5JXAH

Crystal structure of ligand-free vrc03 antigen-binding fragment.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
235
structure length
231
Chain Sequence
QVQLVQSGAVIKTPGSSVKISCRASGYNFRDYSIHWVRLIPDKGFEWIGWIKPLWGAVSYARQLQGRVSMTRQLSQDPDDPDWGVAYMEFSGLTPADTAEYFCVRRGSCDYCGDFPWQYWGQGTVVVVSSASTKGPSVFPLAPSSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords VRC03 Heavy chain
publication title Somatic Hypermutation-Induced Changes in the Structure and Dynamics of HIV-1 Broadly Neutralizing Antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 231
sequence length 235
ec nomenclature
pdb deposition date 2016-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxaH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxaH01
4J3VA 4Y5XC 4Z9KB 5KAQG 4YHNA 4FTVD 3TO4D 3T2QA 1AGCA 2EDLA 4L8CA 3IF1A 5ACLA 1ZHLA 1DVFC 1KPUB 3EDJA 2CMRL 2PR4H 3AS1A 4HXBH 4OZHE 5H94A 5DJCB 5CBEA 3CVHH 4OZ4B 1G7PA 1KYOJ 1MCOH 1PDKA 1UT9A 3MXWL 4ORGA 2XT1B 4PY8I 4HK0B 1FJ1A 1UZ6F 2BOBA 2DYPB 4F80A 3QIBC 1D5MB 3ZDZE 4XP5L 5TGBB 4W4NA 2P46B 3O3AA 1S9YA 1NCTA 2PETA 5EZJA 1UCTA 1Q1JH 4UV4H 4D9QD 4WFHD 3LN4B 4JZJA 1VACA 1SMOA 2NX5B 2R2HB 5ISZA 1Q8MA 2FJHA 4MMXC 1T89A 5I8KH 3QG6B 3RUGA 2Z31D 4Y4KB 3NTCH 1SEQL 3B43A 2R9HC 4JQVC 1MCPL 1IAOA 4Y2DC 4NKDA 4ODVL 4LPYA 4NFDA 4PJDF 2EIZA 3MNVB 3VXMA 1MPAH 2KQNA 4ODXA 1RK1A 5C7XL 1JMZA 3W9DB 1RHHA 4RDQF 1E28B 5HHOB 1CGXA 4S10A 5MENE 3P4MA 4HS6B 1QG3A 5LGKA 2BVQA 3UYOD 5C0DB 2QBWA 2HMID 3ZYOA 1FN4A 3G6DL 1NLBL 2YA2A 1FAKT 3SKNA 5IMMB 2VDKL 1JPSL 3QI9D 3L5IA 1A7PH 3PWLA 3BVNA 1CZ8L 4IHOB 3MRIB 3V4UL 3LZFL 4KUZL 5FA4A 3BWAA 4QHKI 3T1WA 2BK8A 4Y4HA 1ND0B 3WFBH 3BEWB 1QSEA 1YJDL 4EOWH 3FT3A 2CO7B 2EDHA 5L2KB 4OCXL 3HG1E 4G7VH 3GSXA 3FO1A 2UWEE 5B39G 1PKOA 4J6RL 1QFWL 3TNNB 3OSKA 3WS6A 4KV5F 2R1WB 5FGBC 5I73B 1MQKH 3WJLC 1X7QA 3B3IB 1WBYB 4Z5RA 3SJVD 1SQ2N 2NXZD 1HCVA 1LWRA 4OFDA 2YD7A 