5JWOA

Crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic from thermosynechococcus elongatus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
231
structure length
217
Chain Sequence
VKKIPTMIEGFDDISHGGLPQGATTLVSGTSGTGKTLFAVQFLYNGITIFNEPGIFVTFEESPQDIIKNALSFGWNLQSLIDQGKLFILDASPDPDGQEVAGDFDLSALIERIQYAIRKYKATRVSIDSVTAVFQQYDAASVVRREIFRLAFRLAQLGVTTIMTTEEFVSDNVVILRNVLEGERRRRTVEILKLRGTTHMKGEYPFTINNGINIFDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the day-night transition in a bacterial circadian clock.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Transcription regulator
molecule keywords Circadian clock protein kinase KaiC
total genus 70
structure length 217
sequence length 231
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jwoA00
3C41J 2WSMA 1I4DD 3CZPA 2H7VA 4QRHA 5JRJA 2YC2C 1AJEA 3CWQA 1RE0A 4ARZB 3IPXA 3IIMA 3L0PA 4BEJA 4F91B 1M7HA 3TBKA 5JECA 2OE2A 5BW8A 4LBZA 3X1XA 1HE8B 1KO8A 4MRVA 1U0HC 1Q1EA 1E98A 4A6PA 2RGXA 1XEWY 1R7RA 4JJKA 2CE7A 5JWOA 1EX7A 1YR7A 2IXEA 3AVUA 4RZUA 5FBLB 1ODFA 3EC2A 1COWD 3TR0A 1KY2A 2BJWA 2IYTA 1NNEA 3BB4A 3QKSB 4LY6A 2ODEA 4D26A 1TEVA 1E1RA 3QKRB 4XWAA 1YR6A 3P1JA 2AKYA 1ZM4A 2DYKA 1A2KC 2FNAA 3T15A 3PITA 1WXQA 4MDEA 1Z07A 3WRYC 3K0AB 1N6HA 3EC1A 1G291 5SZKB 4LHZA 2IXFA 1N0WA 4URWR 2H1LA 1KGDA 2ZUBA 4Q00A 3QXXA 4LBWA 3I5YA 3A36A 2WTUA 3X1DA 5CITA 4LJ8A 2ZRIA 1JALA 1DAEA 2ZRJA 4NL4H 2WOOA 3ZYCA 2FPMA 5L3SA 3LA6A 1ZNWA 3C8UA 2CNWD 1E2LA 3K70B 4QGHA 4B3FX 4ZCMA 3IILA 3O8DA 1RVDA 1SVIA 2OHFA 4RD2A 1DE0A 3W3ZB 2Q3FA 4BUJA 5C46F 2XXAB 1ZM9A 2VHTA 1E2HA 2GILA 2IYLD 3QKSA 4D6PA 4DLXA 2ORVA 3AKEA 3EG5A 4US1R 4ZDIA 5DH9A 4XVRA 4MQBA 4LJ7A 1WDTA 5EUMA 2J87A 2VQSA 3THXB 2YJTD 1J99A 4Q1CA 3CR7A 4NYIR 3RWOA 4RZXA 1P7CA 3A1SA 1XTJA 2QT0A 2ZE8A 2ZSDA 1GVNB 3LBIA 1KSHA 1OB5A 3D6TB 2JA1A 1QDEA 1M74A 2NG1A 4QHTA 2Q9BA 4G5SA 1Z22A 3RSLA 1P75A 4IJMA 2Q0HA 2OCBA 4TTRA 4BFTA 3ADDA 5K8TA 1VTKA 1RYHA 4D4LA 4JVNA 3B1WA 4IHQA 4PXAA 3GLHA 3U3JA 3PUVA 4ASUD 4B2IA 3ADBA 1CRQA 3A58B 4OBEA 2RGNA 4PQYA 1OXXK 1VCIA 4TWZA 1P4SA 1SZPA 2XTZA 4IVRA 3KXLA 1CULC 1VPLA 1R0XA 4O2RA 3W6PA 1N0UA 1XZQA 1TQ4A 4JVSB 5DYGA 5LD2B 2WJIA 2QY9A 2XAUA 1QHIA 4IOMA 1E99A 5HE9A 1IM2A 3KKPA 3PEVA 4PQFA 3GJ6A 4TYWA 2OILA 4YXWD 2D74A 5CK5A 4HUTA 1HYQA 3RYTC 3K0EA 3KQKA 2O8BB 2CLDX 3IQWA 2BKEA 4HZUA 2SHKA 2YINC 3R7WA 3NHAA 2ZE7A 3QSYA 1R8QA 2P0EA 2O8DB 2GETA 3SBEA 4Q02A 3ZQJA 2H18A 5LD2C 4TTPA 3LVQE 5SZJA 5EE0A 4A9AA 1K6MA 2G83A 4JMPA 1E1QA 1Z2AA 2FSFA 1WCV1 4AY2A 3LLUA 5KU1A 3VU9A 3ZIAD 2J59A 2PCLA 4DLUA 4D4JA 4IFBA 2AD1A 4B32A 3EZ9A 1DS6A 3KL4A 1JR3D 1MT0A 2GJ8A 3LH5A 1UEJA 1Y63A 1NF3A 4MGZR 4DLTA 3AVQA 2ZXUA 4AIIA 2C98A 3DL0A 1XD2B 1EK0A 1W0KD 4TYPA 3F8TA 1G41A 3QNUA 4CZ2A 3U44B 1IN6A 5GJVC 1RZ3A 4Q4HB 4LC0A 3UIEA 1SVOA 3UG7A 2VP4A 3HP1A 1MRNA 1MO4A 2FZLA 1ZIPA 3DMNA 4ACAA 2DFKB 2FSGA 2QORA 1KI1A 3CPHA 3CRMA 4KYIB 4PC3A 5CLQA 3T1TA 2D7CA 2GJAA 1B0UA 1E2MA 3WNDA 4TL9A 1YZNA 2AKAB 1NRJB 1VG9B 2ZJZA 4W7SA 1HH4A 4FIDA 1Q57A 2JJ2D 4YMVA 3GLFE 1EG7A 2BBOA 1F2TA 2NPFA 1N6IA 3AKYA 2Z4RA 2W6JD 3K0SA 2Y8EA 2ZJAA 3FHTA 5KHOC 4P4TA 2HEIA 2EFDB 3KQNA 4BZQA 8OHMA 3N5CA 2ERXA 3PENA 2ZUCA 4DHEA 2ANCA 2OLJA 4OHWA 1DTSA 2FSHA 4CT5A 1XXHB 5AJYA 2EFHB 5BN5A 5FUYA 2F3TA 2LKCA 1O3YA 4HDQB 4C0LA 1RKBA 4JLVA 3Q5EA 3T06B 5KSZA 1N6KA 2QQ0A 1II9A 1TEXA 4Q4AB 2JDIA 3L82B 1U90A 1E2FA 3LW7A 3QXHA 1KDTA 5AWFC 3SJCA 4A6XA 3A6PC 4JLDA 4PPNA 3PR1A 1E0AA 2P6RA 3CX6A 4WZAE 3LNCA 3D3QA 2VSOA 4JLAA 3BFXA 5G3ZA 3IDQA 4UNRA 5EE9A 3I62A 1CTQA 1M6NA 2GWHA 3BOSA 4QL3A 1N6NA 4XD7A 1XEWX 2QMUA 2WWGA 2ZI6A 4KFRA 5J47A 4TZ0A 1S3GA 2EYQA 4B2PA 3RC8A 3GLHB 4HB3A 4NYMQ 4TLAA 3GLHE 1TNDA 1FUUA 4TMKA 4IDNA 1G4AE 3AF3A 5G41A 1VG0B 4G01B 2IF2A 1MABB 2OSBA 1ESNA 4WVFA 3Q8XB 2BOVA 3IEUA 2R6CA 3VU9B 5CJ2A 1JAHA 4URXR 2ZAMA 2TMKA 4G3XA 4XSHA 3QG1A 4PSVA 4Q5IA 4QM6A 2CVFA 4N3NA 3TSWA 1G3QA 821PA 4XVUA 1TMKA 5LBIA 3GLGE 4NH0A 3WMFA 2OBMA 2IBMA 1AGPA 3DVLA 3PUXA 3EZ6A 3TW4A 1F5NA 5TB5A 2PMKA 1MO5A 1J8MF 3V9PA 1W1WA 4DWJA 1W36B 3R7WB 2NPIA 5DHFA 2CE2X 1E79A 2ZANA 4LOAA 4V0OA 3ZZ0A 3TUIC 2NZ8A 2GXSA 5BQ5A 4Q18A 3NWJA 2AX4A 3A8TA 2OFXA 1IXZA 2VHCA 2ZSFA 3L0IB 2QBYB 3AH8A 2PMDA 2JIZD 3R9IA 1GRNA 4D4KA 3AV0B 1KK1A 4R2HA 2PBRA 3AKDA 3AP2A 2OXRA 5H68A 4AKGA 4PZYA 1KSJA 2QSYA 5TVKA 3O8RA 4URZR 4GNKA 1WBDA 2ZJ5A 1D8TA 4MRPA 2PEZA 1XJCA 3RWMB 1UKZA 2QZ4A 5EUQB 4HYYA 2R8RA 4Q4JA 2OAP1 1VECA 1G7CA 1KNQA 3QG5A 1HE1C 1VHLA 2BCJQ 2E87A 2GXUA 1SVLA 2O0JA 3B1XA 4M22A 4Y0VA 4EPWA 2XITA 4LV5B 3FPAA 2GEUA 1LVGA 4Z51A 4Z1MD 1GRRA 2W6IA 4BFWA 3KJHA 4RFSB 2BKUA 2D3WA 2FEMA 4CEHB 2REBA 1AA9A 3NC0C 2ZSBA 2PCJA 1U81A 3GJXC 3GPLA 1YE8A 1L2TA 1PUIA 3AGPA 4AG5A 3T61A 4Q7MB 5C18A 5KDOA 2GF0A 1E4YA 1W4RA 2BBSA 4DIDA 3N2IA 5A4JA 5HZHA 2ZRLA 2OT3B 4GZLA 4URYR 4WZ6A 5CJPA 2CLSA 5GVSA 1NG9A 4CEJB 3AB3A 2WAYA 2O8EB 2GCNA 5CLLA 1E9AA 1KO5A 2EW1A 5KUTA 4I1VA 1JPNA 2QMEA 4KSCA 1KMQA 3KFXA 1G3IA 3SYNA 3U60B 3QOFA 1P5ZB 4OYHA 3W3AA 1ZAKA 3DO6A 3T12A 4E03A 2G1KA 1C4OA 4FMDF 3B2EA 4Q1AA 4EKDA 1T3SA 3ZVLA 1NSFA 3TRFA 5IHPA 4NZYA 2RH5A 4TN1A 5FPTA 4TL6A 1XJ0A 3MD0A 