5JWOB

Crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic from thermosynechococcus elongatus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
TAVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIALRLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein kinase KaiC
publication title Structural basis of the day-night transition in a bacterial circadian clock.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Transcription regulator
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07689 KaiB KaiB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5jwoB00
2O89A 1KTEA 3ZRDA 4ECJA 5EVOA 1VF1A 3N9JA 5IOXA 2JACA 4ZB8A 3IE3A 2C0FA 1JZDA 2MBSA 3JCML 3C1SA 2NVLA 14GSA 2H1GA 2I3YA 1THOA 1AQVA 3QFBC 2AHEA 2K18A 4K7NA 5DCGA 1H75A 3GUSA 5LD0A 3KCMA 1URMA 4V2MA 3UARA 1B48A 1HD2A 3EYTA 4ISDA 2OADA 4MK3A 5AISA 2F8FA 4RQRA 3F4RA 3ZFBA 2LUSA 5E4WA 5DAKA 1GSQA 4NWYA 22GSA 2E2GA 5ECQB 3M0FA 3LORA 2L5LA 2KHPA 4ZL8A 1GTIA 3ZZXA 2L6DA 4HU9A 4KCAA 4PGTA 4GSNA 4ZBDA 1K0OA 1GTUA 1OC9B 3GSSA 3LXZA 3HCZA 2J9HA 5J4UA 1OC3A 3GIXA 4TW5A 4AGSA 3BCIA 4DSSB 3KIJA 3FY7A 1GH2A 4TN8A 2YCDA 3TUEA 4WF4A 2XPEA 2MMAA 3APSA 5A4VA 1WE0A 2IMFA 4JZQA 3KP8A 1T7PB 4MJCA 5HFGA 1XIYA 1GSUA 3HVSA 2MYGA 3QDNA 3GA4A 1ACVA 4KDYA 1LJRA 4ZB6A 5AN1A 5D9XA 1BQ7A 2V1MA 5G31A 2PVQA 1VRSD 1SK0A 2YWIA 4MZWA 4XIHA 5F06A 2AV4A 2IMDA 3UBKA 3LSZA 1SJZA 2YJ7A 2OBIA 3FW2A 3L4NA 2AJQB 4GWRA 1ST9A 2E7PA 4KDXA 2VCXA 4KDUA 2K6VA 1IYHA 3FZ9A 1EV4A 1LBKA 4LMVA 4PNFA 4IW9A 1AQWA 3QD9A 1O8XA 4MZCA 4GQCA 2H66A 2MZCA 5ECKB 2NTOA 2YWOA 2H8LA 1SYRA 3LFLA 2CQ9A 2TRCP 4K2DA 2WRTA 2H6YA 2GSTA 2KP1A 5HQPA 3GNJA 3UEMA 5F0GA 2H74A 1XPVA 2GGTA 2VCVA 2H0GA 4HUAA 4XS4B 2TRXA 3F4SA 3EC3A 1ZCPA 3IAM2 1Z3EA 3H1NA 1GNEA 2YV9A 2M72A 1HNAA 3UVTA 3LYKA 2KUCA 1ABAA 2QC7A 1ZYQB 1TDIA 2H6ZA 3GV1A 3QR6A 2F3MA 4AJ8A 4EO3A 3Q6OA 4BWQA 4JBBA 1SKSB 1W89A 3E0UA 3ME7A 5IMFA 1GTBA 2VOCA 1X5CA 4EXJA 1WRYA 2XBIA 2QSIA 1V40A 3VPTA 18GSA 2C0EA 2KP2A 3TKSC 4I2UA 1A24A 4WEYA 2VO4A 1TRWA 4NHZA 5KN1A 2E0QA 5ABRA 1KNGA 3FEUA 7GSSA 2LJKA 3AY8A 2OACA 2ON7A 2WGRA 1ERWA 2VM2A 1ERVA 4IVFA 4XCSA 2DJJA 3IOSA 2LS5A 1A23A 5H5RA 1GSSA 2K8VA 4G9HA 1K3OA 1M99A 1QXHA 3RBTA 2IIYA 3DVWA 3EMXA 1XBSA 5KN3A 4NPBA 3FHKA 4BPYA 2IMIA 3CYNA 2P0GA 4LLRA 17GSA 1GLPA 2VLVA 1A0RP 3ZLPA 1K0NA 2PMTA 4ZBAA 3VPQA 5KN0A 1M2BA 2O87A 2YZHA 2G2QA 2NPBA 4TXOB 4QL9A 4TR3A 1PQNA 4XRAA 1PL1A 1N2AA 5CNWA 3F6FA 2IN3A 4HJ2A 1B4PA 5INYA 1XVWA 1SJIA 3D5JA 4RI7A 3CTGA 5D9VA 4NV2A 3F3QA 3HD5A 3HHVA 3IV4A 4ZXGA 3APOA 3G9BA 3M9KA 3P7XA 1PL2A 2R6KA 3F8UA 4MJAA 5H5QA 1OKTA 3HYPA 5IPGA 2EIRA 3TRXA 3WT1A 4YAVA 3HZ4A 3ZTLA 1WWJA 4OWYA 2VLTA 4MZBA 4ZB9A 3D4TA 3HXSA 1OKDA 5GSTA 2CT6A 2H75A 3GKMA 1X9SB 3TJJA 1NHOA 3DWVA 4G19A 3DKSA 1VF2A 4KA0A 4YAPA 1ML6A 2HT9A 2P5QA 4MCUA 6GSYA 2IMEA 5B6MA 1UA5A 3FKFA 4MLYA 1KEBA 1JZRA 3L9VA 5E59A 2C3NA 4TOPA 1THXA 2K9FA 2CX4A 2PUKC 5JCUA 3IK9A 4AF2A 2H1AA 3CTFA 5IMVA 5D9TA 1NSWA 4DEJA 1WMJA 5DJLA 3TDGA 1A8YA 1M9AA 2H73A 2JADA 4V2LA 3TJFA 4KB3A 1YF0A 4TXVA 1TKDB 2DC5A 3A2WA 4D73B 1FB6A 1FW1A 1WIKA 4HZ2A 4F0BA 4FYCA 5IM9A 1XWCA 1SENA 1PMTA 2X64A 5GAND 1MDJA 3UJ1A 2J23A 2V6OA 4KX4A 2IFQA 1BG5A 3GX8A 1PN9A 4WF5A 4F0CA 1MDKA 1VF3A 3ZIJA 3A2VA 3M8NA 4KUNA 5DALA 1BAYA 4ACSA 1EOHA 4N30A 2F9SA 4IS0A 1F37A 4CHSA 2FLSA 2FD3A 2YANA 2F8AA 1XWBA 3QOUA 3HJMA 2L57A 3BD2A 3VLNA 2CZ2A 4L5LA 1V9WA 5FWGA 5DQYA 1GSFA 2OE1A 3K8NA 4Q5RA 4J56E 4MMMA 2VCWA 4F9ZA 3DEXA 1YZXA 1CQGA 1MD4A 3EU4A 4RI6A 3I43A 1UVZA 1C72A 3GX0A 2DIZA 5IMDA 2C8UA 2H0HA 3H4KA 4TR1B 5JWOB 4XS6A 1A8LA 1T4YA 3IR4A 4OO5A 2XBQA 3F63A 4MH3A 5GZZB 3DMLA 3R2QA 3KJYA 3TKPA 4IELA 1X0RA 2IMKA 20GSA 4RUVA 2HE3A 2FGXA 2BJXA 2L4CA 1SJ6A 5JWRB 4L8EA 1NHYA 4N0ZA 3TKSE 1OC8A 4O32A 2HZFA 4XRDA 2GZZA 3KMOA 1YJ6A 1ZL9A 4XTSA 3SWLA 1XFLA 3QCPA 1OC9A 2AUVA 1EEJA 2JSYA 3F9UA 3LJRA 5G5FA 3CMIA 1M2DA 4EF0A 2A2SA 3ISOA 4PQHA 2LEGA 4DSSA 2H70A 2C0DA 3RPNA 2BMXA 3RDWA 4MPFA 1ILOA 4WBJA 1TRSA 3PGTA 1XVQA 4O92A 3RPPA 3Q74A 1HNBA 1EGRA 3V1WA 6GSXA 6GSVA 5KN2A 4K0GA 6GSWA 1SK1A 3GSTA 3GL3A 2FA4A 4HEA2 1YY7A 5B7CA 2A2RA 1FVKA 1DUGA 3UBLA 3IAS2 4N10A 1TTZA 2EIQA 2VLUA 2G0FA 3KD0A 4DSRA 4K7IA 1F6MC 3M9JA 2YZUA 2ZNMA 3F6DA 1A2LA 3CRTA 1RQMA 1K0MA 1YEXA 5JCWA 1XCCA 1M9BA 4NAXA 9GSSA 3C73A 2FCHA 4ML1A 4HOJA 4KE3A 1EGOA 2N5AA 2X8GA 3LEFA 2V2GA 4BL7A 3G7YA 3TKRA 1MDIA 3ZYWA 4OFTA 4OCFA 4LL1B 3VK9A 2IWTA 5D8IA 3TCOA 4KCEA 1SD9A 3KH9A 2H71A 3C1RA 3PR8A 1XW9A 3FRCA 5D73A 5ECSA 3LXTA 3U5RE 1E6BA 1T8EB 4IN0A 5LCZA 2O7KA 2VL3A 2C4JA 4L0UA 2R4VA 1UC7A 3GURA 2LTKA 5CYYA 2MMOA 3OR5A 2HRNA 4XS4A 3D4MA 5CO3A 2MMZA 4MDCA 2L6CA 6GSUA 5ECNB 1O8WA 4WKWA 3KEBA 3LGCA 4HQSA 1E2YA 2BTOT 5CAXA 4TRXA 1AUCA 4WETA 1G6YA 2LRNA 1EP8A 4YQUA 4I8BA 3HY2A 1O81A 1G7EA 3FZ4A 2H1BA 5ID2B 2VL2A 5CP1A 5B6NA 5EL8A 1U3IA 3KP9A 1X9MB 1YKCA 4KW6A 4OFNA 3UMAA 1TJDA 4POLA 2DJ1A 5HR2A 1SKWB 2LV3A 3GH6A 2JZRA 4ML6A 3QAGA 4KH7A 3M3MA 1PD21 4KAEA 1X9WB 1GUKA 4EUYA 1M2AA 4P3YB 2RIIA 4IP1A 1GP1A 3H79A 2PBJA 1Y6EA 2VM1A 2K8SA 4L0WA 4ZILA 3Q18A 1GL8A 1TK0B 1HNCA 2YPMA 2JU5A 4V2NA 4MJEA 4MPGA 2LJRA 4HQZA 4JEDA 1B4QA 2CA8A 4PNGA 5HR3A 1TI1A 4BVYA 1M7TA 3L9UA 3QFAC 2M46A 5ECRB 2WJUA 1AAZA 1NM3A 3VI5A 3J7Yk 3KTBA 2VCQA 5HR0A 3LG6A 3US3A 3WD6A 3WGDA 2GZYA 2B1KA 2AB6A 3Q19A 2RUFA 1N8JA 4GRFA 3GH9A 4NMUA 5GAPD 2X8CA 4JRRA 5G1KA 2GS3A 3TGZA 3TKQA 1I9DA 1K0DA 3UAPA 4TXOA 1O73A 1GSDA 1FOVA 1YF1A 4N11A 3MDKA 1XWKA 1DE1A 2RUEA 3QMXA 6GSTA 3GKNA 4KNDA 4KSMA 8GSSA 2ZUPA 3E3EA 1PX6A 3D21A 2YWMA 3S9FA 2R2JA 2PPTA 1BEDA 2OE3A 4HJMA 1AW9A 3DRNA 4IP6A 2CVDA 1S3CA 3HA9A 1PSQA 1QUWA 5IMCA 1R7HA 4N0VA 5C00A 2B5EA 3C8EA 2GZPA 10GSA 2JL4A 1TW9A 1GUMA 4POMA 1LU4A 3F0IA 4GF0A 4L5OA 1FAAA 4X0XA 5IPHA 1R4WA 5F05A 4I2TA 4Q5NA 2HFDA 1V98A 1J08A 3GKKA 4ECBA 1RK4A 3TJGA 3SBCA 2C3TA 5ELAA 1QGVA 2H30A 1UN2A 1ZMAA 5DBQA 1JFUA 3ZMKA 4DSQA 2ES7A 5IOWA 2H72A 4FH8A 3DYRA 5B8BA 1SK2A 1XWGA 3EVIA 4OCEA 1X5DA 1Z9HA 2V6KA 2I4AA 2B6MA 1QQ2A 3O3TA 3IA1A 2FY6A 2KLXA 5ECIB 2V41A 4TR0A 4D73A 3DXBA 4YH2A 3P8WA 1PKZA 2P31A 1AIUA 1R5AA 2CX3A 2VL9A 3TOTA 2NBSA 2B7KA 4EE0A 3G7JA 2CAQA 4K6XA 2OBKA 1GTAA 4NV5A 12GSA 1AC1A 2IPAA 3FZAA 3HKRA 3IK7A 5EPFA 4FYBA 2DJKA 5AIXA 5ENUA 4YQMA 2DSAA 4F03A 4TKYA 1ERUA 3HDCA 3I9V2 1GULA 2GT5A 2FNOA 4XS1A 1BJXA 3NOFA 3KM6A 3GTUB 3EE2A 3HVXA 1Y25A 3BCKA 3L78A 3GKXA 2H01A 2H19A 4OD7A 5G2ZA 2R5GA 3CSIA 4IBPA 5JCGA 4JE1A 4I6XA 1M0UA 1S3AA 1XWAA 4GSTA 1EV9A 3DD3A 19GSA 4PXOA 3HZ8A 3APQA 5CRWA 2V32A 4WXTA 4RQXA 2O85A 4ECIA 1VF4A 3HJPA 4ZL7A 2L59A 4X1UA 1GWCA 3FZ5A 3UVHA 1PX7A 2PN8A 5COHA 2HZEB 3J7Yb 4Q5QA 5DCHA 1S3DA 4ECCA 1J0FA 3O6TA 3FYGA 1SU9A 4POBA 3I6AA 2XHFA 5A4WA 3TJBA 1SD8A 1U88A 3NZNA 3VWWA 2IL3A 2DLXA 3MAKA 2WZ9A 3GL5A 2NDOA 5CRDA 1J9BA 5JWQB 3W8JA 3ZFLA 3CBUA 4ILFA 2N5FA 5DJMA 2LRCA 2LJAA 1FG4A 1XOAA 4MABA 3IC4A 2HLSA 4ZBBA 2KOKA 3TOUA 2R3XA 2RM5A 2DMLA 4IJ3A 4EKZA 3VWUA 4K1FA 2GSSA 2RM6A 1PA3A 1R26A 3MNGA 1GSYA 1DSBA 5J9BA 1WJKA 2Z9SA 1XW5A 2A4VA 4FIWA 1K3YA 2GVPA 2DMMA 4Z7XA 3EU3A 2N5BA 5IQYA 4GLTA 4GSSA 3GFKA 5IMAA 2FWEA 5ECMB 1ZZYA 1DBYA 1K0AA 2DIYA 3UOMA 2FA8A 1OAZA 4F2IA 1U87A 4EDZA 5KEJA 4J2FA 1U6TA 1V2AA 2GTUA 2HSHA 3WGXA 4CW9A 1BYEA 2WDUA 3WT2A 1T3BA 16GSA 1F3AA 5C04A 1JHBA 2OE0A 3WGEA 2OA7A 1JZOA 2WB9A 3ERGA 4F82A 2PWJA 1Z6MA 1TK5B 1TU8A 1TI3A 2C80A 3UIWA 1A2JA 3MWHA 4IHUA 1B9XC 1F2EA 2I1UA 1V57A 3TKSA 3W6GA 5HFIA 3TRPA 2LQQA 1QFNA 2LQOA 4ZL9A 1H4OA 2B5YA 2REMA 1Q98A 1YKAA 2VD0A 3CSJA 3H8QA 1ZGNA 2H0IA 3GHAA 5CRGA 4WR4A 5LNKe 4PUFC 2CAIA 1G0TA 2FWFA 1ZOFA 4OO4A 1GNWA 3EWLA 3IRAA 3ZVJA 1G6WA 1USBA 3GMFA 1TK8B 2X8HA 2OJLA 5DAKB 1HQOA 2LRTA 3RHBA 1EEMA 2MBTA 5GSSA 3VWVA 4HI7A 3D6IA 3TJKA 2ON5A 2YN1A 3G7IA 5ID2A 4BVXA 3KZQA 2FUG2 2X99A 4KGIA 1PGTA 2LKUA 1YDKA 2GSQA 5F8BA 1Z7RA 1V58A 5FHIA 3IHQA 1GRXA 2HI7A 1T1VA 4I97A 1B9YC 4V1Ag 1Q4JA 2H1DA 2FWGA 1WPIA 5H5SA 1FVJA 3CXGA 1MTCA 2C0GA 4HS1A 4Q5FA 4K8MA 2D2ZA 1X5EA 5ECLB 5CRHA 2VD1A 3BOAA 3FR3A 2EC4A 4CDOA 4AJ7A 2TIRA 11GSA 4JR4A 3VFIA 4YQVA 3ZREA 5IIZA 1TP9A 1GSEA 4E8HA 5J9CA 1FB0A 1ON4A 2GDRA 2FWHA 1U3AA 4ID0A 2PGTA 1MEKA 3KMNA 4EL1A 5HFKA 2LSTA 3KGKA 2B1LA 1KBNA 1VGLA 1RW1A 3FK8A 1FHEA 4JU5A 3DGQA 2XPDA 4J57E 3ED3A 2DBCA 1F3BA 2CV4A 4MJBA 3F4TA 1CQHA 2GQMA 2PU9C 2DJ0A 5HR1A 1OVNA 2P5RA 2VAFA 2VIMA 5IO0A 5G5EA 2F51A 3BJ5A 1TRVA 2B7JA 1EZKA 1XOBA 1MD3A 2GQKA 4GCIA 1ERTA 1SYXA 2XC2A 3VURA 2YP6A 3EURA 3WYWA 3RHCA 5DDLA 2HSYA 3FR9A 4FYUA 1EOGA 1YQ1A 4GXZA 4MF7A 5G1LA 1K3LA 1JLWA 3ZMLA 5J41A 4MA9A 2IJYA 3IPZA 3IXRA 4K9ZA 2L4QA 3C7MA 4EVMA 1IYIA 4IJIA 2PVOC 5ECPB 2M80A 3P90A 3MSZA 4AJ6A 1TRUA 1OYJA 1EP7A 4O5RA 3I69A 3KTLA 3VWXA 3GYKA 5J5NA 3QAVA 2GLRA 1F9MA 4PURA 2O8VB 1QK8A 4POKA 3HJOA 4TVEA 4IQ1A 1W4VA 3HVVA 1BX9A 1XXUA 2GSRA 5A5KA 4TR4A 4O7HA 4OMVA 2WS2A 1EWXA 2B3SA 2YJHA 5AGYA 3FR6A 4DVCA 2QKEA 4MF5A 4G10A 4PUAA 3TB2A 3EMPA 2AAWA 2H6XA 2C1YA 2JZSA 2HYXA 4EC0A 4IQAA 2JZTA 1Z5YE 1Z7PA 2AYTA 2I9HA 1YEPA 2VUPA 5IO2A 4QQ7A 3PINA 2VCZA 1A0FA 2HNLA 5ECHB 2E2MA 1SL2B 3PH9A 3P2AA 3H93A 3CRUA 4KSOA 2YOIA 1GUHA 1ZYEA 3IDVA 5CREA 2QGVA 1SKRB 4XHMA 3L9SA 1I5GA 2DJ2A 4H86A 4LA1A 5G30A 4WR5A 4WBRD 1AXDA 3DVXA 5DQSA 4GTUA 2H76A 5B8AA 2VCTA 2VL2C 4GQFA 4OFMA 2CVBA 2OKAA 3GTUA 1O7UA 1WOUA 4ULXA 2WULA 5ELGA 4FO5A 5J3RA 4HDEA 4BA7A 2DJ3A 3F3RA 4K0NA 1Z6NA 4PQ1A 3A2XA 3TRQA 4NHWA 2WFCA 1SL0B 1FO5A 3QPMA 3UL3A 2GT6A 1A2MA 13GSA 2ZCTA 3C71A 3BBYA 4PQIA 1GLQA 3CSHA 5FT3A 5F07A 4I5QA 1K0BA 1T4ZA 2CZ3A 3E9JB 3N5OA 4G2EA 4MP4A 1SL1B 4K7OA 2PERA 2HXKA 5L71A 4V1Ap 2HZEA 1WP0A 3ME8A 2WCIA 3L0HA 4EDYA 4LMWA 3NIVA 1O6JA 2YNXA 1R5PA 2HRFA 3D22A 3W8SA 4HU7A 3ZVJD 5D96A 1PRXA 2I81A 3VI7A 4TR1A 5DVBA 3LYPA 2GQLA 3ERWA 4X43A 3RAZA 1TOFA 2R37A 3ZITA 2C3QA 4BWSA 3GRXA 2ALBA 3ZL5A 4MH2A 4ZIJA 4IGJA 2MMNA 5A4UA 2YV7A 5D93A 1G7OA 2B5XA 1QMVA 1PKWA 5EY6A 3M1GA 3GN3A 4HZ4A 3LWAA 1HYUA 1OE7A 3D0ZA 4IKHA 4E8EA 3O76A 1TU7A 2CVKA 4JR6A 2FHEA 1NW2A 1XW6A 4PX1A 3ZIVA 2YWNA 5IMZA 2EIOA 2L5OA 3KXOA 1O85A 6GSSA 3KH7A 1JZWA 2IFQB 4MF6A 1T00A 2RLIA 4NXIA 3IBHA 1OE8A 1XZOA 5D9WA 3EINA 5DALB 1K0CA 5ECOB 2LNSA 1TXXA 3QAWA 1DE2A 2JSZA 3A5WA 3U6VA 5AIVA 4QL7A 3DIEA 1AQXA 3A3TA 3ERFA 4LL4B 3LQ7A 2LNTA 1JLVA 1B8XA
