5JXAH

Crystal structure of ligand-free vrc03 antigen-binding fragment.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
235
structure length
231
Chain Sequence
b'QVQLVQSGAVIKTPGSSVKISCRASGYNFRDYSIHWVRLIPDKGFEWIGWIKPLWGAVSYARQLQGRVSMTRQLSQDPDDPDWGVAYMEFSGLTPADTAEYFCVRRGSCDYCGDFPWQYWGQGTVVVVSSASTKGPSVFPLAPSSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VRC03 Heavy chain
publication title Somatic Hypermutation-Induced Changes in the Structure and Dynamics of HIV-1 Broadly Neutralizing Antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 231
sequence length 235
ec nomenclature
pdb deposition date 2016-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxaH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxaH01
2EDQA 2Z8SA 3O11B 5JHDD 3DMMA 1AO7D 4I4WA 4J7RA 4Q6IA 5D7LA 4XBPB 1H8NA 2Y72A 2JJSA 1EBPA 1CDGA 2B1HL 4BSVB 1BEYL 3C9NA 5EU6D 5JOPE 4XVSH 2ICES 1BD2D 3GB7A 4M7ZB 3RI5F 2O5ZH 4Y2OA 4G8FA 3ZKXC 2DQJH 4K7PH 3RTQD 5CBEB 1KSRA 3WS6C 2MPAH 3FZUC 4MCZB 5ESQB 4AEEA 2O5XH 1KELH 5BJTA 3QEQE 3A6CH 4HMEA 3GKZA 2J1KA 4NHCL 5DHVB 4YEFA 3WXVH 3L6FB 5I8KL 4K8RH 4M61B 3V4PL 1FZMA 3VFRA 2J8UE 1EGJH 4LVNB 2AJZA 3RZCC 4F7CA 2EKSA 2C1OA 4RAHA 3VFGL 5JUEH 4PJ5B 3HUJA 4X83A 1QP1A 4Q2ZB 3L3IB 5GS0C 3W9DA 1J88A 2XYCA 3IJSB 4K8RC 3SDCA 5CKAA 4P2RE 1ULVA 1SJXA 4MJIA 3STLB 3S98A 5EA0H 2VZVA 4O2FA 4TUKL 3SJVA 2NY5C 5IHUL 4JKPH 4MJ2A 4KK9D 3WD5L 1X5AA 1JJUA 4CVWA 4ZNEA 4A2LA 4U1JA 2A6KB 3LD8B 1KXQE 4LARL 3BH8A 2WINB 4YZFF 1AGDB 1M7XA 4M9OA 4X7CC 4YBLC 2BVEA 2CD0A 4HIEA 3BP6A 5DUBA 5IROC 4F58L 2EEBA 2P8MB 4LLQB 5DMIL 4XVTH 3OAUH 3L3DB 3OF6D 1MCPL 1PQZA 3BO8A 1BFOB 2KUTA 7CGTA 4EOWH 4DW2L 1YEKL 4R7DA 4ZAKD 1MRFL 4JDVA 3L9RB 3IFLL 4QRUB 5FB8A 1AE6L 2NZIA 3RHWF 3S37X 1UEYA 2R0WL 3CSYB 5E6IB 2AJ3B 2BVQA 1SEBB 2DQHH 4GXUM 1UM6H 4G7YL 4CADA 3ZDZE 1AHWA 1F11A 2APWA 3O6LL 5L7XL 4Y5VA 4OZFG 1I9EA 2OX5A 2IAMC 1FYTE 2LABA 4PYGA 3SDDB 1PKQA 4F3FB 5KSAC 1UB5A 5CILL 4PJBF 3OZ9H 4MXWH 4QTIL 4XZUB 1AXTL 2YPKB 1RHHA 1QBLH 4P46C 4N8CL 4XMKH 1UKTA 3VXTB 5J7CC 1YEFH 2YD9A 3H0TB 4TUOA 5T1DH 1W72B 2OZ4H 1OB1B 1JZ6A 3GSNL 5CWSA 1G0YR 3IETB 1OGAD 4MX7A 2DD8H 4U6TA 3SHSA 2OMBA 5I16B 1ORQA 4R7NB 1DQTA 2Z93A 3CFKB 2FO1A 4XWGH 3RL2B 5J56B 2YC1A 3IRZA 1RMFL 5HHXH 1TTGA 3MV8E 3BT2L 1RZIB 3M17A 1XF3A 5H2BB 3TZVC 4WI8A 1J1XH 3P73B 3BRGC 2GK0B 3GSQA 5J1AB 1S78C 5CJQL 1BFVH 1E6JL 4JFEE 4MS8C 3Q6FA 3CU7A 1I9RL 3MROB 4JHZA 5E9DD 4OQTL 3DHJA 5DWUH 2DQIH 4R4FL 3GHBH 5HDQH 3SDXA 4QO1A 5GS1A 3TWCL 1EIBA 5JXED 4NZRL 5I1EL 1FO0A 1XT5A 5D2NA 3CU1A 2VLJD 5FGCE 5KOVC 4P4RA 1GRWA 3QEUB 1ES0B 4IEFB 5GRWA 1MIEH 4AEHL 4Y8DC 2F54B 4UIMB 1WISA 4YJZL 1FHGA 5D7SL 3BYYA 2V7HA 4Y16D 4YDVB 4ZPTA 5MEOA 1ZT7A 2JB6B 1ZVHA 2WM0A 1WZLA 5IV2A 4MA3B 3I02B 4XWOD 1YECL 4X7TB 5TDNA 5IIEA 2VE6A 4KQ4L 1X5ZA 4XXCA 1QFOA 4Z76B 2YD4A 5EO0A 3KXFD 2AEIT 1FAIH 4MD5B 3WCYA 3ZO0A 4TOYH 1OTUD 4BSWA 2BHUA 2IGFL 1KIPB 2AK4E 4JVUA 3H2WA 2O61B 2VLMD 4CMMB 2EIZB 3V4VH 1PW3A 3RQ3A 5DHVH 4BFEA 5I0ZA 2X4UB 2JIXA 2Z31D 2AV1B 2ICWI 4YO0A 4OFVA 3CDCA 2ZCHL 4HBCH 2WAHA 1AGFA 4OLYH 4XCEA 5D7IE 1SYSB 3S4SG 2JB5H 3QIWD 3KNBA 5E1HB 5C71A 3ARSA 3CJJA 4LCWA 4N90E 3VXRA 5B3JF 4C55A 1NMBL 1F97A 2DL9A 3VU2A 2I24N 3QULA 5MENA 5DRNB 1A21A 2VDLL 4X80H 5D1QD 1YEIL 2CKNA 3F7PC 5KVDH 1MCOL 3ELAT 4PJDF 2ICEB 5FCSH 3R8BB 1LDPH 5BV7B 5A3IC 1HZHH 1SY6L 3FOMB 4ZOCA 5D2LE 5C08B 1G9NH 5BMFH 5IHLB 2VC2H 5F9OL 2IQAA 4KXZI 1YMME 4PJ9A 4WHYG 4OCSH 1AGBB 5F97E 4ZPVA 1U3HB 4Q0XH 2UYLB 2VZ3A 4FQIL 4LRIC 1RK0B 1T03L 2BC4B 5GGSA 3LMJL 3IFPB 4EI6B 1YMHB 2F53E 1G9NC 3LD8C 3WUZA 4G6AD 2CH8A 5CSBA 1INEL 1PFCA 4OI8A 3IXTA 3TPKA 4JFYB 4PRID 1QTYT 3D39E 3DXAA 3QCTL 4PY7B 4UZGA 5HHMD 3QZWG 4PREA 3MYJB 3QUYB 1CD1B 5LGHL 3P4NA 1PG7W 1MCIA 2VABA 3NN8B 4JGUA 2N4IA 3RNKB 5E4EB 2WUBL 1HI6B 1Q9LB 2PYEE 5GGRA 5SWZE 2ZCLH 3GI9L 3JWDH 3T3ME 1FJ1B 1MWAH 3MV8A 1JGUH 2EO1A 5C6TH 3ZDXF 3D69A 4F37F 1E4XI 2C4FT 1KLUB 2DWDB 1R5IB 4WEUD 2CR3A 1BVKA 5DVLA 1ZLVK 3HNTL 5E6IC 2K7PA 3BZEB 3NCYS 4JFOA 3JWDC 3Q6GH 2L7UA 4LKCA 3IKCA 4TTGA 5I6XB 5ILTL 2DQEL 2A73B 4WTZG 4NQDE 3VI4F 3WXWH 2Y5TB 4UT6H 3SDDC 1U2HA 1W72H 4PR5A 4TTDC 5T3XD 2JE8A 5E4IA 4ZFFB 3V0WH 1WICA 2V7NA 3GNMH 3O0RH 4M6NH 4PJCB 2GJ6D 4NOBA 5GGVL 1N4XL 3GMMB 3TO4B 4ZMAT 1MUJA 4OTXH 1QEWB 3IS0X 1DBJH 4WHCA 3QQNA 3QHFL 1Z0NA 3DV6B 2XZQL 1OP3K 1RULL 4ZTPL 1IC7H 4I3SH 3LKPA 4QT5B 3V52H 1F3RB 2HLFC 4WWKA 3QEGL 4QRRB 3WKML 1JGDB 3GMOB 2FR4B 1CE1H 2NX5B 1YYMH 2XTLA 2EH7L 3GSXA 1MQKL 4O9HH 1YYLH 3EOYG 4OF3A 5EU6E 3GK8L 4IOSD 4OFIA 1BD2E 1WTLA 1IJ9A 4HGWB 1KGCD 1JGEB 4PRNA 4WHTB 1MRDL 2CPCA 3L3JA 4QTHA 2CDFA 1X5IA 1RJCA 3HE6D 4X6CB 5TQ0H 4E9LA 4OKVA 4LLMA 4UBDC 3I50H 5EOQL 2IBZX 4KXZH 4HXAL 4MZ2A 5D5ME 1XIWB 2N56A 3FO0H 5I1LA 3BKYL 4YHZL 4H20H 3AY4A 3O3BB 5HHVH 4LLYA 1UWXK 1H8SA 5F71A 4RFOH 5D7IA 5HGHA 2PCPA 2XIDA 2VH5H 4YFEA 3GRWL 5KJRH 3ZDYE 1G6RB 5F96H 3DO7A 1G9ML 4BH7A 4XP6H 3SOBH 3SDXF 4I13B 5HGBA 2W91A 2Q76B 3ISWA 4EN3A 1NMCB 4XNMB 3NABH 4MMXC 5DD5H 5DQJB 1FSKB 2PYFA 4NNYA 3ZE0E 4ONHA 1Y18A 5E5UB 5B39G 4BUHA 1H3GA 4MNGE 5DVOA 1T20B 1WZ1L 3UBXB 4FG6D 