5JW4Q

Structure of medi8852 fab fragment in complex with h5 ha
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
222
structure length
177
Chain Sequence
QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSYNAVWNWIRQSPSRGLEWLGRTYYRSGWYNDYAESVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARSGHITVFGVNVDAFDMWGQGTMVTVSSASTKGPSVFCLVKDYFPEPVTVTFPAVLQSSGLYSLSSVVNHKPSNTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Structure and Function Analysis of an Antibody Recognizing All Influenza A Subtypes.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Immune system
total genus 33
structure length 177
sequence length 222
ec nomenclature
pdb deposition date 2016-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jw4Q02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jw4Q01
1MHCA 4M93C 3LEXB 1J10A 1SVCP 3HNSH 1UM4L 1QA9B 4HT1H 2Q7YA 3HI5H 4M62H 1HILB 3H9SB 1JPFA 2D03L 5I15H 1P7KA 4HUWA 2BFVH 3TJEL 2YD7A 4S1DC 4I3SL 3MUGA 4UV7L 4NQUA 4XC1H 4AT6B 3K1DA 1QRND 4QGYA 1GZQA 4NO3B 4EOWH 5GJTH 2D3VA 1Z9SA 1LK3L 4PJAE 4DUXA 3IGAA 3S96B 1C5CH 5DJDB 1MJUH 4K94L 1IVLA 1UB5A 4Z0XA 4WGVB 5C0ND 1N0XH 3GKZA 5E99H 3LMJL 4TRPL 4GG6F 4RSVA 1N6QH 5IG7A 3BXNA 4HGWA 4D0CA 4H26A 1BM3H 1NUDA 1K8DB 2VQTA 2X89A 3OQ3B 4OZIF 5ABDE 3EHBC 3F7QA 2YKLH 1XF2B 4HLJA 2J88L 2WW8A 4X98B 3MACH 1CDBA 5D1XB 4U7SA 2JJWA 1KGCD 3JWOC 4YHZL 3NA9L 1LP9B 2E5EA 4RGOH 4PJDE 1MRFL 1AQDA 5K33A 1FHGA 2NW2B 1ZAGA 2EE6A 4XCCL 3IDYB 3L3HA 1UWGL 5AG8A 3BJ91 4G8GB 4KV5E 3T0WA 1DEEB 5TDNA 3WHE0 2CKBL 2DYPA 5E2JA 4XPBL 1NAMA 2DI9A 3X3FL 1UB6B 4YDIH 4E0RB 4JPWL 1YEFH 1FZOA 2OJEA 3ZKND 3WSQH 3D9AH 1CL7L 2DMKA 3FQTA 3P77A 2I27N 1CWVA 1AJ7H 4JFDE 3GJFB 4ZYKA 2X1XR 4QRTA 5AZEH 1I8KB 1RHFA 1FG2B 1OARL 4X5WB 3WHE1 5D1ZB 3RVUC 1C16A 1FP5A 5ERWB 3GSVB 3FN0H 2ZNXA 2AEPL 4XGZA 3PWPD 1A1MB 1RUQL 2ADIA 1DBBL 5GZNC 3TH2T 4HC1L 3OKKA 1T7ZA 3WFEH 5JW4R 1RHHB 3PGCB 3SCMD 4MNQA 4B7LA 1S8DA 2AXGA 2GTZB 3T0EB 1OAKL 5E4EB 3DRTA 5CBEB 2JCCB 5GZOC 2VWEE 2EE3A 4PJFA 4A6YH 3RHWF 1X5HA 4YX2H 3U7WH 2W65B 1FO0B 5DD0H 3CSGA 3UTTA 5IT2H 3IDJA 5KZCB 5IQ9B 5ESVA 5ADPH 1JYVA 4TNWF 4FQCL 2GJ6E 2VXVL 1OM3L 4HDIB 1IAIM 1ZK9A 4MDJB 3QFJB 3VGEA 4Q97A 5D70H 4J4PA 5AZ2L 1JZ5A 3S36X 5IVZA 1VEPA 3DURA 4B7IA 3STZA 2WK2A 2K3TA 5CILL 3O6FA 5FIEA 5IW1B 3VFMA 1CD1B 4PJEA 4GQ9L 3AM8A 3MJ8B 2Z31B 3J7HA 4K3HA 4NHCH 1ZLWK 2ZOKA 4K9EL 2I5YL 4JFFD 3QEHA 3H9ZA 1I7RA 1K3IA 2QQLL 4PGCB 1OPGH 2NXZC 4H25A 5SWZE 3QO1B 1OW0C 3S3PA 4KMTL 4RFOL 1K6QL 4R96B 1GGCH 3V52H 1G84A 1U93A 4OCYH 2DWDA 5EA0H 4UV4L 2GUOA 3MUJA 2R4SH 4X6EA 3CFJA 4U1SA 2XZAL 1UEMA 4HC1A 1KCRL 4YC2C 3S35H 5ISZE 1AFVL 2DBLH 4YUEH 1OGAE 2IPTL 1FLRH 1WFNA 1HI6A 3HE7C 3BPOC 2VLLA 5CS7A 4UT7H 4YO0A 2FSEA 1ACYL 4K55A 5KSBB 5FA3B 2F8XC 4OQTL 4HXAH 1U8NA 4YDVB 4N0UB 5BZDA 2DKSA 2JIXB 2YWZA 2P8LA 3OG6B 4IMKA 3MOAH 5FGCE 3TYGH 5EORH 2QKIB 4RDQF 4PGBB 3PQYA 2DMCA 2XTJC 4S1SL 2QTEA 2GSIA 3SDCB 5IGXH 4ONGL 4Z76A 4JQXC 1EUTA 4R7DB 3ZL4L 5GRUH 4MJ5A 4K23L 2IAMC 1T04A 1AO7B 1EEYB 5D7KE 1UVQB 3UTPD 1DN2A 4JKPL 3TH4T 2KDGA 5IB5A 2EDBA 1PKOA 5FGBA 3VXOA 1FAIH 1KIRA 3D0VA 4O2FB 3HZKB 4UUJB 4ZXBD 5I1CH 4JRXD 1IC5H 4G8FB 5ESAB 5DQJA 5IVXE 2L0DA 4G8EB 1QYGL 3QG7L 4OIIH 3W2DL 4JO4H 3ZDZF 3T0DA 2VN7A 4JKLA 3LPGA 4NRZA 3MR9B 2WZPD 4KRPB 3MRNB 4K3EH 1FH5H 4Y4HA 2CK0L 4XNMA 1MRCH 3OKNA 4TTGA 1MIMH 5DLMH 4KROC 4M6NL 4G6JH 2RFXB 1FNSL 3KPTA 4MZ2A 3M8OL 5IESL 4G43A 2VZTA 1G9NH 3ULUC 4RQQB 3HPLB 1PEWA 3MLTB 4QRUB 4GLRH 4P46B 4OM0H 1A1NB 3NCBB 2AK1L 2KZWA 2DB8A 5I8CB 1JBJA 1NDGB 2B2XL 3WHXB 3ZDYF 5I1DA 2A6KB 4MA3B 1RULH 4YBLB 3FRUB 4AMKH 1UWEL 4HWBL 2DQFB 4JHAL 3FRPG 4C56E 1YEDA 3OAYH 3CXDH 3HC3H 3G6JF 5EOCL 4Z7NF 1T2XA 1NFDE 4IS6A 3NCEB 1J0IA 4X8JB 2Z35B 4M6OL 4Y16B 3HUJE 1XZ0B 2HJFA 3W39B 5CKAA 1IGMH 1RIHH 4PJIF 4GRLB 2AJ3B 2XFXB 1MWAL 2R1YB 1I1CA 4F37K 3BGAA 1WLHA 1GGIL 1LEGB 4LVOB 1A4JA 2FX8L 3TBYB 3KPRD 4Q2ZB 1A7RL 4WCYL 4Z95L 3EYSH 4XPAL 1LMKA 3VFRA 1Y6KR 3SPVA 4G5ZL 1AGEB 2JJTA 4Z7UF 2ZSWA 3DO7B 4XC3H 1JHKL 1U8QA 3WNMA 3IF1B 1JI2A 4A2MA 4XMKL 5DC4B 1J1XL 3H9HB 3U2SB 2SEBA 1WIOA 5CIPB 2UWEA 5BW7A 4ODTL 2ZCKL 2R2BA 4NP4L 2HKHL 4XX1E 2MFNA 1DL7H 4IMLB 4UDTB 1L4IA 1U8LA 3B9KB 2GSGA 5F7EL 2YK1H 4WEUD 2R2HA 4CU7A 5I1JL 2MWCA 1MCOL 3BRFA 4ORGB 5DFVC 1AP2A 1I1AD 2G5RA 3V6FB 2J12B 1YMHA 4LVHC 4LKCA 1UXSA 4RGMC 4PR5A 1CDGA 1MH5B 5JIHA 5LXGH 2XKNB 5EN2A 1U2CA 5B3JF 1QR4A 2ZUSA 3QDMB 1U95A 3QXAB 3RY5A 2ENYA 4F15B 2EYTB 4NO2B 5DK3A 3QHFH 3LKRA 2Y07H 3CFEA 4QO1A 1G7LA 4MA1C 4XAWL 4FQXD 1IRAY 2CRZA 2COQA 2FYYA 1KUMA 3VWKD 1CGXA 1MWAA 2J8UE 4F7TA 4YE4H 1KB5A 3Q48A 3EKCA 5KW9L 3QDGB 3ARTA 3MGAA 5IMOA 1KC5L 2F53E 5GRYA 2XNAA 5E7BA 2OQJB 4MNGE 4BQCA 2MPAH 1ORSB 2BSTB 4JFQB 3CFKA 3P2TA 5CEZL 1JZ7A 5GPRA 2DQUH 2X4NB 4V1DB 1ED3B 3QCVH 3JWDC 2M1KA 3O3AA 3TCLB 1QR1B 1BLNA 4P23D 1IL1A 3QEUA 2BSSB 5KS9B 5HGBB 1ZOXA 1CFBA 4D2NA 1XCQA 3C8KA 3FQUA 3KS0J 4CGTA 4M43H 3O2WL 3REWA 1FJ1A 1PW3A 3CDFA 2NTFB 5F7LB 4ZTPL 3HE6D 3MLSL 1JN6B 1T5XA 2Z4QB 3V6OA 4LU5H 2VITB 4J4PC 5E2UH 1CGYA 3QBTB 3ROLA 1HZHH 5ACMA 5MENA 5JDJA 4Q9QH 3O6FC 1Q0YH 1S5IH 4U4BA 4H8WL 