4XPAL 2VXQL 2F5BL 1NC4B 2DLHA 3KPLA 1RD6A 5C09E 3ARFD 3S4SG 5IW6A 4XXDB 2UY7A 4Q9RL 2Z8VC 4LARL 1T22A 2W59A 2APTA 3V5DA 35C8L 4PJBA 3PL6B 5KSAA 5FDWB 3ULVH 4G3YL 3KYOA 4QT5A 3OKEB 1CVSC 5FF6B 1U95B 5H35A 1WFUA 3BAEL 2HKFL 3VXTA 2DIAA 3MLPA 5ADPH 2D0GA 2LTQC 5EZOH 1MJ7L 3SGKA 4UV7L 2R0WL 3QZWB 4YHZL 4Z6AT 3EDDA 1KLGB 4PJAF 4RMTA 4NJAH 3RNQB 1TPXB 1DUZA 4MMZC 3L5XH 2J8UE 4YZFF 4C54A 2VXUL 3HUJF 1AO7D 2X44D 5EBWB 5L8LB 2BNQA 4G9FB 1OAXL 3EUUA 2V5TA 4DKFH 4FQ1L 1RJZA 1IC1A 4KRPD 1IVLA 3L6FA 5BRZD 4GRLD 1D5BB 3U0PA 1CXFA 4NJ9L 4Y16A 3S5LG 2DQEL 3TCLB 3ARZA 1XGRB 4MGXA 4ZNCD 2GITA 1XGPB 3MBXH 2ATPB 3GSWB 5DHXB 3QDJB 2DBLH 3WBDA 3H9HB 5J12B 5EDXA 5JPNA 3TBWB 5FO8A 4Q9QH 5BJTB 1NCDH 4Y4FD 5KSUB 4F7TB 3ABZA 3RWCB 3CK0H 1I3GL 1GPOH 5LGJB 4KK6D 3WLWD 4WEUD 5BZWA 2QSCH 1R3KA 3IJHA 3SGDH 2IH3B 4QHMB 5GGQH 4P4KD 3NABH 5E6ZA 5FIEA 4JFFD 3TO2A 4YXHH 2DQFB 4NKOB 1EHNA 3RDTA 5ACZA 3CUPB 5I1GL 3IKKA 5CCKL 1QQDA 5D1QA 2NY4D 4N5EC 1R3IL 3V5KB 3IAGC 4JFXB 1ZWIB 4JLRA 5TE4H 3JVGA 1ZGLA 2BXYA 2VUYA 3WUZA 5CEXA 4P23D 2W9EL 2GT9A 1S7TB 4N8CL 1MI5B 3AB0B 2XZQL 2HA1A 5CP3H 1U8QB 4X5LA 5I15L 4NN6B 4Z7UE 3MPCA 5DI8B 1BFOB 3FT4B 1SM3L 1NGWA 4FXGB 4PJHB 1LE9B 4HGMA 4P2QE 4F3FB 4ENEC 5B22A 2OMNA 3ZE2F 4Q58C 4KFZC 3BI9X 2QEJA 2X89A 2H2SD 5TFSH 3WLBA 1OGAA 4WY7L 4XPGL 4WI2A 4OZGE 3CFCL 2Y07H 3PGDA 1I1RA 2BRRL 4OM1H 3OXRB 3KHOA 4JQXA 3UBXB 3CNKA 4W6XB 5MHSD 3MMEA 2VMFA 1CDYA 4U6YA 3VXRE 5IOPB 4ISVA 4WIQA 4RBPK 5HYIA 1T4KA 4M43L 4GSDL 3FHQA 5GPRA 3ZHKA 2WZPD 3AM8A 3C5SB 1IM9D 1AY1H 1P84K 2MKLC 4QNPE 4TVSa 3BZFB 1V7MH 5I0DA 1INEH 4KK9D 1K4DB 4LP4A 1JGVL 2VDML 4X6DF 3WNMA 2B8OT 5L9DH 3BD4A 5D7SH 5D7KE 4JDTH 4K9EH 2EDYA 3QIUB 5KS9F 2F58H 1AJ7L 5DHVH 3P0YH 4AQ1B 2JJSC 3F7VB 4HKBA 3EYQD 5INCA 3LMJL 4HXAH 1LP9A 1WC7B 25C8H 1XF1A 3BGMA 4PJIE 2XA8L 2Q7NA 4KKBD 3CMOL 2PO6C 4RGND 4MAYA 2UY6A 3MJGX 2P8LB 4NO0B 5FO7A 1ZLSH 3UYRL 2NTFA 5GSRA 1ZEAL 