1BP3B 3T2NL 1KTKE 1FL3B 3WNMA 4Y1AE 4APQA 1HHKB 1BJ1J 3D39A 1NFDF 1HNGA 2R2BB 3OKOB 4S1QL 4RAVB 5HGDB 3WHXB 4PB0H 3H3BC 3MRKA 5C0BD 1BLNB 4D3CL 4L8BA 4HF5L 4XHJD 2ED9A 1YEDA 3K8KA 2XT1B 1CU4L 1HQ4B 2PYEA 5D1XB 5ESAA 5H8DA 4YIQB 1W0VB 5J4MA 1QSFB 3ZL4H 3U6RA 1YNKH 1G7HA 3CZFA 3GIZH 4PGDB 3U7YL 1T3FB 1NDGB 1EHLH 3EYVB 1L9NA 2FEDD 1T1XB 4PJAA 1JPFB 1FNLA 2R2EB 2YSSB 1T6WA 1KULA 2E7CA 2HT4C 4KMLB 5BV7C 4CDHA 5LWYL 3DX9A 3QUZD 1GZPA 35C8L 1FZOA 5HI3C 3ARUA 3LKSA 2BXZA 4HJ0D 1D3CA 4PG2A 5EFIA 4ETQA 1U3HC 3CFIC 4HAFA 3HC0A 4KUCD 5DA4A 3WS3A 1JI2A 4QWWC 5ENWA 4M6MH 4JG0H 3U0TA 4XVJH 1ZEAH 3MV9D 5I1IL 1AD9B 1XGQB 4P2QB 3WLWD 3HNVL 4P4KA 5K9QI 3VXUA 3WUWG 1UA6H 3QNYB 3R0NA 3P4OB 1U8OB 3VXMA 1VFAA 3PGFH 1I4FB 1YJDH 3QUYC 2VUYA 2J4WH 4FQ2H 1KT2B 3UC0H 4Z7OE 5AD0A 1JNLH 4UOW0 3RKDC 1YC8A 4X0KB 1Q9OB 1ZVYA 1J9CT 1FQ9C 4FQ1L 1UFUA 3KAAA 5ITFA 1EJ6A 1U93B 4G8IA 4BQBA 4HUWA 1YJDC 4PRHA 3LKRA 3VE0B 3JWOL 1OHQA 3QWOB 1HKLH 4JFDB 4JZNA 5D7LD 3T65B 4TYUA 2OXGA 4RGNB 1CQYA 1OSZB 3MACL 1BIIB 3RFZC 4NRXB 2P45B 3BZ4B 3TO2A 1DVFB 3ARBB 4HKBA 5ESVB 1XF5A 3QDJB 4UTAH 5F1SA 5DMYA 4OSUH 1A0QH 1K8IA 3EGSB 4Z78B 5C0IB 4OLWL 3RPIA 1CIUA 5C0NC 2C26A 3TT3H 3LZFL 3UTZB 5C8JB 2HG5A 5EB9A 5HYSG 5D1ZB 4ZS6D 1QNZL 1C7TA 2NY1B 5HDLA 4D9QE 4TPRL 4JQIL 2LVCA 2GTZA 5I1DB 4PLJC 1T2JA 5HYJD 4XP4L 3TO4C 3GSRA 3U0PB 4NRYB 1FH5L 3BDXA 1EXUA 4Z7VB 3B6SB 1G7IA 5INCA 1AY1L 4C56D 4KRPB 3TYFA 1HXYA 1ERNA 2IFGA 1U8QB 2EYRB 3VI3F 1U8KB 4GG6A 1HNFA 4UV7L 2V5MA 3HE7D 1HHHA 1Q8MA 3QUXA 5I30L 5DSCA 5TFSH 1HH9B 4WFED 5CEZL 3W39A 5CEYB 4GW5B 4DN4H 2MHAB 5EZLA 4L3CA 1G0DA 2EC8A 3LEYL 2D7TL 3RIAK 3RAJL 1NCBL 1DSFH 4EDXA 3H9HB 2X4OB 3KPOA 4Y1AA 2IEPA 2IG2H 5JIIA 4IHOB 1I8KB 1JHTB 1A1NA 4JFQB 2HN7A 3HPJA 1G6RH 1K6QL 1MJJA 3G5XA 1XIWC 2GY7B 2XQYG 2MWCA 5IR1B 5GGVY 1YPZB 1MEXH 5LGJB 3QUML 5ID0B 4X99A 1X5KA 2VKXA 5FGBA 3I6GB 3PJSA 2EE6A 1U8MB 2UUDK 3HAEB 5FO8A 2G5BB 3W0WD 2OL3B 2BOCA 1OGTB 4TNWF 2CIIB 1KIRA 3MRQA 4PRAA 4OZGB 3KR3L 4LHJB 2F15A 1P7KA 5GGTH 5AG8A 5E0QA 1FFRA 2ZOLA 3MC0A 1FSKC 4IMLB 3IRPX 1H8OA 3U0WL 1CICB 1CG9B 1TMCB 1LE9A 1ED3A 4LSUL 1MCJA 5CMAB 4HUXA 4PGZA 1MAJA 1FV1A 1TNMA 2P46B 1A1MA 4F7EA 1IGIL 1F4XH 1P2CA 5GGQH 3REWB 1LO5A 2X1PA 1MHHA 4PRIE 1S9YA 2FB4H 4GUPB 4P5MA 3T4YA 4RMQA 5HHME 4PP1D 1ZWIA 4U1NA 2XPGA 1MHCB 1X4YA 2E8ZA 2GIYA 3LS4L 4RSVA 4LPCA 4YDKL 4OZ4A 4HEPG 1KJMA 4YQXH 4ODBD 3RDTA 3S3PA 3WEXA 3C8KA 2R4RH 1QR1B 3IFNH 4YHOL 1X7QB 2H8PA 1OP5H 1C5DB 1J8HD 3A6BH 3O9WB 1KCVH 3IJYA 4XVUD 1VENA 2FD6H 5D1XC 5IMOA 5IMKB 4KK6D 4GXVH 1IFHL 2VDRL 3MBEB 5DS8A 3IDJB 3P0YL 3ROLB 5EU5B 1OAXL 5E8EB 2EDDA 3IDYB 1H3TA 3TBWB 2J8UB 4YGVA 4NO3B 1JNHB 2CR6A 3NH7L 3QRGL 4CU7A 5C92A 4HH8A 3QH3A 4MQXC 1BECA 4JY4A 5E1AA 1CI5A 1QFWH 1K9TA 4UINL 5DJCA 1OP9A 3C5ZD 5I8CB 1J1PL 2UY6A 1VADB 4C58B 5T3XE 5HHQA 2IANE 1FPTH 4IRSA 4YHKL 2P7TB 2ESVB 5BVPH 2BNQB 5DT1H 3ARGB 1YEJL 2X42A 2DBJA 4HH9A 4PJAF 2VR4A 5FYJH 1UCBH 1R5VB 1L9MA 3F12A 2IPKA 3KPQB 1WT5A 5MERA 1N26A 1X3DA 4MA7L 1C1EH 4HFUL 4H26A 2VYRE 4LVHB 5D7JB 3MRPB 3B2VL 2HT2C 1F90H 4KMTL 4TQEH 3PV6A 1BQLL 3DROA 3ZSSA 3MOBH 4I18A 1RHFA 3ARDA 2PKDA 7FABH 1NCDH 1HE7A 4RGNC 4U1SB 3FJTA 3FOLB 3F58L 3N1GC 4G3YH 5EU3A 1DVFC 3ARBC 4LCYB 3WNNA 3B9VA 1ZANH 2DQUH 1WZMA 4B7LA 3GMRA 3CNKA 1CYGA 2W65B 4J3WA 3SDCC 3GMPA 3H9YA 3RX7A 1KEMH 4XI5D 5SV4A 3CFEA 3VXNB 1FYTB 3VCLA 4Z0BH 2FZ3A 4QXWA 5F7FA 3SKOA 4MD0B 5D1ZC 1NCCL 2NY1C 2GCYB 2HKFL 3MRJA 2WWKT 4NSKB 4HLZH 4OD3L 4X6EB 5KANI 5C07B 1Q1JL 4ZFOL 6FABL 4LCWD 3CVHA 3MLZL 4NYLB 4PUBH 3IAGC 4YHML 3VFTB 4GAYB 3VWJD 2A1WL 4OZFB 4JY6A 2IMMA 1Q9KB 3H9SE 2F19H 2ZUSA 2NYYC 4N8PA 2VLLA 4P3DB 4HBQA 4NO5B 4NKIH 4KRPC 4GQ9L 4G8GA 3V5DA 1TLKA 5I1KH 1OCWH 1NFIB 4M1CC 1RUAH 3HG1A 4Z95L 3EO0B 2XA3A 4P9HH 1CF8L 4PTTB 4F9LA 1RUKL 43C9A 3GSUA 5LCVH 4G6JL 2AXFB 1C5CH 5BRZD 2ITCA 3FT3B 4DGIH 4P9HC 4Q97A 1IGCL 2DKUA 4KFZC 4GMTH 4LNVA 3ES6B 1OAYL 4R2GD 5C86A 4TVPH 1T1YB 3X11B 4GG6F 5C0BE 2H26B 4QXUL 4X9IA 4QHUB 1HYSC 1MQ8A 2XQBL 3HAEH 2NW2B 2VL4A 2OL3H 1N5YH 4OUUA 3STZB 3VXPB 4FQXA 4P2OD 4K94H 5DJ2A 4F9PC 5FGCB 4M5ZL 2YD2A 4JFZL 1NC4B 1S9VB 4GKNB 5JO5B 1CVSC 5TPWL 5D93C 5I76A 4KKCC 1LEGB 2YPLB 3HMWL 4K94C 2FO4A 5E2TL 1RIUH 1WBXA 4K55A 2M26A 1A22B 1EMTL 4Y4HB 5IVOA 5JW5A 4OD2A 3S34L 3ZSTA 4MAUH 3DX8A 4C57C 3QDMB 5K9JL 3M8OH 1YDPA 1X44A 5AEAA 4OCYH 3BDYH 3HTLX 1DQJA 1QFHA 1KF9B 3HHRB 3P30H 2APVA 4LPUA 5KVEL 2D7NA 3I6KB 2BSRA 4YHNA 4J8RA 1FO0H 3BP5B 5H94A 2RBLA 3W2DH 2YZ8A 2HTLD 2E9IA 3QIUB 2B1AH 1KYOJ 4JN2B 2VDNH 1MY7A 5IVZA 4U0QB 4MVBC 5GS2D 4QXTB 1ZT4A 1DUZB 4M62H 2DQCH 5IBLC 3O9WC 4D8PB 4HX1B 1NJ9B 1L0QA 1IL1A 2XXMB 3MBEC 2Q7YB 3O81A 3EO9L 4I3RL 1B2WL 2H9GB 5MI0C 1GYAA 5BOZG 1A6VL 1G7LB 3T0WA 4I77H 4JRYA 4MB5A 3AUVA 1EX0A 2COQA 2CO6B 5HGAA 4QXGH 5F1NA 1LO3L 1IGFH 2CLZA 3AS1A 4RRPA 3ARFB 4JCMA 3UJIL 5BXFA 2PW1A 1A64A 4L5FL 4URTB 3U7AA 1NANH 2VN4A 4PJDE 4RISH 3ZTJG 3SQOL 5D2LB 5GS0L 4WWID 4N0CC 4M8QB 3HCVA 3HZKB 1YMMB 4WU5A 5KSVB 3ARGC 5KOMC 2NY5L 3V0VA 4J1UA 5CKGA 5E99H 2BNUB 4HFWA 5CD3B 1XH3B 2VDQH 4RBPK 4YHLH 4QCIA 4PJ8D 1EDQA 4UV4H 4LPWA 3RGVD 3LQAH 3QO1B 