3UMTA 4U6YB 3AM8C 4U1LB 3PJSA 4DVRL 5HI3C 1V3KA 3BAEH 1HXYB 3GB7B 3O9WD 5HYSG 1VGKA 4I0CC 4J3TA 1P7QB 2RQ8A 4X6CA 2VNCA 3BZEB 2J4WH 3L9RA 1Q72L 2PTVA 3R1GH 1HHIA 4NRYB 3QUXD 4S1QL 3TP4A 5C8JA 1JYWA 3GSNH 3RWGA 5FK9A 2B1HL 5LGJA 5C3TA 1A6TA 2JJVA 5TDOA 4GW5A 4RZCB 3EO0A 3S36L 5F7UA 1D6EA 1T2QL 3LZFL 2X4TB 5B8CA 1FSKC 5ENWB 3U4EB 1VEMA 2VLME 2AK4B 2E27L 4L8SB 3VGBA 3MV8A 5FCUL 4AM0A 3I9GL 2I60H 5IHUL 1XFPA 4I48A 5JHDE 2BNQE 4OT1L 1TZIA 1FIGL 4ZSOB 4J23A 3U0TB 3ABZA 3T8XA 2HTKD 5BRZD 4IMKC 3MJ9H 3KLAA 5HVHC 1M7IA 4XCEB 1LEKB 4XMPH 5J13C 3E6FA 2VDML 1CLOL 1U8JA 3F12A 4OD1H 3MRBB 1MI5E 3TO4B 1N4XL 2XA8H 4H88L 4XPHH 4LMQE 1A9BA 1NGPL 3GBMH 3L7EA 3PWVB 4G6FD 4GO6B 4TULH 1LE9A 4JDZA 1HSAA 5BV7L 2AJXL 5I1IH 5JHLL 2DQIL 4MAUH 3N1PC 4NBXB 4NNYA 3T1FB 4RAUA 5FGBC 3TT1H 2BY0A 1LO3L 5INDA 3EBAA 3MGOA 2XIDA 5ALCL 5EO0B 5IJVA 3LSOA 1AXIB 5DHVB 1C7SA 4RX4D 1NLBH 3VI3E 1G7IA 2WWKT 2OTWA 3KR3L 4HX1B 4YGAB 5CJ8A 4U6VL 1BBDH 4M7JL 3QH3B 5DI8A 1N7ML 1T6VN 4MJIE 1FYTD 3NABL 4CVUA 4Y4HC 1J5OH 3OAYK 1ZWIA 5EC1B 2G9HB 1MSPA 1ZHLA 4KHXL 5DZNA 2BK8A 4PP2B 5EU4A 1J8HD 3BPLC 1HSBB 4S2SB 1BZ7B 1NGXA 4MD0B 1CI5A 3RWCA 1N2RA 3O6LH 4ZUSB 1AY1H 4IRSD 4X6FB 2JELL 3LEVL 2P7TA 3PWJA 3ARBB 5KJRH 3V5KA 1I8MB 4Y2DB 1GJIA 1QBLL 2BVTA 3UJJL 4JVUA 3L3KB 4NM4H 1Z2KA 5FHAL 2C5DC 3T4YA 3TIEB 1UXWB 2BDNL 1KLUB 5HVWA 4HIJA 1BJ8A 3QUYB 3T0AA 5DYOA 4XB8A 1QSEE 3EOYG 1SYSB 3QZWG 1G6RL 1OSZA 4KTEL 4TSBH 2NY0C 3PWPA 2V17H 4APQB 1OLZA 1MY5A 2GK2A 4UDUA 3FZUD 2X4QA 4QWWD 4NQVB 3MLRH 1WT5A 4G80A 4WFFE 1UH3A 5HHOA 1FORH 3QWOA 4KQ3L 2QQNH 4QRRE 3DJ9A 3MRJB 4JFZH 4Y4FD 1X5AA 5A1AA 4ZFFB 1IAOA 3MROB 5F71A 1NCWL 4LLDB 4LSQH 1ZHBA 4HUNB 2DQCL 1H9VA 1JVKA 4G7VH 4OTXL 2VMFA 1PSKH 3K4ZA 1INDL 3BEVB 3MXWL 1NCCH 3B6SA 1ND0B 3LRGA 1XF1A 1F6AA 1OVZA 3FB6A 1U8OB 3VA6A 4U1IA 4BQ8A 2JJTC 2AXFA 5A16B 1ZT4B 2ZKHL 2F54B 4QHMA 3VFTB 4ORZC 5E5UB 1WBYA 1FZMB 4P5TB 3IJHB 4PD4J 5TQ0L 3SDAB 4P3WA 1GZPA 5DK0B 5BW7C 1OTUC 4IBLT 3FO9A 1CU4H 2VDOH 3RUGE 3U30B 5BJTB 1K9TA 4WIQA 1MAJA 1I3RB 2HRLA 4PJBA 2AV7A 4JG0L 1MLCA 4U49A 4URTB 4G42A 5BS0B 2B1AL 1XEDA 4M4RA 2BVOB 5DC0A 5F72S 4JFFA 4PRAB 5C0BE 1AXTL 1RU9H 5HD8D 2HRPH 4DOHB 4MB3A 4KZEH 2VQ1B 1EA9C 5KAQF 4AQOA 2M2DA 1G6RA 3MRFA 4A6YB 5FO8B 1ZA3B 4F7EA 5IR1A 5JNYB 3O6KL 1JWSB 3PGFL 3MV7E 1CIUA 4PRPA 2R0KL 3F5WB 2PETA 5E9DE 5SX5H 3BH8A 4YR6B 4M02A 4CN6A 4RBPH 1ROWA 5IIEB 5TDPB 5DVLA 3UYRL 5D7IB 3BN9D 2YZ8A 4Z7OE 3BW9A 1N3NB 5L6YL 4UILH 2PCPA 2IANE 3QNZA 1ACZA 4KWUA 1IGIH 1MHPH 5C0GB 3UTSD 2WINB 5IB4A 2AJYL 3GKWH 4MLIA 5EOCJ 2FJGB 3DYMA 5IMKB 4O2CB 4U2ZA 5A43C 2VZOA 1CR9H 1ZANH 4R4BB 4LSTL 3IXTA 5JLZA 2ICWB 5IHBA 1FL5A 2I9TA 1U8PA 4U1JA 3VA2C 4HF5L 2CMRL 2WSKA 3E0GA 2QSQA 3P4LA 4NQED 3G6AB 4LPVA 3V79C 4O02L 5M94B 4GJTB 1CXFA 3G9AB 3HCVB 3V6OC 1IAKA 3HA0A 1CICD 4JRXA 1EJ6A 3HMXL 1B0GB 1S7RB 2JJSA 1YNTB 3UTQB 3QEQE 2UY6A 5EU5A 4AZ8A 1TVDA 1IM3A 4OF6A 5DR5L 3PGDA 2DICA 1NSNH 1FDLL 4ENEC 4R97B 2OJZH 4IOFD 5I17B 5TFSL 1F11B 3N9GL 5I1KL 3VMOA 2CLRB 1DSFH 1F4WH 2CIKA 3K81A 5HHPA 1ZLSL 1UA6L 4W6WB 4F57H 4NQDB 5MEOA 1XGYH 3WO4C 5ALBH 5FYJE 1UEYA 5FM4A 1MIEL 2YD9A 1YYMH 2VABA 5TE4L 1EAPA 4MXVF 5D2LE 4G6AC 3DRQA 5DJ0A 5C09E 5B8CC 4ODVL 4ZUWB 4P3CH 5BCAA 5CEXA 4LSUL 4X83A 5FF6A 1JGLH 3QUZD 4PLOB 5D4QA 3SJVB 1HE7A 4G9DB 1T1WA 1CXHA 2AEQH 2V2WA 1MFEH 3P0YH 4BA8A 3D2UB 4GG8A 5IHZB 5LWYL 4L9LB 1IC7L 4PYHA 4JVWA 4HWZA 4O51A 5ECJE 2RR3A 3OZ9H 4LBEA 5CP3A 2KBGA 5DJ6B 3FQRB 4PJAF 1U9KA 2DS4A 2J7LA 3L5XL 2BOCA 2LE9A 1MCPH 4L3CA 4BZ2L 3QO0A 5KSAB 4NO5B 1L7TL 1YPZB 3VXRB 4X6BA 4QHUA 5JUEL 5E5MB 1FV1B 4OSUL 5H35A 3OX8A 4I9WD 2XN9E 3O6MH 1BVLB 1JUFA 1WCBA 2QLVB 3AC0A 3CMOL 3KDMB 4OD3H 4H8WC 3GK8H 5C0NC 3FT2B 1D5BB 4NT6A 4GKNA 4R2GB 3KVQA 1UENA 3B43A 4PFEA 3IVKA 4L3ED 5GGUB 4L8CA 4PJ7B 1BP3B 3N85H 4ZUVB 2NY5L 4PJ8A 4PJXB 2AAVA 4YHLH 3TYFB 4PJDF 4UIMA 4EN3B 2EC8A 1MVUA 3QDJD 1PD6A 1EERB 1I1AA 2ERJB 2V9RA 3PNWA 3DBXA 5JPNB 4KV5F 5HHNB 3RDTD 1I7UA 4ETQB 4WW1A 3A6CL 1UWXH 5HJ3B 3OJ2C 2D31A 1JGDA 3GM0A 4LLYB 4PS4H 1YNKH 2CPCA 4LARH 5CINH 1WWWX 1KULA 2M8XA 4POZD 3P0VH 3ZKNC 5GGRA 3T2NH 4PJ5B 3VH8B 4R7NA 4NUJA 5GS1B 3F58H 1KEML 2GJZA 4FQXA 4OZHB 3KPPA 5CP7A 1RZJH 4MLSA 5CGYC 5EB9A 3KPQA 2V7HA 5I9QC 2QSCL 5HHQA 2C1OB 1B6UA 3IU3B 4LCWB 4QHLA 3ULVE 2JB5H 3PDOA 1UFUA 2PO6A 1NC4B 4K8RL 2HLAA 1X5FA 3TPUA 3N0PB 4HIHA 4RMTA 4XMLH 5DJ2A 3BPCA 1WT5C 3GSQB 3P4NA 4IHOA 1BOYA 5MHSD 5BV7C 1QVOB 4ZAKB 4OV5A 1SQ2N 2XZZA 4EKXA 5EU6B 2H9GB 4FZEH 1G7HB 2YD6A 1A9EB 4M4PA 3P73B 3NAAL 1MLBA 3AUVA 5DMKA 5IM7B 2VDKH 4P23A 4OGXH 3C09B 2AQ2A 4FTVE 1CXKA 1FLTX 2UUDH 1N6VA 1F58L 2NZ9C 5GS2H 3MLUL 4LCIH 1F90H 3AS2A 2CGRL 3A0OA 4GMTL 5AEAA 3TESA 3L3IA 1MQKH 5EBMB 1KTRL 3RVVD 2YHGA 3LHPH 3OR7A 1H3TA 1FVCB 5M7QA 3C5ZA 2R4RH 1L7IL 2ZG1A 2C1PB 4K7PX 1QNZL 5SX5K 2FATL 1I9IH 1JTTA 3LD8C 3PWLB 3MLXH 4AIZA 4BELD 4RBPK 3KJ6L 5F96L 4I3GA 3VXPA 5F88B 3LQAL 1WIUA 3TBTA 4E42B 3LH2H 4N8CH 7FABL 4ZFZA 3O3EA 3B2VH 3AGVA 2YUXA 2DMBA 4CRPA 3A67L 3JTTB 4FG6D 4NWTL 4X80L 5TGBA 1T03L 3J8F7 5AD0A 4FQJH 4ELMB 2W0KA 4EDWH 1UACH 2FX7H 5C9JB 4HJ0D 3I3DA 4U0QB 1B4JL 3NPSC 1OAXL 3D3VB 