2QRNA 4C4PA 2XTMA 3TR5A 2C96A 4Q1EA 5IT5A 3G0HA 1Z0AA 2CLCX 1T6NA 2IL1A 2IWRA 3FKQA 1RYFA 5CIWA 5F3WB 5DN6D 1FNMA 1JAIA 1P2SA 5IK2A 2FPLA 4Q1FA 5JJLA 3TAUA 4GOJA 2J3EA 5B57C 1D9ZA 1S8FA 3QVVA 3C16C 4DLZA 4JLBA 1KYIA 1K5DA 2R9VA 2JLWA 2A9KA 2F1RA 4AKHA 1ZD1A 5FBWB 4ASUA 5DO9A 4BLSA 1JECA 1W48A 2B7CA 2KWIA 2LCFA 2OZEA 3ZVMA 5DNYB 2ZRNA 2ZVPX 4HLCA 2GK6A 3E5HA 5KPJA 3IKJA 3W5JA 5DYIA 1AKEA 1P62B 4ZKEA 1L8QA 4NYJR 3VX4A 2CJWA 3CPEA 1H8EA 1CR2A 3RLFA 2VP9A 2W0MA 1QBKC 1C1YA 4XTCS 1KTVA 5BXQC 1IY1A 1KKMA 4V02A 2R6FA 4HDCA 2WKPA 3UWOA 1XXHA 1SVWA 2V6IA 2QTVB 2J7KA 3R20A 4PPGA 4B43A 3NDBB 4ZDJA 2I3BA 4B75A 2GESA 4Q21A 4D82A 1OYYA 4FD2A 5FOVA 1QRAA 1A5TA 2BJVA 2C04A 2CL0X 2IS6A 3HR8A 3FMIA 1OFIA 1SKYB 4JYBA 1AN0A 1Z47A 5TV2A 421PA 621PA 1NL3A 3M1IA 2V1UA 3IEVA 4P31A 2XJ4A 1EFHA 2UKDA 1M1YE 2XSZD 4DT1B 3TUZC 1QHNA 4JSYA 1YQTA 5J4VA 3WNCA 1KIMA 4LYAA 4C2UA 2A30A 1BO6A 2B8TA 4ILEA 2JGNA 4UNNA 4Q9IA 5BYJA 1Q3TA 3OESA 1XEXA 3SJAA 4WXRA 1JBKA 3FE2A 3DKPA 4M8NE 4A36A 1GNQA 1XCMA 2WMNB 3K70D 2W58A 3B78A 3CRW1 1AZTA 2KB0A 1K8RA 4C0AC 3C15C 1CF4A 1E2JA 2VF8A 3ZD6A 1FQKA 2CVHA 5FTLA 2ODWA 4IKEA 2CDNA 2ZJBA 4PSKA 4QXAA 3X1YA 5BYKA 3AP3A 1OYWA 4MYCA 1SVKA 4YXWA 3TE6A 3WYAA 1NVXQ 2JLQA 3LLMA 3PUZA 4NONA 1KKLA 2IYUA 1CRPA 1KMHA 2OXCA 1F2TB 1FMLA 3CX7A 1F60A 4CIDA 3U5ZB 1R5OA 2R44A 3MCAA 4TYQA 1P61B 1TAGA 4W5WA 5FI1B 4RD4A 3UKDA 1KO7A 3Q72A 4LYHA 5E7JA 3QUSA 4KFUA 4QGAA 2A3RA 2WZQA 5HPYB 2HXYA 1VCMA 1N6PA 1HQYE 1A7JA 3ZS9A 2Q9CA 4ON9A 4RFVA 4BFYA 4Q4HA 2WJGA 1TPZA 5KPDA 4YDSA 2RGAA 2HYIC 1YJ5A 4OKSA 1CR4A 1JPJA 1JR3A 1D6JA 4LC1A 5E4FA 2V6JA 3OHMA 1E9RA 4IW3B 1J90A 2BM0A 5FOUA 2J0SA 1F2UA 2MMGA 1GWNA 1R0WA 3QPUA 4O25A 2ZS9A 1LFDB 1XXHE 3K0FA 1DAIA 4EPXA 1MR3F 2RMKA 4U00A 1KO1A 2GZAA 1LB1B 2C8VA 4E09A 2WWYA 3EWAA 4U02A 3QXSA 3WY9A 3HPRA 1XP8A 2WWFA 3R8FA 2ERYA 4HAUA 4RZ3A 3RC3A 1E1RD 1OHHA 3TQFA 2ONKA 4OL0A 3V4RA 1OKKA 4HLDA 2BEJA 3FFAA 2F6RA 2BBTA 1SGWA 3TQCA 4BZPA 4Q1BA 4BLQA 3HDTA 4L15A 4ZCLA 4Q9KA 4QFMA 1II8A 4C7OB 3CRVA 3OFND 2WJVA 4LRWA 4IEIA 3P32A 3T5DA 1Z6GA 4DEYA 4MDFA 1G3UA 721PA 2ZU6A 1Z6AA 4A8JC 4M21A 4JT2A 4M4SA 4HZIA 3DHWC 3K8YA 4TTQA 2IS1A 2ZE6A 4OQNA 2WWXA 1HUQA 2A78A 4BZXA 1XPOA 1MH1A 4B3BA 4BLPA 4O3MA 3MLEA 521PA 1WP9A 4JZKA 4D2IA 4DRZA 4EDHA 3Q5DA 4IXMA 2JLSA 2PH1A 1DAKA 2ZI7A 3K53A 2RAPA 1EWQA 1YVDA 4HLUA 3WYGA 1D2NA 2DPXA 1UDXA 1KI2A 5DHAA 2PLFA 4DEXA 3VNUA 2FGKA 2FZ4A 2BDTA 1AS3A 2P65A 4KI0A 1U99A 4X8OA 1XWIA 1Q0UA 5FPYA 1K5GA 2OG2A 1N5JA 3EZFA 3CUEF 3DPUA 3JZAA 1OH8A 4XTRA 3J81k 4HAZA 4TLDA 2P6UA 2MSCB 2FE4A 3W6NA 1I2DA 2QTHA 4F38A 2R6AA 4B34A 1QHHB 2YC4C 3KX2A 4CDGA 2YV5A 4JSTA 4P33A 5LB4A 1ZCAA 3TK1A 1XPRA 4Q4LA 4G5RA 4RZ2A 4AC9A 4Z1MA 1WRBA 2FMXA 1ZNXA 3OIWA 4A2WA 1EGAA 1GKUB 3HU3A 1KMHB 1Z0IA 4Q7LA 5M04A 5L3RA 2B7BA 1SKQA 2FF7A 1CXZA 3RAPR 4WZBE 5FFMA 1X3SA 5JHGB 5GADl 1IXSB 3N2EA 1OPXA 1XU4A 3Q85A 1BIFA 4JT4A 4LJ9A 4PPQA 2WJHA 1VKJA 4OK3A 2KBFA 1BH2A 5ELXA 2VP2A 2GAAA 1G7SA 5EXTA 3JZMA 2VRWA 1LTQA 1TU4A 2D4HA 1ZUNB 2JIZA 5FL7D 3S1AB 1E2PA 3DMDA 4NE2A 4D4MA 3E1SA 3OIVA 5FL3A 1OV4A 1Z08A 1WA5A 2RCNA 2O52A 3H1TA 1X1RA 2AWNA 1TUIA 4CYMA 1VIAA 1Q21A 4QGFA 1PLLA 4A82A 2VL7A 1A82A 1G6HA 3K9GA 3C7KA 4TMWA 3U7GA 2J41A 3SHWA 1SXJE 3QKUA 2DFNA 4CRWB 4AK9A 4ESVA 5AJXA 2IC5A 1DO2A 5CDFA 1FOEB 3MWJA 2NO0A 4LK2A 1VIYA 3L2OB 1OKKD 1YZKA 3ZVNA 4MUAA 5TY0A 1LF0A 1OW3B 3EWSA 1XTRA 2G1JA 4DLRA 1W0JA 2OCAA 3I8SA 4XD7D 2W0SA 2IUSA 4IDPA 2ZRDA 1U9IC 1EFUA 1OIXA 1FQJA 5FH9A 2CJWB 2YWEA 4KAXA 2W2TA 1SXJC 4MUBA 2JAQA 4NU0A 1EFTA 5AK0A 3FGNA 2F55A 2XOKA 1VYVA 1DAFA 2D62A 2IS4A 4PHGA 1CBUA 1OFUX 1UM8A 4CEIA 4ZDKA 4U5XA 1I4LD 1TUEA 3L43A 4JL6A 3REGA 3U3RA 4ZI2A 2I1QA 2FFQA 1ZJ6A 4IVPA 2REXB 4LHVA 4MYTA 2RGNC 4Q4AA 4DSUA 4DT1A 3WHKA 4KFSA 2YKGA 2EVWX 3KTAA 2HYDA 3GJ7A 4R98A 4XSGA 5DI9A 3RS7A 3OEHD 1QHYA 3A1WA 1W2GA 1G20E 5G3YA 2NQ2C 2VP0A 3THXA 2K5UA 2ZYUX 4WW0A 2ZRCA 5DLQC 5TARA 3ZGXA 2DWQA 3TMKA 1H8HD 4PAQA 2C95A 1NBME 3OF5A 2HT6A 3SS8A 4AKIA 1CJKC 4A0GA 1E94E 4LHYA 1KI6B 2R6DA 2XZOA 2IUTA 4FMBB 3I3SR 5EP3A 3VTKA 1R5NA 2BM1A 3FMOB 3GJ8A 4PC6A 5J4HA 2MMCA 2A5YB 5C1BA 3AVPA 2JLUA 1SHZA 2VHJA 3Q7PA 4B6EA 3KB1A 2QEQA 1NJGA 4GI7A 3FYHA 4NCIA 3QXCA 2I1VB 3LRPA 3UG6A 4Q48A 2GVDC 2BV3A 3VNVA 2H92A 1L4UA 3MSXA 4GZMA 4FCVA 2ZRAA 4M53A 3U7FB 1T91A 1EFCA 4UNPA 5BN3A 4PZZA 4B35A 3IPYA 1MV5A 3VMFA 1NKSA 4TYYA 5L3SB 1IJEA 3FMFA 3CIOA 1ZNYA 4C0SA 1FFHA 4AYWA 5KTYA 2A2ZA 2QMHA 5HE8A 4DDVA 4LYFA 1YZLA 1XD9A 1ZVQA 5JEDA 1ZCBA 5EXPA 4NYJQ 4PAOA 2J7PA 1N5IA 1GOTA 2ZITA 2KBEA 3NG1A 4ZCIA 1MO6A 3PVSA 1PVOA 2B6HA 2C9OA 2QL6A 1G1MA 2ZRBA 1KAGA 3I8XA 1AGRA 1JXOA 2NGRA 4LV6A 4B47A 3AVWA 4IDOA 3T1VA 3L8ZA 1TL7C 2GJ9A 3CNNA 1PZNA 2OUKA 2Q21A 2Z0MA 5B2ZA 3VKGA 3AKCA 4R9UC 4BFUA 4II7A 5GJBA 1SXJA 4AKEA 1NP6A 2FU5C 2J1LA 2G88A 4R71A 5JHHB 2AL7A 5KDDA 2OO7A 4G1UC 5FTJA 5HCNA 2F1HA 1VG8A 2CL6X 2JASA 3QKTA 5JWHA 2ZI5A 4KLNA 2OCYC 3CH4B 2W2VA 4DUGD 3CX8A 4BGDA 5FPSA 3O8BA 3TAHA 1KDOA 1WQ1R 2GBLA 1FTNA 1ZRHA 2YZ2A 1F3OA 1KY3A 3SQWA 4B3DA 3C5CA 5D3MB 5EXSA 5H1YA 3VR1A 3EW9A 2FG5A 2FA9A 3CKLA 1OFHA 1GP2A 5F2EA 1FP6A 3FOZA 