chains in the Genus database with same CATH superfamily
2O89A 1ZYNA 1KTEA 3ZRDA 4ECJA 5EVOA 1VF1A 3N9JA 5IOXA 2JACA 4ZB8A 3IE3A 2C0FA 1JZDA 2MBSA 3JCML 3C1SA 2NVLA 14GSA 2H1GA 2I3YA 1THOA 1AQVA 3QFBC 2AHEA 1ZYPA 2K18A 4K7NA 5DCGA 1H75A 3GUSA 5LD0A 3KCMA 1URMA 4V2MA 3UARA 1B48A 1HD2A 3EYTA 4ISDA 2OADA 4MK3A 5AISA 2F8FA 4RQRA 5BRTA 3F4RA 3ZFBA 2LUSA 5E4WA 5DAKA 1GSQA 4NWYA 22GSA 2E2GA 5ECQB 3M0FA 3LORA 2L5LA 2KHPA 4ZL8A 1GTIA 3ZZXA 2L6DA 4HU9A 4KCAA 4PGTA 4GSNA 4ZBDA 1K0OA 1GTUA 1OC9B 3GSSA 3LXZA 3HCZA 3LW9A 2J9HA 5J4UA 1OC3A 3GIXA 4TW5A 4AGSA 3BCIA 4DSSB 3KIJA 3FY7A 1GH2A 4TN8A 2YCDA 3TUEA 4WF4A 2XPEA 2MMAA 3APSA 5A4VA 1WE0A 2IMFA 4JZQA 3KP8A 1T7PB 4MJCA 5HFGA 1XIYA 1GSUA 3HVSA 2MYGA 3QDNA 3GA4A 1ACVA 2HRKA 4KDYA 1LJRA 4ZB6A 5AN1A 5D9XA 1BQ7A 2V1MA 5G31A 2PVQA 1VRSD 1SK0A 2YWIA 4G0LA 4MZWA 4XIHA 5F06A 2AV4A 2IMDA 3UBKA 3LSZA 1SJZA 2YJ7A 2OBIA 3FW2A 3L4NA 2AJQB 4GWRA 1ST9A 2E7PA 4KDXA 2VCXA 4KDUA 2K6VA 1IYHA 3IHGA 4BL7B 3FZ9A 1EV4A 1LBKA 4LMVA 4PNFA 4IW9A 1AQWA 3QD9A 1O8XA 4MZCA 4GQCA 2H66A 2MZCA 5ECKB 2NTOA 2YWOA 2H8LA 1SYRA 3LFLA 2CQ9A 2TRCP 4K2DA 2WRTA 2H6YA 2GSTA 2KP1A 5HQPA 3GNJA 3UEMA 5F0GA 2H74A 1XPVA 2GGTA 2VCVA 2H0GA 4HUAA 4XS4B 2TRXA 3F4SA 3EC3A 1ZCPA 3IAM2 1Z3EA 3H1NA 1GNEA 2YV9A 2M72A 1HNAA 3UVTA 3LYKA 2KUCA 1ABAA 2QC7A 1ZYQB 1TDIA 2H6ZA 2DKIA 3GV1A 2HSMA 3QR6A 2F3MA 4AJ8A 4EO3A 3Q6OA 4BWQA 4JBBA 1SKSB 1W89A 3E0UA 3ME7A 5IMFA 1GTBA 5KOWA 2VOCA 1X5CA 4EXJA 1WRYA 2XBIA 2QSIA 1V40A 3VPTA 18GSA 2C0EA 2KP2A 3TKSC 4I2UA 1A24A 4WEYA 2VO4A 1TRWA 4NHZA 5KN1A 2E0QA 5ABRA 1KNGA 3FEUA 7GSSA 2LJKA 3AY8A 2OACA 2ON7A 2WGRA 1ERWA 4ICYA 2VM2A 4BVYB 1ERVA 4IVFA 4XCSA 2DJJA 3IOSA 2LS5A 2UZ8A 1A23A 5H5RA 1GSSA 2K8VA 4G9HA 1K3OA 1M99A 1QXHA 3RBTA 2IIYA 3DVWA 3EMXA 1XBSA 5KN3A 1PFOA 4NPBA 4EIQA 3FHKA 4BPYA 2IMIA 4G0KA 3CYNA 2P0GA 4LLRA 17GSA 1GLPA 2VLVA 1A0RP 2R0GA 3ZLPA 1K0NA 2PMTA 4ZBAA 3VPQA 5KN0A 1M2BA 2O87A 2YZHA 2G2QA 2NPBA 4TXOB 4QL9A 4TR3A 1PQNA 4XRAA 1PL1A 1N2AA 5CNWA 3F6FA 2IN3A 4HJ2A 1B4PA 5INYA 1XVWA 1SJIA 3D5JA 4RI7A 3CTGA 5D9VA 4NV2A 3F3QA 3HD5A 3HHVA 3IV4A 4ZXGA 3APOA 3G9BA 3M9KA 3P7XA 1PL2A 2R6KA 3F8UA 4MJAA 5H5QA 1OKTA 3HYPA 5IPGA 2EIRA 3TRXA 3WT1A 4YAVA 3HZ4A 3ZTLA 1WWJA 4K5SA 4OWYA 2VLTA 4MZBA 4ZB9A 3D4TA 3HXSA 1OKDA 5GSTA 2CT6A 2H75A 3GKMA 1X9SB 3TJJA 1NHOA 3DWVA 4G19A 3DKSA 1VF2A 4KA0A 4YAPA 1ML6A 2HT9A 2P5QA 4MCUA 6GSYA 2IMEA 5B6MA 1UA5A 3FKFA 4MLYA 1KEBA 1JZRA 3L9VA 5E59A 2C3NA 4TOPA 1THXA 2K9FA 2CX4A 2PUKC 5JCUA 3IK9A 4AF2A 2H1AA 3CTFA 5IMVA 5D9TA 1NSWA 4DEJA 1WMJA 5DJLA 3TDGA 1A8YA 1M9AA 2H73A 2JADA 4V2LA 3TJFA 4KB3A 1YF0A 4TXVA 1TKDB 2DC5A 3A2WA 4D73B 1FB6A 1FW1A 1WIKA 4HZ2A 4F0BA 4FYCA 5IM9A 2R0CA 1XWCA 1SENA 1PMTA 2X64A 5GAND 1MDJA 3UJ1A 2J23A 2V6OA 4KX4A 2IFQA 1BG5A 3GX8A 1PN9A 4WF5A 4F0CA 1MDKA 1VF3A 3ZIJA 3A2VA 3M8NA 4KUNA 5DALA 1BAYA 4ACSA 1EOHA 4N30A 2F9SA 4IS0A 1F37A 4CHSA 2FLSA 2FD3A 2YANA 2F8AA 1XWBA 3QOUA 3HJMA 2L57A 3BD2A 3VLNA 4MNNA 2CZ2A 4L5LA 1V9WA 5FWGA 5DQYA 1GSFA 2OE1A 3K8NA 4Q5RA 4J56E 4MMMA 2VCWA 4F9ZA 3DEXA 1YZXA 1CQGA 1MD4A 3EU4A 4RI6A 3I43A 1UVZA 1C72A 3GX0A 2DIZA 5IMDA 2C8UA 2H0HA 3H4KA 4TR1B 5JWOB 4XS6A 1A8LA 1T4YA 3IR4A 4OO5A 2XBQA 3F63A 4MH3A 5GZZB 3DMLA 5BMUA 3R2QA 3KJYA 3TKPA 4IELA 1X0RA 2IMKA 3FMWA 20GSA 4RUVA 2HE3A 2FGXA 2BJXA 2L4CA 1SJ6A 5JWRB 4L8EA 1NHYA 4N0ZA 3TKSE 1OC8A 4O32A 2HZFA 4XRDA 2GZZA 3KMOA 2R0PA 1YJ6A 1ZL9A 4XTSA 3SWLA 1XFLA 3QCPA 1OC9A 2AUVA 1EEJA 2JSYA 3F9UA 2X49A 3LJRA 5G5FA 3CMIA 1M2DA 4EF0A 2A2SA 3CQFA 3ISOA 4PQHA 2LEGA 3HVNA 4DSSA 2H70A 2C0DA 3RPNA 2BMXA 3RDWA 4MPFA 1ILOA 4WBJA 1TRSA 3PGTA 1XVQA 4O92A 3RPPA 3Q74A 1HNBA 1EGRA 3V1WA 6GSXA 6GSVA 5KN2A 4K0GA 6GSWA 1SK1A 3GSTA 3GL3A 2FA4A 4HEA2 1YY7A 5B7CA 2A2RA 1FVKA 1DUGA 3UBLA 3IAS2 4N10A 1TTZA 2EIQA 2VLUA 2G0FA 3KD0A 4DSRA 4K7IA 1F6MC 3M9JA 2YZUA 2ZNMA 3F6DA 1A2LA 3CRTA 1RQMA 1K0MA 4G0IA 1YEXA 5JCWA 1XCCA 1M9BA 4NAXA 9GSSA 3C73A 2FCHA 4ML1A 4HOJA 4KE3A 1EGOA 3IC8A 4X4JA 2N5AA 2X8GA 3LEFA 4CY6A 2V2GA 4BL7A 3G7YA 3TKRA 1MDIA 3ZYWA 4OFTA 4KF9A 4OCFA 4LL1B 3VK9A 2IWTA 5D8IA 3TCOA 4KCEA 1SD9A 3KH9A 2H71A 3C1RA 3PR8A 1XW9A 3FRCA 1M3JA 5D73A 5ECSA 3LXTA 3U5RE 1E6BA 1T8EB 4IN0A 5LCZA 2HRAA 2O7KA 2VL3A 2C4JA 4EIPA 4L0UA 2R4VA 1UC7A 3GURA 2LTKA 5CYYA 2MMOA 3OR5A 2HRNA 4XS4A 3D4MA 5CO3A 2MMZA 4MDCA 2L6CA 6GSUA 5ECNB 1O8WA 4WKWA 3KEBA 3LGCA 4HQSA 1E2YA 2BTOT 5CAXA 4TRXA 1AUCA 4WETA 1G6YA 2LRNA 1EP8A 4YQUA 4I8BA 3HY2A 1O81A 1G7EA 3FZ4A 2H1BA 5ID2B 4BVXB 2VL2A 5CP1A 5B6NA 4HSCX 1U3IA 5EL8A 3KP9A 1X9MB 1YKCA 4KW6A 4OFNA 3UMAA 1TJDA 4POLA 2DJ1A 5HR2A 1SKWB 2LV3A 3GH6A 2JZRA 4ML6A 3QAGA 4KH7A 3M3MA 1PD21 4KAEA 1X9WB 1GUKA 4EUYA 1M2AA 4P3YB 2RIIA 4IP1A 1GP1A 3H79A 2PBJA 1Y6EA 2VM1A 2K8SA 4L0WA 4ZILA 3Q18A 1GL8A 1TK0B 1HNCA 2YPMA 2JU5A 4V2NA 4MJEA 4MPGA 2LJRA 4HQZA 4JEDA 1B4QA 2CA8A 4PNGA 5HR3A 1TI1A 4BVYA 1M7TA 3L9UA 3QFAC 2M46A 5ECRB 2WJUA 1AAZA 4K2XA 1NM3A 3VI5A 3J7Yk 3KTBA 2VCQA 5HR0A 3LG6A 3US3A 3WD6A 3WGDA 4O5UA 2GZYA 2B1KA 2AB6A 3Q19A 2RUFA 1N8JA 4GRFA 3GH9A 4NMUA 2DKHA 5GAPD 2X8CA 4JRRA 5G1KA 2GS3A 3TGZA 3TKQA 1I9DA 1K0DA 3UAPA 4TXOA 1O73A 1GSDA 1FOVA 1YF1A 4N11A 3MDKA 1XWKA 1DE1A 2QA2A 2RUEA 3QMXA 6GSTA 3GKNA 4KNDA 4KSMA 8GSSA 2ZUPA 3E3EA 1PX6A 3D21A 2YWMA 3S9FA 2R2JA 2QA1A 2PPTA 1BEDA 2OE3A 4HJMA 1AW9A 3DRNA 4IP6A 2CVDA 1S3CA 3HA9A 1PSQA 1QUWA 5IMCA 1R7HA 4N0VA 5C00A 2B5EA 3C8EA 2GZPA 10GSA 2JL4A 1TW9A 1GUMA 4POMA 1LU4A 3F0IA 4GF0A 4L5OA 1FAAA 4X0XA 5IPHA 1R4WA 5F05A 4I2TA 4Q5NA 2HFDA 1V98A 1J08A 3GKKA 4ECBA 1RK4A 3TJGA 3SBCA 2C3TA 4YKGA 5ELAA 1QGVA 2H30A 1UN2A 1ZMAA 5DBQA 1JFUA 3ZMKA 4FQUA 4DSQA 2ES7A 5IOWA 2H72A 4FH8A 3A5IA 3DYRA 1SK2A 1XWGA 5B8BA 3EVIA 4OCEA 1X5DA 1Z9HA 2V6KA 2I4AA 2B6MA 1QQ2A 3O3TA 3IA1A 2FY6A 2KLXA 5ECIB 2V41A 4TR0A 4D73A 3DXBA 4YH2A 3P8WA 1PKZA 2P31A 1AIUA 1R5AA 2CX3A 2VL9A 3TOTA 2NBSA 4A5PA 2B7KA 4EE0A 3G7JA 2CAQA 4K6XA 2OBKA 1GTAA 4NV5A 12GSA 1AC1A 2IPAA 3FZAA 3HKRA 3IK7A 5EPFA 4FYBA 2DJKA 5AIXA 5ENUA 4YQMA 2DSAA 4F03A 4TKYA 1ERUA 3HDCA 3I9V2 1GULA 2GT5A 2FNOA 4XS1A 1BJXA 3NOFA 3KM6A 3GTUB 3EE2A 3HVXA 1Y25A 3BCKA 3L78A 3GKXA 2H01A 2H19A 4OD7A 5G2ZA 2R5GA 3CSIA 4IBPA 5JCGA 4JE1A 4I6XA 1M0UA 1S3AA 1XWAA 4GSTA 1EV9A 4PTSA 3DD3A 19GSA 4PXOA 3HZ8A 3APQA 5CRWA 2V32A 4WXTA 4RQXA 2O85A 4ECIA 1VF4A 3HJPA 4ZL7A 2L59A 4X1UA 1GWCA 3FZ5A 3UVHA 1PX7A 2PN8A 4O5QA 5COHA 2A2PA 2HZEB 3J7Yb 4Q5QA 5DCHA 1S3DA 4ECCA 1J0FA 3O6TA 3FYGA 1SU9A 4POBA 3I6AA 2XHFA 5A4WA 3TJBA 1SD8A 1U88A 3NZNA 3VWWA 2IL3A 2DLXA 3MAKA 2WZ9A 3GL5A 2NDOA 5CRDA 1J9BA 5JWQB 3W8JA 3ZFLA 3CBUA 4ILFA 2N5FA 5DJMA 2LRCA 2LJAA 1FG4A 1XOAA 4MABA 3IC4A 2HLSA 4ZBBA 2KOKA 3TOUA 2R3XA 2RM5A 2DMLA 1XG8A 4IJ3A 4BIKA 4EKZA 3VWUA 4K1FA 2GSSA 2RM6A 1PA3A 1R26A 3MNGA 1GSYA 1DSBA 5J9BA 1WJKA 2Z9SA 1XW5A 2A4VA 4FIWA 1K3YA 2GVPA 2DMMA 4Z7XA 3EU3A 2N5BA 5IQYA 4GLTA 4GSSA 3GFKA 5IMAA 2FWEA 5ECMB 1ZZYA 1DBYA 1K0AA 2DIYA 3UOMA 2FA8A 1OAZA 4F2IA 1U87A 4EDZA 5KEJA 4J2FA 1U6TA 1V2AA 2GTUA 2HSHA 3WGXA 4CW9A 1BYEA 2WDUA 3WT2A 1T3BA 16GSA 1F3AA 5C04A 1JHBA 2OE0A 3WGEA 2OA7A 1JZOA 2WB9A 3ERGA 4F82A 2PWJA 1Z6MA 1TK5B 1TU8A 1TI3A 2C80A 3UIWA 1A2JA 3MWHA 4IHUA 1B9XC 1F2EA 2I1UA 1V57A 3TKSA 3W6GA 5HFIA 3TRPA 2LQQA 1QFNA 4YKFA 2LQOA 4ZL9A 1H4OA 2B5YA 2REMA 1Q98A 1YKAA 2VD0A 3CSJA 3H8QA 1ZGNA 2H0IA 3GHAA 5CRGA 4WR4A 5LNKe 4PUFC 2CAIA 1G0TA 2FWFA 1ZOFA 4OO4A 1GNWA 3EWLA 3IRAA 3ZVJA 1G6WA 1USBA 3GMFA 1TK8B 2X8HA 1M3IA 3PPUA 2X4AA 2OJLA 5DAKB 1HQOA 2LRTA 3RHBA 1EEMA 2MBTA 5GSSA 3VWVA 4HI7A 3D6IA 3TJKA 2ON5A 2YN1A 3G7IA 5ID2A 4BVXA 3KZQA 2FUG2 2X99A 4KGIA 1PGTA 2LKUA 1YDKA 2GSQA 5F8BA 1Z7RA 1V58A 5FHIA 3IHQA 1GRXA 2HI7A 1T1VA 4I97A 1B9YC 4V1Ag 1Q4JA 2H1DA 2FWGA 1WPIA 5H5SA 1FVJA 3CXGA 1MTCA 2C0GA 3EPTA 4HS1A 4Q5FA 3MIXA 4K8MA 2D2ZA 1X5EA 1S3RA 5ECLB 5CRHA 2VD1A 3BOAA 3FR3A 2EC4A 4CDOA 4AJ7A 2TIRA 11GSA 4JR4A 3VFIA 4YQVA 3ZREA 5IIZA 1TP9A 1GSEA 4E8HA 5J9CA 1FB0A 1ON4A 2GDRA 2FWHA 1U3AA 4ID0A 2PGTA 1MEKA 3KMNA 4EL1A 5HFKA 2LSTA 3KGKA 2B1LA 1KBNA 1VGLA 1RW1A 3FK8A 1FHEA 4JU5A 3DGQA 2XPDA 4J57E 3ED3A 2DBCA 1F3BA 2CV4A 4MJBA 3F4TA 1CQHA 2GQMA 2PU9C 2DJ0A 5HR1A 1OVNA 2A4HA 2P5RA 3R3EA 2VAFA 2VIMA 5IO0A 5G5EA 2F51A 3BJ5A 5KOXA 1TRVA 2B7JA 1EZKA 1FOHA 1XOBA 1MD3A 2GQKA 4GCIA 1ERTA 1SYXA 2XC2A 3VURA 2YP6A 3EURA 3WYWA 3RHCA 5DDLA 2HSYA 3FR9A 4FYUA 1EOGA 1YQ1A 4GXZA 4MF7A 5G1LA 1K3LA 1JLWA 3ZMLA 5J41A 4MA9A 2IJYA 3IPZA 3IXRA 4K9ZA 2L4QA 3C7MA 4EVMA 1IYIA 4IJIA 2PVOC 5ECPB 2M80A 3P90A 3MSZA 4AJ6A 1TRUA 1OYJA 1EP7A 4O5RA 3I69A 3KTLA 3VWXA 3GYKA 5J5NA 3QAVA 2GLRA 1F9MA 