3KXFD 2X7LA 3QUXA 5EU3B 4L3AA 2GAZB 5F9OH 3HZVB 5E2TH 4I3RL 3LDBB 1UKSA 2X4OA 4N0YL 1SM3L 4H5SB 5GRXG 4YLQT 1R3KB 1PEZA 3MLVL 1NBZB 4PY7A 1WWAX 2AV1A 3GI8H 1JPGB 5CJOH 4Z7UA 4LHUD 5KG9B 3CIQA 3RWJB 5E2VH 3NTCH 3KPSB 4FQ2H 2JB6A 5L9DL 1XGQA 3E3QC 4U33A 2R1XA 4Q6IA 3MV9B 2W9EH 2W9DL 3LS5L 4KGJA 4X9GA 1KJ3H 5BRZA 3H9SD 5L88L 4DCQA 5A2IH 3BHBA 1DQDL 1W72H 4LLUA 1J0JA 4GAGL 1WBZB 1NCBH 3KPMA 2BMKB 1OD9A 5F93C 5JDSB 1BQHA 5DSCA 4W6YB 4H1LH 4U1GB 5J9PA 3TPKA 2C3HA 2CDGB 1UGNA 4OFVA 4MD4A 3PIQA 4PRBA 3D39A 3QXDA 3PHQB 4QHNA 3UC0L 1ZVHA 1CT8B 1T66D 3NZ8B 2OSLB 4OCSH 3BDXA 5T3ZE 3GSNB 1DLHA 5EUKB 3QUMH 3CDCA 4XZUB 4J8RA 4FFYH 4DZ8B 2F74B 5C6WH 3LQZA 4RX4A 2IQAA 4JZJB 6CGTA 2JJSC 1IAMA 1WBXB 4ODSH 4QEGA 4X4YB 1GGYA 3DETC 1QSFE 1YN6A 4LCYB 3IFOA 3BSZL 4FFVD 1IEAB 4HKJB 1CZ8L 2XZCH 2BVPB 5HYJE 5D1XD 3W0WE 2HLFD 5JW5B 1J8HA 1NMCB 2VDRL 1I9JH 4ONFL 4ODWA 5K9KB 5EOQL 4QYOB 4M3JA 4DEPB 3HI1B 4IRSA 3BX7C 2GI7A 4G8GD 4G3YH 4I5BA 1QFOA 3QYCA 3VFPB 1RIVH 2O26U 4OLYL 5C0FB 2DIBA 2NNAA 2BRRH 3HRPA 4D9RD 5D2NB 3PABB 5EBGA 3RKDD 4YPGA 4N9GB 3BD5A 4JG1H 1C5DA 4NRXA 1RZKH 5IMLB 3K80A 4FQIH 1NFDF 5D1ZD 4PLJD 1XT5A 1N59B 4JO3L 3HUJF 1KEGH 1RUML 1ODAA 4JDTL 4U05A 4YQXL 3EO1A 1GIGL 5ID1B 3V4UH 4CDGC 1TJHH 1FGVH 2EDTA 3Q5OA 3TZVB 2Y7QB 5F7HA 3ROOA 4OCLC 1S7TA 2ZOLA 1UWXK 5LQBH 4AG4L 4H0HB 3SKNA 2R56H 1JPSH 1XCTB 1XR8B 4BH7B 4XP9L 1R3HB 4JO2H 3WLBA 4TN9A 5I73C 5D1QA 1J0ZA 2ZPKH 3INUH 2AGJH 4NBZB 5KZCD 2EDQA 4ESKA 1T5WA 4UAOB 4IOSD 4ODUA 1HQRA 4EJ1C 3NH7H 3E6HB 3I50H 3I6LE 2JK5B 1KSRA 3B5HA 1CCZA 3QFJD 4KZDH 3X13A 4PJ8C 4DVBB 3GSXA 2RAMA 2PN5A 2FHFA 2IPKA 3WUWA 1OWRM 3OXRA 1UM6L 2WP3T 3ULUE 2J5LB 2F5BL 1HCVA 1MFAH 4AEIL 5SWSB 5FA4B 3LN4A 4NPYB 5CUSL 3ES6A 4JHZA 4J6RL 1I1AC 3KYMA 2Z31D 4FXKA 5IK3B 1NGQH 3PHOB 3WXWL 1B6DA 3K2MC 4WHTA 1KG0B 3HI6H 5ANMB 2B5IC 1AGCA 3QA3B 4LDLB 2UUDK 3BDYL 4LAQL 1TCRA 1U3YA 5C08A 5FYKD 1BVKB 2ID5A 5GRJH 2DQDH 4CMMA 1A6UL 4LRNH 4FQXC 4I18A 4RGNB 3TNNB 1C08B 4ALAL 1EHAA 2J8UF 5DD5L 5I71C 5FYLD 1O0VA 2FJFA 3GBLA 4LLMA 4EDXA 1IM9A 2PO6C 1KN2L 5DEFB 1LGVA 2NLJA 2O61A 4JFYB 4LLWA 4PV8B 4MA8L 4XNXH 5EDXA 5TE6L 3RNKB 1E6OH 1RPQA 3MXVL 1HOCA 1QLFB 5I66B 2JIXD 2OMNA 4MXWH 2CK2A 3WFDH 2FBOJ 4P23C 3ZE0E 3VCLB 2BCKB 1S7UA 4MSWA 3GMNB 3JV0A 4OCXH 4DK6A 2O5YL 3MBEB 1NKOA 1I1YA 1HINH 3SDCD 1N64H 1IJ9A 1JK8B 4WI9A 1IGJA 3V0AC 4POYA 1D5MA 1CL7I 2Y06H 4MD5B 4NCC1 1MHEB 3LIZL 4NQEA 4BKLA 3U6RB 2DQHL 1I7TA 1AO7D 5K9QG 1Q1JH 4Z77B 3C5ZC 4D9LL 4F9PA 2YXFA 4OI8A 4TQEH 3U7YH 1CFVH 3VFOA 5CSZB 1NBYA 3BVNB 3KPLB 1AQKL 3KYKL 4LASH 2ZWLT 4YAQB 3QIBB 4EVNA 4GRWB 4KKCD 4NKDA 4MJ4A 5ITBL 1YEIH 3GMOB 5D6CA 4LF3A 5IFHH 4I2XA 1ZTXH 1IC1A 4WUUB 3MNWA 2Z8RA 4KRPD 4XWGL 5F89A 2XPGA 12E8L 3EO9L 1LD9B 1NMAL 3CC5B 3DNKA 1FFNB 5T1KA 1C1EL 3QUXC 4MCZB 3GEWB 1E28B 2R2EA 4K8RC 4PV9A 5GGVY 1HIML 4HK3J 1RUKH 3SQBA 5DRXB 3NZHH 5JIIA 1QKZH 4HK0A 1A8JH 1E4JA 4YHIA 3IKCB 3UYOD 4P46D 5GGSA 2FEEL 5EUOA 3UZEA 3ARDA 2OR9H 3BUYA 3QUZA 3D85B 1YN7A 1MEXL 4Y8DC 3UTTE 3WEXB 1FNAA 4DKDC 4K71C 4XPTH 4Q6IC 5I8OH 2HTKC 5HGHA 2A77H 2XI9A 3PL6A 3SDYH 5B4MC 3RNQB 5DRWB 1GOGA 2BP3A 2LFGA 4PGJA 4Y16D 4OZGA 4PJCA 3HLAA 1AIFB 2W60B 4GRLD 4P2RB 4GUPA 1A7NH 3M17B 1U8IB 1F00I 5EFIA 3CJJA 3UO1L 4IIQA 4B41A 3LQAC 3VD7A 4PJEE 2P45B 4PGDB 1BFSA 2D9CA 5BMFL 4TPRL 2FECL 1FFQA 4L3EA 4OI7A 3X12B 1C8PA 4TVPH 3VI3F 4JFHD 4KK8D 3SKMA 1U42A 3KPNA 5C0JA 1JNLL 1F97A 1VACB 2E9WA 2PYEE 1EDQA 5F7DB 5F1OB 3IDMA 3FT4A 4YWGH 4TUJA 43C9B 3VW3H 4GBXB 2A0LD 4XI5D 3IB4A 3SOBL 3SO5A 3KGRA 1KB9K 3RL1A 3ZHLA 3JWOH 3B9KD 3WIIH 1YQVH 2J8OA 2R69H 5EIIB 3MLWH 1MCWM 1A6AB 4IRSC 4WY7H 4L4TB 2R0LL 4OI9A 5DJZA 4FABL 3O81A 3S97C 1JWMB 3CFDB 5C70A 5IBTL 4OF7A 3OWEA 3BP4B 4KJWD 4XNQB 3QDMD 2MQ3A 5C2BH 2FCBA 2OMBA 4F7CB 1F3JB 5EULV 1FRGH 2VKWA 2DJ4A 1A1OA 4Q0XH 3H0TA 2FD6L 2OTUA 1A7OL 2H3NA 4YXLL 2N4IA 1BEYH 4CN4A 3L3DA 1E4WH 1QFPA 1LDSA 2C3XA 3S37X 3FZUC 1M4KA 1T7VA 1WIPA 3FFCB 4U2YA 5E2WL 1NANI 3JV4B 3QDGD 5FM5M 1SHMA 4P59H 3MFFB 1BOGB 3GIZL 4PJGA 1VFBB 3M1BA 4R90H 1Z5LA 3WJJA 4TSCH 3EYOB 5IQ7H 3OR6A 1U8MA 1JJUA 3SGJA 3I75B 1KPRA 1RZIB 4V1DD 1SJVA 4X9FA 3S3SA 3QCUH 3DUUA 4E41B 1KYOK 5AYUH 1IGTA 5D1QC 2PYFA 2WNGA 4WFHD 1MJJA 3QQ9D 3HC4L 4CAGA 3MLPA 3CLEH 3WFHA 4HJGA 1NCNA 5C0EB 2VISA 5JW4M 4RAVA 5FYKU 5DT1H 3OXSA 3RUGF 3RWFB 1HH9B 4OAWA 3LKNA 2BY3A 2XKUA 3BKYH 2LV4A 1GGBL 1MCBA 1KFAH 1HHJB 1KCVH 5FDWA 3CVHA 3FONA 3HZMB 3E8UL 1YEKL 2YR3A 3BWAB 4JM4L 5F9WC 3TV3H 5F7YC 1Q94A 1BIIA 1RJZB 3OPZH 1R3IL 3FO2A 2YXMA 2P5EB 4HWUA 4MS8C 1IC4L 3CK0L 1QSZA 5HD8C 1W0VA 2YA2A 5F1IA 1TCMA 1MF2L 4Y0GA 1P7QD 4LCCB 5I2IB 4X9IA 4PBWD 1CFSA 2EDLA 3DX9B 1NCAH 3KLDA 4LPXA 2DOCA 3L3JB 3JTSA 2X6MA 4RDQG 1NAKH 4I18C 3I2CL 1KXVC 4XPFL 3IFLL 4XH2B 2ZUTA 1R5VA 5FECA 4Z7OF 4JB9H 3D69A 2B8OT 4G7YH 4CNIB 4MQXC 1A3LL 3BN9C 4WHYH 3IFNL 4LHUA 5DDHB 4PRIB 3C9NB 2AK4D 3QWRD 4XNZB 3LEXA 4ODHH 1INQB 1T1XA 4L9DA 3OJDB 1QA9A 4GKZB 1NUFA 1HILA 3CX2A 3H9SA 2X4UB 3TWCH 5DD1H 4XXDB 2CUMA 1YEGH 2VH5H 2DLFL 1EK3A 4CU8A 5D71L 3QFDB 3VFUB 3WLWC 4Y1AB 4PJDA 4AT6A 5J12B 1IKFH 2DLTA 2Z8VC 3L5WB 5EIVA 3RIFK 3DV6B 2UWEE 2KKQA 