4C7OA 2DB3A 1BYIA 1ZC4A 3MGCA 3CBQA 4DJTA 2AXNA 2VYFA 1KDPA 1T0HB 1G6OA 4DVGA 3OEHA 1Q1BA 2GK7A 4OI2A 3IQXA 3R9XA 5C4GB 2ZJYA 2Z6VA 3D8BA 1YR9A 1RRCA 1Z6YA 3GQBA 1Z8FA 1VMAA 1CJMA 4F4CA 1BYUA 4US0R 1UKEA 4YMWA 3VR6A 1GM5A 1ZNZA 5FTNA 5JFGA 2ZRMA 4QBHA 5KSPA 2VTKA 1NVVR 4D80A 4EUNA 4XVQA 2PX0A 2F1JA 4QJ5A 1S1CA 4MKFA 2PZFA 5DI3B 3ICEA 3QPVA 4QG7A 3LVRE 4A2QA 2GF9A 1E0JA 1XD8A 5AJZA 1IN4A 4DLSA 3ZZTA 1NLFA 3LBNA 4EFMA 1N5KA 5IRCD 4YQFA 1SVMA 2WWIA 1T0JB 2VIIA 4DXAA 1VYTA 3CRRA 4QGGA 3QENA 3IHWA 3T1OA 4GP7A 4HUQB 4YDHB 1W4AA 2QM8A 2J5XA 4NCKA 3W90A 2WPDD 4QKQA 1GDDA 4IXNA 1XBTA 5KO2A 3U7HB 2R6GA 5FPKA 2IYQA 2PEYA 4KXFB 4P4SB 4GRAA 4TQUS 3SDZA 3KQUA 5F9FA 4FCWA 3EIQA 6Q21A 4PSAA 5JCZA 1EXMA 2BC9A 4TL7A 1XCGB 1JQJC 1XB2A 5KNCA 1M2OB 2WM9B 4Q47A 2NTYC 2ZYTX 3W6OA 2OM2A 1DEKA 2IF0A 4ZKDA 2JJ1A 3I73A 2F7SA 3QEJA 1G7TA 1G19A 1J8YF 3IBYA 5AUQA 1N0VC 2UZIR 1H8ED 1P9RA 4DCNA 1OXTA 1W4CA 3EA5A 4TQ9A 2IT1A 3Q7QA 5KNDA 2IK8A 1VCOA 3K0AA 2ORIA 1EFRA 2BIFA 3X1ZA 1E2EA 1TF7A 1G3RA 4M9XA 2JLXA 2RB4A 1SQ5A 4XJXA 2DFLA 3GJ0A 1TQ2A 3QVUA 4L16A 1N2CE 4HLQB 1T5LA 4M1TA 2VF7A 3SQXA 1SXJB 3A37A 2CCKA 2W00A 4LJYA 2P67A 4B3XA 1HT2E 4KJZA 2JLRA 4DSOA 4XWKA 1U0JA 1VYUA 4Q7KA 3CZQA 3HJNA 1ZMXA 4HATA 2W83A 4MRRA 1N6LA 1KAOA 4EJSA 3FMPB 3OE7A 2NO1A 3GD7A 2P3SA 4W5HA 3SR0A 4RKFA 2IX3A 1IY0A 1E9BA 5FBVB 4TT3A 1JJVA 5D3MA 1VCNA 3B1ZA 4IOKA 3IO5A 4A0RA 3IIJA 2QGNA 4BLRA 4MGIR 3GJ5A 2CXXA 3THYB 1E1QD 4L4UA 4AYTA 1GL9B 1FW6A 5FUWA 1E2KA 2JCSA 2O5VA 4PC7A 1PLJA 1XJQA 3PUYA 3B7GA 3JVUA 3CM0A 4N0DA 3IBGA 5CM9C 3LX5A 2IHBA 4IOLA 4PR0A 4DSNA 3U6KA 3GLFB 2IEZA 1FX0B 4PZLA 4R2IA 5DIFA 4IOJA 1GKYA 1DAGA 1RRGA 4FXPA 3V00A 1E9DA 2ZREA 3BGWA 1HTWA 4RKEA 2HLDA 4A8JB 4YMUA 1W36C 3KKOA 1TX4B 2ONJA 1T9HA 4C0BA 4A4DA 4B76A 3WMGA 1YKSA 4I1OA 2G6BA 2BWJA 2ZRHA 1BOFA 4AD8A 1R6BX 2NOAA 3ZVRA 3ZDQA 3QBTA 4M1SA 3B13B 2ZU0C 3NTUA 3QBVA 4WXPA 4X8HA 3UATA 4RFSA 5GJCA 1UEIA 4HZUB 3SC3A 3SYKA 3DZDA 3BXZA 4LJ5A 3AEZA 1RW4A 4JKYA 4YMSA 1GILA 1P2TA 2ZTSA 3QEOA 1KK0A 4Q4JB 2ECKA 1XF9A 4V0ME 3B1VA 5EXXA 2HT1A 2ZPTX 5DSZA 2WJJA 3TIFA 1ANKA 4M0LA 3TNFA 4HEJA 4OHZA 2ZR0A 2UZ3A 1MO3A 4MITA 2QROA 3BH0A 5FTMA 1DVRA 1SULA 3CNLA 4H1UA 3UANA 5FBQB 1ZINA 5EE5B 5LPNA 1T4GA 1YZUA 2WV9A 4DC9A 2XNDA 2V3CC 2CCGA 4TSFA 2HUPA 3HWSA 1CIPA 3B8HA 4FI3C 4PPFA 4TMTA 4OQXA 2OFOA 3KQHA 3JVVA 4D81A 4ABYA 4I81A 1O87A 3RS2A 2BHRA 1NN0A 1AM4D 2HCJB 1G3MA 3WXMA 3GLIE 2QAGB 1YRAA 5IDVA 3ICQB 4HLUC 5HR5A 1US8B 2IYYA 2YWFA 2AFHE 3K9HA 3AVTA 5JWRA 3KUDA 1CP2A 3A1VA 3PXGA 1KSGA 2A5JA 1Q44A 2YYZA 1BMFA 1ZUIA 1UFQA 1AS0A 1RFLA 2OV2A 2FDCA 3SYLA 3RNLA 1RIFA 2QAGC 4PHTA 3GFPA 3KKNA 1NBMD 3L8YA 4I1UA 3MMPA 2X77A 3ND8A 3EPJA 4DIEA 4JVMA 4G5GA 2ZIAA 5FTKA 4BRWA 3VR2A 2PJRA 1KSFX 4KU4A 1Q12A 4HAWA 2NZJA 2Q3MA 1IBRA 1XMJA 1ZD9A 4KYUA 4B74A 1F2UB 2ZJOA 4KHZA 2DWPA 4C2TA 2EU8A 5CM8B 1Z5ZA 1DBSA 2AR7A 1GZSA 1P9NA 4PO8A 1KI3A 1JEEA 5CYOA 1P9WA 3ADKA 3F3YA 2GDJA 1XFAA 4NTZA 3O47A 2A5GA 1FL9A 3EIEA 1NSTA 2AK3A 1II8B 3GFOA 2DFTA 2ZYVX 4QHYA 4MKGA 5D3QA 4QM7A 3SNHA 1UADA 4OQLA 1ZP6A 2ZM5A 1R10A 3KKMA 5EZ5A 3RANA 1XRJA 3PEWA 1E0SA 1AS2A 3TSOA 4YMTA 3BFKA 2AFIE 1OH5A 4B6FA 2JLVA 2C99A 3RRMA 5FOWA 1M7BA 1DAMA 4NBSA 2J7PD 4PO9A 4HAXA 3B85A 2GTPA 3RS0A 2RKOA 2XX3A 1FP7A 2VP6A 4CEHA 1QF9A 4DB4A 4IEEA 2O8FA 1MOZA 3RS5A 3LO5A 2XGJA 2C03A 2DY1A 2QMOA 4DSTA 1Z83A 3H4MA 2VPPA 4V0NA 3B9QA 4PHFA 1Z06A 4TQAA 3AF1A 2ZR7A 4KFTA 4FMDB 1OFTA 1T8UA 1UDWA 3AP1A 1G18A 2P2LA 3LBHA 1ELOA 2J0UA 3C5HA 4D0GA 3KFVA 1PV4A 1SHKA 1RJ9A 3H0KA 3I72A 5JEEA 2VSFA 3E2IA 1ZM7A 4O0MA 1COWA 1UPTA 1LS1A 1G8FA 3SE0A 3R9WA 2G3YA 4OK6A 2DWOA 4AWXA 3LWNA 4NKRA 3G82C 4JBYA 4DZZA 2ZEJA 4RCYA 1A4RA 4QNMA 4MKIA 4ZI3A 1FZQA 1R5BA 2QENA 3HU2A 4JL5A 5CYPA 1KI4A 1P72A 5CDFE 1G9XA 4JLNA 1Z6XA 3I1FA 3ASYA 3WMEA 1P6XA 1IOZA 3BC1A 3TGPA 1KNXA 2B8WA 3VQTA 4UNQA 3GEIA 4XIGS 2ZAOA 1T3HA 1X8JA 2HF8A 4EJSC 3NBXX 1QHHA 3X2SA 2XOKD 3BH7A 4URUR 2FOLA 5FI0B 3TJZA 3K0CA 3ZZUA 2QRZA 3M4YA 1KI6A 1IY2A 4JLOA 2GCOA 2QI9C 1U2RA 2AD5A 1G21E 3P4XA 4PAMA 4IRUB 3VR3A 2GJSA 3ADCA 2CCJA 5SZIA 4G5QA 5AR1A 5FPHA 1M34E 4JBXA 1Q1ZA 4MKHA 1ONBA 4LBYA 3LQQA 2BCGY 3BH6A 5JS7A 1KK2A 3LW8A 3AGQA 1E2QA 1KI9A 1DPFA 3IUYA 4C0KA 3AVYA 3VKWA 3CLVA 5J40A 3NH9A 1SXJD 4UQOA 2QP9X 2GEDA 4LHWA 2GVZC 1P60A 3BBPA 1QZXA 1MRSA 1E9CA 2ZR9A 3WBJA 4GPTA 1Z63A 2O8EA 1CJUC 4NHOA 1S0UA 3OEED 1DG3A 1G64A 2IYRA 3CF0A 4KSBA 5FL7A 4QBFA 5DISB 3DM9B 2CMKA 1Z28A 2WSSD 4Q9LA 3T5GA 3GP8A 3EA0A 3ETLA 2IW3A 3U4QA 4YLGA 1D5CA 4RVCA 1DADA 1MKYA 2C9YA 5EZ6B 1Q20A 2C9CA 3L0SA 3PQCA 4B71A 5FBRB 3OZXA 3DM5A 4RD0A 3SFZA 2PX3A 3U2QA 2FFBA 1HY3A 3NH6A 4RCZA 2AN9A 4DUGA 1WE2A 1P2VA 4NCJA 2O0HA 3U3OA 1UF9A 1U8AA 2GKSA 3GLGA 5B64A 4M1YA 3SEAA 1E69A 2XZLA 1A2BA 2IYVA 3C4JA 2GJKA 2ZJ2A 4X8MA 1TTTA 2ANBA 1WBBA 1Z0FA 1PJRA 1KZGB 2NO7A 3MJRA 3OFNA 1U9IA 4FCTA 1G8GA 4OI4A 2Z83A 121PA 1JXMA 1ZD8A 2QU8A 4B48A 2O8CB 2H5EA 2QE7D 4C0HA 3X1WA 3QQ5A 5DGXA 2YOFA 3CWZA 5AJVB 3EPHA 2VHUA 4LX0A 4LZZA 1TQ6A 1W5TA 4RD3A 2IEYA 5ANRB 3BFVA 3T35A 3HYTA 4BRUA 4ACBA 3M6AA 2HF9A 4CGZA 3FHCB 2ZSEA 3SHFA 4NDZA 3THWA 1OXUA 3LD9A 