4PURA 2O8VB 1QK8A 4POKA 3HJOA 4TVEA 4IQ1A 1W4VA 3HVVA 1BX9A 1XXUA 2GSRA 5A5KA 4TR4A 4O7HA 4OMVA 2WS2A 1EWXA 2B3SA 4Z2TA 2YJHA 5AGYA 3FR6A 4DVCA 2QKEA 4MF5A 4G10A 4PUAA 3TB2A 3EMPA 2AAWA 2H6XA 2C1YA 2JZSA 2HYXA 4EC0A 4IQAA 2JZTA 1Z5YE 1Z7PA 2AYTA 2I9HA 1YEPA 2VUPA 5IO2A 4QQ7A 3PINA 2VCZA 1A0FA 2HNLA 5ECHB 2E2MA 1SL2B 3PH9A 3P2AA 3H93A 3CRUA 4KSOA 2YOIA 1GUHA 1ZYEA 3IDVA 5CREA 2QGVA 1SKRB 4XHMA 3L9SA 3MYDA 1I5GA 2DJ2A 4H86A 4LA1A 5G30A 4WR5A 4WBRD 1AXDA 3DVXA 5DQSA 4GTUA 2H76A 5B8AA 2VCTA 2VL2C 4GQFA 4OFMA 2CVBA 2OKAA 3GTUA 1O7UA 1WOUA 4ULXA 2WULA 5ELGA 4FO5A 5J3RA 4K5RA 4HDEA 4BA7A 2DJ3A 3F3RA 4K0NA 1Z6NA 4PQ1A 4Z2UA 3A2XA 3TRQA 4NHWA 2WFCA 1SL0B 1FO5A 3QPMA 3UL3A 2GT6A 1A2MA 13GSA 2ZCTA 3C71A 3BBYA 4PQIA 1GLQA 3CSHA 5FT3A 5F07A 4I5QA 1K0BA 1T4ZA 2CZ3A 3E9JB 3N5OA 4G2EA 4MP4A 1SL1B 4K7OA 2PERA 2HXKA 5L71A 4V1Ap 2HZEA 1WP0A 3ME8A 2WCIA 3L0HA 4EDYA 4LMWA 3NIVA 1O6JA 2YNXA 1R5PA 4USSA 2HRFA 3D22A 4CY8A 3W8SA 4HU7A 3ZVJD 5D96A 1PRXA 2I81A 3VI7A 4TR1A 5DVBA 3LYPA 2GQLA 3ERWA 4X43A 3RAZA 1TOFA 2R37A 3ZITA 2C3QA 4BWSA 3GRXA 2ALBA 3ZL5A 4MH2A 4ZIJA 4IGJA 2MMNA 5A4UA 2YV7A 5D93A 1G7OA 2B5XA 1QMVA 1PKWA 5EY6A 3M1GA 3GN3A 4HZ4A 3LWAA 1HYUA 1OE7A 3D0ZA 4IKHA 4E8EA 3O76A 1TU7A 2CVKA 4JR6A 2FHEA 1NW2A 1XW6A 4PX1A 3ZIVA 2YWNA 5IMZA 2EIOA 2L5OA 1PN0A 3KXOA 1O85A 6GSSA 3KH7A 1JZWA 2IFQB 4MF6A 1T00A 2RLIA 4NXIA 3IBHA 1OE8A 1XZOA 5D9WA 3EINA 5DALB 1K0CA 5ECOB 2LNSA 1TXXA 3QAWA 1DE2A 2JSZA 3A5WA 4Z2RA 3U6VA 5AIVA 4QL7A 3DIEA 1AQXA 3A3TA 3ERFA 4LL4B 3LQ7A 2LNTA 1JLVA 1B8XA
chains in the Genus database with same CATH topology
2O89A 1ZYNA 1KTEA 3ZRDA 4ECJA 5EVOA 1VF1A 3N9JA 5IOXA 2JACA 4ZB8A 3IE3A 2C0FA 1JZDA 2MBSA 3JCML 3C1SA 2NVLA 14GSA 2H1GA 2I3YA 1THOA 1AQVA 3QFBC 2AHEA 1ZYPA 2K18A 4K7NA 5DCGA 1H75A 3GUSA 5LD0A 3KCMA 1URMA 4V2MA 3UARA 1B48A 1HD2A 3EYTA 4ISDA 2OADA 4MK3A 5AISA 2F8FA 4RQRA 5BRTA 3F4RA 3ZFBA 2LUSA 5E4WA 5DAKA 1GSQA 4NWYA 22GSA 2E2GA 5ECQB 3M0FA 3LORA 2L5LA 2KHPA 4ZL8A 1GTIA 3ZZXA 2L6DA 4HU9A 4KCAA 4PGTA 4GSNA 4ZBDA 1K0OA 1GTUA 1OC9B 3GSSA 3LXZA 3HCZA 3LW9A 2J9HA 5J4UA 1OC3A 3GIXA 4TW5A 4AGSA 3BCIA 4DSSB 3KIJA 3FY7A 1GH2A 4TN8A 2YCDA 3TUEA 4WF4A 2XPEA 2MMAA 3APSA 5A4VA 1WE0A 2IMFA 4JZQA 3KP8A 1T7PB 4MJCA 5HFGA 1XIYA 1GSUA 3HVSA 2MYGA 3QDNA 3GA4A 1ACVA 2HRKA 4KDYA 1LJRA 4ZB6A 5AN1A 5D9XA 1BQ7A 2V1MA 5G31A 2PVQA 1VRSD 1SK0A 2YWIA 4G0LA 4MZWA 4XIHA 5F06A 2AV4A 2IMDA 3UBKA 3LSZA 1SJZA 2YJ7A 2OBIA 3FW2A 3L4NA 2AJQB 4GWRA 1ST9A 2E7PA 4KDXA 2VCXA 4KDUA 2K6VA 1IYHA 3IHGA 4BL7B 3FZ9A 1EV4A 1LBKA 4LMVA 4PNFA 4IW9A 1AQWA 3QD9A 1O8XA 4MZCA 4GQCA 2H66A 2MZCA 5ECKB 2NTOA 2YWOA 2H8LA 1SYRA 3LFLA 2CQ9A 2TRCP 4K2DA 2WRTA 2H6YA 2GSTA 2KP1A 5HQPA 3GNJA 3UEMA 5F0GA 2H74A 1XPVA 2GGTA 2VCVA 2H0GA 4HUAA 4XS4B 2TRXA 3F4SA 3EC3A 1ZCPA 3IAM2 1Z3EA 3H1NA 1GNEA 2YV9A 2M72A 1HNAA 3UVTA 3LYKA 2KUCA 1ABAA 2QC7A 1ZYQB 1TDIA 2H6ZA 2DKIA 3GV1A 2HSMA 3QR6A 2F3MA 4AJ8A 4EO3A 3Q6OA 4BWQA 4JBBA 1SKSB 1W89A 3E0UA 3ME7A 5IMFA 1GTBA 5KOWA 2VOCA 1X5CA 4EXJA 1WRYA 2XBIA 2QSIA 1V40A 3VPTA 18GSA 2C0EA 2KP2A 3TKSC 4I2UA 1A24A 4WEYA 2VO4A 1TRWA 4NHZA 5KN1A 2E0QA 5ABRA 1KNGA 3FEUA 7GSSA 2LJKA 3AY8A 2OACA 2ON7A 2WGRA 1ERWA 4ICYA 2VM2A 4BVYB 1ERVA 4IVFA 4XCSA 2DJJA 3IOSA 2LS5A 2UZ8A 1A23A 5H5RA 1GSSA 2K8VA 4G9HA 1K3OA 1M99A 1QXHA 3RBTA 2IIYA 3DVWA 3EMXA 1XBSA 5KN3A 4NPBA 4EIQA 3FHKA 4BPYA 2IMIA 4G0KA 3CYNA 2P0GA 4LLRA 17GSA 1GLPA 2VLVA 1A0RP 2R0GA 3ZLPA 1K0NA 2PMTA 4ZBAA 3VPQA 5KN0A 1M2BA 2O87A 2YZHA 2G2QA 2NPBA 4TXOB 4QL9A 4TR3A 1PQNA 4XRAA 1PL1A 1N2AA 5CNWA 3F6FA 2IN3A 4HJ2A 1B4PA 5INYA 1XVWA 1SJIA 3D5JA 4RI7A 3CTGA 5D9VA 4NV2A 3F3QA 3HD5A 3HHVA 3IV4A 4ZXGA 3APOA 3G9BA 3M9KA 3P7XA 1PL2A 2R6KA 3F8UA 4MJAA 5H5QA 1OKTA 3HYPA 5IPGA 2EIRA 3TRXA 3WT1A 4YAVA 3HZ4A 3ZTLA 1WWJA 4K5SA 4OWYA 2VLTA 4MZBA 4ZB9A 3D4TA 3HXSA 1OKDA 5GSTA 2CT6A 2H75A 3GKMA 1X9SB 3TJJA 1NHOA 3DWVA 4G19A 3DKSA 1VF2A 4KA0A 4YAPA 1ML6A 2HT9A 2P5QA 4MCUA 6GSYA 2IMEA 5B6MA 1UA5A 3FKFA 4MLYA 1KEBA 1JZRA 3L9VA 5E59A 2C3NA 4TOPA 1THXA 2K9FA 2CX4A 2PUKC 5JCUA 3IK9A 4AF2A 2H1AA 3CTFA 5IMVA 5D9TA 1NSWA 4DEJA 1WMJA 5DJLA 3TDGA 1A8YA 1M9AA 2H73A 2JADA 4V2LA 3TJFA 4KB3A 1YF0A 4TXVA 1TKDB 2DC5A 3A2WA 4D73B 1FB6A 1FW1A 1WIKA 4HZ2A 4F0BA 4FYCA 5IM9A 2R0CA 1XWCA 1SENA 1PMTA 2X64A 5GAND 1MDJA 3UJ1A 2J23A 2V6OA 4KX4A 2IFQA 1BG5A 3GX8A 1PN9A 4WF5A 4F0CA 1MDKA 1VF3A 3ZIJA 3A2VA 3M8NA 4KUNA 5DALA 1BAYA 4ACSA 1EOHA 4N30A 2F9SA 4IS0A 1F37A 4CHSA 2FLSA 2FD3A 2YANA 2F8AA 1XWBA 3QOUA 3HJMA 2L57A 3BD2A 3VLNA 4MNNA 2CZ2A 4L5LA 1V9WA 5FWGA 5DQYA 1GSFA 2OE1A 3K8NA 4Q5RA 4J56E 4MMMA 2VCWA 4F9ZA 3DEXA 1YZXA 1CQGA 1MD4A 3EU4A 4RI6A 3I43A 1UVZA 1C72A 3GX0A 2DIZA 5IMDA 2C8UA 2H0HA 3H4KA 4TR1B 5JWOB 4XS6A 1A8LA 1T4YA 3IR4A 4OO5A 2XBQA 3F63A 4MH3A 5GZZB 3DMLA 5BMUA 3R2QA 3KJYA 3TKPA 4IELA 1X0RA 2IMKA 3FMWA 20GSA 4RUVA 2HE3A 2FGXA 2BJXA 2L4CA 1SJ6A 5JWRB 4L8EA 1NHYA 4N0ZA 3TKSE 1OC8A 4O32A 2HZFA 4XRDA 2GZZA 3KMOA 2R0PA 1YJ6A 1ZL9A 4XTSA 3SWLA 1XFLA 3QCPA 1OC9A 2AUVA 1EEJA 2JSYA 3F9UA 2X49A 3LJRA 5G5FA 3CMIA 1M2DA 4EF0A 2A2SA 3ISOA 4PQHA 2LEGA 4DSSA 2H70A 2C0DA 3RPNA 2BMXA 3RDWA 4MPFA 1ILOA 4WBJA 1TRSA 3PGTA 1XVQA 4O92A 3RPPA 3Q74A 1HNBA 1EGRA 3V1WA 6GSXA 6GSVA 5KN2A 4K0GA 6GSWA 1SK1A 3GSTA 3GL3A 2FA4A 4HEA2 1YY7A 5B7CA 2A2RA 1FVKA 1DUGA 3UBLA 3IAS2 4N10A 1TTZA 2EIQA 2VLUA 2G0FA 3KD0A 4DSRA 4K7IA 1F6MC 3M9JA 2YZUA 2ZNMA 3F6DA 1A2LA 3CRTA 1RQMA 1K0MA 4G0IA 1YEXA 5JCWA 1XCCA 1M9BA 4NAXA 9GSSA 3C73A 2FCHA 4ML1A 4HOJA 4KE3A 1EGOA 3IC8A 4X4JA 2N5AA 2X8GA 3LEFA 4CY6A 2V2GA 4BL7A 3G7YA 3TKRA 1MDIA 3ZYWA 4OFTA 4KF9A 4OCFA 4LL1B 3VK9A 2IWTA 5D8IA 3TCOA 4KCEA 1SD9A 3KH9A 2H71A 3C1RA 3PR8A 1XW9A 3FRCA 5D73A 5ECSA 3LXTA 3U5RE 1E6BA 1T8EB 4IN0A 5LCZA 2HRAA 2O7KA 2VL3A 2C4JA 4EIPA 4L0UA 2R4VA 1UC7A 3GURA 2LTKA 5CYYA 2MMOA 3OR5A 2HRNA 4XS4A 3D4MA 5CO3A 2MMZA 4MDCA 2L6CA 6GSUA 5ECNB 1O8WA 4WKWA 3KEBA 3LGCA 4HQSA 1E2YA 2BTOT 5CAXA 4TRXA 1AUCA 4WETA 1G6YA 2LRNA 1EP8A 4YQUA 4I8BA 3HY2A 1O81A 1G7EA 3FZ4A 2H1BA 5ID2B 4BVXB 2VL2A 5CP1A 5B6NA 5EL8A 1U3IA 3KP9A 1X9MB 1YKCA 4KW6A 4OFNA 3UMAA 1TJDA 4POLA 2DJ1A 5HR2A 1SKWB 2LV3A 3GH6A 2JZRA 4ML6A 3QAGA 4KH7A 3M3MA 1PD21 4KAEA 1X9WB 1GUKA 4EUYA 1M2AA 4P3YB 2RIIA 4IP1A 1GP1A 3H79A 2PBJA 1Y6EA 2VM1A 2K8SA 4L0WA 4ZILA 3Q18A 1GL8A 1TK0B 1HNCA 2YPMA 2JU5A 4V2NA 4MJEA 4MPGA 2LJRA 4HQZA 4JEDA 1B4QA 2CA8A 4PNGA 5HR3A 1TI1A 4BVYA 1M7TA 3L9UA 3QFAC 2M46A 5ECRB 2WJUA 1AAZA 4K2XA 1NM3A 3VI5A 3J7Yk 3KTBA 2VCQA 5HR0A 3LG6A 3US3A 3WD6A 3WGDA 4O5UA 2GZYA 2B1KA 2AB6A 3Q19A 2RUFA 1N8JA 4GRFA 3GH9A 4NMUA 2DKHA 5GAPD 2X8CA 4JRRA 5G1KA 2GS3A 3TGZA 3TKQA 1I9DA 1K0DA 3UAPA 4TXOA 1O73A 1GSDA 1FOVA 1YF1A 4N11A 3MDKA 1XWKA 1DE1A 2QA2A 2RUEA 3QMXA 6GSTA 3GKNA 4KNDA 4KSMA 8GSSA 2ZUPA 3E3EA 1PX6A 3D21A 2YWMA 3S9FA 2R2JA 2QA1A 2PPTA 1BEDA 2OE3A 4HJMA 1AW9A 3DRNA 4IP6A 2CVDA 1S3CA 3HA9A 1PSQA 1QUWA 5IMCA 1R7HA 4N0VA 5C00A 2B5EA 3C8EA 2GZPA 10GSA 2JL4A 1TW9A 1GUMA 4POMA 1LU4A 3F0IA 4GF0A 4L5OA 1FAAA 4X0XA 5IPHA 1R4WA 5F05A 4I2TA 4Q5NA 2HFDA 1V98A 1J08A 3GKKA 4ECBA 1RK4A 3TJGA 3SBCA 2C3TA 4YKGA 5ELAA 1QGVA 2H30A 1UN2A 1ZMAA 5DBQA 1JFUA 3ZMKA 4FQUA 4DSQA 2ES7A 5IOWA 2H72A 4FH8A 3A5IA 3DYRA 1SK2A 1XWGA 5B8BA 3EVIA 4OCEA 1X5DA 1Z9HA 2V6KA 2I4AA 2B6MA 1QQ2A 3O3TA 3IA1A 2FY6A 2KLXA 5ECIB 2V41A 4TR0A 4D73A 3DXBA 4YH2A 3P8WA 1PKZA 2P31A 1AIUA 1R5AA 2CX3A 2VL9A 3TOTA 2NBSA 4A5PA 2B7KA 4EE0A 3G7JA 2CAQA 4K6XA 2OBKA 1GTAA 4NV5A 12GSA 1AC1A 2IPAA 3FZAA 3HKRA 3IK7A 5EPFA 4FYBA 2DJKA 5AIXA 5ENUA 4YQMA 2DSAA 4F03A 4TKYA 1ERUA 3HDCA 3I9V2 1GULA 2GT5A 2FNOA 4XS1A 1BJXA 3NOFA 3KM6A 3GTUB 3EE2A 3HVXA 1Y25A 3BCKA 3L78A 3GKXA 2H01A 2H19A 4OD7A 5G2ZA 2R5GA 3CSIA 4IBPA 5JCGA 4JE1A 4I6XA 1M0UA 1S3AA 1XWAA 4GSTA 1EV9A 4PTSA 3DD3A 19GSA 4PXOA 3HZ8A 3APQA 5CRWA 2V32A 4WXTA 4RQXA 2O85A 4ECIA 1VF4A 3HJPA 4ZL7A 2L59A 4X1UA 1GWCA 3FZ5A 3UVHA 1PX7A 2PN8A 4O5QA 5COHA 2A2PA 2HZEB 3J7Yb 4Q5QA 5DCHA 1S3DA 4ECCA 1J0FA 3O6TA 3FYGA 1SU9A 4POBA 3I6AA 2XHFA 5A4WA 3TJBA 1SD8A 1U88A 3NZNA 3VWWA 2IL3A 2DLXA 3MAKA 2WZ9A 3GL5A 2NDOA 5CRDA 1J9BA 5JWQB 3W8JA 3ZFLA 3CBUA 4ILFA 2N5FA 5DJMA 2LRCA 2LJAA 1FG4A 1XOAA 4MABA 3IC4A 2HLSA 4ZBBA 2KOKA 3TOUA 2R3XA 2RM5A 2DMLA 4IJ3A 4EKZA 3VWUA 4K1FA 2GSSA 2RM6A 1PA3A 1R26A 3MNGA 1GSYA 1DSBA 5J9BA 1WJKA 2Z9SA 1XW5A 2A4VA 4FIWA 1K3YA 2GVPA 2DMMA 4Z7XA 3EU3A 2N5BA 5IQYA 4GLTA 4GSSA 3GFKA 5IMAA 2FWEA 5ECMB 1ZZYA 1DBYA 1K0AA 2DIYA 3UOMA 2FA8A 1OAZA 4F2IA 1U87A 4EDZA 5KEJA 4J2FA 1U6TA 1V2AA 2GTUA 2HSHA 3WGXA 4CW9A 1BYEA 2WDUA 3WT2A 1T3BA 16GSA 1F3AA 5C04A 1JHBA 2OE0A 3WGEA 2OA7A 1JZOA 2WB9A 3ERGA 4F82A 2PWJA 1Z6MA 1TK5B 1TU8A 1TI3A 2C80A 3UIWA 1A2JA 3MWHA 4IHUA 1B9XC 1F2EA 2I1UA 1V57A 3TKSA 3W6GA 5HFIA 3TRPA 2LQQA 1QFNA 4YKFA 2LQOA 4ZL9A 1H4OA 2B5YA 2REMA 1Q98A 1YKAA 2VD0A 3CSJA 3H8QA 1ZGNA 2H0IA 3GHAA 5CRGA 4WR4A 5LNKe 4PUFC 2CAIA 1G0TA 2FWFA 1ZOFA 4OO4A 1GNWA 3EWLA 3IRAA 3ZVJA 1G6WA 1USBA 3GMFA 1TK8B 2X8HA 3PPUA 2X4AA 2OJLA 5DAKB 1HQOA 2LRTA 3RHBA 1EEMA 2MBTA 5GSSA 3VWVA 4HI7A 3D6IA 3TJKA 2ON5A 2YN1A 3G7IA 5ID2A 4BVXA 3KZQA 2FUG2 2X99A 4KGIA 1PGTA 2LKUA 1YDKA 2GSQA 5F8BA 1Z7RA 1V58A 5FHIA 3IHQA 1GRXA 2HI7A 1T1VA 4I97A 1B9YC 4V1Ag 1Q4JA 2H1DA 2FWGA 1WPIA 5H5SA 1FVJA 3CXGA 1MTCA 2C0GA 3EPTA 4HS1A 4Q5FA 3MIXA 4K8MA 2D2ZA 1X5EA 5ECLB 5CRHA 2VD1A 3BOAA 3FR3A 2EC4A 4CDOA 4AJ7A 2TIRA 11GSA 4JR4A 3VFIA 4YQVA 3ZREA 5IIZA 1TP9A 1GSEA 