3BGMB 2E8ZA 1T20B 1YDPB 4H0GA 3TO4D 5DJCB 2AQ3A 3O2VH 4BZ1H 3RGVB 2QEJA 1ZT1B 4W70A 4UMGA 5T3XD 1QFWL 4NNXA 1CXIA 3WE6B 2W1NA 2EH8L 5DA0B 2A9MH 3HG1B 4F9PC 4WJ5A 4UB0L 1X5IA 1BD2B 5F9JA 1TTUA 3VG9B 2DM7A 4WWKB 3I3EA 3C08L 2EYSB 3BEWB 2Y9RT 1XF2A 4X98A 4IOFC 4DW2H 4HMEA 1ETZB 5CD5D 5KSVB 5D1XA 4DUVA 5I1GH 4DKFL 4WW2B 4L8DB 4P2OD 4LEXH 3C6LB 1LP9A 4EQ2A 3OKEA 2MHAB 3DIFB 5FO9B 4YEFA 3SGEI 2Y6SC 4HJJH 4TUKH 4G8GA 4M61B 3OSKA 2CLZB 1DEEA 4LL9A 5D2LF 3V9FA 3UPAA 4H1LB 3DGGA 4D3CL 3CGTA 4UTBL 3VJ6A 1VFAA 1A6ZB 2MCPL 3RL2B 3ARBD 2AKRB 4Y2DD 4G9FB 5D96C 3X3GL 5TH2B 3N1FC 5JO5B 3LKOB 3ARDC 2I24N 1I8KA 4QXUL 3VGHA 2YPLB 3QUMB 1H15B 1FG2A 1A14H 2JF1A 4X5WA 1XR9A 3QUZC 5D1ZA 3V5HB 2K1MA 1XGUB 3QUYD 4WTXA 5ERWA 5ADOH 3C5SB 4GKSB 1ZGLM 4LSVL 2EO1A 4PTTA 1N5AA 4EUPG 1QUNA 2F58L 5KTEL 2ITDB 2IFGA 4GAJH 2FO4B 2YMXH 4APQD 3PL6C 1WFOA 1EGJH 5ACZB 2HAZA 4PB9L 1RHHA 3PGCA 1JPTL 1RURH 1ZHKB 4NQSB 3RIAK 3T0EA 3VDBA 2F5AL 5FM5O 5CBEA 5KSUA 1EVUA 3GBNL 4U1HB 3HRZB 4HS8H 4NKMA 1I3GL 4FFWC 3TBWA 1BQHG 2YEZB 2W65A 1FO0A 5SWZA 4IIQC 3FQXB 2AJVH 3DTXB 5DK2A 4HV8A 3O3UN 3SQOH 1S7QB 4KXZI 4JY5H 1CFNB 2DD8H 3MOBH 2E8YA 3QDAA 5GRVK 5KVDL 4YHYC 5MP6H 3BGFC 4WFED 5ISZA 4HDIA 5F1KC 4MDJA 2QL1A 4X6CE 4HXBL 2F54D 2FX9H 5JORB 5IB2A 1RUAH 4QRPB 4P5TD 3SDAD 1T0MA 4P9HH 3MNVA 1XF3B 5F3BB 1U8KB 4LLQB 4XVSL 1LE5A 1WC7B 5IW1A 4K2UH 4UU9B 3NACL 2B39A 1YY9D 5EZLB 1QHOA 2WLYA 3MJ8A 5KVGH 1GSMA 2Q3ZA 2Q86A 4JPVH 5BS0D 4ZD3H 1D5ZB 3K8KA 4ZO8A 4NZJA 4RISL 4Z18A 5GIRB 5GJSL 4PGCA 2X40A 1FGNL 4HBCH 3QO1A 4POZC 1MQ8A 3WKML 3ORJA 2BVQB 4R96A 1J9CT 1UM4H 1HNGA 2X5PA 4EBQH 4X9HA 1UJTA 5GS3A 4YIQA 1QRNE 2D03H 2FEDD 3ULVF 3CZJA 3AU1A 3TJEH 1MCWW 5GGRY 4I3SH 4PJXF 2YRPA 2IC2A 3VXTB 4UV7H 4XVUC 3UYPA 5K9QI 4QT5B 4C83B 5LKNA 3OAUH 3MRKA 1G9MC 5JW3L 1LK3H 4ISVB 3AB0C 2DLHA 3EIFA 4XB7A 5FA3A 3SO3B 5KSBA 2FHCA 2HT2C 3NFNA 4LLVA 1FCCA 2BVUA 2ICES 4YDVA 1TITA 3IDIB 4N0UA 3QAZC 4K94H 1IGCH 3WNNA 5JXAL 3WJJC 5CBAB 2QKIA 1MCDA 3SE9L 3SGJC 1P2CB 1HDMB 2D7OA 2J6EH 4CVXB 3CMGA 3D5OF 2LTQC 4OZHF 4R7DA 2BSED 5LBSL 3RVVC 1KGCE 2QQQA 4WDIA 1AO7A 1EEYA 3SCMB 2ESVB 1UVQA 3GSOB 1V3MA 1S9WA 1LILA 1SY6L 3S37L 3U9UB 2EXYD 4YHZH 2WBKA 4R8WL 2V9QA 1MRFH 1VADB 3HZKA 3Q6FB 4XCCH 4UUJA 1FNGA 5EG6C 1UWGH 4G8FA 5ESAA 3IETB 2C4FU 5DRZB 1S7XB 4G8EA 3S34H 2O93L 5CWSA 4M5YH 4NKOB 1P4LA 4C56A 5I75B 3WUWG 4FG6C 4RA3A 2CKBH 5HYIA 2X44D 3MR9A 4XPBH 3X3FH 4JPWH 3BZ4B 4U6XB 5DS8B 3CCHB 4Z7VB 1PJ9A 1CL7H 2R0ZL 2Y23A 2HG5B 4D0BB 3BP7B 3DHMA 4XNYH 1OARH 3PWPE 4NQDD 4CVZA 1KELH 1P4BL 3WXVH 3CSPA 3LV3A 1S9VB 3UEZA 1BHGA 2AEPH 3MLTA 4QRUA 3S4SB 2HT3D 4KUZL 1RUQH 2GCYB 1DBBH 5EO9B 4HC1H 4LDOB 5I8CA 2DIAA 2G75B 3DOSA 4S10A 1LO4L 3FCTB 3ZMRA 2A6KA 3QQ4B 35C8L 3FRUA 1OAKH 3ZKQD 1H5BB 2BRQA 2DQFA 3NCMA 3IDUA 4YFLF 5JQ6L 3SJVD 5I76A 3TF7C 3D2UD 4QXTA 5I18H 3RA7H 2Z35A 2FGWL 5D9SA 1SY6A 4FQCH 4GRLA 2VXVH 1OM3H 2AJ3A 2XFXA 2R1YA 3K2UL 1LEGA 1GVIA 4GSDH 4PTUB 3B9EA 5KSAD 5AZ2H 4KK6D 2VDPL 3S35X 4BUHA 3NCFB 3VXRD 3WNKA 1EH9A 1T66C 1X4XA 3TA3B 4PJBE 5CILH 3VGFA 1DQML 4NZRL 4X9BA 4L29B 1AGEA 3H3BC 4GQ9H 3LCYA 4JFFE 3KYOA 4R2GD 3DO7A 4HLZH 4LIQL 5F3HB 5GSRB 1SEBB 3RWHB 4Z5RB 3IF1A 3HAEA 3H9HA 4CW1A 5HBBA 3U2SA 4K9EH 2I5YH 4Y8AA 4RA0C 2QQLH 2B20A 2EDXA 4FFVC 4JY4B 3G5VB 2F8OA 1DUZB 5J1AB 3O8XB 4M93B 1YA5A 2EKSB 4IMLA 4KMTH 4RFOH 5D1XC 5HDBE 1K6QH 4EN3D 3T2QA 3QIUB 5FKAB 3GDBA 3O0RL 2VL5B 4ORGA 4MNGA 4ZS7L 2XZAH 3FB7A 3T2OA 3PWNB 1AFVH 5JXED 4NZTL 2VWEC 1MH5A 2IPTH 4MDIB 2J1KA 2XKNA 3RTQA 2VAJA 4JAMB 3S8WA 3VXMD 5HDQL 3QDMA 3E3QE 3ALXA 4GMSL 4G6KL 3SGKA 1JMXA 1LO0L 5JZ7D 2EYTA 4UQ2B 4FXGB 3C5JB 4UNVA 4UZGA 3RKDC 2PXYB 4OQTH 3NPZB 4PJ5D 1VGEL 1P1ZA 3PDGA 4OLXH 1H0DB 5CEYB 2NZIA 3HHRB 1I75A 4MQ7B 2I25N 5I19H 5D1ZC 5DJYB 5I8KH 4LCWD 5HHXL 4MZ3A 1J05A 4JDVB 4ONGH 4PJHE 4Z8FL 3IJYB 3QDGA 1NC4D 3MMEA 3UTPE 1BX2B 4U3XA 1HHHB 4HSQA 5DTFB 2X4PB 4D0DB 4ZAKD 4C55A 2VSCA 2OQJA 1UYWL 4JKPH 5EU6D 1ORSA 3T0EC 4HIEA 2PW1B 4OM1L 5E4EC 4JRXE 1FZKB 2X4NA 1ED3A 4V1DA 3WKNA 2AP2A 2VL4A 4ZFOL 2IGFL 1QR1A 2BSSA 5KS9A 5HGBA 3S88L 1JYXA 1QYGH 3QG7H 2CDFB 4R3SB 1TIUA 1FPTL 4KY1L 4UT6H 4UTAL 3HC0A 2Q8AL 1BJMA 2NTFA 4Q9RL 1RZ8B 1NANH 2CK0H 4KKLD 1JN6A 2Z4QA 4OIAA 3ULUF 1YJDC 2BNRB 2VITA 1RJLA 3GMRB 2A9NL 1FNSH 3GRWH 3M8OH 5I30L 5IV2B 3CFCL 5IESH 3MFGB 3UXFA 4U6YA 4DGIL 4JFEB 4F58L 1AKJB 2KZ1B 4G6ML 3WNPA 4DQOL 3KNBB 1HXYA 1D7FA 2AK1H 3GB7A 1WTGT 1QLEL 8FABB 2B2XH 1P7QA 4JN1H 5BQ7B 3BZEA 1EJOL 3W82A 1BQSA 3H3PL 2C4XA 1MI5A 4JCMA 3EGSB 2FIKA 4L4VB 3ARRA 3D3VD 5HI4D 4NRYA 1T22A 1UWEH 4HWBH 4JHAH 4JQIL 1KPVA 5MI0B 3KAAA 4HT1L 3GNML 1Y18B 1JIBA 3LKPB 5EOCH 4RZCA 2BFVL 2X4TA 5SWQB 1UC6A 1TQBB 4M6OH 4MJ2A 1QSVA 2AK4A 5K9OB 5LGHL 3KPRE 4NN5C 2EYRA 3JV6B 1EBAA 3FTGB 1M71B 2YBRB 5GJTL 4ZDHB 1GGIH 3U36B 3TIDB 4YEEA 3KPSD 4ELKA 2EO9A 3H42L 1A7RH 4WCYH 4Z95H 3ZE0F 3MV9D 4XPAH 1DQTA 2FBJL 5DHYB 4G5ZH 1RZGB 3QULB 4NCDA 4XCEA 1LEKA 4OD2B 1YEHH 5HYSB 4ZUUB 1XF5B 3MCKB 1KJ2L 3MRBA 5C6PB 1N6QL 2X1OA 1MCHA 3TO4A 1JHKH 3L3GA 4XMKH 1BM3L 5GGQL 4JRYB 1HWHB 1TVHB 4ODTH 1JFQH 1U3HD 3QXUA 3SY0A 4P5MB 3UBXI 3TJHD 1EFXA 5F7EH 