1J70A 2BMDA 4D0LB 4V0LA 3F0TA 4OQFA 4HAYA 4Q03A 1KHTA 3ECCA 4C9BA 2FPKA 3AUXA 3BIFA 4C0QC 5IF9A 1W49A 1TF5A 4MYUA 2A5FA 3AF4A 3L0OA 4LGMA 2J9RA 4LJAA 1GKIA 1NVWQ 2AWOA 2HJVA 3GLGB 1W7AA 3A4MA 5CK4A 2XJ9A 4TLCA 3NXSA 4N0EA 3RS4A 3R8CA 2CHVA 4NP6A 2YWHA 1G5TA 1E0KA 1US8A 2GRJA 4J0QA 4M9QA 4TMVA 2V7QD 3I32A 4K81B 1R2QA 2KJQA 4K8OA 2PT5A 4QJ3A 1S3SA 1X1SA 2FEOA 4M1MA 1KJWA 4ARZA 1XEXB 5LDDC 5KSOA 2X19A 1VDZA 1E9EA 2GBLC 2YWGA 1OE0A 4ZIRB 1GUAA 1IXRC 1G8HA 3WRXC 1NN1A 2B92A 2E9SA 3T1QA 5GVRA 1Q3HA 3GEHA 3VAAA 1AQUA 2WAXA 3CRQA 3K0CC 1IN8A 1FPMA 2EFGA 1R0ZA 2YOHA 3DEFA 4KV9A 1FUKA 5HKKD 2KI5A 2IHYA 3BAFA 1I2MA 4V0MA 4JKIA 3TW8B 2IXGA 4B3GA 3OE7D 1HURA 2FGJA 2WOJA 3K1JA 4P4SA 4IDQA 5SZHB 1D2EA 3FDIA 3EPLA 4F92B 1YZTA 3UXMA 3QI2A 4HAVA 2W6ID 3B5JA 1W5SA 2WSSA 3FTQA 3GJ4A 3NBYC 3QIAA 3UMFA 2IS2A 3CO5A 4C0JA 2R65A 2G0NA 2VH5R 2WIBA 1XTSA 1NKTA 3EARA 3VFDA 5J4YA 2GZHA 3NC1C 5JJKA 3GCGA 1X8LA 3K9LA 3NIBA 2E1RA 3MUFA 4XOIA 4Q01A 1JI0A 2X8AA 4BEBA 5UKDA 3NEYA 1N6OA 1PLKA 3SU8A 3E70C 3CNOA 2GNOA 3BRWD 1GFIA 2FV8A 2JJ8A 1Q1QA 4TT3D 1NIJA 1I4TD 1XTQA 2ATVA 1YZQA 2J0QA 4UNSA 4EFNA 2IYXA 3Q9LA 3DDCA 3DKVA 2JLYA 3TSZA 1NMYA 1OF1A 2WIAA 1UKYA 1KO4A 1R8SA 3FWYA 1SKYE 1QVAA 2WKRA 4H1VA 2XSZA 3H86A 3QJYA 2ZS8A 2D2EA 4KITB 2J0UB 4G5OA 1OXVA 4OHXA 4HUQA 5G53C 2QG6A 3AVOA 1ZC3A 4GP6A 4L9WA 3IO3A 2J0VA 2MSDB 3SJBA 3CF2A 3U3KA 2GCPA 4KBGA 1D2MA 1UKVY 1QHSA 4Q9JA 3UWKA 3IHLA 3W8NA 1EFRD 1Z0DA 4RJLA 5JMTA 4V0KA 1L4YA 2QAJA 4QC2A 4JVLA 1YRBA 4HB2A 4AURA 1B23P 2YOGA 1E96A 2O8FB 5EP1A 1E32A 4P0TA 1NLZA 4QOSA 4I1SA 2Z4SA 2FX3A 3LV8A 1RPZA 4QJ4A 4K46A 4Y0AA 4EQ6B 4AI6A 1NJFA 4BFXA 2CL7X 2GA8A 3GEEA 4WIAA 1W4BA 3PCRB 1X6VA 4LCBA 4TYNA 2V7QA 3LXRA 1TF2A 4DCSA 1F6BA 1ZYUA 3KDSE 1DAHA 4UJ5A 1U8YA 2YVUA 4DDWA 5P21A 4BFSA 4FMCF 4HSEA 4BASA 3I5XA 3RHFA 3PJRA 1OB2A 2DBYA 2FFHA 2CHGA 4A15A 2FFAA 5KOYA 2O8DA 1CLUA 3QF7A 5CB6A 3BB1A 1YR8A 2BMJA 4WAUA 2OBLA 2PLRA 3FHOA 4KLZA 2J45A 3K9NA 2CK3D 1JEDA 2NO6A 2HJGA 4FWIB 3B82A 1F48A 1WMSA 2O8CA 4JYCA 2WHXA 3K70C 1ZU5A 5HTKA 3HU1A 4E22A 3T34A 3PEUA 1ETUA 1NI3A 1Z29A 1RC8A 2OCPA 3GFTA 4EAQA 4NMMA 3IIKA 2GZDA 2H8KA 1XZPA 3FKSD 4Q19A 3UPUA 5L3VA 1HV8A 4OI0A 4LPKA 1NN5A 1ZU4A 2N42A 1SVSA 3BORA 2HLDD 4P32A 2FN4A 1GITA 4M1WA 2XB2A 2RGGA 3BS4A 2EWVA 3C14C 4ZIRA 2P5TB 3W5IA 2MSEB 2JLZA 3P20A 3SI7A 2DHRA 1UBCA 2CNWA 2UVQA 1KI7A 1DO0A 2CK3A 3QPWA 5FOXA 1OXSC 4DCUA 1OT3A 2EYUA 2V4ZA 1IQPA 2ZE5A 1R4AA 2CEAA 1ZIOA 3ZH9B 4GOKA 4E07A 2HCBA 3P4YA 3THYA 3UMRA 2ORWA 2ZVQX 1KI8A 3U61B 1W36D 3VKHA 2VA8A 2F43A 2DCUA 2RGDA 1MABA 4TLEA 3TLXA 2OAQ1 3PEYA 1YU9A 3OAAA 4CT4B 4BFVA 3NBFA 2RHDA 1NVVQ 3FB4A 3UK6A 3QF4A 4DCTA 3TVDA 4DLWA 3KQLA 1TQDA 4CF7A 1S9DA 3LY5A 4PANA 4X8LA 4F7WA 5JSZB 3LDAA 2EFCB 4O2LA 5EE1A 4MGYR 4TSFD 1S4QA 4H9GA 4B44A 1LW7A 4B3CA 3DOFA 3G5UA 3MWKA 3WBKA 1VG1A 4GMXA 4EPVA 1G4UR 2X2FA 1CJTC 4GDFA 5AUOB 1CEEA 1W0JD 3ZJYA 4EPTA 1GRQA 5JBQA 3TH5A 2OESA 1QHXA 2ODBA 1NIPA 3AQ4A 2JEOA 5TXGA 1XTIA 3EASA 2G0TA 2Q6TA 4LUCA 2QPAA 3QXJA 4LI0A 2RHMA 3OEEA 2L0XA 3KJIA 4PQRA 5EE3A 1E2GA 1NBMA 1OJLA 3LX8A 1T5IA 1OH7A 4LSGA 4A0FA 1T8TA 5FOTA 1FMJA 1GNRA 1DOAA 1W44A 4LJ6A 1AKYA 1NLYA 1EX6A 5TDHA 1QG4A 3MWLA 1W46A 3ZQ6A 3K09A 2F9LA 1V43A 1UBGA 2EFEB 4OJKA 5JS8A 1W2HA 1OH6A 4OK5A 1ZM3A 4MYHA 1IN5A 1RRFA 3KJEA 1X86B 3RRYA 1WF3A 4NCNA 3FVQA 2GAOA 2WPDA 4RD6A 1UBFA 1YHNA 2ZYWX 4GMDA 2ZETA 4A2PA 4F93B 4KO8A 3NKVA 1AK2A 3EZ7A 2XTNA 5K8LA 3NHBA 1IHUA 2PT7A 4OJQA 1XD2A 1GL6A 2BEKA 3RS3A 2Q9AA 3EPKA 1OLOA 2IYWA 3REFA 3BK7A 3N70A 5A0FA 5BN4A 5KNBA 2GEVA 1XCPA 1GNPA 1N5LA 1D9XA 2QPTA 5E7IA 1XTKA 1FNNA 1M7GA 4UXHA 2V55B 1CU1A 2XNDD 4ERNA 4P4UA 2FH5B 1N3BA 2VSXA 3Q3JB 4UXIA 4Z8XA 1UJ2A 3PV0A 3RVBA 4CEJA 1KJYA 1DARA 2ATXA 2GCOB 5A5GA 3MWYW 5K8UA 3O8CA 3TVTA 3TKLA 2ZS7A 4EQ6A 1KOFA 2PZEA 5AUNB 1KDRA 5K8IA 2QAGA 3LXXA 4V03A 4B33A 3I61A 2QNRA 2P5SA 3EAQA 5H8WA 4DBLC 5TMPA 5FR2A 3AVVA 5DE3A 4FW9A 2D2FA 3S1AA 2AK2A 3HPQA 2PZGA 1U8ZA 4Q7JB 4XH9B 2F3RA 2LWIA 5JLJA 3GMTA 2F9MA 2V1XA 5C4MA 1FX0A 1GIAA 5FUXA 1GG2A 1XX6A 4MRNA 1IONA 2EWWA 4OI1A 3SN6A 3NEJA 4KVAA 4JS0A 1G8PA 1UBEA 1OHHD 5JRZA 5JJIA 3B9PA 1E3MA 5JI3E 3HYRA 1E6CA 4A0HA 2D06A 2QQEA 3OIUA 4I4LA 2VP5A 4UJ3A 3ZS8A 2WWHA 3V4FA 4KCGA 1LF5A 5JCPA 3LAWA 2IUUA 4GSYA 1XNJA 1GTVA 5C2JB 1LNZA 4C30A 2WVJA 4WA7A 2QUZA 2F1IA 2IYZA 4KODA 3EX7C 5F98A 2PL3A 3SJZA 3D7MA 4YC7A 1G8YA 1ZBDA 4TLBA 2EQBA 1XPUA 4DDTA 3KKQA 2WMOB 2C78A 4BLTA 5DI3A 4UXJA 1E79D 1L7VC 4PC1A 4BWYA 3P26A 2X1VA 1G7RA 4LHXA 4PC2A 1TADA 4TMXA 4F4IA 4KVGA 2W6JA 4FMCB 5BWMA 1IAQA 2C2HA 2FSIA 2IYSA 4ITRC 4WOPA 2ZUDA 4TZ6A 2RGBA 2JJ2A 4S2EA 3TUJC 3VHXA 4Z8YA 3WP0A 4A8JA 5E3HA 4RY2A 4POAA 3OIYA 1NY5A 1P3JA 1NG1A 3BJIC 4US2R 3KTAB 2V8OA 3GLFA 3AF0A 4LDJA 4CW7A 1W47A 1H65A 1HA3A 1KJZA 2BVNA 1BMFD 3EZ2A 4KBFA 2PJZA 4TMZA 5JZVA 5HCIA 3CW2A 3I92A 4QBIA 2B21A 1EESA 4PHHA 4DB2A 3PIRA 4BPBA 2QA5A 1ZUHA 4JLPA 5E95A 1TU3A 3A4NA 3U44A 1A1VA 1J2JA 3KXIA 1T3LA 1S9HA 1XDBA 3BERA 3AVXA 2N1BA 3CONA 4ZPXA 4ESHA 1XMSA 4D25A 2ZRKA 4JL8A 5AJWA 3FFBA 5EJEA 1JJ7A 1Q22A 4HB4A 3RRNA 3ZIAA 3CPJB 3F5FA 1AIPA 4GFDA 4EFLA 3W8RA 