3SDAA 4JQXA 1K8DA 4P5TB 4BZ2L 4C56E 1IARB 1ZHKA 4M48H 3H9SA 5GJSH 1D5IH 2IQ9L 5D7JC 5IW3A 4YK4B 3RIAF 4NHUB 5EU7E 5HYIA 3LQAC 1ZSDA 3KPRE 2V6HA 3IXAA 5SWZB 4WFEE 3H3PL 2VIRB 5J3HC 5E5MA 4GRLB 4ONFL 4U6HA 5F7LB 4RMRA 2XZAH 3MUY1 4XBGB 3QZWB 1PBYA 4IRJA 1JPSL 2VQUA 2PO6A 5C7XL 4HUVB 4L8SB 4PJFA 1LD9B 1SEQH 3Q5YA 2FHFA 1SM3L 1GSMA 1AGEA 4KKLC 4OIIL 4NQDB 4GQPH 1IQDB 3DYMA 5FO9B 1Z9MA 2AJVH 3VI4E 1PLGL 3PWNA 4ODUA 4F15B 2CUHA 4HMCA 3W0WE 4PG9A 2FECL 3BPCA 1SVZA 2R1XB 1I1FA 5KS9F 2WWKO 4OKDA 5EC1A 3VFSB 2YD8A 5I2IA 1Q0YL 5CHNA 1I9JH 3NCBB 1WGOA 4XMLH 2BDNL 4EI5C 1WWBX 2RIKA 5JXAL 3P0GB 4ZQKB 3EFFB 2OR8A 4HKZB 4L4TE 4XGZA 3F5WA 5IBTL 1NGXA 3HB3C 3OKYA 3SKJH 1FNGA 1AO7B 5JHDB 4OFYA 4F7TA 4ODTL 3LN5B 3AU1B 1N2RA 1LK2A 5E2VL 4G9DB 5EU6B 3TCLB 1YY9D 1BD2B 1OAQH 5LVEA 2BRRH 1AKJA 4YDJB 2VL5B 4N9GA 1FZKB 4QY8A 3VXUD 4P3CL 3RTQB 3S36L 1F4WH 4DN3L 5HHOD 3VXMD 1OAUH 2XKSA 3IDXH 1KN2H 4ODWA 3PNWA 3WYRA 5D5MB 3F62A 3PGDA 3WIHA 4OGYH 3JV6B 4FMKA 3QJHB 3CK0H 2BOBB 3WV0A 1M71A 2HLAB 3D48R 3KYMA 4YWGH 5JR1H 4XC1H 2QJDA 5GZOD 4FFYH 3WFBL 1G7PB 1OTSD 3ZE1E 1IAIL 4Z0XB 2XRAH 1MFCL 3KPLA 2X4NA 4GG8B 4YUEH 3QXAB 3MLVH 5IB5A 2XWJA 1FCGA 5AYQA 2VITB 3DVNB 2W0PA 1CTNA 1CXEA 1XGPB 1MVUB 2FGWH 4MNGB 3BVNB 3I75A 1OPGH 1OAZL 1TNNA 5DQDH 3CCHA 4XH2A 5F9WB 4L4VA 5MEPA 4U6XA 3X17A 3HC3L 3VRIB 3KPTA 1WCBB 1ZHLB 2Q6WA 3LPGA 4YXLL 3QIUC 4RFEA 3PF2A 4ORGB 1NGPH 5FHAH 4BA8A 1JMXA 5I18L 3U2SA 1IEAB 2W9DH 5B39B 4GW1B 4B41A 3RY6C 3KPRA 3WE6B 1YEEH 2C9AA 3QXDA 4FZEL 1T0MB 1QYGL 4ZAKB 1U92B 4DWHA 2DQDL 3WL9A 2X1WL 4AT6B 3UTQB 1SVCP 4L8DA 2BMKA 5IJVA 1NCNA 4QRTA 4S2SA 1D9KB 5GSRB 1WFNA 3OGCA 1EAJA 2YS4A 4HIIA 4UAOB 3SE8H 5FM4A 1TFHA 4H25B 3DSFH 3DIFB 2KKQA 1P6AB 2R1WB 1UM5L 2A74A 1WBZA 3GIVA 1VFBA 2EZ0C 2A77L 4U3XA 2YPVL 5F1KC 4EBQL 2AK1L 3EO1A 1VEPA 3OXSB 5DD6B 5C09E 4ENED 1JN6B 3VFVB 1OGAB 5CEZD 2X9YA 2I5YH 3KPPA 1IM9D 5AZEH 1NAMB 1I3UA 4OV5B 2PUQT 4TSBH 3D2UD 4MQ7A 3RWGA 3X12A 4FQHA 3OJ2C 4L4TA 3UO1L 5DD3H 2H32H 1BVLB 1OARH 4LU5H 4LDOB 3PG2A 3OSKA 1YNTB 4GRLC 4TSCH 1NLBH 3UAJC 2IADB 3LPWA 4JJ5A 3WUWB 5BRZE 3EYOB 4HS8L 2L7JA 5E6ZA 5E9DB 4HWBH 3L1OL 4RCAA 5HY9A 5EH1A 5F6HI 1CFBA 5IB4B 3S3JA 4AZ8A 1IC4L 1JFQH 1FGNL 3RDTD 4EZMA 2ADGA 3A67L 4U3CA 2VLJB 3MNVB 1UXSA 4MDJA 4QNPE 4NN6B 5DJAB 1AIFB 4FP8H 4F15C 4PIRF 3GBMH 1RZKL 1BJ8A 1S7WA 4XT1C 4ZFZA 5C0EB 3T0ED 4PJFF 2XI9A 2ADFL 3V5HB 4A6YB 2F8VA 3NCCB 5DMKA 4Y16B 2XKUA 4ZXBC 4HV8B 4X98B 4U1IB 4AG4L 1JIBA 4NN5B 5F7NC 2J2ZA 2AGJH 5LGKA 4MAYA 4EVNA 5F93C 5JW4N 5HYSB 2X6MA 1NUFA 1VGEH 5A16A 4WV1A 3JWNC 4S0TD 3FTGA 5FECB 1KCUL 5FGRA 4KRLB 1DQDH 4K3GA 2OP4H 4WRLA 3KXFB 4G5ZH 1F2XK 3QIBA 3HLAA 3SBWC 5I17B 4P23D 5D4QA 3GMQB 2RGSA 4P9ML 5T1KD 3KYOA 2C3GA 3D85A 4TULL 4AH2B 2Z4QB 2ZJSL 3SKMB 1XCQB 1GGBH 4PJXE 3G5VB 1V7NL 4JR9L 5C0RL 2Z31B 1FGVH 1RIVL 5D96B 5CGYD 4JPVL 3LEVL 4Z5RA 1HKFA 1WQVT 2I9TA 3QIWB 3IT8D 4X9HA 4JZJB 3CLEL 1GGCH 5FYLL 2ADJA 1P4BL 2OK0L 3BPLC 3QXUA 4OLUL 5DJDA 1JUFB 1IT9H 1KBGL 5FA4A 2ID5A 5D1QB 5IEKA 1RUMH 3RUGA 12E8L 4HIHB 4NQEE 5DLML 3GBLA 2AERT 1KPUB 3K2MC 1LGVA 2I60H 3BD4A 4HDIB 2HJKB 2PF6A 3OV6A 5IGXH 3FT2A 1NDMB 5I9QB 4KK9C 1Q94B 2HJLB 1E28A 1BMGA 1ZA3A 3HI5L 4HSQA 2HFEA 1AP2B 3FAWA 4MQSB 4RDQG 2Z91B 3LQZA 5B3NA 5DC0A 4XPGL 5F9WC 4F33A 1PEWA 4U33A 3O2DA 1NEZG 4WO4A 4PRIB 1KN4H 1PYWA 5HHMB 4RMVA 4OB5H 3BXNB 5BVJA 3FB6A 4WTWA 5IQ7L 2HJFA 2PW2A 3MRBB 5FV2A 5TH2B 1U41A 1B0WA 4DGYH 3HG1D 3QSKB 3GJFB 4K3JH 3HR5A 4UT7L 4J12A 3IF1A 4CBPA 4Q9RH 3FONA 2VR9A 3VD4A 3VRJB 3GSOB 4ZAKC 1CXIA 2EECA 1MJ8H 3OR7B 4CU6A 4M6AA 4NFBA 5LAXB 4PP2B 3GHEL 1INDL 4H8WL 1DN0B 1T4KB 1ZA6A 1S7SB 4WUUD 3VDBA 1FBIL 1IM3A 3L3HA 4RGMB 1GAFL 3QQ4B 3TEUA 2DWEA 3ZKND 1WC7A 5CUSL 4HCRA 3ZYIA 3I6LE 5BV7L 2HP4A 3RWHA 3VH8A 3MRCA 1SY6A 1EAPB 1HHJB 1XGYH 1QA9B 4J4PD 1EERB 1NAMH 4HS3B 3R1GH 1F4YH 2GJ6B 4UQ2B 5D8JH 3QB7C 3BOVA 5DZOA 4JJHA 3MLRH 5JMRA 2XV6B 3TIDB 5I1GL 5TDOA 4NWTH 1M7DB 2LU4A 4OM1H 5DRWA 4XPFH 1TJGH 5I15L 5E94B 1CFVH 3FFDB 3LPFA 5DC9B 1J1OH 4ZD3H 3UCRA 1B0GB 3CUPB 4M7KL 1LO4L 1EEZB 3U83A 4XCFL 1GIGH 3MXWH 3ZHLA 2V9QA 2PXYC 4M4PA 4RMWA 5FYJU 2A2QT 4HC1H 3HZYB 4AIXA 2I9LA 1XR9A 2WIIA 2HRPH 5MP6L 2JJTA 1DDHA 1IZKA 3EOBA 3PQYA 3QFJA 4LQFH 5D6CB 5DJ0B 5HHOE 1JV5B 4X4YB 3UTTA 5EZIH 1UH3A 1NBYA 4U1MB 3TVMA 1SBSL 3BHBA 4V1DD 5F7DA 4PJXA 1PSKH 2NY3D 5IHZB 5CINL 4J3XA 4ORZC 5D9SB 4Y2DA 4Y5YA 5JXEC 4X4MA 4AENB 4KDTA 3GSVA 3UPCA 1MFDH 3V6FB 2AABH 3G5YA 3JTTA 4G7VL 1AGCB 1U8LB 3LRSA 3DO3A 2V5RA 4M7LT 1RJYA 4NQVB 1KLGB 5IVXA 4PJBB 2YEZB 1S3KL 4Y16C 4X4XA 3JVGA 4J6RL 1WJ3A 4UTBH 4WI2A 1X5FA 2XA8H 4E0RB 3D0VB 2ATKB 3MGOB 2DDQL 3O4LA 4O02H 1TQCB 1MJUL 1OTUC 3E8UH 4I18C 2LE9A 2LQRA 2PTUA 3ARDC 5C6WH 3C6LA 3MNWB 3TNNB 2WBJA 5L6YL 5L0QB 1B88A 1JTPA 1CGTA 2ZG2A 2XY1A 3G9AB 3OKDB 5B38A 4GBXA 3FQTB 3IJHB 5SWSD 2Z31C 3L3GB 2WSKA 5IMMB 5C0BB 4IM8A 1S9WB 5E24E 1A7OH 2R0LH 3CVHH 1FVCA 1Z3GH 4LP5A 4XCYB 4YDIH 4FNLL 3WSQH 4OM0H 3QIWC 2UZYB 3MREA 1NMAL 3MSPA 2ZUQC 1HILB 1T1ZA 3KJ6L 3M1BA 4JRXA 3U9UA 4MXVE 3SGEI 1PGRB 4WVRA 5A2IH 3ULVF 1DUYA 3ZHDA 3VFOA 3QISA 1NBQA 4PRDA 2HFFA 3QUZB 5FA3A 5KZCD 