4E8HA 5J9CA 1FB0A 1ON4A 2GDRA 2FWHA 1U3AA 4ID0A 2PGTA 1MEKA 3KMNA 4EL1A 5HFKA 2LSTA 3KGKA 2B1LA 1KBNA 1VGLA 1RW1A 3FK8A 1FHEA 4JU5A 3DGQA 2XPDA 4J57E 3ED3A 2DBCA 1F3BA 2CV4A 4MJBA 3F4TA 1CQHA 2GQMA 2PU9C 2DJ0A 5HR1A 1OVNA 2A4HA 2P5RA 3R3EA 2VAFA 2VIMA 5IO0A 5G5EA 2F51A 3BJ5A 5KOXA 1TRVA 2B7JA 1EZKA 1FOHA 1XOBA 1MD3A 2GQKA 4GCIA 1ERTA 1SYXA 2XC2A 3VURA 2YP6A 3EURA 3WYWA 3RHCA 5DDLA 2HSYA 3FR9A 4FYUA 1EOGA 1YQ1A 4GXZA 4MF7A 5G1LA 1K3LA 1JLWA 3ZMLA 5J41A 4MA9A 2IJYA 3IPZA 3IXRA 4K9ZA 2L4QA 3C7MA 4EVMA 1IYIA 4IJIA 2PVOC 5ECPB 2M80A 3P90A 3MSZA 4AJ6A 1TRUA 1OYJA 1EP7A 4O5RA 3I69A 3KTLA 3VWXA 3GYKA 5J5NA 3QAVA 2GLRA 1F9MA 4PURA 2O8VB 1QK8A 4POKA 3HJOA 4TVEA 4IQ1A 1W4VA 3HVVA 1BX9A 1XXUA 2GSRA 5A5KA 4TR4A 4O7HA 4OMVA 2WS2A 1EWXA 2B3SA 4Z2TA 2YJHA 5AGYA 3FR6A 4DVCA 2QKEA 4MF5A 4G10A 4PUAA 3TB2A 3EMPA 2AAWA 2H6XA 2C1YA 2JZSA 2HYXA 4EC0A 4IQAA 2JZTA 1Z5YE 1Z7PA 2AYTA 2I9HA 1YEPA 2VUPA 5IO2A 4QQ7A 3PINA 2VCZA 1A0FA 2HNLA 5ECHB 2E2MA 1SL2B 3PH9A 3P2AA 3H93A 3CRUA 4KSOA 2YOIA 1GUHA 1ZYEA 3IDVA 5CREA 2QGVA 1SKRB 4XHMA 3L9SA 3MYDA 1I5GA 2DJ2A 4H86A 4LA1A 5G30A 4WR5A 4WBRD 1AXDA 3DVXA 5DQSA 4GTUA 2H76A 5B8AA 2VCTA 2VL2C 4GQFA 4OFMA 2CVBA 2OKAA 3GTUA 1O7UA 1WOUA 4ULXA 2WULA 5ELGA 4FO5A 5J3RA 4K5RA 4HDEA 4BA7A 2DJ3A 3F3RA 4K0NA 1Z6NA 4PQ1A 4Z2UA 3A2XA 3TRQA 4NHWA 2WFCA 1SL0B 1FO5A 3QPMA 3UL3A 2GT6A 1A2MA 13GSA 2ZCTA 3C71A 3BBYA 4PQIA 1GLQA 3CSHA 5FT3A 5F07A 4I5QA 1K0BA 1T4ZA 2CZ3A 3E9JB 3N5OA 4G2EA 4MP4A 1SL1B 4K7OA 2PERA 2HXKA 5L71A 4V1Ap 2HZEA 1WP0A 3ME8A 2WCIA 3L0HA 4EDYA 4LMWA 3NIVA 1O6JA 2YNXA 1R5PA 4USSA 2HRFA 3D22A 4CY8A 3W8SA 4HU7A 3ZVJD 5D96A 1PRXA 2I81A 3VI7A 4TR1A 5DVBA 3LYPA 2GQLA 3ERWA 4X43A 3RAZA 1TOFA 2R37A 3ZITA 2C3QA 4BWSA 3GRXA 2ALBA 3ZL5A 4MH2A 4ZIJA 4IGJA 2MMNA 5A4UA 2YV7A 5D93A 1G7OA 2B5XA 1QMVA 1PKWA 5EY6A 3M1GA 3GN3A 4HZ4A 3LWAA 1HYUA 1OE7A 3D0ZA 4IKHA 4E8EA 3O76A 1TU7A 2CVKA 4JR6A 2FHEA 1NW2A 1XW6A 4PX1A 3ZIVA 2YWNA 5IMZA 2EIOA 2L5OA 1PN0A 3KXOA 1O85A 6GSSA 3KH7A 1JZWA 2IFQB 4MF6A 1T00A 2RLIA 4NXIA 3IBHA 1OE8A 1XZOA 5D9WA 3EINA 5DALB 1K0CA 5ECOB 2LNSA 1TXXA 3QAWA 1DE2A 2JSZA 3A5WA 4Z2RA 3U6VA 5AIVA 4QL7A 3DIEA 1AQXA 3A3TA 3ERFA 4LL4B 3LQ7A 2LNTA 1JLVA 1B8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O89 A;  1KTE A;  3ZRD A;  4ECJ A;  5EVO A;  1VF1 A;  3N9J A;  5IOX A;  2JAC A;  4ZB8 A;  3IE3 A;  2C0F A;  1JZD A;  2MBS A;  3JCM L;  3C1S A;  2NVL A;  14GS A;  2H1G A;  2I3Y A;  1THO A;  1AQV A;  3QFB C;  2AHE A;  2K18 A;  4K7N A;  5DCG A;  1H75 A;  3GUS A;  5LD0 A;  3KCM A;  1URM A;  4V2M A;  3UAR A;  1B48 A;  1HD2 A;  3EYT A;  4ISD A;  2OAD A;  4MK3 A;  5AIS A;  2F8F A;  4RQR A;  3F4R A;  3ZFB A;  2LUS A;  5E4W A;  5DAK A;  1GSQ A;  4NWY A;  22GS A;  2E2G A;  5ECQ B;  3M0F A;  3LOR A;  2L5L A;  2KHP A;  4ZL8 A;  1GTI A;  3ZZX A;  2L6D A;  4HU9 A;  4KCA A;  4PGT A;  4GSN A;  4ZBD A;  1K0O A;  1GTU A;  1OC9 B;  3GSS A;  3LXZ A;  3HCZ A;  2J9H A;  5J4U A;  1OC3 A;  3GIX A;  4TW5 A;  4AGS A;  3BCI A;  4DSS B;  3KIJ A;  3FY7 A;  1GH2 A;  4TN8 A;  2YCD A;  3TUE A;  4WF4 A;  2XPE A;  2MMA A;  3APS A;  5A4V A;  1WE0 A;  2IMF A;  4JZQ A;  3KP8 A;  1T7P B;  4MJC A;  5HFG A;  1XIY A;  1GSU A;  3HVS A;  2MYG A;  3QDN A;  3GA4 A;  1ACV A;  4KDY A;  1LJR A;  4ZB6 A;  5AN1 A;  5D9X A;  1BQ7 A;  2V1M A;  5G31 A;  2PVQ A;  1VRS D;  1SK0 A;  2YWI A;  4MZW A;  4XIH A;  5F06 A;  2AV4 A;  2IMD A;  3UBK A;  3LSZ A;  1SJZ A;  2YJ7 A;  2OBI A;  3FW2 A;  3L4N A;  2AJQ B;  4GWR A;  1ST9 A;  2E7P A;  4KDX A;  2VCX A;  4KDU A;  2K6V A;  1IYH A;  3FZ9 A;  1EV4 A;  1LBK A;  4LMV A;  4PNF A;  4IW9 A;  1AQW A;  3QD9 A;  1O8X A;  4MZC A;  4GQC A;  2H66 A;  2MZC A;  5ECK B;  2NTO A;  2YWO A;  2H8L A;  1SYR A;  3LFL A;  2CQ9 A;  2TRC P;  4K2D A;  2WRT A;  2H6Y A;  2GST A;  2KP1 A;  5HQP A;  3GNJ A;  3UEM A;  5F0G A;  2H74 A;  1XPV A;  2GGT A;  2VCV A;  2H0G A;  4HUA A;  4XS4 B;  2TRX A;  3F4S A;  3EC3 A;  1ZCP A;  3IAM 2;  1Z3E A;  3H1N A;  1GNE A;  2YV9 A;  2M72 A;  1HNA A;  3UVT A;  3LYK A;  2KUC A;  1ABA A;  2QC7 A;  1ZYQ B;  1TDI A;  2H6Z A;  3GV1 A;  3QR6 A;  2F3M A;  4AJ8 A;  4EO3 A;  3Q6O A;  4BWQ A;  4JBB A;  1SKS B;  1W89 A;  3E0U A;  3ME7 A;  5IMF A;  1GTB A;  2VOC A;  1X5C A;  4EXJ A;  1WRY A;  2XBI A;  2QSI A;  1V40 A;  3VPT A;  18GS A;  2C0E A;  2KP2 A;  3TKS C;  4I2U A;  1A24 A;  4WEY A;  2VO4 A;  1TRW A;  4NHZ A;  5KN1 A;  2E0Q A;  5ABR A;  1KNG A;  3FEU A;  7GSS A;  2LJK A;  3AY8 A;  2OAC A;  2ON7 A;  2WGR A;  1ERW A;  2VM2 A;  1ERV A;  4IVF A;  4XCS A;  2DJJ A;  3IOS A;  2LS5 A;  1A23 A;  5H5R A;  1GSS A;  2K8V A;  4G9H A;  1K3O A;  1M99 A;  1QXH A;  3RBT A;  2IIY A;  3DVW A;  3EMX A;  1XBS A;  5KN3 A;  4NPB A;  3FHK A;  4BPY A;  2IMI A;  3CYN A;  2P0G A;  4LLR A;  17GS A;  1GLP A;  2VLV A;  1A0R P;  3ZLP A;  1K0N A;  2PMT A;  4ZBA A;  3VPQ A;  5KN0 A;  1M2B A;  2O87 A;  2YZH A;  2G2Q A;  2NPB A;  4TXO B;  4QL9 A;  4TR3 A;  1PQN A;  4XRA A;  1PL1 A;  1N2A A;  5CNW A;  3F6F A;  2IN3 A;  4HJ2 A;  1B4P A;  5INY A;  1XVW A;  1SJI A;  3D5J A;  4RI7 A;  3CTG A;  5D9V A;  4NV2 A;  3F3Q A;  3HD5 A;  3HHV A;  3IV4 A;  4ZXG A;  3APO A;  3G9B A;  3M9K A;  3P7X A;  1PL2 A;  2R6K A;  3F8U A;  4MJA A;  5H5Q A;  1OKT A;  3HYP A;  5IPG A;  2EIR A;  3TRX A;  3WT1 A;  4YAV A;  3HZ4 A;  3ZTL A;  1WWJ A;  4OWY A;  2VLT A;  4MZB A;  4ZB9 A;  3D4T A;  3HXS A;  1OKD A;  5GST A;  2CT6 A;  2H75 A;  3GKM A;  1X9S B;  3TJJ A;  1NHO A;  3DWV A;  4G19 A;  3DKS A;  1VF2 A;  4KA0 A;  4YAP A;  1ML6 A;  2HT9 A;  2P5Q A;  4MCU A;  6GSY A;  2IME A;  5B6M A;  1UA5 A;  3FKF A;  4MLY A;  1KEB A;  1JZR A;  3L9V A;  5E59 A;  2C3N A;  4TOP A;  1THX A;  2K9F A;  2CX4 A;  2PUK C;  5JCU A;  3IK9 A;  4AF2 A;  2H1A A;  3CTF A;  5IMV A;  5D9T A;  1NSW A;  4DEJ A;  1WMJ A;  5DJL A;  3TDG A;  1A8Y A;  1M9A A;  2H73 A;  2JAD A;  4V2L A;  3TJF A;  4KB3 A;  1YF0 A;  4TXV A;  1TKD B;  2DC5 A;  3A2W A;  4D73 B;  1FB6 A;  1FW1 A;  1WIK A;  4HZ2 A;  4F0B A;  4FYC A;  5IM9 A;  1XWC A;  1SEN A;  1PMT A;  2X64 A;  5GAN D;  1MDJ A;  3UJ1 A;  2J23 A;  2V6O A;  4KX4 A;  2IFQ A;  1BG5 A;  3GX8 A;  1PN9 A;  4WF5 A;  4F0C A;  1MDK A;  1VF3 A;  3ZIJ A;  3A2V A;  3M8N A;  4KUN A;  5DAL A;  1BAY A;  4ACS A;  1EOH A;  4N30 A;  2F9S A;  4IS0 A;  1F37 A;  4CHS A;  2FLS A;  2FD3 A;  2YAN A;  2F8A A;  1XWB A;  3QOU A;  3HJM A;  2L57 A;  3BD2 A;  3VLN A;  2CZ2 A;  4L5L A;  1V9W A;  5FWG A;  5DQY A;  1GSF A;  2OE1 A;  3K8N A;  4Q5R A;  4J56 E;  4MMM A;  2VCW A;  4F9Z A;  3DEX A;  1YZX A;  1CQG A;  1MD4 A;  3EU4 A;  4RI6 A;  3I43 A;  1UVZ A;  1C72 A;  3GX0 A;  2DIZ A;  5IMD A;  2C8U A;  2H0H A;  3H4K A;  4TR1 B;  5JWO B;  4XS6 A;  1A8L A;  1T4Y A;  3IR4 A;  4OO5 A;  2XBQ A;  3F63 A;  4MH3 A;  5GZZ B;  3DML A;  3R2Q A;  3KJY A;  3TKP A;  4IEL A;  1X0R A;  2IMK A;  20GS A;  4RUV A;  2HE3 A;  2FGX A;  2BJX A;  2L4C A;  1SJ6 A;  5JWR B;  4L8E A;  1NHY A;  4N0Z A;  3TKS E;  1OC8 A;  4O32 A;  2HZF A;  4XRD A;  2GZZ A;  3KMO A;  1YJ6 A;  1ZL9 A;  4XTS A;  3SWL A;  1XFL A;  3QCP A;  1OC9 A;  2AUV A;  1EEJ A;  2JSY A;  3F9U A;  3LJR A;  5G5F A;  3CMI A;  1M2D A;  4EF0 A;  2A2S A;  3ISO A;  4PQH A;  2LEG A;  4DSS A;  2H70 A;  2C0D A;  3RPN A;  2BMX A;  3RDW A;  4MPF A;  1ILO A;  4WBJ A;  1TRS A;  3PGT A;  1XVQ A;  4O92 A;  3RPP A;  3Q74 A;  1HNB A;  1EGR A;  3V1W A;  6GSX A;  6GSV A;  5KN2 A;  4K0G A;  6GSW A;  1SK1 A;  3GST A;  3GL3 A;  2FA4 A;  4HEA 2;  1YY7 A;  5B7C A;  2A2R A;  1FVK A;  1DUG A;  3UBL A;  3IAS 2;  4N10 A;  1TTZ A;  2EIQ A;  2VLU A;  2G0F A;  3KD0 A;  4DSR A;  4K7I A;  1F6M C;  3M9J A;  2YZU A;  2ZNM A;  3F6D A;  1A2L A;  3CRT A;  1RQM A;  1K0M A;  1YEX A;  5JCW A;  1XCC A;  1M9B A;  4NAX A;  9GSS A;  3C73 A;  2FCH A;  4ML1 A;  4HOJ A;  4KE3 A;  1EGO A;  2N5A A;  2X8G A;  3LEF A;  2V2G A;  4BL7 A;  3G7Y A;  3TKR A;  1MDI A;  3ZYW A;  4OFT A;  4OCF A;  4LL1 B;  3VK9 A;  2IWT A;  5D8I A;  3TCO A;  4KCE A;  1SD9 A;  3KH9 A;  2H71 A;  3C1R A;  3PR8 A;  1XW9 A;  3FRC A;  5D73 A;  5ECS A;  3LXT A;  3U5R E;  1E6B A;  1T8E B;  4IN0 A;  5LCZ A;  2O7K A;  2VL3 A;  2C4J A;  4L0U A;  2R4V A;  1UC7 A;  3GUR A;  2LTK A;  5CYY A;  2MMO A;  3OR5 A;  2HRN A;  4XS4 A;  3D4M A;  5CO3 A;  2MMZ A;  4MDC A;  2L6C A;  6GSU A;  5ECN B;  1O8W A;  4WKW A;  3KEB A;  3LGC A;  4HQS A;  1E2Y A;  2BTO T;  5CAX A;  4TRX A;  1AUC A;  4WET A;  1G6Y A;  2LRN A;  1EP8 A;  4YQU A;  4I8B A;  3HY2 A;  1O81 A;  1G7E A;  3FZ4 A;  2H1B A;  5ID2 B;  2VL2 A;  5CP1 A;  5B6N A;  5EL8 A;  1U3I A;  3KP9 A;  1X9M B;  1YKC A;  4KW6 A;  4OFN A;  3UMA A;  1TJD A;  4POL A;  2DJ1 A;  5HR2 A;  1SKW B;  2LV3 A;  3GH6 A;  2JZR A;  4ML6 A;  3QAG A;  4KH7 A;  3M3M A;  1PD2 1;  4KAE A;  1X9W B;  1GUK A;  4EUY A;  1M2A A;  4P3Y B;  2RII A;  4IP1 A;  1GP1 A;  3H79 A;  2PBJ A;  1Y6E A;  2VM1 A;  2K8S A;  4L0W A;  4ZIL A;  3Q18 A;  1GL8 A;  1TK0 B;  1HNC A;  2YPM A;  2JU5 A;  4V2N A;  4MJE A;  4MPG A;  2LJR A;  4HQZ A;  4JED A;  1B4Q A;  2CA8 A;  4PNG A;  5HR3 A;  1TI1 A;  4BVY A;  1M7T A;  3L9U A;  3QFA C;  2M46 A;  5ECR B;  2WJU A;  1AAZ A;  1NM3 A;  3VI5 A;  3J7Y k;  3KTB A;  2VCQ A;  5HR0 A;  3LG6 A;  3US3 A;  3WD6 A;  3WGD A;  2GZY A;  2B1K A;  2AB6 A;  3Q19 A;  2RUF A;  1N8J A;  4GRF A;  3GH9 A;  4NMU