1FTSA 2R62A 4G0NA 4PX9A 1H8HA 2CBZA 1OSNA 4M1OA 3CH5A 1LV7A 4NPHA 4ZV4A 4L9SA 1LS6A 1IN7A 4DKXA 1NVUQ 5KDLA 2XXAA 3WYFA 1ESMA 2C77A 4L8GA 4GL2A 3KB2A 3LFUA 4R7ZA 2Z43A 2QSZA 5EP2A 1N25A 2R2AA 2XNSA 1WB9A 5G40A 1BKDR 2WBLC 4AYXA 2WKQA 4HI0E 4BFZA 5J5CA 2FJUA 2QP4A 1XEFA 5L3QB 5B58C 4M2LA 3GLIB 4JLMA 2JJ1D 2GHIA 4JLKA 1AQYA 2QN6A 2ZQ5A 1VHTA 3PUWA 4M9SA 2BMFA 3M0EA 3B6EA 3RSOA 1DELA 3SFVA 5HKKA 3ONWA 1E2NA 1DG1G 1R0YA 2A7QA 2HV8A 4JIMA 3VR5A 5B30A 4CVNA 4DCVA 1HQCA 4IDHA 1KZ7B 3CF6R 4LBVA 2D7DA 3BWDD 5IK2D 3KZ1E 2VO1A 5LB2A 2J46A 1OIVA 1Z0JA 4Z54A 4HB0A 1C9KA 1Z3IX 2WWWA 2NMVA 4LV8B 1J7KA 1S96A 2NO9A 3QF4B 5FUVA 1E9FA 2XB4A 1V5WA 4Q9HA 2GXAA 3ND9A 5GJWC 4AG6A 4WBSA 2LKDA 1M8PA 1S1MA 2A5DA 2VHQA 3LQRA 4GOXA 1JR6A 3SBDA 2ZI9A 4PO1A 2F43B 5EP4A 1UAAA 1JQLB 4GBMA 3THOA 3U7EB 4P3YA 5L3QA 4LWZA 4EIWA 2G9NA 1JNYA 4LJ4A 4OHVA 1YZGA 3U4QB 3QY0A 2ZRFA 3WHLA 2HXSA 4B2LA 4I99A 1G5RA 4MH0R 4IVQA 2WICA 3QKRA 3VHLB 2YNMA 4HDOB 3KUCA 4N1AA 1PUJA 2QE7A 4BECA 3W9YA 2OLKA 3K0FB 4Q66C 5J4KA 4ZDWA 3A1UA 5H70A 2Z5FA 4FWTA 2H57A 2VLIA 5FR1A 3AF2A 2OBNA 3P27A 4A1FA 1ZM2A 1NMZA 2ZI4A 1GSIA 2G77B 2Q3HA 3AUYA 3BB3A 3H84A 4NCHA 3AM1A 5E7MA 2ZSAA 4GT1A 1JR3E 4EPYA 2ASEA 5KYKA 5F9HA 4MGKR 2QBYA 3GJ3A 4C3ZA 1NMXA 3NBZC 2RGCA 4DDUA 1GL7A 3KXKA 2C5LA 5L8VA 4JBWA 4NYMR 3U6BA 3IGFA 1G5PA 3MG9A 2ZROA 1KK3A 4DLVA 4W5JA 2BMEA 2NIPA 2ZI3A 1Z0KA 1RRPA 4RSGA 1E9SA 3GLIA 3KJGA 3ZD7A 4E5UA 1QVRA 3MRSA 2JATA 2DR3A 2QT1A 2ODNA 1OIWA 1E2IA 1XMIA 2JDID 4S35A 1NN3A 3A1TA 4JJZA 1Z6TA 1HT1E 2WJYA 4XWOA 5FOSA 1U98A 3MAAC 4MRSA 2ZJ8A 4RD1A 2OFWA 3I4LA 3MFYA 3VX3A 2QGZA 3A4LA 3RABA 2ZRGA 3NVAA 2GXQA 3EIHA 3SOPA 3ZLJA 1P2UA 4LYJA 4B73A 4TL8A 2YHSA 4IFEA 1QHGA 5EQTA 3WNBA 1CJVC 2KSQA 3QE0A 1IJFA 4UKDA 1U94A 3SZRA 5JI2E 4PFSA 1GAJA 3PG5A 3D31A 4LPSA 1X8KA 2IA5A 3CR8A 1ZW6A 1XMVA 3K09C 2H16A 2QPOA 1BS1A 3PFIA 5J4LA 4DLYA 5AUPB 1II0A 3H2YA 1U0LA 2P6NA 1Y3AA 4EJSB 3OAAD 1G17A 3ASZA 1AZSC 2AHOA 2H17A 1N6RA 2RGEA 2XEXA 2BBWA 4FINA 2AXPA 5DN6A 2X2EA 2ZRPA 2QTFA 3CB4A 2HDNB 2CHQA 1JB1A 1NY6A 1CKEA 1G16A 2W2XA 3EXAA 1EWRA 4M1KA 4ZO4A 4U7DA 3RRZA 3B60A 5CB8A 4URVR 4W9MC 1CS4C 2REOA 3NDPA 4FN5A 3WP1B 2O0KA 2QP3A 4OHYA 1E2DA 1QG2A 1CR1A 2VBCA 2XZPA 4F4JA 4L5BA 4BE7B 4NYIQ 4MA4A 1P73A 4BQSA 3UMSA 3B1YA 3DOEA 2VEDA 2N46A 4PTLA 5CIQA 3DZ8A 1HEIA 1LY1A 3VR4A 3RDPA 2O8BA 2KE5A 2FWRA 2I4IA 2V54A 5KSYA 2V9PA 221PA 4YONB 3MJHA 5JSZA 4A92A 1E4VA 1Z2CA 4QNRA 2OEPA 2IWHA 3HR7A 1CR0A 1RJ9B 4BLOA 1W0KA 3U3MA 3FKSA 5HZKA 3THWB 4QHSA 4CEIB 4JLJA 4OQMA 4D0NA 2QM7A 4EPRA 3BE4A 3BD9A 1S2MA 3W34A 4QBGB 4Q1DA 4M9ZA
chains in the Genus database with same CATH superfamily
1Y8RB 4HNUA 5BVGA 1D07A 3GRUA 2H7VA 3P9QA 5DTJA 3EXIA 2ZVJA 3HM9A 3ZWXA 3GN2A 1UPBA 3CWQA 3DD5A 5AKYA 5EHZA 1AJEA 1NQUA 1J2TA 3NIDB 2OSVA 2QTAA 4G0OA 4WCDA 2NP7A 1FSPA 1T15A 1AZWA 3QWAA 3QLEA 4DMKA 1GZHB 3WQHA 3IPXA 4JI3B 4MICA 1IJKA 3CH6A 1WUHS 6LDHA 1OAOA 2OE2A 4TV9A 5T64A 1KEZA 5LXTA 4E51A 2Q4TA 1PJQA 1XEWY 4GPD1 5LQAA 1NQAO 3R3XA 2CE7A 5JWOA 2QY6A 1D2RA 3AVUA 3N8NA 2F3UA 4J0CA 3ZH2A 3VM6A 5FBLB 1N78A 2HCRA 2A0WA 5K5EA 3TR0A 5IT0A 2RC5A 2BJWA 1NUPA 3HVIA 3FNRA 3ROGA 3QKSB 4LY6A 3UA3A 2WB2A 4RIIA 2JCGA 4XWAA 1S7GA 1E60A 1AQNA 2QTGA 3JCZA 2DYKA 5J5VA 2FNAA 4G86A 4IIXA 2D1RA 3V2IA 1PQYA 3PQ4A 4LWPA 3DEHA 1HYEA 4W9NC 2JHFA 3UMVA 1J7JA 4F60A 5I4KA 3ICWA 3K0AB 1N6HA 3EC1A 5EGSA 1JQ3A 2JD2A 3PICA 1T0BA 4E21A 1Y1TA 3M6VA 2D8AA 1C7RA 3HCEA 4PX3A 1N0WA 4URWR 2H1LA 3LK7A 2Q4DA 3LM8A 4KI7A 4POOA 1JFRA 4Q00A 3QXXA 2BMWA 3A36A 3UJ8A 2WTUA 2WHEA 3HYNA 3X1DA 3N3BC 4O1MA 2C92A 2I1LA 2PO5A 3ZYCA 4YLYA 3I9FA 1TYCA 3LA6A 3MELA 1SU8A 2X13A 2OQRA 2ZIWB 3C8UA 3JPYA 1JKXA 2OTCA 3NHUA 4GRDA 4XLZA 2LDXA 1H1DA 2OC4A 5F9MA 1MX3A 3FNGA 3WWCA 1FLDA 1BDMA 1SVIA 4J6FA 3RUFA 1PW5A 2B61A 4EKIA 1VKOA 1FRZA 4WCFB 2RHCA 2XXAB 4EUFA 2VHTA 1E2HA 2GILA 2P3OA 3QKSA 4RVFA 3HDJA 3MD9A 2IIQA 2WDZA 3AKEA 4P7BA 4EO4A 2CVZA 3JQAA 4UUPA 5DH9A 1O97D 2OO5C 4XVRA 2HRQA 3MT0A 2NTJA 5EWJB 1WDTA 1ZI6A 5JSYA 3UICA 3UM9A 3THXB 2PQMA 2O2YA 3HKDA 3CR7A 1YE5A 4OIMA 2P9CA 3ABOB 4QU8A 1P7CA 2VKQA 4RLSA 2HGSA 5DIZA 1BG6A 3N58A 4FJ1A 4DBLE 1XTJA 5AYVA 3ZOZA 1FNCA 1R3DA 2ZE8A 2ZSDA 4OREX 1GVNB 2BFOA 1BVYF 1Q7RA 2PY6A 2GI4A 1H2YA 4NZNA 2FW9A 2E5WA 4X20B 4GM4A 2ZPUA 5MFPA 5ALRA 1K9VF 4CMJA 3Q0TA 4TTRA 2P4UA 3G1UA 4YCMA 1RYHA 5ICSA 1EM6A 3QLTA 4PXAA 3GLHA 4ADSG 2XIQA 3L8DA 1N1DA 3KELA 3V8PA 2ZTVA 2P40A 1FFXB 1O9HA 4JROA 1LBEA 2C97A 1Q11A 3AIOA 1L5YA 4IVRA 1DKMA 1UWVA 2AOUA 3KXLA 1R0XA 4J2OA 2G17A 2GKOA 3H18A 4KXVA 4AJ4A 4DA0A 4J16A 4JVSB 5KQSA 5LD2B 2NXCA 2QY9A 4KKXB 1KAMA 3QU2A 1QHIA 3ITDA 4MQ4A 2IUYA 4AY4A 2HNAA 5HE9A 4DQXA 1Z2EA 2OMKA 3H11A 1IM2A 3KKPA 3PEVA 4KK3A 4EF4A 5ISMA 1XRLA 4TYWA 2B3TA 1ISIA 5CK5A 1I01A 1YBHA 1ZBQA 2PO7A 3PNSA 4DL9A 3K0EA 4HUTA 3KQKA 3I9V1 1ZN9A 4ZI7B 4HZUA 1BVRA 1CQIB 1QE3A 1V7CA 2SHKA 4HCJA 3H8WA 5JE8A 3R7WA 1PKXA 2EZTA 3OBIA 1FVFA 2ACVA 2ZE7A 4ETIA 1FXUA 2C00A 3QSYA 1QMGA 2Y66A 2GETA 3I01M 4YRZA 2QU7A 2GD2A 4X7PA 4Q02A 3TLKA 2BEUB 2YXEA 3LIIA 1X87A 1XVVA 5LD2C 4TTPA 4AS2A 5MF6A 4ZD6A 5TGTA 1PBTA 3L4BC 2C3YA 4A9AA 