5FKPA 4NC1E 5I9QC 1NGZA 2XFXA 4W81A 1U8IA 5I8OL 2GQHA 1GOFA 1RIHH 2XZCH 3RUGF 3MV9B 1K3IA 3NIFE 2HTKD 4LNRA 4XCNB 2J6EL 4G6AC 3RJQB 3JV4A 5B8CB 5CEZE 3GJFH 4NKDA 4ZYKB 2CDGB 4DGVL 4PJHA 3U1SL 1D5BA 3UJTH 5DD1L 3VFPB 3MZTA 2DIAA 2I27N 5AAWA 2ZKHH 3OPZH 2I07B 3A0OA 4NGHH 2X5PA 3L5IA 4KHTL 1C5BH 1J12A 2NY2C 5DD0H 4FQXC 1BAFH 4JRWA 4OAWA 5ELIA 4F57L 3SO5A 3VG9B 2EXYD 4K7FA 3RWFB 1F3JB 4OF8A 1CFTA 4FHBD 4PV8A 4Z7UF 4OCRL 1FORH 5D7LB 2NY7L 3I2CL 3C9NB 5T3XH 1CFQB 3GB7B 2NNAA 2VDMH 2CKBA 1AQKH 2P8PA 1Z9SA 2G75A 4RGMC 1I1AA 3KYNB 4BELD 4L3ED 1X6LA 2AI0H 4ZUTA 4PJDB 3VG0H 2FH8A 5BJTB 2DN7A 3O8XA 3P9MA 4PBWD 3CGTA 1CTOA 5KVFH 1U3YA 2O5YH 3T0EE 1ORSA 3FQNB 1LK3H 4OCWL 2YRZA 3VFRB 5HYJB 4L8CA 1NLDH 1I7UA 4F7CB 1MHPH 5JIPA 5I19L 3RVWD 1YEHH 1FZJA 1JNJA 3INUH 3WJJC 3GMLA 1R24A 4QGYA 3ARZA 1IGJA 1N3NB 4LLVA 1FNEA 4XNQB 1WEJL 3QG6B 1IAKB 2XNAB 4D2NA 1DCLA 2EO9A 4ELKB 1H3PL 3U30B 2FL5B 2JCCA 3WFCL 4D9LL 1KJ2L 4Y5XC 4NBZB 2J12B 1UG9A 3NPZB 4U1JB 2CLRB 1AJ7H 1LEKA 2OSLB 1V5JA 3MLWL 3HE6C 4BM7A 4NFCA 4ALAH 4BFIB 1I1CA 1MCBA 1HDMB 5DJZA 3CXHK 5D72L 4HHAB 4N0FA 2APXA 1MFBL 3PP3K 2BNRD 4U6VL 4ELME 3DPBA 2H3NA 3QAZC 4HJJH 2ARJQ 3PDOA 3BO8B 1TCRB 1BWWA 1TETL 5CBAA 2B4CL 4YHIB 4OLVL 5DUPH 4NKOB 2ZSWA 4L9LA 2OQJA 1T7YA 1WLHA 2Y5EA 3KDMA 4JDVB 1RUPH 3W0WB 1DQQA 4D0DA 2JJUA 3ZTNL 1BZ7B 4KU1A 3BAEL 2QEJA 4DEPB 1IVLA 4QRPA 2CDEB 4JHAL 2IPUG 5LKNA 1F11B 2VQ1B 5KS9E 1BGXH 1MI5A 3RU8L 1G7QB 1KFAH 3SE3A 2VJXA 4U7MA 2H1PH 5I0DA 5EO1A 3V6OA 5ICZA 4JO3H 1JF1B 1BQSA 4D94A 5DRZB 5IVXF 3C8HA 4MCYA 1TQCC 4I8DA 3BSZL 4UT9L 2XWBB 1R3JA 1RHHB 3S96B 4FG6C 1J8KA 3G6AB 1TZHB 1W0WA 2C4XA 1X6NA 5ICXA 3FB7A 2Y07H 3EBAA 2EDJA 4TUOB 4AK1A 5GRUH 3NOIA 5L0QC 5T33L 4X5XA 5SWQB 5CWSB 4DK6A 2VXTH 5TDPA 5EIQA 3BQUA 3E3QE 1ORQB 3NACL 5JW4Q 4F2MA 4GAJH 4AL8H 1JWUB 1P1ZA 5GJTH 4MJ6A 1J8HB 1A7NH 1FG2B 1JI1A 2YC1B 2DQTH 1JNNH 4HGKC 4KV5F 3GI8H 5C0DA 2QSQA 3OJVC 3QUMA 1DEEA 1RZGA 3MV11 4WUUE 2FEDC 3BPOC 2DTML 4GMSL 1F6AB 1AD0B 3I9GH 4PLNC 1S7RA 2GJJA 2R0ZH 1FN4A 3C5ZB 1FL6A 4OZHF 3LCYA 3GSNB 3SDXB 2DLEA 4OGAD 4YFLI 4KZDH 4JQVA 3KJ4B 15C8H 4GKZA 4HJ0C 4UMGA 3KPSA 2RQ8A 3FAXA 2NXYC 2FIKA 3U9PL 4Y4FD 1PAMA 2XN9D 1ITBB 3L3OA 2OLDA 5IWLA 4P4RB 4QOKD 5E2WH 5JDSA 4JFFE 5DR5L 5TE4L 3BGFB 5DQ9B 5KTEL 2HVKA 5HVWA 1JPGA 1J0KA 4E42A 3W5MA 1EFQA 1UJ3A 1X5LA 3LOWA 1MOEA 4LVOC 2W0KA 3SQBA 5DUML 3LN9A 4HQQH 5F21B 1CLOH 3NZHL 5IV2B 3CXDH 5I1HL 1NC2A 2Q8AL 5D70H 2C7UA 1NFDB 3B9KD 1CK0H 3BKJL 4L29B 3VWKA 4XNYH 2X70A 3VG9C 1GJIA 3N0PB 1DBML 5FM8A 2VTFA 3O6FA 3V6ZB 1F45A 4RMTA 3GBNL 5EG6C 2PR4L 3OG4B 1ZLUH 4BSWB 1E6OH 4D0BA 3RNQA 5GS3A 2QV2A 5DEGA 4PRBA 4JGMA 3DURA 1IAOB 2RFXA 3C08H 3J7HA 4V1DE 5GZNC 3QI9A 2D7OA 4M3JA 2RCSL 5IBUG 4JHWL 2QHRL 2JELL 4XNXL 4UNVA 3O6ML 1YEGH 3TJEH 2ERJC 5FIEA 3KWWA 3S3SA 4YO0B 3UTSD 3ULVD 2P5WD 2DRUA 2Q8BL 5I1CL 4ELMA 4ZS6C 1P7QA 4PV9B 2OI9B 4YPGA 2B1HH 1BEYH 4UNTA 3KNBB 4MNQA 2CK0L 3TBYB 5JA8B 4PJIE 4LCWB 1WIPA 4M6OL 4JLRA 1CD9B 1GHFL 4HJGB 2WP3T 4OFPA 3CC5B 2LTQB 1OAKL 3VWJB 3W5NA 4KJPD 3RL1A 3FRPG 1UM4L 4NHCH 4IJ3B 4NNXA 3ARPA 5EU7C 3HE7C 2FH6A 4PJEA 3V4PH 1J7VR 4ZPVB 1Z2KA 2G5RA 3TN0A 3U30C 3RA7L 5GGSB 3VFGH 5GRYA 1QBBA 3PWLA 2E7MA 4WTXA 5BRZB 2WMPA 5FYLD 2W60A 4R2GB 5SWSE 4TUKH 3EYFB 4PREB 5IHUH 3CFBB 2XWTA 2VABB 5F6HJ 3WD5H 2WNGA 4R96A 1KB5A 2JCCF 3SDYL 2R1YA 1AC0A 2D31A 4IOIA 4LLWB 4P2OB 4ZODA 3DRQA 3QXVA 5I71B 1TZIA 3RWEA 1TJIL 4LARH 3T2OA 4GH7B 2GSGB 1JF6A 4MB3A 1EJOL 1ZVSA 2BY1A 5EBMA 2ZCKL 1BVKB 3B2UD 3V5KB 1JWSA 2AJSL 4F58H 4ZFOA 2C4FU 4JPIA 5DMIH 1MCPH 3FO9B 5GRVL 1T5XA 5J8OA 2OTUA 4DW2H 1YEKH 2NTFA 1MRFH 4OFKA 5JOEA 1SJVA 1RJZA 3IFLH 1AE6H 1MSPA 4G43B 2V7NB 3UEZA 2R0WH 3AS3A 4KVCL 4G7YH 1B9ZA 1MF2L 2K1MA 5IB2B 3DUSA 3O6LH 4NM4L 5KSBE 5L7XH 5JNYB 2ARWA 5CSZA 3D3VA 4WJ5B 5ANMA 4JO2L 1WCQA 5CILH 1UVQA 1PX3A 4QTIH 5EC2B 3LKPB 1AXTH 4XVUC 3G6JA 4WWKB 4KK6C 4N8CH 4N8VA 1IKFL 1OAQL 4S11A 3X3GL 3C87A 2ZNXA 1UZ6F 4P0DA 3B5HA 3V8OA 5HYEA 3P9LB 5GQBA 3GJEB 2AEPL 3GSNH 5JORB 2CIKA 2X9XA 2P4AB 3IDXL 3MCKA 4PRNB 4MA8L 3NPSC 5DZLA 2F8XC 3UTTD 3TVMD 4MAYC 2MKWA 2AAVA 3GO1L 5DDHB 3V79C 1EFXA 2E27L 4XB7A 3BPNB 1RMFH 4Y2DD 3BT2H 5CIPH 5I1LB 5C0CA 1TXKA 3BRFA 4X7EC 1GC1L 25C8L 2ED8A 3KLSA 4OBRA 4U1LA 5CJQH 2PCPB 1E6JH 5JLZA 5ADOL 4PJIA 1I9RH 3BGFC 3TV3L 4OQTH 2CMRL 2YXMA 4KI5D 3RGVB 1CE6B 2J5LC 1AC6A 3MRHB 4BH7B 4Z7NF 3WFHB 3MUHL 4R4FH 1ACZA 5HGBB 3TWCH 4NZRH 5I1EH 1A6ZA 2VMFA 4RAUA 1GGTA 3QQ3A 2VB5A 4GFTB 2A83A 4M1GL 2PYFB 1U3ZA 3HMXA 3E2HC 1KPRA 4AEHH 3OKKB 2E6JA 4ONHB 1J0ZA 5FUCE 5D7SH 4OF0A 2PN5A 3WS6A 1NEZB 1CL7I 1NUGA 1YN6B 3TBTB 1QRNE 1VEOA 2UZIL 1RY7B 2FRGP 1S5HB 3IFOB 5L2JA 4KGJA 1YECH 1BHGA 3RIFF 3U46A 5EPMB 3W9EA 3HI6L 3RPKA 1OT2A 4KQ4H 4XI5C 3C09B 3JTSA 1XF4B 4LOUD 2BNRE 5FOJA 1M7IA 3RZCA 4OT1L 1O5DT 3TIEB 2OI9C 5BO1L 2IGFH 1ZTXL 5CD5D 2VXSL 3CZJA 3AM8C 4O5LL 4OI9A 4NDMB 5BS0A 4KTDL 3DRTB 2QADD 4R26L 3CZFB 2LTQC 3VWJC 4DQOL 1YA5A 4PJAB 4BUGA 1EPFA 1VA9A 5T1LA 4HIXL 2QQLL 2WP3O 2ZCHH 2C3VA 1YY8A 1TVHB 2VLKA 3OB8A 4DFHA 1IZJA 5F9DC 5J6HA 3FN9A 3DX9B 4QHLA 4NRZB 2CJUL 3AB0B 4IJ3C 5EUOA 4N0UA 1NMBH 5EFIB 