5I1JH 3LVEA 1MCOH 4M7LL 5EO0A 4EXPX 1AI1L 3H7BB 1FVEB 4Z7WB 3GMPB 4KKCC 2VLRA 1MHHB 4XWOD 5H37H 3U0WL 1JNHB 1QSEA 4HS6B 1NDMB 3FO1B 4HKBB 1DVFA 2IBZY 3DX8B 3THML 4JRWA 1VEOA 3QH3A 1CGUA 1KJVB 1UG9A 4KRPC 2VXSL 3VRJB 5J1TC 5EC1A 5J6GB 2G9HA 2H26B 1UZ8A 2VE6B 1INEL 4PP2A 2DKUA 5F6IB 4XAWH 1U58B 5C3LD 4M3KB 1HSBA 1BZ7A 3MJGX 4OIBA 4MD0A 4WTWA 1I3UA 3VRLE 5JR1L 4QOKB 2XTJB 2VLKB 4X6FA 5HYFA 1FNHA 5KW9H 3DXAB 4HKXA 5DQ9A 1KLGB 2BNUB 2LVCA 5J56B 2NY4C 1A7QH 4RIRA 3RI5K 2HH0L 1KC5H 3F7YA 1ZSDB 3BESR 3KPOB 2IAMB 3G5YB 3TIEA 4YBLC 3GIVB 4O00A 3QUYA 4XBEH 5CEZH 4LHUG 3CD4A 1KJ2A 3IDNB 4APQA 3RUGA 2LABA 5D93C 1A4KB 3KG5A 1FFPA 4P5KB 1KPUB 4D94A 4YXHL 2EIBA 4OGAD 1E4XL 5T5FL 3O2WH 4GRLC 5C0BA 4PG2A 4ZFFA 3EOBA 3MROA 4PJEF 2E9IA 1WFTA 4LVOC 3O3BB 1YEEL 3T0XA 3TZVD 1K5NB 3ILQD 2YSSA 4YK4B 4KROB 1C12B 4MGXA 3RWIA 2VUOA 43CAB 4AL8L 1U8OA 4KK8C 3MV7A 5A16A 2OL3L 5E9DA 4DVRH 1WQVT 2F54A 3VD3A 3VFTA 1K8IB 1FVDA 4ODXB 4LGSB 1FZMA 4P5TA 3SDAA 5FYJL 1EEQA 5DK0A 1XGPB 2A0LC 3BE1L 4XI5C 4CU6A 3D87B 4LSPH 1OPGL 2A73B 2YA1A 3K46A 5BJTA 1Q72H 1MHCB 2IANA 5AG9A 4S1QH 1I3RA 4NUGL 2B1HH 5SWSD 1CG9A 3ZTNL 1ZGLP 1AH1A 1UQSB 1X4ZA 1K4CB 2R4SL 4OZFH 1P7KB 1G7JB 3SE3A 2ZG3A 3S36H 4JZNA 3SGDI 4PRAA 4HD9A 3LZFH 3MUGB 4PJ9A 1FLRL 3RTQC 4K7PY 2E27H 1AXSB 1CDUA 4P3DB 5EBLA 4KJWC 4WFGD 3PWUB 5DMGD 4HH9B 1FL6A 3MRHA 1A3RH 3SGKC 3I9GH 1ZA3A 4F15C 5ETUA 5CD3B 1RJCA 3G5ZB 5BRZE 3UZQA 5JNYA 1JWSA 4OT1H 3IGAB 1FIGH 5CLWA 1ZA6A 3F5WA 2A6DB 4JKMA 4RGND 4YR6A 1SJHB 1GHFL 5TDPA 5EORL 5D7IA 4OFIA 2VDMH 1CLOH 5DGRA 5LG1A 4RNRB 4OFYD 5T5NG 5IGXL 2A6IB 4HGWB 4FNLH 1N3NA 1N4XH 1R3LB 3SN6N 4H26B 4NKQB 1NGPH 2A83B 5C0GA 4X8XA 2WINA 5BV7H 3I6GA 2OXGA 2FJGA 1AGDB 5IMKA 2Q3AA 2H6PB 4R4BA 2IG2L 3OGCB 1LO3H 1KIPA 2OTPA 5ALCH 1G6VK 1REIA 5I1CL 3DSNA 3MBED 4LVHB 4PRNA 2ZUUA 4BSJA 1FYTE 1PGRB 3KR3H 3RX8A 4U6VH 5TDNB 1IQWH 2DYPB 5E00A 3FAXA 5E8OB 1J8HE 1P9MA 1MRCL 3HCVA 3LOWA 2OJEB 1MIML 3ZTJG 1J0HA 3P77B 5L8LB 4G6JL 3C60B 1B0GA 1S7RA 3F7VB 5FYKH 4L1DA 3UTQA 4QRTB 4JHWL 3CUPB 1MCRA 3QIBD 4QTHB 3P3YA 4JREB 1EV2E 4MA7H 4JJ5B 3QIWB 1E4KA 2WBWB 5FYLH 3LEVH 3Q5TA 3ALPA 3GMQB 4XGZB 5I17A 3RX7A 32C2B 5LCVH 3UJJH 4WUUD 3PP4L 5TE7L 3BPNB 1HXMB 3ULVL 5FHAH 3BKCL 4MNQB 5E8NB 4NQDA 1S8DB 4KUCD 3WNLA 3T65A 5C07B 1WISA 4AMKL 5ID0B 3DRTB 1EHLL 4PJFB 1JV5B 3NFSH 3L5JA 2A1WL 4P4KB 2YN5A 3RJQB 1BAFL 3IDJB 3RVWC 1A7PL 2OZ4H 5ESVB 1GGTA 4ZUWA 4KQ3H 3OKLA 5F1NB 1RIHL 3I02B 5GSVA 2YA0A 1NCUA 4HPOL 3D85D 1TJIL 5IVZB 3AMLA 1INDH 1KNOB 3D2UA 3MXWH 3STZB 5IHZA 4L9LA 2UWEF 2DRUA 2CKBB 5EWIH 2OXHA 4OFDA 1EUUA 5DJ6A 3FQRA 1LQSR 1WFUA 4R26H 1FNEA 3TO4C 5KSAA 2YD8A 4NO5A 1TJGL 1U36A 1YPZA 1Q38A 3P11H 4P2RD 5TQ0H 3VXRA 2AABH 3QEHB 1FV1A 1DQJB 1I7RB 2X09A 3CPLB 1BVLA 3LS4H 4X6DB 4H25B 4JR9L 2H2PD 4HKZB 4NCC2 1DL7L 2R29H 1MCLA 2RJMA 1FIEA 1HWGB 4HIXL 4O5LL 2B1AH 1JCKA 3BH9B 2XKSA 4PJ7A 4ZUTA 3T1WA 4ZUVA 3IRZA 1D6VL 1N8ZA 3MA7B 4DN3L 4LFHD 3QHTC 5CD5C 1DVFC 4PJXA 2WUCH 3C6SB 3TYFA 4GBXD 4EN3A 4XAKD 3V5DB 1WEJL 1WUNT 3QHFL 3O6KH 3PGFH 2R0KH 3ZO0A 4EI5B 2VZ3A 4KKBC 5DUBB 4ETQA 1NBVL 1QTYT 3CVIL 2P8LB 1BJ1J 4FTVA 5HVHB 1RY7B 1WZ1H 4L4TD 3PQYB 4LLYA 4LSDA 3UYRH 5J13B 3UTSE 2V5TA 4AK1A 4HUUB 5L6YH 2BJML 4OKDA 3LRSB 4PJ5A 3QXWA 1DBAH 5GS1A 1JMZA 4OZHA 2CO6B 3C8DA 4Z0BH 2NCMA 2AJYH 2IH1B 3QUYC 2C1OA 4LCWA 3MYJA 2VLJB 1HEZA 3V0WH 4LVEA 1YEJH 2ITCB 1R5IA 4LSTH 1NC4A 4APQC 3IDXL 1KIRB 2B7DT 5E6IB 5T3ZL 1MFNA 2A74A 4GW1B 4LHJB 4NQEE 3FFCD 2GW5A 1QVOA 3B4NA 4ZAKA 3O2DL 1V7MH 4HF5H 3MV01 5EU6A 1F3DJ 1G7HA 1A9EA 3F6LA 2D4FA 3P73A 4DZBB 4PBVC 5HI5D 1MCCA 4PG2C 3OF6A 3V0VB 3W9DA 4XNMB 4IDJH 1DBKH 5IM7A 1MPAH 2MOVA 3UX9B 3HMXH 2MNUA 4Q9QL 4KTYA 4BFGA 4E41D 4I2XE 3CSYA 5DR5H 4E9LA 1N0LA 4YZFF 2FEEI 4CBPA 1FVCA 3BAEL 3N9GH 5I1KH 3UTOA 4P5TC 3SDAC 1F2QA 1ZLSH 3VXQB 3PWLA 5J7CC 1UA6H 2F9BT 2L7UA 4JFXA 3MQIA 5IBLC 5HGDA 3HAEG 5F88A 3U30C 1YY9C 4UT9L 1MIEH 3REVA 3JTTA 2CRMA 5TE4H 3VE0B 1JRHL 3SE3C 5EUOE 2P5ED 5C9JA 5E1AB 4PJ9C 4ODVH 4JO1H 2HJFB 5E8DL 1JHLL 5EU3A 2XTLA 4LSUH 3BIBX 3HZVA 2FECI 3AXLA 3G5XA 1A4JB 2VLMD 3SDDA 4KK5D 3D25B 3EJYD 3FHAA 4KTDL 4NC1C 3EDJA 4LSSL 4MCYB 5GS2D 3VFNA 1KN4L 3HZYB 1IEBA 1NBZA 4OZGE 4PJCE 1IC7H 1M7XA 1JPGA 3VFRB 4X7CC 3SPVB 2UZXB 3L5XH 4I9WE 3RWJA 4PRID 1U8QB 5TJWK 3KPSA 1L7TH 2XA8L 1EBPA 5JUEH 3FN3A 4ZNEA 3MV9A 4OSUH 1TZHB 4L3EE 5I1IL 5HYJA 3CMOH 4IM8A 4CJ0A 4MAUL 1WVZA 4XPGH 3W0WA 1JZ6A 1M1SA 4MXQD 1U8LB 1WBZA 4QRQB 2BMKA 5JDSA 4Y1AD 3PUCA 5J1SC 2YUZA 1V7NH 4XVJL 2CDGA 3ULUL 2V5YA 1JGVH 2XQBH 2FIRT 2NY5H 25C8L 3QDJE 4PR5B 2YD5A 3PHQA 4HMDA 3RGVD 3DROA 1CT8A 3NZ8A 1SJXA 2GFBA 3UDWA 1NL0L 1VKXB 3GSNA 1ZLVH 5EUKA 4L4JA 2EXYC 4GFTB 1P9MC 1ULVA 4XZUA 3HG1D 4E5XB 2F74A 2ZJSL 3LKRB 2X9XA 3CFEB 2ARJQ 1G7LB 1BD2D 3A6CH 5E56A 1TLKA 4PG9B 1WBXA 3QT2A 4BH8B 1E4KC 1KBGH 3O6LL 3X11B 4WWKD 1MWAB 2M26A 1IEAA 4HKJA 4R97C 3ESVF 1X9QA 2BVPA 3JSSA 5IMOB 2BVYA 5JW5A 4PP1C 1KEMH 2Z91B 4NM4L 3C6LD 2DWEB 3VRIA 4ZFGL 1Y6MR 4HULB 2WMPA 2XNAB 3K4DA 4MNHB 4HZLB 3HI1A 1TTFA 3CFKB 2QSCH 4UI2A 1EFQA 2C7UB 3VFPA 3O3AB 5MHSE 4K8RH 1BLNB 1IL1B 1P7HL 5LJYH 1A3QA 4PJGE 3U7AA 2X4SA 