A;  5GAP D;  2X8C A;  4JRR A;  5G1K A;  2GS3 A;  3TGZ A;  3TKQ A;  1I9D A;  1K0D A;  3UAP A;  4TXO A;  1O73 A;  1GSD A;  1FOV A;  1YF1 A;  4N11 A;  3MDK A;  1XWK A;  1DE1 A;  2RUE A;  3QMX A;  6GST A;  3GKN A;  4KND A;  4KSM A;  8GSS A;  2ZUP A;  3E3E A;  1PX6 A;  3D21 A;  2YWM A;  3S9F A;  2R2J A;  2PPT A;  1BED A;  2OE3 A;  4HJM A;  1AW9 A;  3DRN A;  4IP6 A;  2CVD A;  1S3C A;  3HA9 A;  1PSQ A;  1QUW A;  5IMC A;  1R7H A;  4N0V A;  5C00 A;  2B5E A;  3C8E A;  2GZP A;  10GS A;  2JL4 A;  1TW9 A;  1GUM A;  4POM A;  1LU4 A;  3F0I A;  4GF0 A;  4L5O A;  1FAA A;  4X0X A;  5IPH A;  1R4W A;  5F05 A;  4I2T A;  4Q5N A;  2HFD A;  1V98 A;  1J08 A;  3GKK A;  4ECB A;  1RK4 A;  3TJG A;  3SBC A;  2C3T A;  5ELA A;  1QGV A;  2H30 A;  1UN2 A;  1ZMA A;  5DBQ A;  1JFU A;  3ZMK A;  4DSQ A;  2ES7 A;  5IOW A;  2H72 A;  4FH8 A;  3DYR A;  5B8B A;  1SK2 A;  1XWG A;  3EVI A;  4OCE A;  1X5D A;  1Z9H A;  2V6K A;  2I4A A;  2B6M A;  1QQ2 A;  3O3T A;  3IA1 A;  2FY6 A;  2KLX A;  5ECI B;  2V41 A;  4TR0 A;  4D73 A;  3DXB A;  4YH2 A;  3P8W A;  1PKZ A;  2P31 A;  1AIU A;  1R5A A;  2CX3 A;  2VL9 A;  3TOT A;  2NBS A;  2B7K A;  4EE0 A;  3G7J A;  2CAQ A;  4K6X A;  2OBK A;  1GTA A;  4NV5 A;  12GS A;  1AC1 A;  2IPA A;  3FZA A;  3HKR A;  3IK7 A;  5EPF A;  4FYB A;  2DJK A;  5AIX A;  5ENU A;  4YQM A;  2DSA A;  4F03 A;  4TKY A;  1ERU A;  3HDC A;  3I9V 2;  1GUL A;  2GT5 A;  2FNO A;  4XS1 A;  1BJX A;  3NOF A;  3KM6 A;  3GTU B;  3EE2 A;  3HVX A;  1Y25 A;  3BCK A;  3L78 A;  3GKX A;  2H01 A;  2H19 A;  4OD7 A;  5G2Z A;  2R5G A;  3CSI A;  4IBP A;  5JCG A;  4JE1 A;  4I6X A;  1M0U A;  1S3A A;  1XWA A;  4GST A;  1EV9 A;  3DD3 A;  19GS A;  4PXO A;  3HZ8 A;  3APQ A;  5CRW A;  2V32 A;  4WXT A;  4RQX A;  2O85 A;  4ECI A;  1VF4 A;  3HJP A;  4ZL7 A;  2L59 A;  4X1U A;  1GWC A;  3FZ5 A;  3UVH A;  1PX7 A;  2PN8 A;  5COH A;  2HZE B;  3J7Y b;  4Q5Q A;  5DCH A;  1S3D A;  4ECC A;  1J0F A;  3O6T A;  3FYG A;  1SU9 A;  4POB A;  3I6A A;  2XHF A;  5A4W A;  3TJB A;  1SD8 A;  1U88 A;  3NZN A;  3VWW A;  2IL3 A;  2DLX A;  3MAK A;  2WZ9 A;  3GL5 A;  2NDO A;  5CRD A;  1J9B A;  5JWQ B;  3W8J A;  3ZFL A;  3CBU A;  4ILF A;  2N5F A;  5DJM A;  2LRC A;  2LJA A;  1FG4 A;  1XOA A;  4MAB A;  3IC4 A;  2HLS A;  4ZBB A;  2KOK A;  3TOU A;  2R3X A;  2RM5 A;  2DML A;  4IJ3 A;  4EKZ A;  3VWU A;  4K1F A;  2GSS A;  2RM6 A;  1PA3 A;  1R26 A;  3MNG A;  1GSY A;  1DSB A;  5J9B A;  1WJK A;  2Z9S A;  1XW5 A;  2A4V A;  4FIW A;  1K3Y A;  2GVP A;  2DMM A;  4Z7X A;  3EU3 A;  2N5B A;  5IQY A;  4GLT A;  4GSS A;  3GFK A;  5IMA A;  2FWE A;  5ECM B;  1ZZY A;  1DBY A;  1K0A A;  2DIY A;  3UOM A;  2FA8 A;  1OAZ A;  4F2I A;  1U87 A;  4EDZ A;  5KEJ A;  4J2F A;  1U6T A;  1V2A A;  2GTU A;  2HSH A;  3WGX A;  4CW9 A;  1BYE A;  2WDU A;  3WT2 A;  1T3B A;  16GS A;  1F3A A;  5C04 A;  1JHB A;  2OE0 A;  3WGE A;  2OA7 A;  1JZO A;  2WB9 A;  3ERG A;  4F82 A;  2PWJ A;  1Z6M A;  1TK5 B;  1TU8 A;  1TI3 A;  2C80 A;  3UIW A;  1A2J A;  3MWH A;  4IHU A;  1B9X C;  1F2E A;  2I1U A;  1V57 A;  3TKS A;  3W6G A;  5HFI A;  3TRP A;  2LQQ A;  1QFN A;  2LQO A;  4ZL9 A;  1H4O A;  2B5Y A;  2REM A;  1Q98 A;  1YKA A;  2VD0 A;  3CSJ A;  3H8Q A;  1ZGN A;  2H0I A;  3GHA A;  5CRG A;  4WR4 A;  5LNK e;  4PUF C;  2CAI A;  1G0T A;  2FWF A;  1ZOF A;  4OO4 A;  1GNW A;  3EWL A;  3IRA A;  3ZVJ A;  1G6W A;  1USB A;  3GMF A;  1TK8 B;  2X8H A;  2OJL A;  5DAK B;  1HQO A;  2LRT A;  3RHB A;  1EEM A;  2MBT A;  5GSS A;  3VWV A;  4HI7 A;  3D6I A;  3TJK A;  2ON5 A;  2YN1 A;  3G7I A;  5ID2 A;  4BVX A;  3KZQ A;  2FUG 2;  2X99 A;  4KGI A;  1PGT A;  2LKU A;  1YDK A;  2GSQ A;  5F8B A;  1Z7R A;  1V58 A;  5FHI A;  3IHQ A;  1GRX A;  2HI7 A;  1T1V A;  4I97 A;  1B9Y C;  4V1A g;  1Q4J A;  2H1D A;  2FWG A;  1WPI A;  5H5S A;  1FVJ A;  3CXG A;  1MTC A;  2C0G A;  4HS1 A;  4Q5F A;  4K8M A;  2D2Z A;  1X5E A;  5ECL B;  5CRH A;  2VD1 A;  3BOA A;  3FR3 A;  2EC4 A;  4CDO A;  4AJ7 A;  2TIR A;  11GS A;  4JR4 A;  3VFI A;  4YQV A;  3ZRE A;  5IIZ A;  1TP9 A;  1GSE A;  4E8H A;  5J9C A;  1FB0 A;  1ON4 A;  2GDR A;  2FWH A;  1U3A A;  4ID0 A;  2PGT A;  1MEK A;  3KMN A;  4EL1 A;  5HFK A;  2LST A;  3KGK A;  2B1L A;  1KBN A;  1VGL A;  1RW1 A;  3FK8 A;  1FHE A;  4JU5 A;  3DGQ A;  2XPD A;  4J57 E;  3ED3 A;  2DBC A;  1F3B A;  2CV4 A;  4MJB A;  3F4T A;  1CQH A;  2GQM A;  2PU9 C;  2DJ0 A;  5HR1 A;  1OVN A;  2P5R A;  2VAF A;  2VIM A;  5IO0 A;  5G5E A;  2F51 A;  3BJ5 A;  1TRV A;  2B7J A;  1EZK A;  1XOB A;  1MD3 A;  2GQK A;  4GCI A;  1ERT A;  1SYX A;  2XC2 A;  3VUR A;  2YP6 A;  3EUR A;  3WYW A;  3RHC A;  5DDL A;  2HSY A;  3FR9 A;  4FYU A;  1EOG A;  1YQ1 A;  4GXZ A;  4MF7 A;  5G1L A;  1K3L A;  1JLW A;  3ZML A;  5J41 A;  4MA9 A;  2IJY A;  3IPZ A;  3IXR A;  4K9Z A;  2L4Q A;  3C7M A;  4EVM A;  1IYI A;  4IJI A;  2PVO C;  5ECP B;  2M80 A;  3P90 A;  3MSZ A;  4AJ6 A;  1TRU A;  1OYJ A;  1EP7 A;  4O5R A;  3I69 A;  3KTL A;  3VWX A;  3GYK A;  5J5N A;  3QAV A;  2GLR A;  1F9M A;  4PUR A;  2O8V B;  1QK8 A;  4POK A;  3HJO A;  4TVE A;  4IQ1 A;  1W4V A;  3HVV A;  1BX9 A;  1XXU A;  2GSR A;  5A5K A;  4TR4 A;  4O7H A;  4OMV A;  2WS2 A;  1EWX A;  2B3S A;  2YJH A;  5AGY A;  3FR6 A;  4DVC A;  2QKE A;  4MF5 A;  4G10 A;  4PUA A;  3TB2 A;  3EMP A;  2AAW A;  2H6X A;  2C1Y A;  2JZS A;  2HYX A;  4EC0 A;  4IQA A;  2JZT A;  1Z5Y E;  1Z7P A;  2AYT A;  2I9H A;  1YEP A;  2VUP A;  5IO2 A;  4QQ7 A;  3PIN A;  2VCZ A;  1A0F A;  2HNL A;  5ECH B;  2E2M A;  1SL2 B;  3PH9 A;  3P2A A;  3H93 A;  3CRU A;  4KSO A;  2YOI A;  1GUH A;  1ZYE A;  3IDV A;  5CRE A;  2QGV A;  1SKR B;  4XHM A;  3L9S A;  1I5G A;  2DJ2 A;  4H86 A;  4LA1 A;  5G30 A;  4WR5 A;  4WBR D;  1AXD A;  3DVX A;  5DQS A;  4GTU A;  2H76 A;  5B8A A;  2VCT A;  2VL2 C;  4GQF A;  4OFM A;  2CVB A;  2OKA A;  3GTU A;  1O7U A;  1WOU A;  4ULX A;  2WUL A;  5ELG A;  4FO5 A;  5J3R A;  4HDE A;  4BA7 A;  2DJ3 A;  3F3R A;  4K0N A;  1Z6N A;  4PQ1 A;  3A2X A;  3TRQ A;  4NHW A;  2WFC A;  1SL0 B;  1FO5 A;  3QPM A;  3UL3 A;  2GT6 A;  1A2M A;  13GS A;  2ZCT A;  3C71 A;  3BBY A;  4PQI A;  1GLQ A;  3CSH A;  5FT3 A;  5F07 A;  4I5Q A;  1K0B A;  1T4Z A;  2CZ3 A;  3E9J B;  3N5O A;  4G2E A;  4MP4 A;  1SL1 B;  4K7O A;  2PER A;  2HXK A;  5L71 A;  4V1A p;  2HZE A;  1WP0 A;  3ME8 A;  2WCI A;  3L0H A;  4EDY A;  4LMW A;  3NIV A;  1O6J A;  2YNX A;  1R5P A;  2HRF A;  3D22 A;  3W8S A;  4HU7 A;  3ZVJ D;  5D96 A;  1PRX A;  2I81 A;  3VI7 A;  4TR1 A;  5DVB A;  3LYP A;  2GQL A;  3ERW A;  4X43 A;  3RAZ A;  1TOF A;  2R37 A;  3ZIT A;  2C3Q A;  4BWS A;  3GRX A;  2ALB A;  3ZL5 A;  4MH2 A;  4ZIJ A;  4IGJ A;  2MMN A;  5A4U A;  2YV7 A;  5D93 A;  1G7O A;  2B5X A;  1QMV A;  1PKW A;  5EY6 A;  3M1G A;  3GN3 A;  4HZ4 A;  3LWA A;  1HYU A;  1OE7 A;  3D0Z A;  4IKH A;  4E8E A;  3O76 A;  1TU7 A;  2CVK A;  4JR6 A;  2FHE A;  1NW2 A;  1XW6 A;  4PX1 A;  3ZIV A;  2YWN A;  5IMZ A;  2EIO A;  2L5O A;  3KXO A;  1O85 A;  6GSS A;  3KH7 A;  1JZW A;  2IFQ B;  4MF6 A;  1T00 A;  2RLI A;  4NXI A;  3IBH A;  1OE8 A;  1XZO A;  5D9W A;  3EIN A;  5DAL B;  1K0C A;  5ECO B;  2LNS A;  1TXX A;  3QAW A;  1DE2 A;  2JSZ A;  3A5W A;  3U6V A;  5AIV A;  4QL7 A;  3DIE A;  1AQX A;  3A3T A;  3ERF A;  4LL4 B;  3LQ7 A;  2LNT A;  1JLV A;  1B8X A; 
#chains in the Genus database with same CATH topology
 2O89 A;  1ZYN A;  1KTE A;  3ZRD A;  4ECJ A;  5EVO A;  1VF1 A;  3N9J A;  5IOX A;  2JAC A;  4ZB8 A;  3IE3 A;  2C0F A;  1JZD A;  2MBS A;  3JCM L;  3C1S A;  2NVL A;  14GS A;  2H1G A;  2I3Y A;  1THO A;  1AQV A;  3QFB C;  2AHE A;  1ZYP A;  2K18 A;  4K7N A;  5DCG A;  1H75 A;  3GUS A;  5LD0 A;  3KCM A;  1URM A;  4V2M A;  3UAR A;  1B48 A;  1HD2 A;  3EYT A;  4ISD A;  2OAD A;  4MK3 A;  5AIS A;  2F8F A;  4RQR A;  5BRT A;  3F4R A;  3ZFB A;  2LUS A;  5E4W A;  5DAK A;  1GSQ A;  4NWY A;  22GS A;  2E2G A;  5ECQ B;  3M0F A;  3LOR A;  2L5L A;  2KHP A;  4ZL8 A;  1GTI A;  3ZZX A;  2L6D A;  4HU9 A;  4KCA A;  4PGT A;  4GSN A;  4ZBD A;  1K0O A;  1GTU A;  1OC9 B;  3GSS A;  3LXZ A;  3HCZ A;  3LW9 A;  2J9H A;  5J4U A;  1OC3 A;  3GIX A;  4TW5 A;  4AGS A;  3BCI A;  4DSS B;  3KIJ A;  3FY7 A;  1GH2 A;  4TN8 A;  2YCD A;  3TUE A;  4WF4 A;  2XPE A;  2MMA A;  3APS A;  5A4V A;  1WE0 A;  2IMF A;  4JZQ A;  3KP8 A;  1T7P B;  4MJC A;  5HFG A;  1XIY A;  1GSU A;  3HVS A;  2MYG A;  3QDN A;  3GA4 A;  1ACV A;  2HRK A;  4KDY A;  1LJR A;  4ZB6 A;  5AN1 A;  5D9X A;  1BQ7 A;  2V1M A;  5G31 A;  2PVQ A;  1VRS D;  1SK0 A;  2YWI A;  4G0L A;  4MZW A;  4XIH A;  5F06 A;  2AV4 A;  2IMD A;  3UBK A;  3LSZ A;  1SJZ A;  2YJ7 A;  2OBI A;  3FW2 A;  3L4N A;  2AJQ B;  4GWR A;  1ST9 A;  2E7P A;  4KDX A;  2VCX A;  4KDU A;  2K6V A;  1IYH A;  3IHG A;  4BL7 B;  3FZ9 A;  1EV4 A;  1LBK A;  4LMV A;  4PNF A;  4IW9 A;  1AQW A;  3QD9 A;  1O8X A;  4MZC A;  4GQC A;  2H66 A;  2MZC A;  5ECK B;  2NTO A;  2YWO A;  2H8L A;  1SYR A;  3LFL A;  2CQ9 A;  2TRC P;  4K2D A;  2WRT A;  2H6Y A;  2GST A;  2KP1 A;  5HQP A;  3GNJ A;  3UEM A;  5F0G A;  2H74 A;  1XPV A;  2GGT A;  2VCV A;  2H0G A;  4HUA A;  4XS4 B;  2TRX A;  3F4S A;  3EC3 A;  1ZCP A;  3IAM 2;  1Z3E A;  3H1N A;  1GNE A;  2YV9 A;  2M72 A;  1HNA A;  3UVT A;  3LYK A;  2KUC A;  1ABA A;  2QC7 A;  1ZYQ B;  1TDI A;  2H6Z A;  2DKI A;  3GV1 A;  2HSM A;  3QR6 A;  2F3M A;  4AJ8 A;  4EO3 A;  3Q6O A;  4BWQ A;  4JBB