3DWGA 4JMPA 3M2TA 5DXJA 3G2LA 2FSFA 2XGSA 1CZKA 4Y9DA 2I65A 2JFZA 1IDOA 3LLUA 2X42A 5DCUA 4EYSA 4KQ6A 4AWBA 4DLUA 3PNLA 4BU0A 2PUWA 4NQZA 4BN0A 4IFBA 3FSGA 4WI1A 1OFVA 4RVSA 4D4JA 1NAIA 1RHKA 4QDKA 3BVPA 1RABA 4HDAA 2VUUA 2D1SA 1PN3A 1DUVG 1LRLA 3EFBA 3FXAA 3ME5A 4W7HA 4O08A 5JNTA 2DRIA 1V5GA 4QDOA 4MGZR 1U8UA 4IMRA 4E5NA 4ZYVA 3DVRX 1WW8A 2WT8A 3NR2A 4J0EA 1GUZA 2I1WA 4CQMA 5FD8A 1EK0A 3RG8A 3N0XA 2YWDA 5IUJC 1G41A 3U44B 4CZ2A 1LVHA 3NJRA 1AMNA 1Q0QA 2C57A 1IN6A 1JSLA 3EZXA 3IJRA 1RZ3A 2AV6A 4PRZA 4Q4HB 3BGIA 4YV7A 2BJHA 2R8OA 5C1DA 1ZIPA 2AZTA 3ZDZB 3A06A 2R86A 3KD2A 3GCXA 1W88A 4IL5A 3NZEA 1PR6A 2WYIA 2UV8A 1Y5MA 3GHHA 4ENWA 3WNDA 1M0WA 1YZNA 1N2JA 4MAFA 2ZJZA 3VGPA 1OJ7A 3OF2A 4W7SA 1H2XA 4L73A 4FIDA 1R6XA 1Y7TA 2P2CA 5T4HA 8AT1A 3GMIA 3D5TA 1F2TA 1N6IA 3AKYA 2WMYA 4CLEA 5JSFA 4F86A 2W6JD 3IKMB 3UUWA 2PDAA 3TMAA 2FWNA 1TCCA 1X1CA 5ENVA 4P4TA 4YP0A 4CKBA 2CV1A 4ICIA 1MV8A 1QH8A 3DF9A 4ZGBA 4DHEA 2ANCA 3EQZA 1NDQA 4OHWA 4CT5A 3HHPA 1Z7YA 1XXHB 1XYVA 2EFHB 4OFZA 2F3TA 2IHZA 1W96A 3AZQA 4KEAA 1VJ0A 3DXYA 4HDQB 4C0LA 2WIKA 5A2QA 3U16A 4QQRA 3N76A 4KUEA 1M66A 1QIGA 1BA2A 1BWSA 1N6KA 4BWGA 4YVFA 4N7MA 1DCKA 2JDIA 3ISVA 5H9WA 3EZLA 2PX4A 4G1VA 3TCKA 3LW7A 3Q11A 1N57A 1EUDA 3WWEA 1VI6A 1J9ZA 3H11B 4YDQA 4L76A 4WZAE 4OP2A 1JWAB 3TECE 1P0MA 5E2AA 1P9LA 1OLUA 3GXOA 4JLAA 3C7AA 4OSPA 2R66A 1T5TA 1ACMA 2Z9CA 4FD3A 3BOSA 4QL3A 1N6NA 4FKZA 1XEWX 5ALKA 3DHEA 1O03A 3QHPA 2NYVA 3AI3A 1ABBA 2VHVA 1IM5A 3O1HB 1N2EA 16PKA 2EYQA 4B2PA 4BC0A 5ITZB 3GLHB 1SBQA 1KMCA 2R7MA 3MLAA 4WY8A 1EDOA 1KF0A 3RBVA 5G41A 1VG0B 1HLPA 3QPBA 2F8LA 5JNLA 1J0AA 3L01A 3AHCA 3Q8XB 1V1MA 5AVXA 3UVEA 4GSLA 5CJ2A 3NBMA 4URXR 2ZAMA 3O93A 2JFNA 4INJA 4LF8B 2QLJA 2OGUA 4Q5IA 3N28A 2CVFA 2G1AA 3C7DB 3TSWA 4FT2A 1G3QA 4YT5A 5IAAA 4QGSA 4XVUA 1TMKA 3GLGE 3G5LA 4GKJB 2BGKA 2QJFA 5IJ0B 3DVLA 3GPDG 1RZRD 5ESXA 4LVOA 4TVKA 1F5NA 5EIOA 3P7MA 5F3DA 4Z53A 3V8RA 1HOXA 2FSPA 4DWJA 3R7WB 5GMOA 3F1KA 2CE2X 5KYUB 4LKOA 4V0OA 3ZZ0A 2G72A 4TWJA 4Y1FA 1PNQA 1EHIA 2GSDA 2GXSA 1MENA 3EN0A 3FLEA 5BQ5A 3IV7A 1I0LA 1U4SA 1L3CA 3P2JA 3RHTA 4BBPA 5HS6A 2OFXA 4E13A 3RYHA 1M2NA 1OR8A 4V2IA 5C80A 1PV2A 1MEOA 2PMDA 3R9IA 1LQUA 1VFPA 4P5PA 3H9GA 2D0PB 2OXRA 5FFNA 2W6ZA 5ENZA 3O8RA 4XGQA 3DE3X 1T2CA 1YTLA 3NCHA 2ZJ5A 3PNOA 1WBDA 4HYTA 4MRPA 1PT9A 4UM8B 4V0SA 2R5NA 2WFMA 3HUDA 4P93A 4O1IA 4XYGA 3W5BA 3DCYA 3DAFA 3M6FA 1SCNE 1UKZA 2H5JA 2XVXA 2QZ4A 4P92A 4Q3DA 1IM8A 5EUQB 4KO1S 3OBBA 1YI8A 5FIUA 2AOTA 1G7CA 3S6JA 1VHLA 3DH0A 3WZMA 4Y0VA 3A3YA 4FJ2A 1FB5A 4LV5B 3AC0A 3F5MA 3R0VA 2H1WA 4Q0MA 5G0WA 4Z51A 1GRRA 3W3AD 3V7FA 2R751 5LDHA 2W6IA 5BY2A 4DR7B 2VQDA 2I5PO 3DMFA 5C9ZA 2Z3WA 5HFNA 5K6AA 4AM8A 1FFDA 2REBA 3LP6A 1U2GA 2ZSBA 4RS3A 2GBPA 4G5XA 1PUIA 3U7QB 4Q7MB 4I50A 4CCWA 4ZJZA 1S8AA 2G1UA 3TZBA 2JZNA 4U9UA 3UF0A 1ES9A 4N39A 4GZ6A 2XDQB 3L8MA 2D0OB 3AM4A 1K6XA 1FDIA 4GZLA 5IKMA 5GVSA 3F5SA 3ZW7A 1QOZA 4CEJB 1T8SA 3AL0C 1KO5A 5MGBA 1VI5A 1EXVA 1PJ3A 2HRZA 3EISA 4KLAA 1ORVA 1TZ2A 1KMQA 3KFXA 1YS1X 1XA3A 4BWFB 1ZA2A 1JX6A 2ONYA 4C14A 3W3AA 1ZAKA 2W2MA 4OFXA 4MQ6A 1C4OA 3JQEA 1P5RA 2J30A 1L5MA 4Q1AA 2ZAIA 4YH1A 1X42A 2PBLA 2WR8A 2Z8XA 4HMOA 2XWBF 5CAEA 4P22A 4UEKA 1PJ4A 1U7HA 2ONCA 5FPTA 4OBWA 1X7XA 1ZXBA 1IEXA 4N47A 2X3UA 4EELA 2XTMA 3CC8A 2OWDA 2YHIA 4Q1EA 3D6UA 2E89A 4TKUB 3QVJA 1TMOA 2GN2A 1AO0A 2NQTA 1JAIA 2A1TS 4W5OA 4L5CA 5KVAA 5CLIA 1T9ZA 5IK2A 2FPLA 4YRIA 3LDGA 4IZIA 1OC4A 2X5KO 2J3EA 3OCWA 1DT3A 2I2BA 3D54D 1UFRA 3QU9A 3ZWBA 5I9IA 1GD1O 1S8FA 3ANSA 4C01A 3C16C 2HIAA 8GPBA 4IDAA 5BR8B 2BE7A 2W9XA 1OBVA 2A9KA 2F1RA 2O23A 3PD0A 4WOCA 5EYPB 4ASUA 4PNZA 1UDRA 5BVHB 1KTIA 3NRCA 3QPAA 3BF8A 3VBCA 2CL5A 3QX8A 3ZVMA 3V4PB 9MHTA 4WQMA 3Q9NA 3DDZX 3QTBA 2V9ZA 3C3AA 4RULA 2QTLA 3WL3A 3W5JA 2A9FA 4L6CA 1XQVA 1K8ZB 1STOA 2ZWOA 3KE9A 2CJWA 1H8EA 3FOCA 3B6JA 3HNPA 2VP9A 1MQSA 2H06A 4INZA 1JTFA 4FILA 5DN9A 3WSWA 2I2CA 4CV2A 3CJRA 2ZTHA 3IV6A 4FKBA 3VI3B 4BRZA 1PK9A 1PQUA 1TO2E 4BGVA 1SZCA 4GG1A 3K1TA 4HDCA 1UFVA 1POXA 3SXPA 2WKPA 3UWOA 1XXHA 2V6IA 4PPGA 2QTVB 3M34A 3IQHX 1Q84A 3A4VA 4I2VA 2PBZA 4GBGA 1JGTA 1OXKB 5D2CA 5KX5B 3ITKA 3L6RA 4B75A 4BE4A 4NF2A 3IAEA 1Z8DA 3LZDA 3KOXA 3W5VA 4Q21A 2H2WA 1QP4A 1CY1A 1TZKA 3TF5A 2OP0A 2BEWB 4BWVA 4KV7A 4NBRA 1OFIA 1SKYB 4R8LA 1AN0A 1Z47A 3K2IA 3RBAA 1ZQ9A 2J3DA 3M1IA 5COQA 421PA 4E2ZA 2V1UA 2R85A 1EFHA 4QU0A 4EUKA 2G04A 2QDXA 1CDOA 1LV8A 4M8IA 4M0MA 2BGTA 1ILEA 3CIFA 4MS4A 2X0FA 3TTXA 1P7WA 2MYNA 3WNCA 3OUUA 1E5VA 5BQPA 3FSGD 3KEMA 4EYGA 1TJ4A 2ADMA 3GRYA 4UUQA 4C2UA 5LP6A 1BO6A 2CLFB 3UXYA 2JGNA 1WMEA 3L7NA 4OTZA 4Q9IA 4KX5A 3O2NA 4KLCA 4MV8A 3SJAA 4WXRA 5C8VA 2Y1DA 4YPFA 4EABA 5E4TA 1HFWA 1GNQA 1FP1D 3OZBA 4ZV9A 4EY3A 4YV1A 3CRW1 1ZUWA 2G4VA 2OCKA 4GW3A 1SUAA 2PV7A 1SUSA 1Z2NX 2KB0A 1W76A 3V4SA 1UQRA 5TE9A 4A6DA 3M3DA 3C15C 4PZEA 1NQOA 3E9YA 3K1AB 3VNRA 3ZD6A 1FQKA 4QZVA 2ODWA 4QUAA 3X1YA 3HXMA 5TLSA 4QXAA 2QRUA 2BE9A 4F9FA 4FU0A 3AP3A 3RVQA 3UXEA 4Z9BA 1G59A 5AI0A 1CUVA 2YJ6A 1PT7A 1RMYA 1HSZA 4H31A 4EAAA 3IAM1 3LC2O 3ZDCA 3RYFB 1VSUA 4UTXA 3CUWA 4J91A 2FQ1A 4KSYA 1NONA 2WK1A 4ZREA 4OLJA 3VR3D 3WJAA 5HG0A 