5D2NA 3FHQA 4G9FD 3FQUB 3ISWA 4HUMB 4N9GA 3V8CA 1EO7A 3SDXE 5I0DA 5IMLA 1FJ1B 4K7FB 3NAAH 1FNFA 1O5DT 2YPLD 4LSQL 2XZQH 2UZYB 3W11D 1EVTC 5E6YA 3VWJA 5D7SH 3ROLB 1F58H 5MENB 3MLUH 4QRSA 4GMTH 2CGRH 2R9HC 4L9LC 4D9QD 3V7AG 1OWWA 2JLLA 3K74B 4WU7A 4OB5H 3PJSB 1FFOA 1OF2B 1EZVX 4Q9CA 3TZVA 2Y7QA 5D5MB 5KSAC 4PJBF 1Q9KB 4OLWL 1L7IH 2ZUYA 2HFGL 1QNZH 4PLKD 2XQYG 1NAML 2FATH 4WHCA 3ZYIA 5DFTA 1PX4A 4X7DC 1XCTA 1XR8A 4BH7A 2VDQL 5E0QA 1BVZA 7FABH 1G9NC 1CGVA 5C8JB 5D8JL 3RWGB 5FK9B 2VQUA 2ED8A 4IJ3C 15C8L 4NWTH 4X80H 1T03H 3RHWK 5HYEA 2OK0L 1FN4B 5TDOB 3E6HA 4JM2B 3KXFE 2JK5A 1D6EB 4LQFH 3ULVC 4OGYL 3PF2A 4NN7C 2HVKB 5B8CB 5HDBF 2WIMA 3F62A 1I7ZA 1B4JH 4DVBA 3QNXB 5B22A 1OAXH 4QRPD 2NXYB 4EN3C 3MV8B 1FYHB 4TNWK 1TNNA 5FA4A 3DUHA 4NPYA 5HPMB 2DF3A 4N0YH 2ERJC 1SM3H 3BKJL 4WI3A 5I1LA 3JWDL 1I4FA 4L5FH 5IK3A 1NC2B 3PHOA 4HHAB 1NJ9A 4HQQH 1FBIH 1B3JA 2QBWA 1KG0A 4XP1H 5ANMA 3E6FB 1QFWI 4Q9BA 4J7RA 2WQ8A 1YMMB 2R1WB 4M9PA 2WBJA 3Q6GL 5JZ7C 3QA3A 1G0YR 3H9SE 5FOBB 1P5VA 4UILL 4HIIB 1BVKA 5L9DH 1FE8H 1NGWB 1A9BB 5GS1C 3L7EB 1IGIL 3LS5H 2DLIA 3TNNA 4HUVA 5L88H 3T09A 3T3PE 4PJHF 1DQDH 1YNLL 2E7CA 4GAGH 2NY2B 4OFYA 1QFUL 5INDB 5DUML 3SGDH 5DEFA 4U6TA 2LAGB 4JFYA 2J8HA 1J12A 1QBBA 4Y5YA 4ZAKC 5IF0B 5DI8B 5FUZL 3K8LA 4AEFA 5C86A 3VCLA 4OF3A 4XCNA 1IEHA 3GMNA 4OZFB 1ZHLB 3MBEA 4AIOA 3HMWL 3VDAA 4GW4B 1JK8A 4TOYL 5L8KB 2ATPA 5ICYB 4MD5A 1MHEA 3MJ6A 3BSZH 1S5HB 1NSNL 5TQ2L 1LP9E 3WO3B 2ESVD 1CZ8H 2P7TB 2P5WB 3PWJB 5KVFL 4KVNH 4Z77A 1JPST 3IJSB 4RRPA 1F4WL 4JFPA 2VDRH 3KJ4B 4G8GE 3KLHC 4YAQA 5EOQH 3QIBA 3T4YB 4TUOA 4JY6B 4HIJB 5I9QB 5DYOB 1A22B 1OT1A 3GMOA 2KUTA 4WI2A 4XP4H 2VDNL 4D9RE 4AEHL 1NMBL 4IRZL 1HKLL 2PTTB 3T3ME 4UDUB 2ED9A 1JHTA 5I8EB 1LD9A 5BV7B 5HHOB 3ARSA 1FFNA 5HI4C 2NR6C 4MCZA 3BIKB 4AIXA 2VIRA 1Q0XL 4NQTA 3V8OA 1CLZH 5T1DL 2OI9B 1ZHBB 5D7JB 4YNYB 2P8PB 3MRIB 3SDDC 3K0WA 2X10A 4JO3H 4YGVB 1Z3GL 2XRAL 1RUMH 4JDTH 3T0EE 1K4DB 1GIGH 4OUOA 4U1IB 1ZLVK 2AXFB 2JCCE 4EXKA 2XY1A 2PYEA 1MCPL 1DQQB 3TM6A 2X2YA 1WBYB 2BHZA 2YZ1A 3WEXA 2ZP0T 1SYVA 4AG4H 3LD8B 2CH8A 1QFHA 4XP9H 3FO9B 3PXJA 3GO1L 3TO2B 4FP8L 3RNQA 5DRWA 4YHOL 2AV7B 3QFJE 1AIFA 1BFOA 2W60A 1RVFH 4U1GC 4P2RA 1UJ3B 2G5BB 4JVPA 1ZT7B 5IEHB 2D7PA 2YD3A 1UM6H 4PGDA 3WIFB 4OCWL 3TA3D 3TJHC 3UDWC 2F5BH 4AEIH 1G6RB 3MRFB 5E24E 5CUSH 3FB5B 4J6RH 2B4CL 1A5FL 4WU5B 4PRPB 4XWOC 3K8MA 5F7WC 4KKAD 2XG4A 3O11A 1CD9B 1VACA 4NO0A 2EZ0D 3C8HA 3LEYL 4LGPB 5F7DA 2PW2B 1LK2A 1S7VB 2W38A 43C9A 2NMSA 1FL3B 1YNKL 1WZKA 5BVPL 4YHML 4UNUA 5CINL 3BW9B 3O8XD 1GAFL 3BDYH 4LAQH 5BOPA 4GG6B 3MRLB 3IU4L 2PCPB 3QNZB 5FYLE 1NMCC 3QIUD 1IT9L 3MRCB 3VRLF 4ZNCD 4OZIB 4ALAH 5EIIA 5DD5H 4QHKJ 5HSFA 1E0OB 4PY8J 3VXSB 4FRWA 2QJDA 4L4TA 4S1DD 4J2XA 4AH2A 1RK0B 4J1UA 1JWMA 3CFDA 1R5WA 4KAQL 4R0LB 5KN5B 3KLSA 5KSBE 2AI0L 4XNQA 4U1NA 1KN2H 4Q58C 3V4VL 4MVBC 4N0UE 4F7CA 2I9TB 5D2NC 3CDGA 2EDWA 4MA8H 5TE6H 2X4RA 4OLUL 3ZSSA 3BQUB 2PXYD 4FZEL 3TC9A 3MXVH 4L8BB 3FO0L 4C57C 3V6ZA 2OS7A 3F7RA 3QNYB 4TVPD 3SKJH 3WDJA 4U31A 4OGXL 1IAKB 4F7PB 5CCKL 3VWJC 1K3ZA 2O5YH 3RZCA 2ORBL 5CJXA 1H8NA 3V4PH 1AO7E 3GMMB 3O4LB 3ZSTA 4KPHL 4YDLC 3MFFA 4M8VA 1IM3B 3LIZH 2RCSL 1VFBA 4MAYA 2V5MA 3LKSB 3EYOA 1EX0A 4EQ3A 3TZVC 4D9LH 3V6BR 1RZ7L 4EIZC 3ILQC 2J3SA 3I75A 1RZIA 5DMJB 4WWID 3KYKH 4QY8A 1UCBL 3OKMB 4E41A 2DLEA 4PRHB 3MNZA 3SE8L 3MRMB 1MCQA 5KVEL 5ITBH 5JOPD 2VABB 4UAOC 5ICZB 1EAPB 2XYCA 4EDWL 1UACL 4XWGH 1IKNA 2FX7L 2BOBA 3DRQB 2IMMA 1KB5L 4P9ML 12E8H 3EO9H 1I9RL 2BNRD 2OBGA 3D0LB 5CJ5A 5K59E 4M6ML 2KQMA 3U79A 3FT3A 1HHJA 1C1EH 5CEXB 4K3JL 1WICA 2J5LC 1S3KL 3HZMA 5E2TL 3BWAA 2VXQL 4WUKL 3ZE2E 1RJZA 1T1WB 4JFED 5FDYA 5DMYA 1VB9A 1AKJD 4GG8B 4CMHC 1PKQB 5GZND 1DFBH 1U0QA 3C2AL 4JLRB 5ESQB 3G6DH 4LBEB 1MFBL 5I2IA 1CGTA 3ELAT 3DI2B 3TN0A 4P99A 1CD8A 2OR7A 2BOCB 2WBJC 4L3CB 2Q76B 4L4VD 5E2VL 5H94B 4HS3B 1MEXH 3L3JA 4FQ2L 4NKIL 5D7LB 1OQXA 2NPLX 4RGNC 1KJ3L 4U6HA 1WCBB 4XH2A 3ARXA 4O9HH 1W72L 3TEUA 1KIQA 3G9VA 1I3VA 4XCFL 3VXNB 4PRIA 5IB1A 3C9NA 5HDLA 3P9MB 4L8CB 4PPTA 4KDVA 1H3VA 1AD9A 1T89A 1J8KA 2DM4A 2E7HA 3OJDA 4WHDA 1NLDL 1S7WA 2X4UA 1N26A 4PJ8B 4Y5YC 4U1MB 2H8PA 5EO1A 2WM0A 5IOPA 2HWZH 3D18A 4OCSL 3OL2A 5BMFH 4TPRH 4F8TA 1TVBB 4UIMB 1MVUB 5GGVL 3IRPX 1OAUL 3EOAB 4ZOCA 1D9KA 3L5WA 3ZYOA 1RV6X 3MBEC 5IB3A 2AJUH 3DV6A 1I7UB 2YN3A 4GKOA 3VFVB 1NUNB 3BGMA 1JNLH 1YDPA 3OJMB 3HB3C 1JGEA 4ODSL 3RGVA 2Q6WB 1ZT1A 4M7ZB 4L1HA 4WEBH 2D31B 4JRYD 3WE6A 1BGXL 1A0QL 3HG1A 1MJ8L 1VCAA 4NN6C 1BD2A 3LY6A 1CS6A 4RWYL 4LMQI 2GJZB 2V7NA 5DJ8B 3KPPB 2DN7A 5E8PB 2Q8BH 3QIBC 2NY6B 4KRLB 3QDME 2R0LH 2EYSA 3BEWA 5HHQB 4QHLB 1NKRA 4FABH 3FJTA 2YPKB 1RIVL 3EJZC 1OP3H 5KSVA 2PO6B 3DVNB 2PR4L 1N6UA 4BQBA 2HLAB 1B0RB 1DZBA 5DJ2B 4YJZL 5C2UB 2P24B 2HJLB 2VZUA 3NOIA 3P4NB 2MHAA 1OB1A 3L3OB 4OV5B 5FO9A 2EDHA 2FD6H 1W72A 4YXLH 4LCUB 3WS3A 2CLZA 5JTWA 3QDGE 2BC4B 2L7JA 3VMNA 4QOKD 2XTJD 2VLKD 2FR4A 4BSWA 5FFLA 2AKRA 1DBML 5F6HJ 3DXAD 4RFNC 3ARGA 1P69B 2UZIL 4XNUL 5TH2A 4V1DE 3HPJB 4LIQE 2IAMD 1DANU 2YPLA 3QUMA 1H15A 3C5ZB 1F8TL 1F6FB 3V5HA 5KS9E 1XGUA 3UAJD 1F13A 3C5SA 1DTUA 4GKSA 2EC9T 3U48A 4WFHE 5DRNB 2ITDA 