F 5C9KA 1YY8A 1ZLVK 4XX1E 1DEEA 4YHNB 3D2UD 5A3ID 1RU9L 3HMWH 1V05A 4LNRB 3D25B 3OJ2C 5EC1B 4U2YA 1HH9B 3V5KB 3FCTA 1YPZB 3V8CA 3VGAC 1F4YL 3BP5B 4EN3C 4KKCD 3QWOB 3WNLA 3A6BL 4HMCA 5D7LD 4TNVF 4X5LA 1FGVL 1BEYH 1DR9A 1E0OB 1VACB 4NQXB 4BSWB 2A9MH 3HZMA 2VOTA 2AK1H 4NWUH 1ZGLA 1AGEB 3LD8B 4LKCA 1OAXH 2DMKA 1T83A 3ROOA 1D9KB 1CL7I 1TZGL 4P2OA 2FZ3B 3FO9A 5KVEL 1YQ2A 4XAWH 5DEGA 2Z4QB 4P4RA 4IRSB 5I1JL 1AQKH 4AEHL 4U7KA 2HT2C 1AD9B 2VR5A 1FGNH 3WKMH 2AJ3A 1HOCB 3B83A 5ESAB 4ETQB 5E4EC 4J4PD 4P23A 4FXKB 1A4JB 3AFLA 1E4XH 1FORL 5C07D 3WLWC 3G5VA 2OS7A 4NKDB 5J9PA 3GI8H 4P2CG 1J05B 1KT2B 4BQ9A 1UACL 4WUKL 1YMMB 3KVQA 4QRQB 2EDQA 2P5ED 2O61A 4A6YL 1GJIA 1HCVA 1BWWA 3EDEA 4KRNA 4HC1L 4PTTA 4P46B 5BQ7A 1ZLUK 4MDIA 5F6IB 3TVMA 1QBMH 4QHLA 5F7EH 2OTWA 3VGEA 2EYSB 4NN5C 5JW5A 4XXDA 3ARZA 1G7HA 4XMPH 1LO5B 1OTTC 3R0MA 3JV4A 1EH9A 2X7LB 4LLAA 1OAKL 4U0RC 2UYLB 2BZDA 2FL5A 2K7QA 4K23L 5F9JA 3TYFB 2KL6A 3W82A 5JXEA 3M07A 4YHIA 3SQBA 4XRCB 3P30H 5JXAL 3BQUD 3GMOA 4YQXL 5F9WC 5LQBH 2MPAH 5I8KL 3C6SA 4PJGA 4KK8D 3QCTH 4MSWB 2EH7L 2VQ1A 5DS8B 5I73B 2NTFA 4RWYL 2CLRB 4LARL 1ZA6B 2FO1A 3VW3L 1Q0YL 1CXIA 4AEFA 3DX6A 4RZCB 5B22A 1RJYA 2K3TA 2NY0C 3U4EA 5IHLB 2C7UB 5DD1L 3ROLA 3WFHB 3V5DB 3HNVH 4UUJA 2EDOA 3EYVA 1FZMB 3DX7A 3NCJL 1W72L 2HRPH 1J0JA 1TXKA 1RJLB 4LDLB 1A7PH 3F7YB 4HUKB 2K1MA 1FN4A 4N8CH 3HFML 5E8DH 3H42H 1DBKL 1JP5A 4LIQH 3RL2A 5LAXA 3LPGA 4CADA 3QIBC 1JPGB 2VWEE 3S35X 1NCCH 3TJEL 2D7QA 2IH3B 5EWIL 2XXMB 3SGJA 3LOWA 1CFVL 5J12C 5K9QI 5SWZD 1BBDH 2ADGA 3FRPG 4NN6B 1VGKB 3THML 1I8MB 4LVHC 5IJKA 3MGTB 3PDGA 1QFPA 3DV4A 5DHYB 4YEFA 4XPTH 3Q0HA 2NYYC 2UZYB 4E0RA 3GMRB 4XVJL 3BPCB 5LWYH 4L4TB 4UILL 2LE9A 1RPQA 3TN0C 1KCLA 3ZKMD 5EZLA 1KXVC 4Z8FL 3BO8B 4KTYA 1RUPH 3I75A 4PR5B 3VJ6B 1IAII 4APQA 5D93C 2C3VA 3TO4B 5FECB 4I48A 3WNMA 5GJSL 3IFLL 5E00A 3MBXL 3HE6B 1WZKA 1TZIA 4BZ1H 2P48B 4P59L 4PJ9B 4NN7C 2F5AL 4K94H 5GRUL 5BV7L 1KEML 3WFDH 4WCYH 2AK4A 4X5XA 3SKMA 2QHRH 3P77A 3LVEA 4ZDHA 3C60C 1N6VA 1VCAA 1KEGL 2X41A 1BD2A 1S7WA 5F3BA 1FPTH 3L5WB 3F7QA 1P1ZB 3CFEA 3HUJB 2H6PA 2R15A 1YN7B 3DV6A 2P43B 5TF1H 1ADQL 3ARFD 1ZT1B 1DCLA 2Q7YB 3QDGD 3DX8B 3A6CH 3U9UB 4Y16D 3KLAB 4PJ8C 5C0IA 4BSVB 4ONGL 3FRUA 2PR4L 1JIBA 3O3EA 1A6VH 1I4FA 4OCMC 5J6HB 4QXGH 5IW1B 4CN4A 4XCYA 4PGJA 3FO2B 5JIKA 3VRJB 1NGZB 3I2CH 4L3EA 1KN2H 3B3IA 3MLVH 2RCSL