A;  1SKS B;  1W89 A;  3E0U A;  3ME7 A;  5IMF A;  1GTB A;  5KOW A;  2VOC A;  1X5C A;  4EXJ A;  1WRY A;  2XBI A;  2QSI A;  1V40 A;  3VPT A;  18GS A;  2C0E A;  2KP2 A;  3TKS C;  4I2U A;  1A24 A;  4WEY A;  2VO4 A;  1TRW A;  4NHZ A;  5KN1 A;  2E0Q A;  5ABR A;  1KNG A;  3FEU A;  7GSS A;  2LJK A;  3AY8 A;  2OAC A;  2ON7 A;  2WGR A;  1ERW A;  4ICY A;  2VM2 A;  4BVY B;  1ERV A;  4IVF A;  4XCS A;  2DJJ A;  3IOS A;  2LS5 A;  2UZ8 A;  1A23 A;  5H5R A;  1GSS A;  2K8V A;  4G9H A;  1K3O A;  1M99 A;  1QXH A;  3RBT A;  2IIY A;  3DVW A;  3EMX A;  1XBS A;  5KN3 A;  1PFO A;  4NPB A;  4EIQ A;  3FHK A;  4BPY A;  2IMI A;  4G0K A;  3CYN A;  2P0G A;  4LLR A;  17GS A;  1GLP A;  2VLV A;  1A0R P;  2R0G A;  3ZLP A;  1K0N A;  2PMT A;  4ZBA A;  3VPQ A;  5KN0 A;  1M2B A;  2O87 A;  2YZH A;  2G2Q A;  2NPB A;  4TXO B;  4QL9 A;  4TR3 A;  1PQN A;  4XRA A;  1PL1 A;  1N2A A;  5CNW A;  3F6F A;  2IN3 A;  4HJ2 A;  1B4P A;  5INY A;  1XVW A;  1SJI A;  3D5J A;  4RI7 A;  3CTG A;  5D9V A;  4NV2 A;  3F3Q A;  3HD5 A;  3HHV A;  3IV4 A;  4ZXG A;  3APO A;  3G9B A;  3M9K A;  3P7X A;  1PL2 A;  2R6K A;  3F8U A;  4MJA A;  5H5Q A;  1OKT A;  3HYP A;  5IPG A;  2EIR A;  3TRX A;  3WT1 A;  4YAV A;  3HZ4 A;  3ZTL A;  1WWJ A;  4K5S A;  4OWY A;  2VLT A;  4MZB A;  4ZB9 A;  3D4T A;  3HXS A;  1OKD A;  5GST A;  2CT6 A;  2H75 A;  3GKM A;  1X9S B;  3TJJ A;  1NHO A;  3DWV A;  4G19 A;  3DKS A;  1VF2 A;  4KA0 A;  4YAP A;  1ML6 A;  2HT9 A;  2P5Q A;  4MCU A;  6GSY A;  2IME A;  5B6M A;  1UA5 A;  3FKF A;  4MLY A;  1KEB A;  1JZR A;  3L9V A;  5E59 A;  2C3N A;  4TOP A;  1THX A;  2K9F A;  2CX4 A;  2PUK C;  5JCU A;  3IK9 A;  4AF2 A;  2H1A A;  3CTF A;  5IMV A;  5D9T A;  1NSW A;  4DEJ A;  1WMJ A;  5DJL A;  3TDG A;  1A8Y A;  1M9A A;  2H73 A;  2JAD A;  4V2L A;  3TJF A;  4KB3 A;  1YF0 A;  4TXV A;  1TKD B;  2DC5 A;  3A2W A;  4D73 B;  1FB6 A;  1FW1 A;  1WIK A;  4HZ2 A;  4F0B A;  4FYC A;  5IM9 A;  2R0C A;  1XWC A;  1SEN A;  1PMT A;  2X64 A;  5GAN D;  1MDJ A;  3UJ1 A;  2J23 A;  2V6O A;  4KX4 A;  2IFQ A;  1BG5 A;  3GX8 A;  1PN9 A;  4WF5 A;  4F0C A;  1MDK A;  1VF3 A;  3ZIJ A;  3A2V A;  3M8N A;  4KUN A;  5DAL A;  1BAY A;  4ACS A;  1EOH A;  4N30 A;  2F9S A;  4IS0 A;  1F37 A;  4CHS A;  2FLS A;  2FD3 A;  2YAN A;  2F8A A;  1XWB A;  3QOU A;  3HJM A;  2L57 A;  3BD2 A;  3VLN A;  4MNN A;  2CZ2 A;  4L5L A;  1V9W A;  5FWG A;  5DQY A;  1GSF A;  2OE1 A;  3K8N A;  4Q5R A;  4J56 E;  4MMM A;  2VCW A;  4F9Z A;  3DEX A;  1YZX A;  1CQG A;  1MD4 A;  3EU4 A;  4RI6 A;  3I43 A;  1UVZ A;  1C72 A;  3GX0 A;  2DIZ A;  5IMD A;  2C8U A;  2H0H A;  3H4K A;  4TR1 B;  5JWO B;  4XS6 A;  1A8L A;  1T4Y A;  3IR4 A;  4OO5 A;  2XBQ A;  3F63 A;  4MH3 A;  5GZZ B;  3DML A;  5BMU A;  3R2Q A;  3KJY A;  3TKP A;  4IEL A;  1X0R A;  2IMK A;  3FMW A;  20GS A;  4RUV A;  2HE3 A;  2FGX A;  2BJX A;  2L4C A;  1SJ6 A;  5JWR B;  4L8E A;  1NHY A;  4N0Z A;  3TKS E;  1OC8 A;  4O32 A;  2HZF A;  4XRD A;  2GZZ A;  3KMO A;  2R0P A;  1YJ6 A;  1ZL9 A;  4XTS A;  3SWL A;  1XFL A;  3QCP A;  1OC9 A;  2AUV A;  1EEJ A;  2JSY A;  3F9U A;  2X49 A;  3LJR A;  5G5F A;  3CMI A;  1M2D A;  4EF0 A;  2A2S A;  3CQF A;  3ISO A;  4PQH A;  2LEG A;  3HVN A;  4DSS A;  2H70 A;  2C0D A;  3RPN A;  2BMX A;  3RDW A;  4MPF A;  1ILO A;  4WBJ A;  1TRS A;  3PGT A;  1XVQ A;  4O92 A;  3RPP A;  3Q74 A;  1HNB A;  1EGR A;  3V1W A;  6GSX A;  6GSV A;  5KN2 A;  4K0G A;  6GSW A;  1SK1 A;  3GST A;  3GL3 A;  2FA4 A;  4HEA 2;  1YY7 A;  5B7C A;  2A2R A;  1FVK A;  1DUG A;  3UBL A;  3IAS 2;  4N10 A;  1TTZ A;  2EIQ A;  2VLU A;  2G0F A;  3KD0 A;  4DSR A;  4K7I A;  1F6M C;  3M9J A;  2YZU A;  2ZNM A;  3F6D A;  1A2L A;  3CRT A;  1RQM A;  1K0M A;  4G0I A;  1YEX A;  5JCW A;  1XCC A;  1M9B A;  4NAX A;  9GSS A;  3C73 A;  2FCH A;  4ML1 A;  4HOJ A;  4KE3 A;  1EGO A;  3IC8 A;  4X4J A;  2N5A A;  2X8G A;  3LEF A;  4CY6 A;  2V2G A;  4BL7 A;  3G7Y A;  3TKR A;  1MDI A;  3ZYW A;  4OFT A;  4KF9 A;  4OCF A;  4LL1 B;  3VK9 A;  2IWT A;  5D8I A;  3TCO A;  4KCE A;  1SD9 A;  3KH9 A;  2H71 A;  3C1R A;  3PR8 A;  1XW9 A;  3FRC A;  1M3J A;  5D73 A;  5ECS A;  3LXT A;  3U5R E;  1E6B A;  1T8E B;  4IN0 A;  5LCZ A;  2HRA A;  2O7K A;  2VL3 A;  2C4J A;  4EIP A;  4L0U A;  2R4V A;  1UC7 A;  3GUR A;  2LTK A;  5CYY A;  2MMO A;  3OR5 A;  2HRN A;  4XS4 A;  3D4M A;  5CO3 A;  2MMZ A;  4MDC A;  2L6C A;  6GSU A;  5ECN B;  1O8W A;  4WKW A;  3KEB A;  3LGC A;  4HQS A;  1E2Y A;  2BTO T;  5CAX A;  4TRX A;  1AUC A;  4WET A;  1G6Y A;  2LRN A;  1EP8 A;  4YQU A;  4I8B A;  3HY2 A;  1O81 A;  1G7E A;  3FZ4 A;  2H1B A;  5ID2 B;  4BVX B;  2VL2 A;  5CP1 A;  5B6N A;  4HSC X;  1U3I A;  5EL8 A;  3KP9 A;  1X9M B;  1YKC A;  4KW6 A;  4OFN A;  3UMA A;  1TJD A;  4POL A;  2DJ1 A;  5HR2 A;  1SKW B;  2LV3 A;  3GH6 A;  2JZR A;  4ML6 A;  3QAG A;  4KH7 A;  3M3M A;  1PD2 1;  4KAE A;  1X9W B;  1GUK A;  4EUY A;  1M2A A;  4P3Y B;  2RII A;  4IP1 A;  1GP1 A;  3H79 A;  2PBJ A;  1Y6E A;  2VM1 A;  2K8S A;  4L0W A;  4ZIL A;  3Q18 A;  1GL8 A;  1TK0 B;  1HNC A;  2YPM A;  2JU5 A;  4V2N A;  4MJE A;  4MPG A;  2LJR A;  4HQZ A;  4JED A;  1B4Q A;  2CA8 A;  4PNG A;  5HR3 A;  1TI1 A;  4BVY A;  1M7T A;  3L9U A;  3QFA C;  2M46 A;  5ECR B;  2WJU A;  1AAZ A;  4K2X A;  1NM3 A;  3VI5 A;  3J7Y k;  3KTB A;  2VCQ A;  5HR0 A;  3LG6 A;  3US3 A;  3WD6 A;  3WGD A;  4O5U A;  2GZY A;  2B1K A;  2AB6 A;  3Q19 A;  2RUF A;  1N8J A;  4GRF A;  3GH9 A;  4NMU A;  2DKH A;  5GAP D;  2X8C A;  4JRR A;  5G1K A;  2GS3 A;  3TGZ A;  3TKQ A;  1I9D A;  1K0D A;  3UAP A;  4TXO A;  1O73 A;  1GSD A;  1FOV A;  1YF1 A;  4N11 A;  3MDK A;  1XWK A;  1DE1 A;  2QA2 A;  2RUE A;  3QMX A;  6GST A;  3GKN A;  4KND A;  4KSM A;  8GSS A;  2ZUP A;  3E3E A;  1PX6 A;  3D21 A;  2YWM A;  3S9F A;  2R2J A;  2QA1 A;  2PPT A;  1BED A;  2OE3 A;  4HJM A;  1AW9 A;  3DRN A;  4IP6 A;  2CVD A;  1S3C A;  3HA9 A;  1PSQ A;  1QUW A;  5IMC A;  1R7H A;  4N0V A;  5C00 A;  2B5E A;  3C8E A;  2GZP A;  10GS A;  2JL4 A;  1TW9 A;  1GUM A;  4POM A;  1LU4 A;  3F0I A;  4GF0 A;  4L5O A;  1FAA A;  4X0X A;  5IPH A;  1R4W A;  5F05 A;  4I2T A;  4Q5N A;  2HFD A;  1V98 A;  1J08 A;  3GKK A;  4ECB A;  1RK4 A;  3TJG A;  3SBC A;  2C3T A;  4YKG A;  5ELA A;  1QGV A;  2H30 A;  1UN2 A;  1ZMA A;  5DBQ A;  1JFU A;  3ZMK A;  4FQU A;  4DSQ A;  2ES7 A;  5IOW A;  2H72 A;  4FH8 A;  3A5I A;  3DYR A;  1SK2 A;  1XWG A;  5B8B A;  3EVI A;  4OCE A;  1X5D A;  1Z9H A;  2V6K A;  2I4A A;  2B6M A;  1QQ2 A;  3O3T A;  3IA1 A;  2FY6 A;  2KLX A;  5ECI B;  2V41 A;  4TR0 A;  4D73 A;  3DXB A;  4YH2 A;  3P8W A;  1PKZ A;  2P31 A;  1AIU A;  1R5A A;  2CX3 A;  2VL9 A;  3TOT A;  2NBS A;  4A5P A;  2B7K A;  4EE0 A;  3G7J A;  2CAQ A;  4K6X A;  2OBK A;  1GTA A;  4NV5 A;  12GS A;  1AC1 A;  2IPA A;  3FZA A;  3HKR A;  3IK7 A;  5EPF A;  4FYB A;  2DJK A;  5AIX A;  5ENU A;  4YQM A;  2DSA A;  4F03 A;  4TKY A;  1ERU A;  3HDC A;  3I9V 2;  1GUL A;  2GT5 A;  2FNO A;  4XS1 A;  1BJX A;  3NOF A;  3KM6 A;  3GTU B;  3EE2 A;  3HVX A;  1Y25 A;  3BCK A;  3L78 A;  3GKX A;  2H01 A;  2H19 A;  4OD7 A;  5G2Z A;  2R5G A;  3CSI A;  4IBP A;  5JCG A;  4JE1 A;  4I6X A;  1M0U A;  1S3A A;  1XWA A;  4GST A;  1EV9 A;  4PTS A;  3DD3 A;  19GS A;  4PXO A;  3HZ8 A;  3APQ A;  5CRW A;  2V32 A;  4WXT A;  4RQX A;  2O85 A;  4ECI A;  1VF4 A;  3HJP A;  4ZL7 A;  2L59 A;  4X1U A;  1GWC A;  3FZ5 A;  3UVH A;  1PX7 A;  2PN8 A;  4O5Q A;  5COH A;  2A2P A;  2HZE B;  3J7Y b;  4Q5Q A;  5DCH A;  1S3D A;  4ECC A;  1J0F A;  3O6T A;  3FYG A;  1SU9 A;  4POB A;  3I6A A;  2XHF A;  5A4W A;  3TJB A;  1SD8 A;  1U88 A;  3NZN A;  3VWW A;  2IL3 A;  2DLX A;  3MAK A;  2WZ9 A;  3GL5 A;  2NDO A;  5CRD A;  1J9B A;  5JWQ B;  3W8J A;  3ZFL A;  3CBU A;  4ILF A;  2N5F A;  5DJM A;  2LRC A;  2LJA A;  1FG4 A;  1XOA A;  4MAB A;  3IC4 A;  2HLS A;  4ZBB A;  2KOK A;  3TOU A;  2R3X A;  2RM5 A;  2DML A;  1XG8 A;  4IJ3 A;  4BIK A;  4EKZ A;  3VWU A;  4K1F A;  2GSS A;  2RM6 A;  1PA3 A;  1R26 A;  3MNG A;  1GSY A;  1DSB A;  5J9B A;  1WJK A;  2Z9S A;  1XW5 A;  2A4V A;  4FIW A;  1K3Y A;  2GVP A;  2DMM A;  4Z7X A;  3EU3 A;  2N5B A;  5IQY A;  4GLT A;  4GSS A;  3GFK A;  5IMA A;  2FWE A;  5ECM B;  1ZZY A;  1DBY A;  1K0A A;  2DIY A;  3UOM A;  2FA8 A;  1OAZ A;  4F2I A;  1U87 A;  4EDZ A;  5KEJ A;  4J2F A;  1U6T A;  1V2A A;  2GTU A;  2HSH A;  3WGX A;  4CW9 A;  1BYE A;  2WDU A;  3WT2 A;  1T3B A;  16GS A;  1F3A A;  5C04 A;  1JHB A;  2OE0 A;  3WGE A;  2OA7 A;  1JZO A;  2WB9 A;  3ERG A;  4F82 A;  2PWJ A;  1Z6M A;  1TK5 B;  1TU8 A;  1TI3 A;  2C80 A;  3UIW A;  1A2J A;  3MWH A;  4IHU A;  1B9X C;  1F2E A;  2I1U A;  1V57 A;  3TKS A;  3W6G A;  5HFI A;  3TRP A;  2LQQ A;  1QFN A;  4YKF A;  2LQO A;  4ZL9 A;  1H4O A;  2B5Y A;  2REM A;  1Q98 A;  1YKA A;  2VD0 A;  3CSJ A;  3H8Q A;  1ZGN A;  2H0I A;  3GHA A;  5CRG A;  4WR4 A;  5LNK e;  4PUF C;  2CAI A;  1G0T A;  2FWF A;  1ZOF A;  4OO4 A;  1GNW A;  3EWL A;  3IRA A;  3ZVJ A;  1G6W A;  1USB A;  3GMF A;  1TK8 B;  2X8H A;  1M3I A;  3PPU A;  2X4A A;  2OJL A;  5DAK B;  1HQO A;  2LRT A;  3RHB A;  1EEM A;  2MBT A;  5GSS A;  3VWV A;  4HI7 A;  3D6I A;  3TJK A;  2ON5 A;  2YN1 A;  3G7I A;  5ID2 A;  4BVX A;  3KZQ A;  2FUG 2;  2X99 A;  4KGI A;  1PGT A;  2LKU A;  1YDK A;  2GSQ A;  5F8B A;  1Z7R A;  1V58 A;  5FHI A;  3IHQ A;  1GRX A;  2HI7 A;  1T1V A;  4I97 A;  1B9Y C;  4V1A g;  