4AIZB 2FO4A 2HT4D 1Z0MA 2O5ZL 4OV6F 3UROR 1S9YA 4ZFZB 2ZPKL 4LRIA 1CDIA 3HC4H 2CUIA 5L7XL 1ZHKA 4NQSA 5TGBB 4P2OA 1GYAA 3NH7L 4U1HA 3RWEA 3BO8B 3G6JB 5B39A 1L0QA 1S78D 4I4WB 2X9YA 3FQXA 3X14B 3WMSA 3DTXA 4GXUM 1PLGL 3H8NA 3UBXB 5CKGA 4KROD 1S7QA 1CFNA 1YEKH 5CMAB 4PJIB 1BREA 1J88A 4JM4H 1QRNA 5AUMA 4JZOB 4Y19B 5B38B 3G04B 5CJQL 4HBQA 1L6XA 5TF1L 5JORA 1J1PL 4OUUB 2AV1B 4YHNB 3ZDXE 1CFQB 3HI6L 1MF2H 1XF3A 5F3BA 1U8KA 4LLQA 3O3DB 4Z7UB 1WC7A 3DI3B 3OKOA 2JB6B 2GTWB 1W0YT 2YPVL 2WWMD 1E27B 4K71B 4Q6IB 3FOMA 3I2CH 1PY4A 2EIEA 2CDEB 3IFLH 2AK4E 3VFGH 4DCQB 2VAAB 3BHBB 5GIRA 3IFNH 2AEIT 2PUQT 4F2MB 1BQHB 3UPRB 5AWNL 3S7GA 4EEEA 5J9PB 3FN9A 3V7AE 1SJEA 4G8IA 4PRBB 3D39B 4D8PB 2XWJB 1GC1L 4XNXL 5C0CB 5F7FA 2DLFH 2JKXA 3FOLB 5D71H 3VXTA 5F97E 4AENB 4Y4KB 1WCQA 4PRDA 4N0CD 2BY2A 3LQZB 4QT5A 3RZCC 4C83A 5T3XE 1F5WA 5CJXC 3NFPB 1N64L 5EOTA 1EO8L 3CZFB 5KBNC 5E70A 4MMXC 2X89D 2Y06L 1QFWH 3IDIA 3WCYA 4MAYC 2AJSL 5HI5C 2IPUK 3WIHH 1IMHC 4NJ9H 5CBAA 2EH8H 1Q1JL 2B4CC 4UB0H 1CFVL 4R4FH 1P2CA 2VLRE 3MV11 4IRJB 1L9MA 1HDMA 1DUYB 2XOTA 3MA9L 4ODWB 5CZKA 4CVXA 5DFVD 4O2EB 3QJFA 4FZ8L 3C08H 3N1GC 2CO7B 2EIZB 2GHWB 2ESVA 3SCMA 3GSOA 2N7BA 3WFZA 3JUYA 4DKFH 3OKYA 1ZV5A 2DYPD 2QHRH 3GI9L 3U9UA 2NNAB 1IKNC 2UVFA 1RZJC 1G0DA 3NCYP 3OTTA 3RVXD 5JOFB 1JP5A 2V2XB 3IETA 1H3GA 3C60D 1C5DB 1S7XA 3ZHDA 4FQLH 4UQ3B 3QIWD 5EUOF 5F8RC 1E4XI 4UTBH 1ZVSB 2ZCHL 4U6XA 1U8HA 1P84K 2EICA 4Z7VA 1ITBB 2HG5A 4QXWA 3X3GH 4FS0A 4D0BA 1RMFH 2CR6A 3QCTL 4QXUH 3TN0C 4MNQD 1KTLA 4KK5C 5C07D 1RK1B 4I13B 2GY7B 2EXWC 5CFHA 1S9VA 4OZGF 2ZOLB 4PJCF 5T1MA 4XPTL 1SEQH 3S4SA 5KTEH 1T7YA 3ECBA 2GCYA 5EO9A 1FQ9C 3WLBB 4P4KD 4PB9H 5D1QB 4HFWA 5AYQA 3D6GA 3MREB 3FCTA 2GT9B 2LVEA 3QQ4A 1R3JB 3P40A 1JPTH 1T5WB 4LP5A 4ODUB 2IQ9L 1H5BA 2F5AH 1XGTB 3GBNH 4Y5XA 1T89C 1I3GH 5DVMA 3JWNC 1CLYL 3VI4E 1YC7A 3AS0A 2IBGA 4NBYB 4J4PD 2P44B 2H2SC 1FNLA 1MUJA 4MXQC 1QP1A 2EC9U 3MBXL 4F33A 1OP3K 3O6FD 5A3IC 3R06B 2F54E 5J12C 5KVDH 3ES6B 1CTOA 1DDHB 1D9KC 3U1SH 4GRWH 2CJUL 3B3IB 5DWUL 4FXKB 1OSPH 3GUTB 2XV6B 5HI3D 2DBJA 3RGVC 1P4IL 4WHTB 4W4OA 4YWGL 4ZPVB 3ZKXB 4Z7QE 5BS0E 2J2ZA 1AGCB 3NACH 1I8LA 1F45A 5C08B 2VKXA 5MERB 3WIIL 5GSRA 1LO2L 3RWHA 1DLFL 4RRPG 5C0AB 3MRQB 2ZZUT 4DOHE 3A6BH 1GRWA 3GGWB 3NIDE 4WY7L 3FB8A 3NGBC 4XBGB 4RISH 2FJFB 4JY4A 4PJHA 5J1AA 1JF1B 5L2KB 4OGZA 1IM9B 2EKSA 3RJDA 5GRVL 3ET9F 3WKMH 4NC1E 1JF5A 3HR5A 3QRGL 5GISL 2O61B 3QIUA 3LB6C 1A6PA 4GOSA 2VL5A 2IALA 1G7MB 4ZXBA 4EI5D 1ADQH 5D7IE 5JQHC 4YDJB 2C3GA 2X1WL 4JAMA 1DN0B 4PJGF 2AEWA 1H8OA 2WWKO 1S7UB 2N1KA 4MSWB 3P0GB 3PQYD 4U3HA 4X4ZA 1I1YB 5JW3H 4F8QA 4WVRA 2DL9A 1G7PB 4X0KA 4UQ2A 3SDXF 3C5JA 1IGJB 3ARGC 3ZT5A 2PXYA 4C4KT 3T77B 4P59L 2PTUA 1QPPA 1XIWB 4BKLB 1H0DA 4R90L 5CEYA 5IKCB 3U4BL 3OV6A 4MQ7A 5JXAH 5I1EH 4TSCL 5IQ7L 3Q3GB 3W11C 3RAJL 3PV6A 4UBDD 2ZCLL 5DJYA 4FQQA 4K3GA 3SE9H 2VLJD 3CLFL 3IJYA 2YD1A 1CK0L 3QCUL 1MFCL 4GAFB 1BX2A 1KCSL 2MKWA 5E6ID 5LBSH 3LN5B 1QBAA 5DTFA 4LRIC 5D6CB 2X4PA 3TVMB 4LF3B 4D0DA 3CLEL 4YBHA 4P2OC 2P47B 4HH8A 1SY6H 1FZKA 4PLKC 4R8WH 4P48A 2XPGB 3TBVA 3EYVB 4P0DA 2OYPA 5T1KB 3V95A 2V5RA 2CDFA 1FC1A 1U6AL 4P2QB 1A6VL 1DE4A 2XG5A 1RZ8A 2V2TA 1Q8MA 1ZHNB 4HK0B 3UPCA 2D4DA 2BNRA 4NQDE 3HAEH 5GGSB 3KPRA 5D96B 4F7MA 5EZJB 3GMRA 4JPIA 1CF8H 1RZKC 2IBZX 1X6LA 3ARDB 5IV2A 5J6HA 4LFHG 2EKJA 1PBYA 2APXA 1P4BH 1AGBA 3RQ3A 1OT2A 4JFEA 1AKJA 5IW3A 3WN5A 4Z78B 1RD6A 3PL6B 5C0RH 2P46B 3JV5A 8FABA 5BQ7A 2HFFB 5I1AA 3EGSA 3MUZ1 2EEBA 1ZVYA 3HLAB 5B21A 3SJVE 3B5TA 5FHBL 1Y18A 1M7DB 3T3PF 5JQ6H 3LKPA 3ZLQC 5DD1L 4NWUL 4NDMB 1YEGL 1KB9J 4RMRA 5TF0A 1QBML 5SWQA 2BSRB 1F2XK 4YHPA 4YHYB 3VXMB 1GGUA 3BGFB 2MJWA 1YPZE 3UJTH 3VXRE 4XP6L 4YXKL 1M71A 2YBRA 5EZOL 3K2UH 3DX7A 3TIDA 3U36A 4PREB 4YBQD 3SO3C 2X41A 2G2RA 2V9TA 2XXMB 1DQMH 4NZRH 1RZGA 4N8VA 3VWKA 4PJ7E 2ADFL 3RL1B 4OD2A 4ZUUA 1XF5A 3MCKA 1JZ3A 5IBUB 4PJXE 1LP9F 3MUY1 4YFLI 3TBSA 3MODL 1TVHA 1YYLL 3SCMC 2YC1B 4DW2L 2G60L 1DJSA 2ZG2A 5H8DA 4M48L 3O0RH 1PDKA 2EH7L 3IAPA 1G1CA 3H7BA 4TVSa 4Z7WA 5E8EA 3UP1A 1A1OB 1YUHA 3GMPA 1MHHA 4HJJL 3VXUB 1ES0B 4HS6A 4N5ED 4TUKL 3NIGE 4NZTH 4QKXB 4IOIB 3T3MF 4OLZL 5I75C 2FLRT 3DX8A 1PG7H 5CZXD 5HDQH 2I07A 1KYOJ 3L3DB 4PJ5E 1KJVA 4GMSH 4G6KH 5T5NF 3SBWA 4OZHE 1LO0H 3HE6A 1CIDA 1GC1C 2R23A 2H26A 2FZ3A 2NX5B 2VE6A 1VGEH 1Y0LB 4S0TD 4NQCB 4JANA 1U58A 4LCWE 2DM2A 2VDLH 1Z5LB 1F6LL 1T0NA 1A14L 3OR6B 4NYLB 3DPBA 4QOKA 1U91B 2VLKA 5HHXH 5F7KC 1KPRB 4FMFA 2GK0B 4X5LA 2GEEA 2I9LA 4Z8FH 3L1OL 3DUUB 2YMXL 2JCCF 3U0PB 2LTQB 1KLGA 1OL0A 2BNUA 3EYFB 4S1RH 3ILPB 5EU6E 3O9WA 3DARA 2PYFB 3MTRA 1ZSDA 1CXEA 3KPOA 3GSWB 5HHMB 1RURL 4K07A 1UYWH 4DUWA 4HJGB 3GIVA 4OM1H 1H5BC 2VISB 4MB5A 4Y5XC 4DN4L 3S5LA 1YQ2A 4RAVB 2DQEH 2IGFH 5J3HD 4OAWB 4XP5L 1WV7T 5DUPH 1NFIA 1JRHI 2Z93A 5FDWB 5MEND 4P5KA 4PY8I 1KPUA 3FONB 5JIKA 4KDTA 4KY1H 4UOW1 4UTAH 2D0GA 2Q8AH 5DURB 1HHGB 3O3BA 5E08H 4EUPA 1K5NA 1KT2B 2P4AB 5CJBA 1RUAL 5F1IB 4W4OC 1C12A 1G7QB 5I30H 1W0WB 3CFCH 1NGYA 1DQLL 4PJAB 4M1GL 4K2UL 1I8LC 4ELME 5IJKA 4DGIH 2KH2B 3T4AB 4F58H 4KKAC 4G6MH 4DQOH 4OJFH 4ZD3L 3PXHA 2E9JA 3Q2CA 4JM2D 3WNOA 1NPUA 3D3VE 