5DWQA 4CIDA 3VZCA 2PMCA 4QUKA 5C8XA 3EUEA 3ZHOA 1P61B 1SZDA 1TAGA 4S0ZA 4RA6A 4DFDA 3HYSA 1W29A 3CR3C 4LYHA 4DQKA 1JKMA 4QFCA 5C3UA 4RY9A 1G0NA 2EL7A 2WZQA 1KE1A 2PUBA 2HXYA 1SCIA 4WK2B 3TZEA 3F9RA 1BC5A 4ON9A 2HN9A 3KPUA 3IXQA 4O33A 4RFVA 2WJGA 3O74A 4LVUA 4MIKA 5U4QA 1UODA 4II2A 2O2ZA 3WL6A 4MXDA 2E49A 3ZNNA 3MJEA 4EBBA 1ADYA 1QFSA 3DTTA 1YJ5A 4YAIA 2K2QB 3QX7A 3RI3A 1JR3A 4XD2A 5E4FA 5IT5A 4TMFA 1YONA 5THXA 3L05A 5JZBA 1EUDB 1P1RA 1SKUA 3PC6A 5FOUA 2J0SA 1NE2A 1AKUA 4JYAB 1DBIA 1GWNA 2LBPA 3BAZA 3BHJA 3D3NA 3KUUA 3ZDEA 3QPUA 3PKIA 1K3TA 4CNBA 4D57A 1E64A 2ZS9A 1U8FO 3WLQA 4DBVO 3K0FA 1E6MA 3RTCA 4EPXA 1J07A 1WEHA 1Q0PA 2VT3A 3BT7A 1KO1A 2C8VA 3C98A 4YRTA 2OYSA 4K9OA 5T3YA 3LDHA 4F1KA 4CKCA 3QXSA 3HPRA 3KPWA 1Y7HA 3LU1A 2JA2A 4HXFB 3QMMA 1E1RD 3DWFA 4PSCA 1ONSA 3AY3A 1UMDB 1A5BB 4ZXPA 3Q3HA 3TQCA 2P4EA 3F6PA 4C6RA 3JYNA 4Q1BA 4BLQA 4L15A 4URHA 4NV0A 4E12A 4UTVA 8MHTA 2GPBA 1II8A 3T3EA 1NUSA 1E2UA 1ORWA 2RH4A 3OFND 3IVGA 4GHWA 1VL5A 4LRWA 3P32A 3WRYA 5C8YB 2B1GA 1Z6GA 4BCDA 4DEYA 3ABRB 1PR1A 4M21A 1JL3A 4HZIA 4QYTA 1S2OA 2WUWE 1FRFS 3K8YA 1NC1A 1A7AA 2WWXA 1HUQA 4OQNA 3T5BA 4KVFA 4QUJA 1F51E 5BT9A 4O3MA 1ORHA 1AKVA 1RE1A 2PU5A 3OLCX 3GLTA 3TTWA 2HHCA 4EDHA 4ALKA 2O57A 1PBNA 5JS2A 5JARA 3R5KA 1DAKA 4WPGA 2VN8A 2ZI7A 3SKXA 5K6AC 1W6RA 3MUOA 4RQAA 4TLLB 2YJ5A 3EVTA 2I6UA 3V6MA 1RYNA 2I54A 1U80A 2DPXA 3ILSA 3R6TA 2P2YA 1UDXA 3A9TA 3KU4A 5DHAA 4GYJA 3VNUA 4RM2A 5IN5A 1TRHA 1R37A 3T0FA 2FZ4A 3B8EA 1PSZA 2C82A 3NBKA 2IU3A 1AS3A 1W25A 3UWMA 3VJMA 5LYJF 1N2ZA 1P19A 1U99A 2RHOA 1JHQA 4ER6A 5FPYA 5CIYA 3VZSA 1KZYC 3DUFA 3EZFA 1OH8A 4JYZA 4XTRA 3J81k 4HAZA 2W2KA 4BAZA 3EXEA 3W6NA 3RSCA 5JNVA 1I2DA 1RS0A 1SXQA 2CJYA 1IPEA 2NYRA 3PQ6A 4CDGA 2I78A 2X9GA 4PONA 4BTLA 3K9FC 4G5RA 1L4LA 4RZ2A 2JFPA 5AVSA 3OIWA 5CLHA 1DKLA 3KHKA 4CTNA 3BE5A 1KMHB 5D7BA 1ZGBA 1NVBA 1SKQA 2FVYA 1JI3A 3ESRA 3RAEC 1XCBA 3UA4A 4DXDA 3C4VA 1B76A 1RRMA 5FUBA 2UU9B 5JHGB 2J5KA 3GT7A 1OPXA 3CN9A 1MT3A 1XU4A 3AG5A 3Q85A 3WADA 3N8KA 1BIFA 1V11A 4JT4A 1ODJA 2OC9A 4LJ9A 2WJHA 4OK3A 4UBKA 1LPMA 1QLWA 1H2BA 1T9GR 3JS5A 2QRQA 3G8BA 4MP8A 1QGYA 1LTQA 4MQEA 4ZCRA 1B73A 3W78A 1ZUNB 1JIQA 3CSDA 5FL7D 5IKEA 2ZAYA 1K7CA 3O90A 1OV4A 2RAUA 3M9LA 3IXMA 2I66A 2O52A 3H1TA 1X1RA 4FQ7A 3KZCA 1TUIA 4X44A 4EGCB 1Q21A 1AUOA 5IC6A 1SEVA 3SM3A 3IP7A 3ZJTA 2XY4A 2VL7A 3KKKA 3WLHA 3E48A 1MC5A 1M6WA 1G6HA 2DPGA 2A86A 2GX6A 2Z2IA 3D3WA 4O4LB 4JT8A 4YX9A 2DLCX 2NW6A 3WQRA 3U7GA 1F9EA 2PWAA 3KJNA 3SHWA 3QKUA 2OENG 4WFKA 1MIHA 1UC9A 1FXWF 3IHTA 5TS2A 4JAVC 5LA6B 1ETHA 2IC5A 2EIHA 1XLUA 4C30A 3I76A 1G1AA 5FPPA 1DO2A 2O3UA 2VAMA 4NABA 4K9PA 4BLUA 1FOEB 4LK2A 1VIYA 3L2OB 3Q3IA 5CDHA 1JG3A 4EA8A 3J7TA 2XV1A 3UJ7A 2HCTA 3EWSA 1WY5A 5HNKA 1ITZA 3V7UA 4I9NA 1S2IA 1W73A 2GO1A 2M6KA 3ETDA 3FWKA 1U8EA 2R7AA 4CHGA 1CNFA 2BAGA 3FETA 4K3VA 1FQJA 4ILKA 5D84A 5FH9A 3MYYA 4E7OA 2NUPB 4KN8A 2VJLA 1IXYA 4F4IA 4IV0A 3A27A 3I9JA 3FGNA 3OQIA 2AOTB 1GZVA 1K4KA 4RX1A 3KNZA 5B1YA 5KTPA 2XMDA 3PPIA 1OFUX 5CJJA 1UM8A 4LZPA 4QSHA 4U5XA 3LCJA 1TUEA 3U3RA 4ZI2A 5L6MB 2I87A 4P53A 4Q4AA 4CGYA 2REXB 4HEA1 3STUA 1R12A 1SNYA 2FRDC 3OX4A 5BOVA 4QPJC 3WHKA 4MVJM 1H0KA 2YKGA 5DI9A 5GONA 1BX0A 3DCJA 2GZRA 3W1WA 5KYYB 2G5CA 5IDQA 1W2GA 3FFXA 3PDCA 3HJAA 4YALA 3EJWA 2ZYUX 4WW0A 4GXTA 4I4IA 2KYRA 1YO6A 3OECA 4BVJA 1AV6A 1OY1A 1L5FA 1YRHA 3VV2A 4CM3A 3JAKA 1YCGA 1H8HD 1HC7A 1OZHA 4DSAA 2AJCA 4Z7JA 1A88A 1U8XX 4RIHA 1NU8A 1ZD3A 2HT6A 5A9TA 3SS8A 4AKIA 3HY4A 4LTMA 1JG2A 1E94E 1XA4A 3C3BA 3IALA 5J2UB 3KOWA 4LHYA 4BGUA 4D9MA 4U7TB 1W19A 1UC4B 2LDBA 2IUTA 4FMBB 2YWBA 3BIJA 4BIIA 1LH0A 4W1SA 2Z56A 4PNHA 3ICOA 3RIYA 3VTKA 3SMVA 1DLJA 1R5NA 5JZSA 3FMOB 3GJ8A 4HBGA 4QXOA 2R47A 4ES6A 1WL8A 3LY9A 3PJEA 3QLUA 4YFVA 1SHZA 2FHSA 1PTJA 5HKAA 1CUFA 1GFZA 2QR2A 2VHJA 4MJXA 1T36B 3LC7O 4H7EA 3BJZA 5EFZA 2XEDA 4RSMA 2XTAA 4I1YA 3WIUA 3BHMA 3LUPA 4GI7A 2ZIFA 1QP8A 3I6MA 4NCIA 4TZTA 3EFOB 4C7XA 1SU4A 4BJ1A 3D3JA 1FDTA 2O2JA 4Q48A 1C0KA 3RW9A 4GYKA 3VNVA 4TV9F 3LTNC 4XYBA 4H6XA 1ZAYA 2GPJA 3WMRA 3ZXSA 3WGMA 1HE3A 3A04A 2YVQA 4GS5A 1EFCA 5AM4A 2VQ3A 5ICCA 2MSNA 5BN3A 4PZZA 5IJ9B 3C48A 3U1VA 1M33A 2R4UA 5FKJA 4M1ZA 5LQCA 1ECGA 1MJGA 4FSDA 3DPSA 1K6IA 4TYYA 1IJEA 4HEHA 1VRVA 1WDLA 3TOCA 1DAPA 1JQAA 2R6HA 2WHPA 4OJTA 3KEOA 3IQEA 5F76A 5KVVA 1ZCFA 3MLBA 1SWVA 2P11A 4CM1A 2A2ZA 4BIMA 2GPSA 1X9GA 4LYFA 5BV7A 2AZ4A 3W2FA 2YJNA 4YTEA 2E4AA 4XGNA 2DBRA 3OLWA 5EXPA 1MOQA 4HWPA 4M87A 4NYJQ 2XTJA 4PAOA 2KBEA 3TZLA 1CPYA 3KQSA 1KFBB 3ZQUA 2GGSA 3HZOA 4H16A 1H2WA 1JAZA 3BDIA 3B3AA 2A4KA 2RI0A 5HZMA 1WDWB 2V8BA 2XQFA 4NBUA 3I8XA 1AGRA 1JXOA 1V3UA 2V6BA 2W2QA 1XTPA 3L5OA 2YV4A 4JIGA 4LV6A 4AXXA 4M0KA 3ZKWA 4M37A 3T1VA 1SFRA 1IHOA 1D4FA 1RQPA 3JD4A 2YY5A 3EB9A 2Q21A 3G2MA 3O8NA 2I7CA 1G5QA 3EVEA 3R5SA 1U7DA 4RJJA 4BFUA 1SXJA 2HF7A 3GT3A 3S2FA 4PNPA 5I9MA 2EGGA 1S2DA 2OO7A 4G1UC 5KDDA 2XE8A 3EW7A 1VG8A 5HRAA 2HRRA 1A9YA 1XLTC 3VH4A 3U19A 1ZK4A 2BR3A 1IN1A 4UM7A 3C6BA 5JWHA 4QTYA 1TAQA 4EA9A 3UPDA 3VO2A 3CH4B 3KPVA 3TRKA 4BGDA 5CTJA 4ND2A 2VNJA 3TAHA 2B8NA 3OFJA 2GBLA 3BK2A 2IPXA 1F3OA 1KY3A 2MSLA 2EARA 1NW8A 3STTA 1T6XA 