1MCBA 1KCRL 2ENYA 3QNYB 3ULUL 2A6IA 4AL8H 5FYJD 1AP2B 2PW2B 3UTQA 4PG9B 4HG4J 5SWSA 3VFRB 4F58H 2AEPL 3C2SA 1HXYA 4WU5A 3DLQR 3VJ6B 5DD5H 3TYGH 1A6PA 3MODH 5I74C 3V79C 4WI9A 1N7MH 1F3DJ 4ZUVA 4KPHL 3MZTA 3ISWA 1ZAGA 3S7GA 2E3VA 3KDMB 3TA3A 4QWWD 3NPSB 4IRSD 5GISH 3VXNB 5ICXB 1RIHL 1S5IL 4RMWA 5GZNC 2OJEA 1ZVYA 4HS8H 2ZOLB 3D25B 5DJDA 5C07D 3RBSA 4MA8L 2CRYA 1Q0XH 3F7RA 3NACL 1B6UA 4K7FA 3MOAH 4XCEB 2Q76B 1F45A 2BZDA 3P30L 5KSBB 4U1NA 1I7UB 2HT3C 4UDUA 2GCYA 2B2XH 4QHUB 3FQUB 4YBHA 4ZPTA 2ZP0T 4YK4C 3VE0B 1INDL 3UTZA 2DQDH 3NZHL 3PV6B 3UTTE 5GRZA 2G75B 3O2DA 4WWKA 4GG6E 4E9LA 3DO3A 2R1XA 1QVOA 1KT2B 1E6OH 4CL7A 1TZGH 3D85B 5IB2A 2H1PL 4IBLT 4PGBA 3S36L 1EGJH 3ETBF 4G8IA 4U6HA 3LS5L 4LCYA 2NY6D 4W68A 2J5LC 5JXED 4XBPB 2HH0L 4P4RB 3HI5L 4PJFF 1EBPA 1A7RL 1FNGA 4UIMB 1FZJB 1YYLH 4M7ZB 4LIQE 4H1LH 4NO2A 2VAJA 1TZIB 3QEQE 4OTXH 1KGCE 3MJ7B 1TENA 1SY6H 4M03A 3PP3H 3HC3L 7FABL 3VRLE 1L6XA 1DEDA 2FX7H 3IDUA 4M4RA 3N1PC 3WN5B 4YGAB 1G1YA 2ARJB 4OCMC 3O2WH 4BFIB 1QRND 2CPCA 3BQUB 2Z35B 1LK2B 3JWOH 4EUPH 4P3CL 1GGCL 3V6OA 1E4KC 5SWQA 1CLZL 4XMLL 2OL3H 1YEJH 2VLLA 5ISZD 3OPZL 1A7BA 2DDQL 2HP4A 5I1DA 3WNKA 5KZCD 3BW9A 1G9MC 3KPSB 1KOAA 4ZFOA 3C5ZB 1KENH 4X4MA 2IANB 3RQ3A 2V7NB 1JCKA 4I4WA 4LLQA 3KYAA 3DV6A 3MFFB 5FCUL 4E42A 1KCKA 3M07A 3TBTA 3RGHA 2XQBH 3G04A 4RA0C 4EJ1C 4ERSH 3KPOA 2JE8A 3OR7B 4HKXA 1E27B 2GJ6A 4LEXH 3LKQA 3MACL 1B0RA 4XNMB 1U6AL 1G6RH 4PRAA 3PIQB 4JY5L 4WO4D 2EIDA 3G5XA 2FGWL 4C4KT 4S1QH 4WUUB 4Y19B 4TUKH 2HJLB 1X5YA 3VXPB 3W9EA 4QRRA 5DQJA 5B39B 4OZHF 4U49A 4WUKL 4MA3B 4R4FH 2D31A 4PJGE 2BDNL 3O4OC 5DMGC 4Y4HD 1D7FA 1FLTX 5BW7C 1I8KA 1BOGB 1KV3A 4Y4KA 1W0WB 2QR0B 4POZD 4PJ8B 3SE9H 3RVUC 4BZ2H 5GS1B 2E9BA 4YHKH 4P9ML 4N1HB 5FYJH 3S4SB 3R0NA 3D18B 2OR9H 2B0SL 43C9A 4P5TB 1MRCL 3LHPH 3W9DA 3WV0A 5T1KA 4MDJA 1E28A 4QOKB 5HHOA 2QSVA 1ORQB 4PRBB 4AQOA 1FRGL 2JLLA 4K2UL 4LK4A 3ECBB 4L3EB 1MAJA 