4NOFA 2R2HA 4ETQB 1ND0A 1CBVL 2YUZA 4HK0B 4FABL 2YA1A 5F9AC 2VDLH 3WS3B 3T77A 5ENWB 1YEIH 5IROA 4TNVF 1MCOH 2IJ0C 4ODXA 1GGIL 3FFCD 1P84J 2NR6D 4P4KB 3VXUB 4DZ8A 4R2GC 1SY6H 5A40E 3C5SB 2ZSVB 3VXMB 5HHOB 5F9OH 1VFAB 1I8MB 1NBZA 2R8SL 3GMNB 3BW9A 3FQRB 4PTUB 5FF6B 4MXQC 1AR1D 2H6PA 4P2OC 5IG7A 4FQIH 1K85A 3WJLC 3PDGA 1T03H 4P49A 3LMJH 2JK5A 1M1SA 1NGYA 3DHMA 2EDWA 4LKXA 4E41A 1INEH 1NAKL 1A9BA 1T04A 4JZNB 4C83B 2P8LA 2IAMA 3MO1A 3QCTH 4EEEA 1T0NA 5DXWA 5LGHH 5KSAA 2YN5A 3AS0A 1OT1A 3ARED 1JVKA 4NZTL 2G9HB 1R3HB 2WUBH 1XF5B 4M02A 4P46A 1I1AD 3GI9H 1CDBA 4M00A 3NFNA 4R97B 4UDUB 1KXVC 4Z8FL 3QA3B 4X6FA 3MV7A 3HNTH 4HPYL 3U36A 5F9JA 5GS2H 2GTZB 3O41A 4F8QA 3BUYB 2HTLC 5ILTH 2DQEH 2VLRD 1FFOB 1U9KA 3WLBA 3GM0A 5ETUA 1ETZB 3ULUF 4LCIL 3STBA 1WBYA 3TYFB 3QDGA 3TZVA 4PGEB 5E8DL 1LMKA 5LQBL 5BZWA 5HYQB 5IHBA 2ZG1A 4NUGL 5GGVH 3DX6A 2ADIA 1HHHB 1N4XH 3QUXB 2X4PA 1QRNA 3QHFH 2KPNA 3L7FA 2UWEF 2XZQH 1RULH 4ZTPH 4EDXB 3UYRL 2WANA 1ZGLA 2E9WA 4POZD 1KOAA 1IC5L 5E2UL 3OR6A 4HKJA 3G6JF 3QEGH 3WKMH 3UTSE 1FVEA 1UQSB 3F7VB 2P5WE 3BPNC 2LVEA 4HUUA 2EH7H 1MQKH 1BOGA 4LLDB 3GK8H 4G6KL 3OKLB 1QO3B 3PHOA 4X99B 2R4SL 1MRDH 3L5WB 4PJ8C 3WNKA 3C6LC 3RGVC 3QFDA 1X9QA 5EOQH 5C0AD 3O2WL 1IM9B 4HXAH 4GBXC 1KIRB 3O11A 1MNUL 3BKYH 2FBOJ 4YHZH 3NA4A 4XBPA 2AVGA 1P7KB 2HRLA 3BI9X 5KVMC 3D2UB 1FG9C 1G1CA 1TZGL 3PWPA 4M03A 4OF7A 3GEWB 1EZVY 1EO7A 3GRWH 3DX7A 4CDGC 1CLZL 1G9MH 4JM2F 5CBEA 3MLXL 4JPWL 1A1MB 4JG1L 5F88B 5FYLE 2CUIA 3MLSH 4Z7UE 3GKWL 2W0LA 5JQHC 1G6VK 4KY1L 5I75B 1ZWIB 4U1NB 5IT2L 4ZOEA 4PGCA 4U1KB 5DHVA 5T5FL 5C9JA 1G9MC 2NPLX 4OZ4B 1AXSA 3L6FA 4M61A 2K7QA 4ZUSB 3RDTB 1BQHG 4LEXL 1DP0A 2NXZD 4P3WA 3H8NA 2D03L 5E5RB 5HDOA 1WZ1H 4PJ5A 5IMOB 3BESR 3S36X 4Q2ZA 3T2NH 3L3IA 3MJ7B 3T0EB 5HVHC 2VISB 1V3MA 4S1QH 4YGVB 4GLRI 1JHKL 4C4KT 1DZBA 2BHYA 2BY2A 5E1AB 3QH3B 4D3CH 4JY4B 4HF5H 1EHXA 1VFUA 4LRIA 3MA9L 2OM5A 1CU4H 2YRLA 2A6KA 3AB0C 4JGJA 1LEIB 5EUKA 3RWIA 1JHLL 3OJMB 4UI2A 1AGDA 2AQ3A 4MHHI 3MRMB 1MHEB 1H3VA 5C0FB 3U7YH 1T7ZA 4RX4D 3HFML 1YY9C 2LU7A 5IOPB 4P23B 5DO2D 2QQNL 5T1KB 3BD5A 3OB0H 3WN5C 1HXMB 3L3DA 3OWEA 1BFOA 2Z0BA 2VERN 5JHLL 5LWYH 5F3BA 35C8H 5EUOF 3BZFA 2HKHL 3AROA 3LY6A 3U7WH 2X89A 1V3KA 3LKOB 3L9RA 4JFPA 5J6GA 4QRUA 3X3FL 5E6IA 4H1LG 1ZV5A 5HD8D 4R0LC 1SEBA 5I1IH 5LXGL 3OTTA 3DSNA 3HNVH 4P57B 3N50A 2XACC 1LE5B 5C08E 4MSWB 3K4ZA 1D7FA 4I0PD 1FCCA 5L2KD 3SDDA 4F3FA 4FFWD 1CICD 5FYKD 1U42A 3CX2A 1UGNA 4G8EA 4BH8B 5GZOC 4U05A 4KHXL 1OTSC 2GEEA 5EU3B 4XZUA 4A6YL 2YPKA 2X7LB 3UJJL 3QI9D 4FQ1H 1WSST 5KS9B 3VXTA 2YD6A 4KAQL 2YA2A 1GZQB 3H0TA 5D71L 1W72A 1OB1A 3JWOH 3IDUA 2FZ3B 2DQGL 3IETA 2YR3A 2WK2A 4MNQD 5I16A 2Y36L 3MACH 4KI5E 4R7NA 2HA1A 4HEME 1GPOL 2Z8VC 3JWOC 3RL2A 1IGYA 2AJUL 4OLWH 1DL7L 4R8WL 1RZIA 3LZFH 1PY4A 5F8RC 5E8OB 2GK0A 3OHXB 1QNZH 1QKZL 4NBYB 3CH8A 3HG1B 4LHUD 4TPRH 4JQIH 4ONGL 3SCMD 3MROA 5EORL 4XP4H 3MFFB 4FA8A 5CJBA 1FH5H 3GSUB 1WFOA 2X4TB 3MJ9L 4FXKB 1AY1H 4WUUB 3NA9L 3AAZB 5F7EL 2DM3A 4AYFA 4PJCE 3QEUA 1ES0A 2CK2A 4MGXA 1A14L 5I1JL 4UV7H 2Q86B 4NJ9L 2F54A 4UIMA 4CU8A 3T08A 5IEHB 5I30H 4NC1C 1E4XL 4PYHA 4PBXA 4XTRD 5CEZH 1KPVA 4YDVA 2JB6A 3GSWB 3LEYH 4NQXA 2D7TH 3RAJH 1NCBH 1WTGT 2JJWA 3EJZD 3RVUD 1N7ML 4MA3A 1EEQA 5JA9A 4ZG1A 4X7TA 2F5AL 4ENEC 2EDOA 4QRRE 3JUZA 2P43B 3NCFB 2ARJB 3FQWA 1ZXQA 2W07A 4Z76A 1K6QH 4NO0D 1EO5A 3TA3D 5CZVL 4ZUUB 4MD5A 3QUMH 1NUDA 1S5IL 5JW5B 1KIPA 1LP9E 4PGBB 4CMMA 3DX8B 3PWUB 3QQ9D 4X6CE 3BN9D 4R9HA 2X4UA 4DKFL 2BZDA 1UACL 2AV1A 3FFCE 2AJXL 3KR3H 2VR5A 1SYSA 4V1DB 4LDLB 2NY3B 4UB0L 4H88L 3U0WH 2C1PB 4I1NB 4MB4A 5J1SC 1DE4B 4LSUH 5C07D 5DRNA 5KAQF 4XPAL 1UWEL 4ZFGL 4X6BB 3EDJA 3O3DA 1G7MB 1S7VB 1IGIH 1Q0XL 1IL1B 2FJFB 1MFNA 4GW4A 3T0EC 1NEUA 3LS4H 3QNZB 4YDKH 3HKFA 4RWYL 1S7QB 5IBUB 1E4WL 4JN1L 1ZGLM 4PJ7E 3SEPA 1U3HA 1U95B 2UYLA 2MSPA 4YHOH 4DKDC 1WWAX 1RK0A 2BC4A 2ZP0T 3IFPA 4EI6A 1YMHA 4QYOB 4C4KO 1IFHH 2VDRH 1CT8B 3VWKC 2DYPA 1MCSA 3P0YH 2DMBA 5IQ9A 1OAXH 4JFYA 3HCVB 1K5NB 1XZ0B 4WENB 4PY7A 5DFWH 2YMXL 5ISZD 3MYJA 3QUYA 1CD1A 1OWWA 1H3WM 4J1UB 3NH7H 3QRGH 4NCC2 3BN3B 3QDHA 4P23C 3NN8A 3T1FA 4QCIB 4TN9A 1G7JB 3TYGL 3ALPA 2YD7A 2VLRE 4UINH 4KTEL 1Q9LA 3FO2B 3MUGA 4JM2D 4OLEA 2NY0D 1ZHBB 1J1PH 4NP4L 1FJ1A 2E7LC 5SWSB 4JFHD 5CJ5A 4ISVB 1QSFE 4YHKH 1XF2B 1KLUA 1PKOA 2DWDA 1R5IA 5ALCL 1YEJH 1A3LL 3VXSD 2F58L 4PJGF 3BZEA 2YPLD 5EOTB 5T3ZL 3IXAB 5HHPB 5DC4B 4EUPG 3EYSL 2A73A 5E5MB 5E56A 5AYUL 3UTPD 3FQXB 4MA7H 3QDMD 4IS6B 4AJ0A 4HFUH 1UB6B 5TE7L 1FFPA 1JE6A 4NPYA 5K9OB 1A9EB 5KZCB 1AGEB 3B2VH 4K23L 4KMTH 1UCTA 4NQCA 1BQLH 1TJHL 2ZG3A 3MX0A 3TO4A 3T3PF 3QWRA 4FTVA 3V4UL 3FB5B 3X13B 2KDGA 1F4AA 1OVZA 3PWNB 2QKIB 1OP5K 3T0DA 2DI7A 3DV6A 4AEIL 2EEAA 1A6PA 1CVRA 4KJQC 2X9WA 3F58H 1Z9LA 2YKLL 4JPKL 4YAQB 5SX4H 4QT5A 1F58L 1X5JA 5C0AE 1I1FB 4QRRA 1JGDA 1GOHA 3GMOA 2FR4A 2NX5A 4U6YB 4U3HA 1LNUB 43CAA 1MREL 4FQQB 4JFDE 1QOKA 4UUJB 3NIDF 3E3QC 1NCCH 4NCC1 3PL6D 5LBSL 4FZ8L 2HKFH 1XCTA 3MRDB 4RGNE 4WHTA 4OD3H 4WI5A 4WFHD 1Q1JH 3P77A 6FABH 4LIQL 1T1WB 1FNGB 4CGTA 3MLZH 3D9AL 4G9FD 3ARFD 4YHMH 4YHPA 1QSED 1N2RB 2A1WH 5HI5D 1XIWA 1X5GA 