1Q4J A;  2H1D A;  2FWG A;  1WPI A;  5H5S A;  1FVJ A;  3CXG A;  1MTC A;  2C0G A;  3EPT A;  4HS1 A;  4Q5F A;  3MIX A;  4K8M A;  2D2Z A;  1X5E A;  1S3R A;  5ECL B;  5CRH A;  2VD1 A;  3BOA A;  3FR3 A;  2EC4 A;  4CDO A;  4AJ7 A;  2TIR A;  11GS A;  4JR4 A;  3VFI A;  4YQV A;  3ZRE A;  5IIZ A;  1TP9 A;  1GSE A;  4E8H A;  5J9C A;  1FB0 A;  1ON4 A;  2GDR A;  2FWH A;  1U3A A;  4ID0 A;  2PGT A;  1MEK A;  3KMN A;  4EL1 A;  5HFK A;  2LST A;  3KGK A;  2B1L A;  1KBN A;  1VGL A;  1RW1 A;  3FK8 A;  1FHE A;  4JU5 A;  3DGQ A;  2XPD A;  4J57 E;  3ED3 A;  2DBC A;  1F3B A;  2CV4 A;  4MJB A;  3F4T A;  1CQH A;  2GQM A;  2PU9 C;  2DJ0 A;  5HR1 A;  1OVN A;  2A4H A;  2P5R A;  3R3E A;  2VAF A;  2VIM A;  5IO0 A;  5G5E A;  2F51 A;  3BJ5 A;  5KOX A;  1TRV A;  2B7J A;  1EZK A;  1FOH A;  1XOB A;  1MD3 A;  2GQK A;  4GCI A;  1ERT A;  1SYX A;  2XC2 A;  3VUR A;  2YP6 A;  3EUR A;  3WYW A;  3RHC A;  5DDL A;  2HSY A;  3FR9 A;  4FYU A;  1EOG A;  1YQ1 A;  4GXZ A;  4MF7 A;  5G1L A;  1K3L A;  1JLW A;  3ZML A;  5J41 A;  4MA9 A;  2IJY A;  3IPZ A;  3IXR A;  4K9Z A;  2L4Q A;  3C7M A;  4EVM A;  1IYI A;  4IJI A;  2PVO C;  5ECP B;  2M80 A;  3P90 A;  3MSZ A;  4AJ6 A;  1TRU A;  1OYJ A;  1EP7 A;  4O5R A;  3I69 A;  3KTL A;  3VWX A;  3GYK A;  5J5N A;  3QAV A;  2GLR A;  1F9M A;  4PUR A;  2O8V B;  1QK8 A;  4POK A;  3HJO A;  4TVE A;  4IQ1 A;  1W4V A;  3HVV A;  1BX9 A;  1XXU A;  2GSR A;  5A5K A;  4TR4 A;  4O7H A;  4OMV A;  2WS2 A;  1EWX A;  2B3S A;  4Z2T A;  2YJH A;  5AGY A;  3FR6 A;  4DVC A;  2QKE A;  4MF5 A;  4G10 A;  4PUA A;  3TB2 A;  3EMP A;  2AAW A;  2H6X A;  2C1Y A;  2JZS A;  2HYX A;  4EC0 A;  4IQA A;  2JZT A;  1Z5Y E;  1Z7P A;  2AYT A;  2I9H A;  1YEP A;  2VUP A;  5IO2 A;  4QQ7 A;  3PIN A;  2VCZ A;  1A0F A;  2HNL A;  5ECH B;  2E2M A;  1SL2 B;  3PH9 A;  3P2A A;  3H93 A;  3CRU A;  4KSO A;  2YOI A;  1GUH A;  1ZYE A;  3IDV A;  5CRE A;  2QGV A;  1SKR B;  4XHM A;  3L9S A;  3MYD A;  1I5G A;  2DJ2 A;  4H86 A;  4LA1 A;  5G30 A;  4WR5 A;  4WBR D;  1AXD A;  3DVX A;  5DQS A;  4GTU A;  2H76 A;  5B8A A;  2VCT A;  2VL2 C;  4GQF A;  4OFM A;  2CVB A;  2OKA A;  3GTU A;  1O7U A;  1WOU A;  4ULX A;  2WUL A;  5ELG A;  4FO5 A;  5J3R A;  4K5R A;  4HDE A;  4BA7 A;  2DJ3 A;  3F3R A;  4K0N A;  1Z6N A;  4PQ1 A;  4Z2U A;  3A2X A;  3TRQ A;  4NHW A;  2WFC A;  1SL0 B;  1FO5 A;  3QPM A;  3UL3 A;  2GT6 A;  1A2M A;  13GS A;  2ZCT A;  3C71 A;  3BBY A;  4PQI A;  1GLQ A;  3CSH A;  5FT3 A;  5F07 A;  4I5Q A;  1K0B A;  1T4Z A;  2CZ3 A;  3E9J B;  3N5O A;  4G2E A;  4MP4 A;  1SL1 B;  4K7O A;  2PER A;  2HXK A;  5L71 A;  4V1A p;  2HZE A;  1WP0 A;  3ME8 A;  2WCI A;  3L0H A;  4EDY A;  4LMW A;  3NIV A;  1O6J A;  2YNX A;  1R5P A;  4USS A;  2HRF A;  3D22 A;  4CY8 A;  3W8S A;  4HU7 A;  3ZVJ D;  5D96 A;  1PRX A;  2I81 A;  3VI7 A;  4TR1 A;  5DVB A;  3LYP A;  2GQL A;  3ERW A;  4X43 A;  3RAZ A;  1TOF A;  2R37 A;  3ZIT A;  2C3Q A;  4BWS A;  3GRX A;  2ALB A;  3ZL5 A;  4MH2 A;  4ZIJ A;  4IGJ A;  2MMN A;  5A4U A;  2YV7 A;  5D93 A;  1G7O A;  2B5X A;  1QMV A;  1PKW A;  5EY6 A;  3M1G A;  3GN3 A;  4HZ4 A;  3LWA A;  1HYU A;  1OE7 A;  3D0Z A;  4IKH A;  4E8E A;  3O76 A;  1TU7 A;  2CVK A;  4JR6 A;  2FHE A;  1NW2 A;  1XW6 A;  4PX1 A;  3ZIV A;  2YWN A;  5IMZ A;  2EIO A;  2L5O A;  1PN0 A;  3KXO A;  1O85 A;  6GSS A;  3KH7 A;  1JZW A;  2IFQ B;  4MF6 A;  1T00 A;  2RLI A;  4NXI A;  3IBH A;  1OE8 A;  1XZO A;  5D9W A;  3EIN A;  5DAL B;  1K0C A;  5ECO B;  2LNS A;  1TXX A;  3QAW A;  1DE2 A;  2JSZ A;  3A5W A;  4Z2R A;  3U6V A;  5AIV A;  4QL7 A;  3DIE A;  1AQX A;  3A3T A;  3ERF A;  4LL4 B;  3LQ7 A;  2LNT A;  1JLV A;  1B8X A; 
#chains in the Genus database with same CATH homology
 2O89 A;  1ZYN A;  1KTE A;  3ZRD A;  4ECJ A;  5EVO A;  1VF1 A;  3N9J A;  5IOX A;  2JAC A;  4ZB8 A;  3IE3 A;  2C0F A;  1JZD A;  2MBS A;  3JCM L;  3C1S A;  2NVL A;  14GS A;  2H1G A;  2I3Y A;  1THO A;  1AQV A;  3QFB C;  2AHE A;  1ZYP A;  2K18 A;  4K7N A;  5DCG A;  1H75 A;  3GUS A;  5LD0 A;  3KCM A;  1URM A;  4V2M A;  3UAR A;  1B48 A;  1HD2 A;  3EYT A;  4ISD A;  2OAD A;  4MK3 A;  5AIS A;  2F8F A;  4RQR A;  5BRT A;  3F4R A;  3ZFB A;  2LUS A;  5E4W A;  5DAK A;  1GSQ A;  4NWY A;  22GS A;  2E2G A;  5ECQ B;  3M0F A;  3LOR A;  2L5L A;  2KHP A;  4ZL8 A;  1GTI A;  3ZZX A;  2L6D A;  4HU9 A;  4KCA A;  4PGT A;  4GSN A;  4ZBD A;  1K0O A;  1GTU A;  1OC9 B;  3GSS A;  3LXZ A;  3HCZ A;  3LW9 A;  2J9H A;  5J4U A;  1OC3 A;  3GIX A;  4TW5 A;  4AGS A;  3BCI A;  4DSS B;  3KIJ A;  3FY7 A;  1GH2 A;  4TN8 A;  2YCD A;  3TUE A;  4WF4 A;  2XPE A;  2MMA A;  3APS A;  5A4V A;  1WE0 A;  2IMF A;  4JZQ A;  3KP8 A;  1T7P B;  4MJC A;  5HFG A;  1XIY A;  1GSU A;  3HVS A;  2MYG A;  3QDN A;  3GA4 A;  1ACV A;  2HRK A;  4KDY A;  1LJR A;  4ZB6 A;  5AN1 A;  5D9X A;  1BQ7 A;  2V1M A;  5G31 A;  2PVQ A;  1VRS D;  1SK0 A;  2YWI A;  4G0L A;  4MZW A;  4XIH A;  5F06 A;  2AV4 A;  2IMD A;  3UBK A;  3LSZ A;  1SJZ A;  2YJ7 A;  2OBI A;  3FW2 A;  3L4N A;  2AJQ B;  4GWR A;  1ST9 A;  2E7P A;  4KDX A;  2VCX A;  4KDU A;  2K6V A;  1IYH A;  3IHG A;  4BL7 B;  3FZ9 A;  1EV4 A;  1LBK A;  4LMV A;  4PNF A;  4IW9 A;  1AQW A;  3QD9 A;  1O8X A;  4MZC A;  4GQC A;  2H66 A;  2MZC A;  5ECK B;  2NTO A;  2YWO A;  2H8L A;  1SYR A;  3LFL A;  2CQ9 A;  2TRC P;  4K2D A;  2WRT A;  2H6Y A;  2GST A;  2KP1 A;  5HQP A;  3GNJ A;  3UEM A;  5F0G A;  2H74 A;  1XPV A;  2GGT A;  2VCV A;  2H0G A;  4HUA A;  4XS4 B;  2TRX A;  3F4S A;  3EC3 A;  1ZCP A;  3IAM 2;  1Z3E A;  3H1N A;  1GNE A;  2YV9 A;  2M72 A;  1HNA A;  3UVT A;  3LYK A;  2KUC A;  1ABA A;  2QC7 A;  1ZYQ B;  1TDI A;  2H6Z A;  2DKI A;  3GV1 A;  2HSM A;  3QR6 A;  2F3M A;  4AJ8 A;  4EO3 A;  3Q6O A;  4BWQ A;  4JBB A;  1SKS B;  1W89 A;  3E0U A;  3ME7 A;  5IMF A;  1GTB A;  5KOW A;  2VOC A;  1X5C A;  4EXJ A;  1WRY A;  2XBI A;  2QSI A;  1V40 A;  3VPT A;  18GS A;  2C0E A;  2KP2 A;  3TKS C;  4I2U A;  1A24 A;  4WEY A;  2VO4 A;  1TRW A;  4NHZ A;  5KN1 A;  2E0Q A;  5ABR A;  1KNG A;  3FEU A;  7GSS A;  2LJK A;  3AY8 A;  2OAC A;  2ON7 A;  2WGR A;  1ERW A;  4ICY A;  2VM2 A;  4BVY B;  1ERV A;  4IVF A;  4XCS A;  2DJJ A;  3IOS A;  2LS5 A;  2UZ8 A;  1A23 A;  5H5R A;  1GSS A;  2K8V A;  4G9H A;  1K3O A;  1M99 A;  1QXH A;  3RBT A;  2IIY A;  3DVW A;  3EMX A;  1XBS A;  5KN3 A;  4NPB A;  4EIQ A;  3FHK A;  4BPY A;  2IMI A;  4G0K A;  3CYN A;  2P0G A;  4LLR A;  17GS A;  1GLP A;  2VLV A;  1A0R P;  2R0G A;  3ZLP A;  1K0N A;  2PMT A;  4ZBA A;  3VPQ A;  5KN0 A;  1M2B A;  2O87 A;  2YZH A;  2G2Q A;  2NPB A;  4TXO B;  4QL9 A;  4TR3 A;  1PQN A;  4XRA A;  1PL1 A;  1N2A A;  5CNW A;  3F6F A;  2IN3 A;  4HJ2 A;  1B4P A;  5INY A;  1XVW A;  1SJI A;  3D5J A;  4RI7 A;  3CTG A;  5D9V A;  4NV2 A;  3F3Q A;  3HD5 A;  3HHV A;  3IV4 A;  4ZXG A;  3APO A;  3G9B A;  3M9K A;  3P7X A;  1PL2 A;  2R6K A;  3F8U A;  4MJA A;  5H5Q A;  1OKT A;  3HYP A;  5IPG A;  2EIR A;  3TRX A;  3WT1 A;  4YAV A;  3HZ4 A;  3ZTL A;  1WWJ A;  4K5S A;  4OWY A;  2VLT A;  4MZB A;  4ZB9 A;  3D4T A;  3HXS A;  1OKD A;  5GST A;  2CT6 A;  2H75 A;  3GKM A;  1X9S B;  3TJJ A;  1NHO A;  3DWV A;  4G19 A;  3DKS A;  1VF2 A;  4KA0 A;  4YAP A;  1ML6 A;  2HT9 A;  2P5Q A;  4MCU A;  6GSY A;  2IME A;  5B6M A;  1UA5 A;  3FKF A;  4MLY A;  1KEB A;  1JZR A;  3L9V A;  5E59 A;  2C3N A;  4TOP A;  1THX A;  2K9F A;  2CX4 A;  2PUK C;  5JCU A;  3IK9 A;  4AF2 A;  2H1A A;  3CTF A;  5IMV A;  5D9T A;  1NSW A;  4DEJ A;  1WMJ A;  5DJL A;  3TDG A;  1A8Y A;  1M9A A;  2H73 A;  2JAD A;  4V2L A;  3TJF A;  4KB3 A;  1YF0 A;  4TXV A;  1TKD B;  2DC5 A;  3A2W A;  4D73 B;  1FB6 A;  1FW1 A;  1WIK A;  4HZ2 A;  4F0B A;  4FYC A;  5IM9 A;  2R0C A;  1XWC A;  1SEN A;  1PMT A;  2X64 A;  5GAN D;  1MDJ A;  3UJ1 A;  2J23 A;  2V6O A;  4KX4 A;  2IFQ A;  1BG5 A;  3GX8 A;  1PN9 A;  4WF5 A;  4F0C A;  1MDK A;  1VF3 A;  3ZIJ A;  3A2V A;  3M8N A;  4KUN A;  5DAL A;  1BAY A;  4ACS A;  1EOH A;  4N30 A;  2F9S A;  4IS0 A;  1F37 A;  4CHS A;  2FLS A;  2FD3 A;  2YAN A;  2F8A A;  1XWB A;  3QOU A;  3HJM A;  2L57 A;  3BD2 A;  3VLN A;  4MNN A;  2CZ2 A;  4L5L A;  1V9W A;  5FWG A;  5DQY A;  1GSF A;  2OE1 A;  3K8N A;  4Q5R A;  4J56 E;  4MMM A;  2VCW A;  4F9Z A;  3DEX A;  1YZX A;  1CQG A;  1MD4 A;  3EU4 A;  4RI6 A;  3I43 A;  1UVZ A;  1C72 A;  3GX0 A;  2DIZ A;  5IMD A;  2C8U A;  2H0H A;  3H4K A;  4TR1 B;  5JWO B;  4XS6 A;  1A8L A;  1T4Y A;  3IR4 A;  4OO5 A;  2XBQ A;  3F63 A;  4MH3 A;  5GZZ B;  3DML A;  5BMU A;  3R2Q A;  3KJY A;  3TKP A;  4IEL A;  1X0R A;  2IMK A;  3FMW A;  20GS A;  4RUV A;  2HE3 A;  2FGX A;  2BJX A;  2L4C A;  1SJ6 A;  5JWR B;  4L8E A;  1NHY A;  4N0Z A;  3TKS E;  1OC8 A;  4O32 A;  2HZF A;  4XRD A;  2GZZ A;  3KMO A;  2R0P A;  1YJ6 A;  1ZL9 A;  4XTS A;  3SWL A;  1XFL A;  3QCP A;  1OC9 A;  2AUV A;  1EEJ A;  2JSY A;  3F9U A;  2X49 A;  3LJR A;  5G5F A;  3CMI A;  1M2D A;  4EF0 A;  2A2S A;  3ISO A;  4PQH A;  2LEG A;  4DSS A;  2H70 A;  2C0D A;  3RPN A;  2BMX A;  3RDW A;  4MPF A;  1ILO A;  4WBJ A;  1TRS A;  3PGT A;  1XVQ A;  4O92 A;  3RPP A;  3Q74 A;  1HNB A;  1EGR A;  3V1W A;  6GSX A;  6GSV A;  5KN2 A;  4K0G A;  6GSW A;  1SK1 A;  3GST A;  3GL3 A;  2FA4 A;  4HEA 2;  1YY7 A;  5B7C A;  2A2R A;  1FVK A;  1DUG A;  3UBL A;  3IAS 2;  4N10 A;  1TTZ A;  2EIQ A;  2VLU A;  2G0F A;  3KD0 A;  4DSR A;  4K7I A;  1F6M C;  3M9J A;  2YZU A;  