3ARBB 4Q97A 1JNLL 5B38B 3SGDI 1HNGA 5SWZE 3RWDB 3CSGA 2HJFB 2EEBA 5KSAD 5CJ8A 4ELKA 5HHPB 5DWUH 1JZ4A 2R0LL 3AUVA 2JB5H 2VDNH 5CJOH 4UT9L 4M7LH 4XCNB 4LSRH 5C0FB 4OD3L 3L95A 3F6IA 3SKMB 3W0WB 3WDJA 3HPLA 1UEYA 4O2EB 4OUUB 2EO9A 4RWYH 4WHYG 1ZANL 4G8GD 1VADA 2LABA 2I9TA 2FX9H 4AH2B 3LKOA 2RCSH 5HHXL 4FQLH 3TJHC 1MIEH 3H6JA 1BWWA 2XACC 5DRZA 4WW2A 4GW5A 4HMEA 3RL2A 1A6WH 1I7TA 2GQHA 3WXVH 4M1GL 5L6YH 1PX3A 3HE6D 4TNWF 1WZKA 1A3LH 2AXFA 43CAB 2VITB 1S7WB 2BVPB 1HH6B 2HG5A 2IG2H 4OGAC 1OWWA 1ONQA 1F8TL 2BSSA 4P46A 1U95A 1MCFA 2VSDA 3CFIC 4J3TA 3FQRB 4LVEA 3CLFL 1FG2B 3IDJB 4XVTL 5F89B 3OAZK 5IIEA 5KANI 3TLRA 2EDDA 2P24A 1NUFA 2V5YA 4QTIL 5HSFA 5GXBB 5JOFA 4GKNB 3AC0A 3PDOA 4HEPG 1NCCH 3G6AA 3SDCD 1I4FB 2VAAB 3O41A 3UJTL 5HD8C 3TH3T 4K07A 4PTUB 1IC5L 1OGTB 1ZT4B 5DRNA 2IGFL 3TH4T 1T03H 3O4LA 3VGAC 1BD2A 2VXSH 4ODTL 5J11B 4Z7VB 2O61A 1IAKB 5C70A 3DX7B 2O5YH 4KKCD 2UV3A 1FGVL 1RZKC 3AREA 4WWID 3MV7E 3ALXA 1RPQA 2ATPA 1C16A 4PJ7E 3P9MA 3L3HB 1T2JA 2R4SL 4BH8A 1T0PB 2IEPA 4TVPL 1LHZA 3TN0B 4YHYB 4MDIA 3R1GH 3X3FH 3RWCA 2FGZA 3OGCB 3NCJL 4NO5A 1L0XA 4R0LB 5LGJA 4LLAA 3TBSB 3MJ9L 5L8JB 2OP4L 1MRFH 4Y5YA 4HUXA 2Q87A 1BF8A 1XAUA 2X89D 1T1XB 4JQIH 3RJQB 5ID1A 3EOTL 3PGFL 3DIFB 2P44B 1JGEA 3DMMC 3KYKL 4JO3H 5BVPH 4U6XA 1KN4L 3UPRB 3EYUL 3IU4H 4GKSA 2BY2A 3S88L 5ESAA 1F4WL 4CDGC 5GGRB 5I75B 3V9FA 1UWEH 4JG1H 1X5HA 3V5HB 1CE1H 1CYGA 1YNTB 4X80H 3B5HA 4TUJB 2GYSA 2AJUL 3DBXB 1L6ZA 1A9BA 3F7YB 2X7LB 3NFNA 4NN5C 4PIRF 1J12A 2GSGA 5C8JB 1XR8B 2HT2C 2P7TB 5D72L 2CGRL 2N1KA 2DN7A 4GRWF 5EU5A 1A4JB 2F53D 3C60D 3DI2B 5C0AB 1Y6MR 4YH6A 1IMHC 2VXTH 4LEOB 5E6IB 2EE2A 2BHZA 1FBIL 1PW3A 3H9SE 3S37X 5JHDA 2ADGB 2NR6D 5CMAB 1D9KC 3TZVD 1DQDL 4XC1H 4F7CB 4HIHB 5J9PA 3BPNB 1KIUA 4X7CC 4XCCL 5HDQL 4KJWD 2RQ8A 3LQAC 4MAYD 4RGMB 1NMCC 3T8XB 2HFGL 4R4ND 2VUOA 3WSQH 1U8IA 3ZTJG 4G8EA 3B8SA 5I6XB 1BVLA 3CCHB 4NPYA 4JPIB 5T3ZE 4YJZL 3L3GA 