4JANB 3O3BA 1AKJB 4GQ9H 4I2XE 1CGWA 2VDPL 1NH6A 1P53A 2GY5A 3OJDB 5BQ7B 4Z95H 4ODWB 1CF8H 3EYUL 4L3EB 4HPOL 1G6RA 3ZKNC 3UMTA 4KDVA 4M8VA 4OJFL 4Z7VE 5DZNA 3NFSL 5E8PA 5DGQA 3AC0A 1RUKH 2Q76A 4G6JH 4J4PC 4M4RA 1IGCH 4NFDA 2I26N 5DQJA 1OAYH 4CAGA 3CSGA 5D6DC 4QXUH 4KK5D 2XQBH 4PPTA 4Z7NE 5GGTA 1I3RB 1IEBB 1T20A 3UBXA 4H5SA 2X4NB 4M5ZH 1FL3A 4HD9A 5IB5B 4I0KA 2N7BA 2QBWA 4JFZH 1HHKA 3FHAA 2XWJB 3OKOA 1M4KA 5TPWH 4RAVA 5HGDA 3WHXA 3VRLE 4QGTA 3MV7D 3HMWH 3I75B 1BLNA 5E2TH 1ZLWH 3CCHB 3NTCL 1EMTH 3S37L 5CLWA 1WAAE 4U6XB 3HS0A 4CN1A 1HQ4A 5D1XA 4OIBA 4QHNA 3S34H 2NY3C 1BBJB 2QR0A 4YIQA 2Q6WB 5K9JH 1W0VA 2ENSA 2CRIA 1LDSA 2DI9A 3H9ZA 1DEDA 2BNRB 3TZVD 2WUCL 5KW9H 4PGDA 1A02N 1T3FA 1NDGA 1S78D 2YWYA 3EYVA 5KVEH 1T1XA 4OZGE 1OD7A 5GSVB 5DFTA 2FSEA 2FECI 5L2KE 1IGTB 3OX8B 3WL9B 4G42B 5HVFB 1EO8L 1J5OL 1VFOA 1P5UA 1NKOA 1K4DA 2RJMA 3OGCB 3DVFA 2V2TB 1AD9A 4Z18A 1XGQA 1DBAL 1RFDL 4P2QA 4WNQB 3FMGL 3EO9H 4I3RH 1B2WH 3NZ8B 3QNYA 4S1RL 3P4OA 1U8OA 1A6VH 4KUZH 3FCTB 4WFFD 4LHUG 1WBZB 1I4FA 1SYVB 5BW7C 1KT2A 4PFEA 3OKMB 3VA6A 1LO3H 4X0KA 5K9KB 1Q9OA 2FBJL 1NCTA 4UNUA 5HI4D 3UJIH 1F5WA 1ZS8B 4LCUA 4S0SD 4WW2F 1U93A 2Z35A 4L5FH 3SQOH 5GS0H 4HUMB 1UYWL 3OBAA 3VE0A 5J0BA 1A1OB 3QWOA 4JFDA 5IJKC 1HINH 1JZ8A 2NY5H 4MQ7B 4P99A 3U4EB 3WHE0 1OSZA 1HSAA 1BIIA 3PP4L 2P1YA 4NRXA 3VXOB 4Y4KD 1REIA 3BZ4A 1DVFA 3ARBA 1A6AB 3QDJA 3RRQA 1YUHB 3ECBB 3EGSA 4Z78A 4RFNC 5C0IA 4BZ2H 1TITA 1H9VA 2ESVE 4NKQB 3UTZA 2BNQE 3OKNB 5D1ZA 2IQ9H 2IH1A 5HY9B 4S1SL 3LSOA 3AMLA 4KGLA 5I1DA 4FFZL 1NFKA 2ADGB 4WI6A 1MLCB 4JFXB 3U0PA 3H3PH 4MDJB 4NRYA 4ONFH 3HRPA 2XN9B 4Y4FB 2R23B 3BEWA 4QOKB 2YWZA 2HTKC 3HRZB 1JPSH 1JP5A 5C7XH 3BH9B 1S7WB 5T1MB 3VFMB 1RZ7L 1U8QA 1U8KA 3SKNA 2J8OA 1I7TA 4A2MA 1SM3H 4OIIH 4X9BA 4Y19D 2D7QA 4ZSOE 4IOFD 1HH9A 1BJMA 1ACYL 1MCLA 5CEYA 1FRGL 4GW5A 4EVNB 2MHAA 1PLGH 3B9KB 3L5JA 3MLYL 4X6DE 3RVXD 2EXYC 2X4OA 3H9HA 3G5ZB 1MJ7L 5CJOL 2BSSB 1E27B 1D9KD 1CCZA 4ONOA 1JHTA 1A2YA 4N8VG 1YPZA 1Q0YH 3V9FA 4BK5A 5LGJA 2BDNH 2JKXA 3LS5L 5JXAH 2KH2B 2R69L 3EJYD 4PRPA 4F9PA 2AKRB 5TF0A 4GXUN 5C07E 4WY7L 3I6GA 3DGCR 2KQMA 3BEVB 2F74B 5IBTH 1U8MA 3HAEA 3UTSB 3MRNA 2P5WB 2G5BA 2OL3A 2X89D 4ODTH 2D9QB 1U8JB 5E2VH 9CGTA 2CIIA 5T5NF 4HK3J 4CKVX 4D9RE 1ZE3C 5H35B 4LFHD 3OAYH 4P3CH 3WFEL 4IMLA 4J23A 4CVUA 5JZ7D 3S36H 5DJDB 4DN3H 4WI3A 2DLHA 1XGUB 2MJWA 2A9NL 4TTDD 3RVWC 2AQ1A 2B2XL 3OMZA 4TRPL 3V7MA 5I66B 1WUNT 3REWA 1V05A 3MQIA 3B3IB 3QJFB 1QLFA 5EBLB 4NIKB 3RP1A 1MHCA 2D7MA 5ISZE 4OCXL 5GHWL 5FUCC 1CXHA 1HIML 2B0SL 3QDAA 3CDFA 1CXFA 1U36A 2B8OT 3MJ6A 1AI1L 5A2KH 4MDIB 4P2YA 3D18B 3WFBH 1HSBA 1X7QA 3QEQA 1DQML 1IAIH 1C5DA 3O9WA 4Z7UB 5TF1L 1MFCH 3LH2L 5IMKA 3QO0B 3K74B 2YHGA 4JFHE 1HWGB 4Z7WE 5BVJB 3T2PA 5FKAB 3MBEA 2EIEA 3M45A 2XICA 1JL8A 2PTVA 3ROLA 5EU5A 2XG4A 3FB6B 5E8EA 2R56L 3VXSE 2PNDA 3ME0A 4QHKJ 3TBWA 2QQQA 4XMPL 4WI9A 5L8JB 2J8UA 5FK9B 4NO3A 2YPLE 1JNHA 3VGAB 2AXGA 4LAQL 1OAZH 4XP1L 4LMQE 1FVDA 1HQRB 3UTPE 5I8CA 4P2RA 4DUXA 3HC3H 2VKWA 1VADA 3QDME 3ZYZA 4PB9L 4YXLH 1VDGA 1WVZA 2P7TA 2ESVA 2BNQA 3ARGA 1BQHB 5I18H 5AAMA 5FUZL 3IDNB 5INDA 1E0OB 2DWEB 1D6EB 4FZEH 4M7ZC 1R5VA 1QYGH 4RNRB 4Z7QF 2DQDH 3ZYOA 4CVZB 1CDYA 1DBKL 1SMOA 3KPQA 1MIML 2B20A 3NIGF 1LILA 3OG6B 4MLSA 5CFHA 4ZO9A 5HHNB 1Y6KR 2OYPA 4G80A 2VZUA 1KTLB 1T0PB 2CXGA 5IM7A 4HT1L 5D7JA 1FP5A 1C12B 5HPMB 5TDOB 3NCJL 4S1DD 3C60D 2EDKA 5AWNL 1OM3L 3DJ9A 5DRWB 1CR9L 4MWFA 3OKEB 5ABDE 1UM5H 4LVNC 1BZ9B 3P11L 1ONQB 1FL5B 3PGCB 2A77H 3FOLA 1D6VL 1MLBB 1VPOL 5TQ2L 4G9FE 4LCYA 2YPVH 3QG7L 1L0YA 4EBQH 2AK1H 5KN5B 3VXNA 4OUOA 1CFSB 5L9DL 1FYTA 3T8XB 3BMWA 3DUUB 3EOBB 3UTTB 2GCYA 3TVMB 2E9JA 4M5YL 3BHBB 3GM8A 2DQFB 1QLEL 3HUJF 4OGAC 2WV3A 3REVB 3UO1H 4H1LB 4Y2DB 3FB8A 1SJHA 1U3JA 3GSVB 4GAYA 3NFPA 4Y4FC 1F4HA 1WF5A 2P44B 1Q9KA 4HS8H 4CNIB 3HPLB 4LGSB 2DAVA 3CXHJ 3S5LG 4EI5A 3H7BA 2EKJA 2QQKL 3L1OH 1NFIA 5CJXC 3VW3L 4JKKA 4O2EB 3EO0A 1MH5B 1QFWM 1IC4H 4PTTA 4E5XB 1FGNH 1B6UA 2A6JB 2FJGB 2YRPA 2GKIA 3MRFB 3A67H 4EIGB 2UVFA 2W0FB 1FC2D 3B9KC 4HUNB 3DVGA 2AXFA 3FT3A 2V2XA 4JFEA 1RZKH 3P40A 5E2JA 2DYPD 3N06B 3S8WA 3ES6A 2OBGA 2ADFH 1VCAA 2CUMA 1OL0A 2H26A 2M8XA 4QHUA 3G08A 1HH6A 4AG4H 3PE9A 3STZA 3VXPA 2WBJB 1RZKC 5JOFB 5EOCL 1HHIB 1V3JA 3FQUA 4YLQT 3F7QA 4NO2B 3U4AA 3MNZA 1NC4A 5IF0B 1KCUH 1MRCL 3Q3GB 5IFAL 2APFA 1LEGA 4OZHB 1BREA 2OS7A 4POYA 4P9MH 4CN4A 2XZZA 1H3UA 1T1ZB 1NCWL 2P24B 3M1BB 4TULH 1J87A 2ZJSH 2QADB 4JRXB 4XAWL 1V7NH 3UPRB 2K3TA 4JR9H 5C0RH 4UU9B 5JHDE 1AO7E 1RIVH 1NBVL 4FMFA 3HR6A 2GSIB 3QWQB 4JPVH 1KUMA 1FNFA 5KSUB 3O3AB 3LEVH 1EHNA 3VFOB 3I6KA 1Z5LB 2AK4A 3UXFA 4WGVB 3CLEH 1LP9B 5FKPB 4PLJD 1F3DH 3BP5A 5FYLH 5K59F 3B83A 5MEQB 3I3DA 3P3YA 4WFFE 2FATL 1P4BH 2XFXB 2OK0H 4OLUH 1KBGH 1R3KB 3QIUA 4W6WB 4ZTOL 12E8H 5DLMH 4JN2A 1H5BB 3WNOA 3CX5J 5KAQG 4FFVC 2AV7B 3HZMA 5T3ZD 4QXTA 3FFCB 1DUZA 2IBGA 3QNXB 4D8PA 4HX1A 1NJ9A 4NKDB 3RY6A 4FXLA 2DM4A 4L9DA 2Q7YA 2H9GA 5HPOA 4P5KA 1EK3A 3QT2A 1G7LA 3HI5H 1W8NA 3VGAC 4OF6A 4OAWB 5E08L 2P5ED 2R29L 1JRHL 4XPGH 2EDLA 4ODHL 1TQBB 2R39A 3CSBA 3MLSL 4GRWE 2GJZA 1TVBA 3DBXB 4YBQD 3QEHA 3S4SA 5D2LA 3IVKB 