2ZNM A;  3F6D A;  1A2L A;  3CRT A;  1RQM A;  1K0M A;  4G0I A;  1YEX A;  5JCW A;  1XCC A;  1M9B A;  4NAX A;  9GSS A;  3C73 A;  2FCH A;  4ML1 A;  4HOJ A;  4KE3 A;  1EGO A;  3IC8 A;  4X4J A;  2N5A A;  2X8G A;  3LEF A;  4CY6 A;  2V2G A;  4BL7 A;  3G7Y A;  3TKR A;  1MDI A;  3ZYW A;  4OFT A;  4KF9 A;  4OCF A;  4LL1 B;  3VK9 A;  2IWT A;  5D8I A;  3TCO A;  4KCE A;  1SD9 A;  3KH9 A;  2H71 A;  3C1R A;  3PR8 A;  1XW9 A;  3FRC A;  5D73 A;  5ECS A;  3LXT A;  3U5R E;  1E6B A;  1T8E B;  4IN0 A;  5LCZ A;  2HRA A;  2O7K A;  2VL3 A;  2C4J A;  4EIP A;  4L0U A;  2R4V A;  1UC7 A;  3GUR A;  2LTK A;  5CYY A;  2MMO A;  3OR5 A;  2HRN A;  4XS4 A;  3D4M A;  5CO3 A;  2MMZ A;  4MDC A;  2L6C A;  6GSU A;  5ECN B;  1O8W A;  4WKW A;  3KEB A;  3LGC A;  4HQS A;  1E2Y A;  2BTO T;  5CAX A;  4TRX A;  1AUC A;  4WET A;  1G6Y A;  2LRN A;  1EP8 A;  4YQU A;  4I8B A;  3HY2 A;  1O81 A;  1G7E A;  3FZ4 A;  2H1B A;  5ID2 B;  4BVX B;  2VL2 A;  5CP1 A;  5B6N A;  5EL8 A;  1U3I A;  3KP9 A;  1X9M B;  1YKC A;  4KW6 A;  4OFN A;  3UMA A;  1TJD A;  4POL A;  2DJ1 A;  5HR2 A;  1SKW B;  2LV3 A;  3GH6 A;  2JZR A;  4ML6 A;  3QAG A;  4KH7 A;  3M3M A;  1PD2 1;  4KAE A;  1X9W B;  1GUK A;  4EUY A;  1M2A A;  4P3Y B;  2RII A;  4IP1 A;  1GP1 A;  3H79 A;  2PBJ A;  1Y6E A;  2VM1 A;  2K8S A;  4L0W A;  4ZIL A;  3Q18 A;  1GL8 A;  1TK0 B;  1HNC A;  2YPM A;  2JU5 A;  4V2N A;  4MJE A;  4MPG A;  2LJR A;  4HQZ A;  4JED A;  1B4Q A;  2CA8 A;  4PNG A;  5HR3 A;  1TI1 A;  4BVY A;  1M7T A;  3L9U A;  3QFA C;  2M46 A;  5ECR B;  2WJU A;  1AAZ A;  4K2X A;  1NM3 A;  3VI5 A;  3J7Y k;  3KTB A;  2VCQ A;  5HR0 A;  3LG6 A;  3US3 A;  3WD6 A;  3WGD A;  4O5U A;  2GZY A;  2B1K A;  2AB6 A;  3Q19 A;  2RUF A;  1N8J A;  4GRF A;  3GH9 A;  4NMU A;  2DKH A;  5GAP D;  2X8C A;  4JRR A;  5G1K A;  2GS3 A;  3TGZ A;  3TKQ A;  1I9D A;  1K0D A;  3UAP A;  4TXO A;  1O73 A;  1GSD A;  1FOV A;  1YF1 A;  4N11 A;  3MDK A;  1XWK A;  1DE1 A;  2QA2 A;  2RUE A;  3QMX A;  6GST A;  3GKN A;  4KND A;  4KSM A;  8GSS A;  2ZUP A;  3E3E A;  1PX6 A;  3D21 A;  2YWM A;  3S9F A;  2R2J A;  2QA1 A;  2PPT A;  1BED A;  2OE3 A;  4HJM A;  1AW9 A;  3DRN A;  4IP6 A;  2CVD A;  1S3C A;  3HA9 A;  1PSQ A;  1QUW A;  5IMC A;  1R7H A;  4N0V A;  5C00 A;  2B5E A;  3C8E A;  2GZP A;  10GS A;  2JL4 A;  1TW9 A;  1GUM A;  4POM A;  1LU4 A;  3F0I A;  4GF0 A;  4L5O A;  1FAA A;  4X0X A;  5IPH A;  1R4W A;  5F05 A;  4I2T A;  4Q5N A;  2HFD A;  1V98 A;  1J08 A;  3GKK A;  4ECB A;  1RK4 A;  3TJG A;  3SBC A;  2C3T A;  4YKG A;  5ELA A;  1QGV A;  2H30 A;  1UN2 A;  1ZMA A;  5DBQ A;  1JFU A;  3ZMK A;  4FQU A;  4DSQ A;  2ES7 A;  5IOW A;  2H72 A;  4FH8 A;  3A5I A;  3DYR A;  1SK2 A;  1XWG A;  5B8B A;  3EVI A;  4OCE A;  1X5D A;  1Z9H A;  2V6K A;  2I4A A;  2B6M A;  1QQ2 A;  3O3T A;  3IA1 A;  2FY6 A;  2KLX A;  5ECI B;  2V41 A;  4TR0 A;  4D73 A;  3DXB A;  4YH2 A;  3P8W A;  1PKZ A;  2P31 A;  1AIU A;  1R5A A;  2CX3 A;  2VL9 A;  3TOT A;  2NBS A;  4A5P A;  2B7K A;  4EE0 A;  3G7J A;  2CAQ A;  4K6X A;  2OBK A;  1GTA A;  4NV5 A;  12GS A;  1AC1 A;  2IPA A;  3FZA A;  3HKR A;  3IK7 A;  5EPF A;  4FYB A;  2DJK A;  5AIX A;  5ENU A;  4YQM A;  2DSA A;  4F03 A;  4TKY A;  1ERU A;  3HDC A;  3I9V 2;  1GUL A;  2GT5 A;  2FNO A;  4XS1 A;  1BJX A;  3NOF A;  3KM6 A;  3GTU B;  3EE2 A;  3HVX A;  1Y25 A;  3BCK A;  3L78 A;  3GKX A;  2H01 A;  2H19 A;  4OD7 A;  5G2Z A;  2R5G A;  3CSI A;  4IBP A;  5JCG A;  4JE1 A;  4I6X A;  1M0U A;  1S3A A;  1XWA A;  4GST A;  1EV9 A;  4PTS A;  3DD3 A;  19GS A;  4PXO A;  3HZ8 A;  3APQ A;  5CRW A;  2V32 A;  4WXT A;  4RQX A;  2O85 A;  4ECI A;  1VF4 A;  3HJP A;  4ZL7 A;  2L59 A;  4X1U A;  1GWC A;  3FZ5 A;  3UVH A;  1PX7 A;  2PN8 A;  4O5Q A;  5COH A;  2A2P A;  2HZE B;  3J7Y b;  4Q5Q A;  5DCH A;  1S3D A;  4ECC A;  1J0F A;  3O6T A;  3FYG A;  1SU9 A;  4POB A;  3I6A A;  2XHF A;  5A4W A;  3TJB A;  1SD8 A;  1U88 A;  3NZN A;  3VWW A;  2IL3 A;  2DLX A;  3MAK A;  2WZ9 A;  3GL5 A;  2NDO A;  5CRD A;  1J9B A;  5JWQ B;  3W8J A;  3ZFL A;  3CBU A;  4ILF A;  2N5F A;  5DJM A;  2LRC A;  2LJA A;  1FG4 A;  1XOA A;  4MAB A;  3IC4 A;  2HLS A;  4ZBB A;  2KOK A;  3TOU A;  2R3X A;  2RM5 A;  2DML A;  4IJ3 A;  4EKZ A;  3VWU A;  4K1F A;  2GSS A;  2RM6 A;  1PA3 A;  1R26 A;  3MNG A;  1GSY A;  1DSB A;  5J9B A;  1WJK A;  2Z9S A;  1XW5 A;  2A4V A;  4FIW A;  1K3Y A;  2GVP A;  2DMM A;  4Z7X A;  3EU3 A;  2N5B A;  5IQY A;  4GLT A;  4GSS A;  3GFK A;  5IMA A;  2FWE A;  5ECM B;  1ZZY A;  1DBY A;  1K0A A;  2DIY A;  3UOM A;  2FA8 A;  1OAZ A;  4F2I A;  1U87 A;  4EDZ A;  5KEJ A;  4J2F A;  1U6T A;  1V2A A;  2GTU A;  2HSH A;  3WGX A;  4CW9 A;  1BYE A;  2WDU A;  3WT2 A;  1T3B A;  16GS A;  1F3A A;  5C04 A;  1JHB A;  2OE0 A;  3WGE A;  2OA7 A;  1JZO A;  2WB9 A;  3ERG A;  4F82 A;  2PWJ A;  1Z6M A;  1TK5 B;  1TU8 A;  1TI3 A;  2C80 A;  3UIW A;  1A2J A;  3MWH A;  4IHU A;  1B9X C;  1F2E A;  2I1U A;  1V57 A;  3TKS A;  3W6G A;  5HFI A;  3TRP A;  2LQQ A;  1QFN A;  4YKF A;  2LQO A;  4ZL9 A;  1H4O A;  2B5Y A;  2REM A;  1Q98 A;  1YKA A;  2VD0 A;  3CSJ A;  3H8Q A;  1ZGN A;  2H0I A;  3GHA A;  5CRG A;  4WR4 A;  5LNK e;  4PUF C;  2CAI A;  1G0T A;  2FWF A;  1ZOF A;  4OO4 A;  1GNW A;  3EWL A;  3IRA A;  3ZVJ A;  1G6W A;  1USB A;  3GMF A;  1TK8 B;  2X8H A;  3PPU A;  2X4A A;  2OJL A;  5DAK B;  1HQO A;  2LRT A;  3RHB A;  1EEM A;  2MBT A;  5GSS A;  3VWV A;  4HI7 A;  3D6I A;  3TJK A;  2ON5 A;  2YN1 A;  3G7I A;  5ID2 A;  4BVX A;  3KZQ A;  2FUG 2;  2X99 A;  4KGI A;  1PGT A;  2LKU A;  1YDK A;  2GSQ A;  5F8B A;  1Z7R A;  1V58 A;  5FHI A;  3IHQ A;  1GRX A;  2HI7 A;  1T1V A;  4I97 A;  1B9Y C;  4V1A g;  1Q4J A;  2H1D A;  2FWG A;  1WPI A;  5H5S A;  1FVJ A;  3CXG A;  1MTC A;  2C0G A;  3EPT A;  4HS1 A;  4Q5F A;  3MIX A;  4K8M A;  2D2Z A;  1X5E A;  5ECL B;  5CRH A;  2VD1 A;  3BOA A;  3FR3 A;  2EC4 A;  4CDO A;  4AJ7 A;  2TIR A;  11GS A;  4JR4 A;  3VFI A;  4YQV A;  3ZRE A;  5IIZ A;  1TP9 A;  1GSE A;  4E8H A;  5J9C A;  1FB0 A;  1ON4 A;  2GDR A;  2FWH A;  1U3A A;  4ID0 A;  2PGT A;  1MEK A;  3KMN A;  4EL1 A;  5HFK A;  2LST A;  3KGK A;  2B1L A;  1KBN A;  1VGL A;  1RW1 A;  3FK8 A;  1FHE A;  4JU5 A;  3DGQ A;  2XPD A;  4J57 E;  3ED3 A;  2DBC A;  1F3B A;  2CV4 A;  4MJB A;  3F4T A;  1CQH A;  2GQM A;  2PU9 C;  2DJ0 A;  5HR1 A;  1OVN A;  2A4H A;  2P5R A;  3R3E A;  2VAF A;  2VIM A;  5IO0 A;  5G5E A;  2F51 A;  3BJ5 A;  5KOX A;  1TRV A;  2B7J A;  1EZK A;  1FOH A;  1XOB A;  1MD3 A;  2GQK A;  4GCI A;  1ERT A;  1SYX A;  2XC2 A;  3VUR A;  2YP6 A;  3EUR A;  3WYW A;  3RHC A;  5DDL A;  2HSY A;  3FR9 A;  4FYU A;  1EOG A;  1YQ1 A;  4GXZ A;  4MF7 A;  5G1L A;  1K3L A;  1JLW A;  3ZML A;  5J41 A;  4MA9 A;  2IJY A;  3IPZ A;  3IXR A;  4K9Z A;  2L4Q A;  3C7M A;  4EVM A;  1IYI A;  4IJI A;  2PVO C;  5ECP B;  2M80 A;  3P90 A;  3MSZ A;  4AJ6 A;  1TRU A;  1OYJ A;  1EP7 A;  4O5R A;  3I69 A;  3KTL A;  3VWX A;  3GYK A;  5J5N A;  3QAV A;  2GLR A;  1F9M A;  4PUR A;  2O8V B;  1QK8 A;  4POK A;  3HJO A;  4TVE A;  4IQ1 A;  1W4V A;  3HVV A;  1BX9 A;  1XXU A;  2GSR A;  5A5K A;  4TR4 A;  4O7H A;  4OMV A;  2WS2 A;  1EWX A;  2B3S A;  4Z2T A;  2YJH A;  5AGY A;  3FR6 A;  4DVC A;  2QKE A;  4MF5 A;  4G10 A;  4PUA A;  3TB2 A;  3EMP A;  2AAW A;  2H6X A;  2C1Y A;  2JZS A;  2HYX A;  4EC0 A;  4IQA A;  2JZT A;  1Z5Y E;  1Z7P A;  2AYT A;  2I9H A;  1YEP A;  2VUP A;  5IO2 A;  4QQ7 A;  3PIN A;  2VCZ A;  1A0F A;  2HNL A;  5ECH B;  2E2M A;  1SL2 B;  3PH9 A;  3P2A A;  3H93 A;  3CRU A;  4KSO A;  2YOI A;  1GUH A;  1ZYE A;  3IDV A;  5CRE A;  2QGV A;  1SKR B;  4XHM A;  3L9S A;  3MYD A;  1I5G A;  2DJ2 A;  4H86 A;  4LA1 A;  5G30 A;  4WR5 A;  4WBR D;  1AXD A;  3DVX A;  5DQS A;  4GTU A;  2H76 A;  5B8A A;  2VCT A;  2VL2 C;  4GQF A;  4OFM A;  2CVB A;  2OKA A;  3GTU A;  1O7U A;  1WOU A;  4ULX A;  2WUL A;  5ELG A;  4FO5 A;  5J3R A;  4K5R A;  4HDE A;  4BA7 A;  2DJ3 A;  3F3R A;  4K0N A;  1Z6N A;  4PQ1 A;  4Z2U A;  3A2X A;  3TRQ A;  4NHW A;  2WFC A;  1SL0 B;  1FO5 A;  3QPM A;  3UL3 A;  2GT6 A;  1A2M A;  13GS A;  2ZCT A;  3C71 A;  3BBY A;  4PQI A;  1GLQ A;  3CSH A;  5FT3 A;  5F07 A;  4I5Q A;  1K0B A;  1T4Z A;  2CZ3 A;  3E9J B;  3N5O A;  4G2E A;  4MP4 A;  1SL1 B;  4K7O A;  2PER A;  2HXK A;  5L71 A;  4V1A p;  2HZE A;  1WP0 A;  3ME8 A;  2WCI A;  3L0H A;  4EDY A;  4LMW A;  3NIV A;  1O6J A;  2YNX A;  1R5P A;  4USS A;  2HRF A;  3D22 A;  4CY8 A;  3W8S A;  4HU7 A;  3ZVJ D;  5D96 A;  1PRX A;  2I81 A;  3VI7 A;  4TR1 A;  5DVB A;  3LYP A;  2GQL A;  3ERW A;  4X43 A;  3RAZ A;  1TOF A;  2R37 A;  3ZIT A;  2C3Q A;  4BWS A;  3GRX A;  2ALB A;  3ZL5 A;  4MH2 A;  4ZIJ A;  4IGJ A;  2MMN A;  5A4U A;  2YV7 A;  5D93 A;  1G7O A;  2B5X A;  1QMV A;  1PKW A;  5EY6 A;  3M1G A;  3GN3 A;  4HZ4 A;  3LWA A;  1HYU A;  1OE7 A;  3D0Z A;  4IKH A;  4E8E A;  3O76 A;  1TU7 A;  2CVK A;  4JR6 A;  2FHE A;  1NW2 A;  1XW6 A;  4PX1 A;  3ZIV A;  2YWN A;  5IMZ A;  2EIO A;  2L5O A;  1PN0 A;  3KXO A;  1O85 A;  6GSS A;  3KH7 A;  1JZW A;  2IFQ B;  4MF6 A;  1T00 A;  2RLI A;  4NXI A;  3IBH A;  1OE8 A;  1XZO A;  5D9W A;  3EIN A;  5DAL B;  1K0C A;  5ECO B;  2LNS A;  1TXX A;  3QAW A;  1DE2 A;  2JSZ A;  3A5W A;  4Z2R A;  3U6V A;  5AIV A;  4QL7 A;  3DIE A;  1AQX A;  3A3T A;  3ERF A;  4LL4 B;  3LQ7 A;  2LNT A;  1JLV A;  1B8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...