2I60H 1NKOA 4YAQA 3BZFA 3QO0A 4OZGF 1NFDB 1K4DA 3RJDA 4X7EC 1PG7L 1XGYL 3HMXA 3SDAB 3ZKXC 1OP3K 3F7VA 1FDLL 3IDYB 4IRZH 2NY4C 4LCWB 3DGGB 4WV1C 4ZS6C 3TA3D 1AI1L 3BEVB 1D5IL 4MX7B 2BFVL 3BZEB 1JN6A 5I2IB 1FVCB 5D5MB 3RWHB 2VDRH 2XN9A 1VA9A 4PP1D 3BZ4A 4J4PD 4X4YB 3VGDA 5LXGH 2P47B 1IFHL 3BHBA 4E41B 1LO4H 3K2UL 5GS0D 1N8ZB 3NZ8B 2LAAA 3ZE0F 3B9AA 5D2LB 1J8HE 3MA7A 5T1MB 5KW9L 4HGKC 2C3VB 2DD8H 3DX8A 2VRAA 3QNYA 3WFDH 5IWLA 1S7VA 2WANA 2PYFA 3BSZH 3QUKA 1EK3A 1YEEH 1AP2A 3MRCB 4K71C 4O51B 4PG9A 4AIOA 3KJ4B 4PJIF 4C56B 4WWKD 2WUBH 2WINB 4RISH 3RWJB 4MCZA 5T1DL 5C0JB 5HY9A 5ACMA 1EVUA 1KLUA 4RCAA 1JYNA 1N6QH 5FUZL 1X5XA 4ZOAA 5AD0A 5ADOH 5LG1A 4TSAH 3GIVA 4XI5C 3O0RH 4GUPB 1ZVHA 1ODAA 1KELH 1JI2A 5I1HL 4WFEE 3MRNA 3KNBB 1T80A 3NCEB 3K4ZA 4JPKH 4F8QA 3RIFF 2C3GA 3CFJB 4WNQA 4D9LH 1MY5A 1WLHA 3SY0B 3MV9B 3Q6GH 1CXLA 4XCEA 1U93B 4M6OL 5DD0H 2X4SB 4IOFC 4B50A 1X44A 3BKJH 4BKLA 4QHUA 4LKCB 4JKPL 2B39A 3MV8D 4GLRH 4P2RE 3HAEG 4MZ2A 2VQTA 1CFNB 3P0VL 1HIMH 2MFNA 5E8OA 5JTWA 2QSQA 2ARJQ 1I8LA 1KBGH 4DUVA 3D85A 4QRPA 4LAQH 4R97C 3WE6A 4G6FD 5AZEL 5ALBH 1XF2B 2NY3B 2DKSA 4UU9A 4YQXL 3GJFH 5EC2A 4J8RB 1B0WA 1F3JA 4XBGB 5ETUB 1K6QL 1RUAL 5EA0L 4Z0BH 1FZJA 5FKPA 5IR1B 3MCLH 1BM3L 4GW4A 1K3ZA 5AYQA 4LRNL 2DM7A 4OGXH 5E2JA 3MJ7A 5IB5A 3GSUB 1MEXL 2F74B 1FL3B 2DYPD 3M1BB 2A77H 4NHUB 4WGWB 1J0IA 4LSUL 2CKBA 4KI5D 1H8NA 1NAKL 3HE7A 3GDBA 5KTEH 3C6LB 2W9LA 1Q9KB 3IDGA 3LS4L 4QWWC 2HT4C 4IRSC 4NQTA 5F9WC 1QTYT 4BJLA 4U2YA 4B5EA 2NX5D 1OTUD 3OKLB 4TPRL 3WFZA 2IMMA 2EXWD 5EG6C 4NZUH 3VRLF 2PW1A 4Y4KD 3DX6B 4S0TD 1KSRA 2X4NA 1A7OL 1UKQA 2ADJB 2B4CC 2IH1B 3KLAB 4OLXL 2IANA 1BFSA 2HAZA 4FQXB 3PWPA 3MFFA 1LNUB 4HCRH 4Y88A 2YD8A 4NC1C 2K1MA 1E27A 1L9NA 2CXGA 3JV4A 3MJ8A 4OZIA 5FUCC 4N0RA 3MROA 5JQ6L 1RUQH 2CUMA 4WHTB 3O6KL 2PXYC 3U30B 4QRUB 3MRDB 1MIML 4PRDB 1MF2L 4ZUSB 5HHOD 2AEQL 4Q9CA 5I1AA 4ZSOE 1RY7B 4KDVA 1ZVSA 4JVPA 