4TUJB 3B2UC 4DCQB 1WIOA 5F1IB 4M8QA 1ADQL 3HZKA 5IQ7H 1YMMA 4K3DL 2A9ML 3AREB 4PJ7B 2FNBA 2J8UF 3RWCB 4YHYB 3WIFB 1XH3A 5CD3A 1I1AB 3T4AA 4UT7H 1DN2A 2AW2A 2F53A 1C16B 2IPTL 1EZVX 1KJ3L 4LRNL 3ILQD 5EWIL 3EFDL 2EDXA 3R4DA 4P5TA 3GHEH 5IESL 2CGRL 1INDH 4H8WH 2EIBA 5CGTA 3ZKMC 4XPBL 2DBLL 2Q7NA 2VLRB 1FBIH 3RVVD 1GAFH 5SWZA 4QEGA 4IIQB 5CUSH 4H8WC 5BV7H 4GRLA 5IB3B 1FIGL 1R24B 1CD8A 2HVJB 3QZWA 5F7UA 3ZHKA 2H32A 4FOMA 3X14B 3LKNA 4Y8AA 3LHPL 5I1GH 2E6QA 1DLFL 4H1LH 4NQDA 4U1HA 1AXIB 3S88L 4RZCB 1IQDA 3MR9A 1EEYB 4LFHG 5FO9A 5I15H 3U7WL 8FABB 2GT9B 3O3EA 4HWBA 4M7JL 3BD3A 1IC1A 1S7TB 1A8JH 2E6PA 3O4OB 3CFJB 1A5FL 4M7KH 2EYSB 3IKKA 1LO4H 5K33A 2R1XA 4XCFH 3ZDZF 1PZUB 1TDQA 4EUPB 1OGAE 3IGAB 1GL4B 5GGSY 4ZXBA 4WTZA 3VFSA 3RWJB 4M7LL 1N59B 5B22A 5MP6H 3WKNA 2ZSWB 1QACA 3ARWA 2AEWA 4L9LB 4KI5C 3UBXI 3EFFA 1QPXA 2EH8L 3KDMB 5E4EC 1SBSH 4HKZA 5C0AB 4RMSA 5DJXA 1KJ2B 4HZAA 5CINH 2VZ1A 5JHDA 1Q9WB 2ED7A 3MJ8B 2F5BL 2Y06L 1UJTA 4FQCL 3DMMD 4CUCA 4LSVL 3AU1A 4DVBA 5EU6A 4G9DA 4G7VH 3SBWA 3TCLA 2MCPL 1BD2A 4YPJA 3K4DA 4RIRA 5E9DE 4YDJA 4OBSA 1A4JB 3DOSA 1FZKA 1GH7A 3RTQA 3CMOL 4MCYB 5I6XC 1S3KH 1R3JB 4J6RH 3DI2B 3SPVA 3K0WA 2VLJE 5D5MA 2B5IB 3FB7B 3MA7B 2A6IA 5HTSA 1T21A 3DETD 5IB1B 4X5XB 4OZIE 4I2XB 3JV6A 4ESKA 4JM4L 5TDPB 1CDIA 5ID1B 3KPMA 2HT2D 4LOUC 2DDQH 3EIFA 3VFWA 1U8NB 2BOBA 1DFBL 2NXZB 2HLAA 2WZPD 1MJUH 3ABZA 5CD5C 2AXHA 2R0KL 4EJ1C 1G7PA 2OR9L 1QFWI 1RVFL 5L6YH 5E95B 4G6FD 4DTGL 4Z0XA 4NM8L 3SGKC 3SDCD 2QADC 4GG8A 1HEZB 3QXAA 4MJID 1PDKA 3SJVD 2H2SD 1T5WB 5DGRA 2VITA 3SY0B 3KXFE 1OTTD 3DVNA 4OCLC 2NY6B 1XGPA 4FNLH 1MVUA 3EYQD 1CLYL 3IYLW 4MNGA 1HWHB 3BVNA 2VLME 3QYCA 4FQJL 3EOTL 4PS4L 1AQDB 1NMAH 5EO9B 3C2SA 3KJ6H 3BP7B 1KENL 1XGRA 1WCBA 1ZHLA 2ATPA 4ORGA 1GOGA 1RU9L 1H5BC 5JDSB 5F3HB 4OLZL 3OF6A 2NR6C 1IEAA 3QPQD 4B50A 5B39A 4GW1A 1JPGB 3IU4L 3DECA 3WE6A 4CMHB 1T0MA 3ZMRA 1U91B 4ZAKA 1U92A 4V2BA 4N1EA 5I8OH 4AT6A 2MQ0A 1PX4A 1XR8B 4JY5L 2DJSA 4FQLL 2J6EH 1NMCC 1TQBC 5GSRA 3JXAA 2Y9RT 4I0PB 3O6FB 4DGVH 5L2KB 2NZ9D 5D7IF 5JPNB 3U1SH 4YX2L 4EQ2A 1I1YB 4H25A 5DD1H 1VACB 2EC9T 3UX9B 2BVPA 2YK1L 3E6HA 1R6VA 3AREC 5ALBL 1IKNC 2RFXB 4KHTH 3QI9B 2FYYB 2IBBA 3LEXB 1T7XA 4F57H 1U8PA 5DRXB 3OXSA 4OCRH 5DD6A 1F42A 1A3RL 1JN6A 2VDOL 3VFVA 1LVEA 1P4LB 1NSNL 2NY7H 3I2CH 5A2FA 1CGUA 2VXUL 1NAMA 3DYPA 3NCEB 4MNQB 5I1AA 5DVNA 2AJYL 1G1YA 2VXQL 2WBKA 2ZUWA 1BVLA 4IIQC 1QZ1A 2V2WB 1YNTA 4LLUA 4QRSB 2R15A 3SN6N 2IADA 1G84A 3WUWA 2PXYA 3EYOA 2UVEA 4LHUB 5EN2B 3SCMB 3C6SB 5E9DA 3MMEB 4OCWH 5C0GB 2CQVA 5C9KA 3UDWC 4AIZB 3C5JB 5IB4A 4QRQB 2QSTA 3GGWB 5I19H 3PWLB 5JXEA 5BZDB 4HC1A 3FRUB 3T3MF 2GHWB 4JB9L 4EUPH 1BBDL 2VLJA 1P84K 3MNVA 3P4LA 5DJYB 3GDBA 3RI5K 4POZC 5DJAA 1ZT1B 4KI1A 2NMSA 3O4OC 3Q0HA 4YGAB 3VGFA 2GJ6E 3GJFK 1WEJH 3CPLB 5C0EA 3KPNA 1U58B 5DTFB 1B4JL 1B0RB 1H3PH 1KB5B 4R96B 2D31B 4IOIB 3WFCH 4D9LH 1KJ2H 1CDJA 4Y16A 4JHBA 4HV8A 4HS6B 4X98A 4ZO8A 1TZIB 3MLWH 4YZFE 4WEBL 5HYSA 4KJYB 3HZVA 4YEEA 3TT1L 1I9IL 4I9WD 5D72H 5EDXA 5FECA 4PD4J 4NO0B 4F7MA 1JWSB 1MFBH 4N0CD 3TA3B 3KXFA 1GGUA 4ZSOB 4U6VH 1KGCE 2ZWLT 1TETH 5I17A 3GMQA 2B4CH 2SEBB 1VESA 2OTUB 4OLVH 3ILPB 4X6DB 4FXGA 4AH2A 2Z4QA 3EDKA 3SKMA 1XCQA 3ZE2F 3G5VA 4K3EL 1UWGL 3ZTNH 2Z31A 1I7ZA 3BAEH 4NQTA 5T3ZE 2JIXD 3TBVA 5C2BL 5F6IB 5ACZB 2B4CC 4GJTB 2B5IC 4JHAH 4M3KB 1J18A 3K80A 3DUSB 1BQUA 3I3EA 3QIWA 3BJ91 5T5NG 3GUTB 1QG3A 3RU8H 1BX2A 4JZJA 5CSZB 2GFBA 5ANMB 1TCMA 2UWEB 3VXRD 4PJBE 2NXZC 1UVQB 5MEND 2DB8A 3BSZH 4UT9H 2P5EE 3FT4B 4N8VB 1KPUA 3E6FB 5JQ6L 3TP4A 4XBEL 5T33H 4Q9QL 4HDIA 2HJKA 5EBWB 1NANI 1NDMA 1Q94A 5E7FA 1VSCA 3HI1B 2HJLA 4FS0A 4PJ9D 4N0YL 5FGSA 3NACH 3ZDYF 5EU4B 5K9QG 4GRMB 1AP2A 5FCUL 4O4YL 2Z91A 4YBHA 1EFXB 1D5ZB 4WDIB 4PRIA 2NLJB 3U82B 4KZEL 3QRFM 5ISZB 3DXAD 1QVOB 1NPUA 2BCKB 1JGLL 1QHOA 5DO2C 3ZE0F 4UDTB 2DTMH 3BDBA 1JYWA 1MELA 2DKMA 4GMSH 4LIQE 3MRBA 4EI5D 2IF7A 4N0RA 5TH2A 2FLBT 2APBA 4YR6B 4JM2B 1Y0LA 2NY0B 3VD5A 3GJFA 3CLFL 4CMHC 4Z7WB 1A6ZB 3MV8D 3OR7A 5E8NA 1N5AB 3U9PH 3QQ3B 3VXSB 3DTXB 5LAXA 4PP2A 3OAZH 5HD8C 4NT6B 3TC9A 4B7IA 1T4KA 1YC7A 1S7SA 4W6XB 2BVTA 5DR5H 5TE4H 1R5WB 5KTEH 3K2UL 3ULSB 4I0PC 3QQ4A 2WQ8A 1RPQA 4FFWC 1CICC 4IRZL 2IANA 2LFGA 5DUMH 5AZ2L 4YH6A 3NZHH 5L2JB 5I1HH 3HNSL 2Q8AH 5KW9L 1QA9A 3MV9E 2CRZA 4HS3A 3BKJH 3CDGB 4YE4L 4W68A 4KWUA 3TIDA 3BWAB 1DBMH 1P7HL 3RZCB 1T2QL 3GBNH 1M7DA 2PR4H 3TJHD 1R3LB 2X4QB 4DKEL 5E94A 3WJJA 4KPHL 2OJEB 2RCSH 4PBVC 4JHWH 2QHRH 2JELH 3D6GA 4XNXH 3S7GA 3O6MH 3VFUB 4WWKD 5E00B 4H0GA 1MFAL 1KJVA 1EEZA 3TH3T 4LSQL 5D7LE 2VAAB 5T1LB 2Q8BH 5I1CH 4Y5XA 3IDYC 2C3VB 4KUZL 3PL6B 2NW3B 4X7SL 3SCMC 2CK0H 5B3JE 1YQVL 3HE6A 5D6CA 1M6OB 2C3WA 5DJ0A 4M6OH 4X4YA 2PTTB 1JV5A 4TSAL 1GHFH 2R2HB 4U1MA 4G9FB 3RX8A 3MOQA 2Z8RA 4O58L 5IHZA 2ITDA 1Z6JT 3T77B 1QSEB 1OAKH 1N64L 2A0LD 4JDTL 4P59L 5EIVA 4LSRL 5HJ3A 1IILE 1BPVA 1I8IB 1IBGL 4QF1B 1UM4H 1RJLB 1HINL 2ZZUT 3V6FA 4DZ8B 1AGCA 1U8LA 2CXKA 4BQ9A 3FL7A 3IDMA 1LO0L 1MCWW 3MZGB 5HYJE 4NQVA 1KLGA 1M05B 2VZOA 4N90D 4K2UL 3QCVL 4HW6A 2YEZA 4XTRC 1R0AL 3RA7H 1E4JA 1K4CB 3QHZL 1TIUA 1NGYB 3S35L 3EJZC 3RVUC 4EN3D 1P4IL 