4I1IA 3HN7A 4MJ3A 4EFKA 3EW9A 4MB6A 2FG5A 2FA9A 1OFUA 4D6XA 1YUBA 4UVGA 2BUBA 2DB3A 4AY5A 1QTQA 3CBQA 1K3FA 2AXNA 4HWGA 1KDPA 3B6KA 2H8GA 2GK7A 3R9XA 3IQXA 5NLLA 5C4GB 1EU1A 5KTTA 3E8SA 4MEBA 1JS1X 2Q46A 2X86A 2J3KA 2X40A 3GQBA 5DLPA 1Z8FA 5BOSA 3GR6A 1RRCA 4MA0A 2RBEA 1D2CA 1QRDA 1X2EA 3SGLA 2NX2A 1Q0SA 2DULA 1E4OA 1ZNZA 2D0DA 3GDFA 2XCLA 5JFGA 3VI4B 2PKWA 3FR8A 4DG9A 2B4QA 3OJWA 1PJAA 4QBHA 3IYLW 4G97A 4YT8A 4QOJA 1S1CA 1ISFA 2KLBA 4LQDA 3ILHA 4QARA 4QG7A 1RWMA 2JCXA 4BO3A 4FGLA 1DTWB 1L7XA 4ZYLA 2IHNA 2I67A 1VJ5A 3U5TA 3ZZTA 5KJ1A 2D54A 4XQ9A 1NLFA 1JHRA 1LPNA 5AJHA 4EFMA 1N5KA 2J5RA 1DQZA 4GMGA 2PMWB 2VIIA 2VPWA 4P58A 2CJPA 1PDOA 4K6GA 5CA0F 4QGGA 4HDRB 3IHWA 3T1OA 4GP7A 4PQEA 1QFYA 2J5XA 4IXNA 4D45A 4BNLA 2R6GA 1OAOC 1VGQA 2PEYA 3MT7A 1CUWA 1Z0SA 4GXRA 2C61A 3FTEA 3HE3A 4FCWA 5EQFA 5F9FA 2H0AA 1JSXA 1V4NA 2PIAA 4YCLA 2BONA 4OG2A 4PSAA 5I8ZA 3ETEA 1QIDA 3F4KA 1JQJC 2NLOA 3QVWA 5IU6A 5CCDA 4WFQA 2GM3A 2GM4A 1YVPA 2A9VA 1BTOA 4B80A 1XB2A 2ZYAA 4C1NA 5KNCA 1M2OB 4JCOA 1PYDA 2NTYC 4MJLA 3T7IA 3W6OA 2OM2A 3OE5A 4QLAA 1NMSA 2QMQA 2Z1MA 2IF0A 2BZ0A 2PFGA 4HNAA 4F9TA 3ELDA 2VDUE 1J8YF 4ZV7A 5JIBA 1BE0A 1N0VC 2XMGA 4IDEA 1JKJB 4K40A 4DF3A 4DCNA 5KNBH 3KYDA 3AVYA 1X70A 4RF3A 4RK5A 4OMCA 5MN4A 1DHTA 1O5IA 1VCOA 2DWUA 1PJ2A 2ORIA 3IAS6 2Q5CA 2VHZA 1E3EA 5CVDA 5K01A 2QB5A 1TF7A 4EWLA 2DJIA 1M1NA 1YIOA 2O0MA 5EWJA 3V8NA 5KJCA 3R0ZA 3ABZA 4HLQB 4C5CA 4CIVA 4E4RA 1DBQA 3U3ZA 5JS1A 3FZYA 4PTYA 2W6NA 1WSDA 4LECA 4UFPA 4DGSA 4KDFA 4GR5A 2IYFA 1HT2E 3ZC3A 1VYUA 4Q7KA 1KIAA 5DNUA 5I9NA 5JRDS 3SSOA 1DKRA 4TTAA 3ZK8A 2W83A 4GPIB 1Y42X 4MRRA 4L8VA 1N6LA 4M8SA 1KAOA 7AT1A 4NWIA 4EJSA 1CG6A 1UZLA 2LV8A 3PC4A 1JLLA 2NO1A 4FFSA 4OXRA 4L0MA 5KJ6A 1R00A 2XI4A 3K9QO 3JQGA 4RYDA 3SR0A 4L51A 2VTBB 2IX3A 1E9BA 1HDXA 4TT3A 5G1OA 1ZUNA 1JIXA 1NM5C 3KR0A 4RLHA 4AJKA 4RYLA 4JK3A 4MGIR 4Y6SA 3HWWA 3NM6B 1GV0A 2ISQA 1T5HX 2GZ2A 3KP1A 1CUBA 5EKXA 4AJ9A 4AF8A 2WUFA 4PC7A 1B41A 2HNBA 3FRHA 3B7GA 3JVUA 4RGYA 5REQB 4Q1VA 4QT4A 3CM0A 2REQA 2Z04A 1JKIA 3ORYA 3CEJA 1RM0A 1IJBA 3IBGA 3LX5A 1PUXA 4GPAA 4DSNA 1PT6A 3KSRA 3W6UA 3W05A 3CLUD 3SZMA 2WJAA 3OH8A 4O2BF 1NZFA 4R7GA 1DAGA 5LIRA 2OR3A 2P35A 3KOMA 4LYGA 1QV6A 2B1IA 1HTWA 1Z33A 2Q1UA 4RKEA 5D86A 3RTGA 1UBNA 2IIBA 3MQ2A 2ONJA 4X5OA 3NGLA 2YIJA 1GVHA 5K3SA 3WMGA 4X6UA 4ME6A 1JR2A 1P1KA 3NP9A 1HMPA 5H3CA 4IJ6A 2QJRA 4D9JA 3EEIA 3WHIA 2NSLA 1X2BA 4ZOLF 2PFKA 4RGVA 4EZIA 3KLBA 1BOFA 4AD8A 1Y9ZA 3CKMA 3DW1X 4IO1A 3QBTA 4M1SA 4W1PA 3ZVRA 3B13B 1TTPB 1Z45A 3NTUA 1JMVA 2OBYA 1Y8RA 4PLHA 3UATA 3V7NA 3RQIA 1IK4A 5BVGB 3QHAA 3SC3A 3ONVA 2F1OA 4YMSA 2GLUA 3QEOA 5A9RA 2PYZA 1AHNA 3SFTA 2ECKA 4D42A 3VU3A 1UXOA 1XF9A 5IW8A 2ES4A 2X8BA 2WIDA 4A0SA 4Q82A 3TIFA 1ANKA 4G65A 3TNFA 1DWQA 2IUFA 4J0HA 2YFYA 4OHZA 2H9YA 3IBSA 5K0TA 3CB2A 1SULA 3CNLA 1JYSA 4H1UA 3COWA 5HGXA 2CCGA 2J9FB 4WLUA 3HWSA 3OKPA 1VBKA 3QWBA 4FI3C 4FYJA 4TMTA 2FEXA 4WOBA 4KZPA 5JAOA 4D5GA 1BZYA 4NFYA 5HK8A 4D81A 1FS6A 2HWUA 1O87A 1Q50A 2HMAA 3BRCA 3D4OA 4I81A 4Y7DA 3T3MB 2G7ZA 4FZ5A 1CE8B 3ZZ1A 2PE5A 4E15A 3IRUA 4V3BA 2XPCA 1BN6A 2HCJB 1CEXA 2XUZA 5HM8A 4Y9TA 3EBLA 4D3FA 3N3AC 4HLUC 5CDSA 1DFIA 2X5JO 5JH7A 4UU8A 1US8B 5BR4A 4G0VA 2IYYA 1X1DA 5EPEA 1NNI1 4ITVA 3KUDA 3A1VA 3VSEA 3WYBA 1L1FA 1MD9A 2LZ0A 4ZAWA 1Q44A 3FBWA 4C1BA 4TWIA 1PDWA 3FUUA 1LLCA 1ZUIA 4Q6WA 4C4TA 3N53A 1RFLA 3T4UA 3FSJX 4KWCA 1NF9A 4YXFA 3D6JA 3RNLA 2FDCA 2R1UA 1ZOPA 5HF5A 2W4IA 1I1OA 4I1UA 3TW8A 4QUIA 2X77A 5EXDA 3FNBA 3T41A 4IIFA 3H42B 1ECPA 4JVMA 4HXGA 2ZIAA 4C5BA 3LGSA 2PJRA 4PM4A 1KSFX 4KU4A 4RIGA 4IGEA 1IBRA 1F2UB 2YMLA 2ZJOA 4KHZA 4UZSA 4FR0A 4EKYA 2ZDGA 3OT1A 1DBSA 2DHEA 3L0ZA 1GZSA 1P9NA 4PO8A 5J2UF 4QJIA 1BHQ1 1PFVA 4J1SA 1P1CA 2EG5A 3ANXA 5A71A 3QOYA 4NTZA 4HJRA 1FL9A 4F8EA 4OJMX 2IBSA 4BMCA 4WUVA 2QTCA 1II8B 1NYLA 3F8SA 4DUYB 2QE6A 4R9NA 3GFOA 4MQLA 2DFTA 3H7IA 1M72A 2UVPA 1UMBB 2O1SA 4IRMA 4Y6GB 5D3QA 5KMGB 3WB9A 1SC4A 3K1YA 2APJA 1KAQA 2HK7A 3LPLA 5FP0A 5EZ5A 3TIXB 3RANA 4MW0A 1AS2A 3TSOA 1CQWA 2GT1A 4YMTA 1B7GO 1OH5A 3I6BA 1DL5A 3RU2A 2IX9A 2JLVA 2C99A 2XB6A 3RRMA 5K0GA 4EHKA 3D7KA 4RADA 4MRAA 3E7XA 3LHDA 2Y92A 1PD0A 2YN4A 4LZOA 5M34A 3FBGA 4ZCIA 3B85A 1SM4A 3OQJA 3OFVA 5CVEA 2ASVA 4HNVA 5BORA 1XLVA 2ZSHA 4X90A 2P9TA 3LHIA 5ELMA 2PUCA 2VP6A 2XUFA 3WR5A 4DB4A 1CY2A 2FZGA 2ZSJA 4IEEA 4D9EA 2O8FA 1WPGA 1DU4A 3MZ0A 4OQQA 1V8DA 2C03A 3KCNA 3R9XB 4DSTA 4DR4B 3AFMA 1L5GB 2VAPA 1OV6A 2Z8YA 4PHFA 1Z06A 4N01A 1X13A 3JQ7A 4GWKA 3KT0A 4FMDB 1T8UA 1UDWA 5EJ6A 2J0UA 4NJOA 3VVBA 3KFVA 1PV4A 2ZUEA 1RJ9A 2B6NA 4HTFB 3CEMA 3HDQA 2PUDA 5LQDA 4RY8A 1ZM7A 1DMRA 3AHJA 3QFSA 4QVGA 4UCWA 2H2HA 2IOQA 1LS1A 1MFZA 1O6BA 3HBFA 3SE0A 3W2IA 3ZU3A 2NVBA 3AFNA 4PLFA 3AFHA 3DQQA 5K6RA 4KR7A 5T41A 2OYCA 4JQCA 3G82C 3ER8A 1T2NA 1K8XB 3V55A 4RCYA 4E6PA 1A4RA 4QNMA 1ZK2A 5G0TA 3ONEA 2JAUA 2CXHA 4ZI3A 4JL5A 1E7QA 2ESRA 3L4BA 3TPCA 1J2EA 1G9XA 1GHTA 4JLNA 2C4TA 4N82A 3URKA 1GG5A 1Z37A 1Z6XA 3ASYA 1QIMA 1P6XA 4U3JB 1IOZA 2XE7A 2JVIA 1FJXA 4TKZA 4ZU1X 1JLRA 4XIGS 4Q05A 2GNPA 1A95A 5FV4A 1T3HA 3TZQA 2LD4A 3HNOA 2A7XA 4CLXA 1ZH8A 2LXNA 4EJSC 1VKZA 2BD0A 1HRDA