4X7SL 5FECB 1TNMA 1XGPA 5BZWB 1HQ4B 3H3PH 2A73A 1U3HB 1H3XA 1I85A 5HY9B 3P4OB 4JQIH 5CEZD 4HMCA 2NXYD 3MV8D 1T1XB 2OP4L 4EBQL 3QIUC 3GNMH 1UQSA 3DUSA 1K4CA 1EGJA 1G7JA 3MO1A 4ZXBC 2RBLA 3STBA 3TT3L 5KSBF 1PZUB 4Y7MA 4P4RB 1NC2D 4PJDB 1AXSA 4P3DA 2P49B 3DGCR 4PUBL 5LGHH 3KPSE 3PWUA 3BJLA 4HH9A 3UTZB 1FYTA 3OAUL 2FJHB 2QADB 4ZNEE 1YMMD 3MV9E 5CD3A 3G5ZA 4H1LG 5GS0H 1RIUL 1F3DH 3OHXB 2PXYC 3H42H 4BZYA 2Y36L 2A6DA 4NNXB 4OKVA 1IGCL 3S3JA 3EFDL 5LAXA 1SJHA 2FBJH 3BMWA 2ZUWA 1GOHA 4LPWA 1JWUB 4WJ5B 5F9JB 2NY2D 4JFDB 3L95A 4RNRA 3Q1SL 4XXCA 1KJ2H 2ADJB 3RX5A 2J6EL 2LU4A 2A6IA 2QR0A 5C6TL 3ARFB 3EDFA 1R3LA 5GGQH 3EFFB 2A83A 3U9PH 1BQLL 3UJIL 5DEGB 3C87A 1AGDA 2Y1VA 3NN8B 4F80A 3OAZH 2H6PA 3OGCA 3OKEB 2YD4A 1RZFH 4M7LH 5FUCC 1AI1H 2W0FA 1OCWL 3BZDA 3U0WH 4I8DA 5B39G 3QPXL 3S34L 5IFAL 4M5YL 5D6DA 1J86A 2N7AA 5DD6B 2H41A 2H32H 4LSRL 4UINH 3THMH 3DGGB 3ZYJA 1LWRA 3FL7A 2QSTA 3VJ6B 1TDQA 2WUBL 2DTMH 1VFAB 4Y4FA 3B5GA 5E8OA 5SV4A 4AQ1B 5K59F 4X7TB 3HNVL 2VXSH 5DZOA 2P5WD 2Y5TB 3RWDA 1EXUB 3SKOB 4I0PB 1INEH 3VG0L 3C60A 2GJ6B 3F7VA 3KWWA 3CUPA 4XNYL 5CGYD 4QTHA 3P9LB 3ZE2F 4JJ5A 3QIWA 1OAYL 1XR9B 1KELL 5CHNA 3WXVL 5JR1H 4LEOB 3CAFA 4PYGA 1F4HA 1OAQL 4B0MM 3GMQA 4PTTB 1N5AB 5D2NE 32C2A 3ZT6A 3WN5C 1I8IB 3QG6B 4HCRH 4DKEL 1HXMA 2H1PL 1PZ5B 2HH0H 4HWEL 4HWNA 3NBNA 2D9QB 3VDCA 5E8NA 5HHOD 5L0QB 5C07A 3OKDB 5ID0A 5KSUB 2IADB 4NKMB 5HHVL 5MI0C 1JV5A 3TBWB 3GZKA 1TETL 2J6EA 5EBWB 5D7JD 1QFWM 5SWZB 1NEZB 5DK2B 4HV8B 4P4KA 5EC2B 5CZVL 2NZ9D 4WV1B 1E6JL 1XAUA 1JNNL 5I18L 4YXHH 3RA7L 1TQBC 4XRCB 1E4XH 5T5FH 5F1NA 3I02A 5F9DC 5ISZB 3S98A 4NJAL 1IGFL 1OGAB 4FQ1L 2R2CA 2GITA 1YEEH 4GSDL 4WNQA 4LAJH 1AE6L 5IB2B 1KNOA 3FQNA 3WFCH 1T0MB 3MNVB 5EZIL 1AD0B 1LE5B 4AL8H 3GHBL 2E9BA 1MJ7L 2CKBA 3NCJL 5C71A 1LNUB 1GPOL 3VWKC 3MRRB 2OL3H 4QF1A 1M6OB 2Q86B 1BFTA 4WI8A 2WIIB 4AJ0A 3IKKA 5FGCB 5F6HI 3Q0HA 1ZMYA 2CKNA 4HUXB 5FYJH 3MCG1 3BE1H 1DQJA 5SWSE 3CPLA 1CBVL 3UTSA 3A6OA 1VA9A 1CGWA 1KV3A 4X6DA 1ZEAH 3MRGB 4HKZA 4NUGH 4DGVL 1ZKAA 4QTIL 4KI5F 3ZTNH 3ARQA 2F19L 4PGEA 3BH9A 4YIQB 4PRPD 4WFGE 1EZVY 3AU1B 4CADA 1BF2A 5ANME 3MA7A 3H6JA 4M1DH 3C6SA 1T7XA 4NN5B 3CFBB 5I6XB 3V5DA 5IVXB 3MRKB 3SBWC 3BP5B 1W8OA 4RGNE 3HE6C 3CNKA 4RMSA 1T0PB 2QHLA 1XGRA 4KHTL 5ITFA 1CICA 3NFNB 4LLVB 4EI5A 5DUBA 5F6IC 4OLXL 1MREL 2A6JA 3DVFA 1GHFH 2P1YA 5I19L 3TNMB 3VXSD 5HGAB 5I8KL 1CVRA 2XQYK 6FABL 3S6CA 1HHKA 2Z92A 4HUUA 4BFIB 3LRSA 2D0HA 5E95B 3O9WC 1SMOA 3S4SG 5KS9F 4WDIB 1J0KA 5I16A 5FB8A 1I9EA 5EPMB 5J11B 2IH1A 4N8PA 3G08A 3BQUD 5C0IB 1EHNA 1S9WB 4NM8L 3UAJC 2VLJA 2ZSVB 2ITCA 2IG2H 3AREB 5I1HH 1JE6A 2HT4C 2ED7A 3L7FA 2W9LA 1FNGB 5E6IA 4GW1A 1EEUA 3QJHA 4U0RB 4K7PL 5CWSB 3O4LD 1P4LB 4C56B 4QCIB 4KDTC 4UT6L 3DETD 4DZBA 3HS0B 3HR6A 1NFDB 4Y5VA 5DF0A 3V0VA 5ICXA 1JI1A 3MSPA 1S78C 3HUJB 2XWBA 2EDKA 1D5XA 4CDHA 4YK4C 4GRWE 3DWTA 3GRWL 4PBXA 4JHWH 2EDYA 3P4MA 4PRHD 1SBBA 2Z0BA 4CVZB 5DMIH 4WUUE 5IJKC 4X99A 3LV3B 2R8SH 3ZDXF 4OBSA 3WFBH 4X5XA 4IEFB 3PP4H 4OQTA 2NY4B 5TE7H 3VXQA 3ULVH 4JN1L 3O41A 1G9ML 1BIHA 4WO4B 5GHWL 1KJMB 3BKCH 4DAGH 1V3LA 2BXZA 1I85C 1MCJA 2CIIA 1LEIA 2Q1EA 1QACA 2WWMC 3MYZA 4NSKA 4ZQKB 1EHLH 5H2BA 3MRDA 1HCFX 3GSUB 3VE0A 2A1WH 5D93B 5I76B 1BAFH 3AFLA 3GMLB 5IW6B 5E1AA 2DQJH 1M05B 4QXTB 1A7PH 5D9SB 5INCB 2UV3A 3MGTA 3OAZK 4HPOH 2L4OA 3QDJA 3EUUA 2WP3O 2IH3B 1RSFA 2Y72A 4KMLB 3D25A 1TJIH 5FUOL 2CQVA 2HKFL 4MCYA 2B0SH 5D7LD 2HJKA 3RDTA 1I1FB 3HZYA 4MX7A 2NYYD 3VFSA 1B90A 3P30L 1LDPL 4GXVL 4N0CC 4P2RE 2ARJB 2VYRE 3CVHL 3KYOB 4NHUB 1YEHL 1V05A 4XXCC 4ERSH 3QI9B 4LKXB 4KI5D 4XHJD 1TJGH 3HAEB 5MEPB 1ORQB 4CW1B 4P9HC 2J8UB 1K2DB 2IBBA 3DSFH 3GRWA 1TZHA 3ETBF 1JFQL 4GAYA 4PJ8D 4JR9H 4WEMB 3F7PC 5TPWL 3AY4A 1F4YL 4QRQA 2F53B 4HIXH 4O5LH 4KVCH 5GRWA 4MNGB 1CE6A 3FB7B 5IMMB 4QWWC 4XAKE 1D6VH 4DN3H 1MNUL 2JJUA 2VR9A 5D6DC 3RTQB 4HFUL 3EZ8A 3O45A 4FFZL 4HWBA 1VKXA 3EYUH 4J3XA 4Y4FC 1SBSL 4NNPL 4LK4A 5J06A 1WEJH 2V5SA 1X5JA 4E5XA 4H20L 3BKML 3RVXC 1CN4A 1P1ZB 4L4TE 3C60C 1NBVH 3SDXA 3FQWB 3CVIH 4PG9A 4N90D 4JREC 3QIWC 1RQ5A 2NY6D 4ONHA 4BH8A 3X11A 5K93A 3VU2A 3IDGB 1MCKA 1J05B 5CGTA 2PO6D 3MMEB 2BJMH 3I84A 1A7QL 3BPNC 3BT2L 2Z91A 2DWEA 3BP6B 4K94C 5I0ZA 4NQXB 4MNHA 2HTLD 1VPOL 1KXQE 1S7SA 3EDKA 1D3CA 2VOTA 4HZLA 4HIEB 4XBEL 2VXTL 3FMGL 3FFCE 2C7UA 4YHKL 4M6AA 3DV4B 3IDXH 3EW3B 4KJYA 5DHXB 1CE1L 5HTSA 1OQOA 4P4KC 1F42A 1IILE 5T3ZH 4F37F 3KYNB 1N5YL 3O2DH 1OTSD 3HC0B 4RFEA 2NY1B 3VI4F 3KXFA 4K7FA 3RU8H 3HNTH 4MJ6B 4E41E 5DA4A 1RFDL 3C5ZD 4NGHL 1KENL 3GSRA 1RJLB 2NY3B 5FKPA 5CGMA 2FWOB 2GKIA 2YRLA 4N0FA 4YFEA 3MJ7A 1PQZB 4LPYA 1AR1D 1J1OH 1AR2A 2BNQB 4JGJA 5JHDB 1NGZA 1T1YB 1BBJB 1OAZL 1OF2A 2DLGA 1Q9OB 5D5MA 4N8VG 1Q9KA 4Z7QF 1A6WL 1L0XA 4O4YL 4LSPL 1MI5B 2XT1B 1IBGL 2FIKB 2X70B 3LPWA 5BXFB 3B83A 4UT9H 1T22B 3MLYL 1PX3A 2WANA 1KPVB 3SKUD 2P5EE 4I77L 3NIDF 4K8RD 5F70A 3LKQB 1FN4A 1JRHH 4JM2A 4NO3A 4Y19D 1CYGA 3CXHK 2HVKA 5FV2A 3QNXA 1H3PL 5E8DH 2OM5A 1JHLH 3S96A 4M5ZL 2EYRB 3X17A 4WHYG 5DJDA 1A3RL 4ZFOB 5HPMA 5T33H 1DP0A 5D7IF 4M7KL 4ZTOL 2FH8A 2QSVA 4ELKB 1CICC 4KTDH 4LSSH 4EI5C 2C4FT 2ZUQC 4MJIB 2AJZB 1KN4H 1CGSL 3LN9A