4E41B 5H37G 3QPXL 3SGJC 3SJVE 4IDJL 4LSSL 4E0RA 4LVHC 2IAMB 3D0VA 3KLAB 2FLRT 1T0NB 2W38A 1BVZA 3WIIL 2ATKA 3KLDA 3MGOA 2DTSA 2D0FA 3TA3C 2D3VA 1ZLUK 3VFNB 5DMJB 3WDIA 3G6DL 4R3SB 1CFNB 3SDYH 3H7LA 1QLRA 5FDWB 3IDGB 3MNWA 1TJIH 3TNNA 2AQ2A 3BN9C 3ZDXE 3S5LB 4APQD 3OKDA 1T2XA 1EJOH 4X6FB 3D39D 2ZCKH 3FQTA 3IJHA 3L3GA 3MV7B 5IMMA 5ICYB 5C0BA 2AJSH 5F6IC 4C54A 4I48B 5HSFA 3O41B 5KVGL 1NL0L 2ZOKB 5DYOA 4OZFH 3WLBB 4BQ8A 2PYED 3P0VL 2IFFL 1HILA 1UADC 2G60L 2BJML 5EZJB 5JTWA 1WBYB 1RZJL 4UOJA 3TZVB 4RA3A 4LBEB 5BZWB 4KVCH 2ORBL 2MNUA 1MF2H 3HC4L 3DX6B 2X1XR 3ET9F 3WIHL 4UIKL 1KG0B 2Y7QA 3AXLA 4NM4H 2FJHA 4NUJA 1PKQE 3L7FB 5ERWB 1S7XB 4JO2H 1R3IL 4XC3L 1ZHNA 1QQDB 5DK0B 4XNUL 1EH9A 1IKFH 2GITB 1DQLL 5B21A 3X3GH 2HFGL 2CDGA 3L7EB 4P4KD 5GIRA 2AEPH 1RZFL 3N85L 4R90L 4ZXBD 2MKLC 4MMZC 2I07A 1J8HE 4MA8H 2JF1A 3T0XA 3MRLB 2AS5M 1PG7L 1XGTB 4JM2C 4PLOB 2NY0C 3MCG1 4DJMA 2YUXA 3GO1H 3MCLL 5J9PB 2E27H 4AM0B 3RWFA 1F3JA 3V8CA 3IS1X 1FAKT 4PRHD 1JTTA 3JSSA 1GC1H 25C8H 3PWPB 5BOPA 1CFQA 3G9VA 3K81A 2YD5A 2QHLA 5ADOH 4Y4KB 4XAKD 1UZ8B 3DX7B 4YNYB 3PXHA 5GGUB 3TV3H 2CMRH 3S97C 1VERA 2XTJD 3D87B 3BE1L 2DF3A 4Y4HC 3KYNA 4GRWB 3SDXE 4R4BB 1VB9A 2AEQL 1GC1C 4PJDA 1A7RL 5KANG 3ARXA 1U6AL 4LEOA 5D2NE 3VJ6B 3CH1B 4HKXA 5M7QA 1KV3A 4PGCB 3PHQB 4M1GH 3VXQB 5C9JB 1JK8B 4N9OB 3O2VL 1AXSB 1FE8L 3FQNA 5HYJA 1RUQL 2D7PA 4LSTL 1Q72L 3NGBB 2UZIH 2IALB 2Z92B 1PVHA 4C56A 1OOAA 3LIZL 3TPUA 4JCLA 1NFDE 4I9WE 2XOTA 3EZJB 4CRPA 3HI6H 4YXHL 3WMSA 1N3NA 4XNQA 3HE7A 3QG6A 1IAKA 2XNAA 5ADPL 4Y19B 4ELKA 2FL5A 2HH0L 3QUXD 2VXVL 4OT1H 3PL6C 2P49B 5BO1H 1ZTXH 2VXSH 1KNOB 2CLRA 1N6QL 2OSLA 5EUKB 4X7FC 1U8HB 1CQKA 1JPTL 3RWIB 1PJ9A 4BFIA 4O5LH 2OXHA 5TE6L 5CP7B 4Y1AD 1HDMA 3ARFC 4KTDH 1RURL 4R26H 1A7QL 3CFDB 4HHAA 4PJGB 4DQOH 5HI5C 5A2LH 3KYKL 5IFJB 5JW3L 4HIXH 2QQLH 3O45B 2GTWA 2BSTA 4G6ML 1TCRA 2GAZB 4B53A 5DEFB 2EDYA 4YHIA 5F3BB 2CJUH 4LCWE 3VXRE 5IW1B 4NKOA 3CIQA 3BZFB 4OGXL 4WHYH 4WCYL 5MENE 3BP4B 3MGTB 1C08B 3W0WA 5FEBA 1CBVH 1L7TL 4JFPB 4FABH 5J6GB 1BZ7A 4OCNC 1H0DB 2DM7A 1HOCA 5EIIA 5CZKA 4P5TC 2NY4D 4XCCL 2CDEA 3BKML 1GGIH 1MWAB 1HHGB 4KJWD 4ERSL 2Y6SD 1OLZA 2VQ1A 1OQXA 1S8DA 3RVTD 1G7QA 4YK4C 4WIQA 4KQ3L 4WW1B 1JF1A 2R8SH 4KK5C 5L88H 4G8EB 1A6TB 4JZOA 5DRZA 1LWRA 5ACLA 3FN3A 3MODL 2XWBA 3S96A 1Y6NR 3G6AA 1TZHA 1INQB 1NAKH 3DXAE 4L8SC 5SWQA 4WU7B 1I1RA 4HWZB 1FFNB 1JWMB 3B9DA 1JWUA 4HWUA 4NZTH 1J8HA 1FG2A 4HZLB 4OZIB 1IGYB 4W4OC 2XY2A 1K2DA 2ICWB 4Z8FH 5FOBA 1KCSL 4WGWB 4W70A 2PXYD 4XPHL 4HPYH 2A6DA 3THML 3ULVL 2WBWB 5J1TC 1F6AA 5ACMA 1AD0A 3QCUL 1RZ8B 1I3GL 1A4KB 5HGGS 3C5ZA 4HMDA 5AUMB 2OTWB 3EOAB 3GSNA 5I73B 3DV4A 3LN4B 4Y0GA 4LCIH 4IRSD 1KIQA 5A2JH 5E8DH 3VI3E 5LQBH 3R06B 5FM5M 3P9WB 4D9QD 4NUGH 4GSDL 1DLHA 5DQ9A 2DIJA 2FHCA 5CIPA 4XPTL 1KEGL 1T22A 1KPVB 3RTQC 2MMXA 3B9AA 1KTDB 3MRGB 4NQXB 1IGML 4KUCF 5HI4C 3UYRH 3OXRB 4OQTA 1NFDA 1IC5H 5E2UH 1T7VA 4L29A 3C60B 3BGAA 3FQWB 5F89B 3O2DL 1XAUA 3BKCL 4GRWH 3V6ZA 3PIQB 4G6KH 4U0RB 3ARDD 2R4SH 1VKXA 1S9XB 3GZKA 4Y4KC 1IAOA 1ZAGA 4U1GB 1AH1A 3VGDA 4AQOA 3PWJB 3B5GA 1F2QA 5CEXB 1PD6A 3BIKB 3O2WH 1JCKA 1Z0MA 1RD6A 1MNUH 1FNSL 2XXCB 4PV9A 1TZGH 1J0HA 4M43L 3U79A 3TBYA 2M2DA 5DHYB 3D25B 3AM8A 2YUWA 4HJGA 1CLZH 3VDAA 2GYSA 3CC5A 5FXCH 3MLXH 3VWJA 4JPWH 5C09A 3O3DB 3NGBC 4HCRL 4J2XA 1CGYA 4JG1H 4HLJA 5IMLA 3GKWH 4KY1H 4GW4B 3EHBD 4G8GD 1JGVL 3MOAL 1A6WL 4CW1B 5IT2H 2ZNWA 5T5FH 4GO6B 5IW6B 2DMCA 4TNWK 2PETA 4IOFC 4LEXH 2D4FA 5IKCA 2D03H 1D5MA 1I8LC 1LQSR 4LCCB 4WW2B 5BRZA 3RVXC 5C1MB 2KL6A 1S7UB 2DYPB 1TTFA 5IQ9B 3I3BA 1D9KC 3EYFA 4JAMB 3CFBA 2CLVB 4UAOC 1JHKH 5IK3B 3T1FB 2DLFL 4XP9L 4ZUVA 4JDZB 4RQQB 4LLWA 4P2OA 3L5XL 2X4SB 3Q1SL 3WJLA 1HN1A 3EJYC 2NY2D 3MA9H 3MUGB 4FQXD 2OMNA 5DJ8A 2GSGA 1JHLH 4M1DL 2VOTA 2X05A 1SJEB 5J12B 1ZMYA 1I7RB 1CL7L 4YC2B 1J05A 3F7YA 3HFMH 3V5KA 4PJAE 1KB9J 4XP5L 2QQNH 1N0XL 4X8JB 3TNMB 3FO9A 5JZ7C 5JHLH 5DI8B 2VO5A 4YFLF 5F7HA 2HKHH 3VMOA 2IAND 2JJVA 1FFPB 2KZWA 2W92A 3X3FH 4NPYB 4G43A 3C2AL 5EZOL 5LXGH 2RHEA 3IDIB 4HIJA 5IB2A 4NQCB 3VXUE 1FC1A 4FTVB 4LF3B 3VXME 5JNYA 1V7ML 1UENA 1BWMA 3O6KL 4WJ5A 4KVNL 4JKLA 5GRZA 1CZ8L 1T89C 4KHXH 4IMKC 3ZE2E 5EC2A 5A43C 4A6YH 2FX7L 4ODSL 3UJJH 3PABB 4NN6C 2UY7A 1NCUA 1CXKA 4PGJA 2P47B 4PRHE 4KAQH 43CAB 5D71H 1N8ZB 4BKLB 3P9LA 3GJEA 5JORA 2DQGH 1NGWB 4BZ1L 2R9HD 3ALXA 4HWNA 4JRYD 1XCTB 4XAKE 2P5EB 4NQEA 2Y36H 2XTJE 1DBBL 3P77B 1BF2A 4NN5C 4KC3B 1KC5L 1MPAL 2HT3D 1GPOH 4XWOC 3P4MB 4UOW1 5DDHA 3G04B 4YHPB 3ROOA 5I73C 5CCKL 2AJUH 3MGAA 1DL7H 2FWOB 4R8WH 2EYTB 3RWDA 1BM3L 3OB0K 1QKZH 1BFSA 4WEMB 4TVSa 4ONGH 4PJ8A 3LB6D 2FX9L 5EORH 4JO1L 3RGVA 1CE6A 3MRHA 3ZE1F 3CVIL 3WFHA 3PXJA 5E8PB 4NZJA 3SDAD 3MJ9H 5D96C 3H9SD 3NA9H 5E03A 4XXDB 1S9KC 3MBXL 2Q3AA 5F7EH 4ZUWB 2BVOA 1ZLSL 4NC0B 5C70A 5C0JB 4GG6E 3TM6A 5F1OB 3QUKB 3VGBA 3PWVB 4S1DC 1A14H 3C60C 3OKKA 3LV3A 5I1JH 4F80A 4NJ9H 4JZJC 4JO4L 3ZKQD 3ZZ1A 1E4XH 1NEZA 1YN6A 4WUKL 3TBTA 4HWEL 4U0RC 2DLIA 4H5SB 5D1QC 1S5HA 3IFOA 4XRCB 2VWEE 3GRWA 4IRJD 1N7MH 4U1GC 4LASL 2PO6D 3OL2A 4DVRL 2F5AH 1WWCA 5EPMA 1SHMA 4ZDHA 1CGSL 1XF4A 3H42L 1B4RA 2MQCA 5CZVH 4CVXB