4DEPB 4HH9A 4LSPH 4H5SA 5IEHA 1YDPB 3T0BA 5IVXB 2IPUK 1CICB 5JW3H 2X4OB 4ZTOL 2Y5TB 3QEHB 2BNUB 2FJGA 4RFNB 3P73A 4MJIE 3FB5B 1AR1D 3TBVB 1NDMA 1DL7H 1T1ZB 5GS0H 4Z78A 5L2KD 3IDMA 3QNXB 3Q5OA 5HVHB 3VCLA 4NM8L 1OAUL 2HVJB 2W9DH 4EI6A 4RMQA 4LF3A 3VFPB 1HHJA 2FD6H 3D18A 4BYHA 2R56L 1F97A 4QRSA 4QXGL 3FN9A 5E1AB 5HI5D 1CF8H 4YHIB 4O2CA 2WBJA 3HC4H 2AI0L 4PJGF 1NC4D 3QULA 3MLTA 2HJKB 1V3JA 4X6CB 5IW1A 1GSMA 2ED7A 3V7AE 4YXLH 4JZJC 4FHBD 5IJKA 4YDIL 6FABL 5DMIL 2ZUWA 4CU6A 3ARBA 4NYLB 3VD3A 3S98A 2NY1C 1Z0NA 4XNQA 1I8MA 1T89C 5B38A 3U7YL 3X14B 5D7IB 1D6EA 3OKOA 1ZLWK 3PL6D 1V3KA 3VW3L 1OQOA 2OS7A 5HHQA 5EN2A 2FO1A 5SX5K 1CDCA 4EIGB 1MCWM 4WFGD 3MGTB 1L0QA 2MKWA 2WIIB 1CU4H 4CN1A 5JQHC 5KVEL 2ZUYA 4O2EA 1MVFA 4WTXA 5DSCA 1UWGH 4KROB 1ZA3B 1T1WA 3CVIL 5KVGH 2NZIA 4OJFH 3NIGE 4BUHA 5CD3B 2ZCKH 1RUPL 4PJCA 4OLVL 2FATH 5GGSA 3MLXL 1N5AA 3QHFL 1UM6H 4GO6B 4NCC2 3O9WA 4NDMA 4NQCA 1FCGA 4U7KA 4UILL 3T0EE 4KRNA 5IGXH 2J4WH 3C08L 3RIAK 4D0DB 4YXKL 4G9FD 3VXUB 3QQ9C 3HFMH 43CAA 4PB0L 4LLYB 4KTDH 2BVPA 3VFOA 5EPMB 2YPLB 3LOWA 1DBBL 3QPQC 3Q3GB 2OZ4H 3QDJD 5EU4B 2HFFB 3FQRA 2JF1A 4DZ8A 1LO3H 3U2SB 2MSPA 1FG2A 3MRQB 4G6MH 1TVHB 4J3WA 5F7LB 3WS6C 5K9JL 4YDVB 4O02H 3ELAT 4XPTH 4GKNA 3O2VH 1F58L 2VKXA 3GMQA 4ZYKA 1FV1A 4JFDE 4K55A 1OM3H 5BQ7B 2YBRA 4JFOA 3CU1A 1KCSH 2VAAA 4MNGE 5GRUH 1J1XH 1JGDB 5JDSB 1T04A 4RGOL 3VGEA 1ZT1A 1FVDB 1IC7H 1OGTA 5E00B 2IAMA 4YBLB 3SDXB 1WWAX 5CIPB 3IDXL 5KSAC 1MCRA 1PZ5A 3DX7A 1G6VK 4OLYL 1MI5D 2EH7H 2BSRB 1FNEB 5BO1L 4ODUB 3SGKC 2A9NL 2ITDA 2EE9A 5MEOA 3ZSSA 2A83A 2NY7H 5DK0A 1HOCA 4I3RL 2ZPKL 2HLAB 3KXFB 2BERA 2DQCL 1MFBL 4NKMB 4FFZH 3OGCA 2W0PA 3DXAB 5J57B 1CFQB 4JZNA 2YXFA 1Y6KR 4M7KH 5FUOL 3EFFB 1ZGLM 3GMMB 5E9DA 3S35H 4I9WD 3GRWH 1V5JA 3PXHA 4ZOEA 1U8PA 4Y1AA 5LCVL 3EJZD 1F4XL 2FEEL 2UZYB 4JN2B 4Y16C 3DVGA 2X4QA 3BGAA 2XI9A 3I6LE 4UDTB 1T83A 2H45A 3V5HA 4YDJB 4KVCL 5FOJA 1TNMA 3CFBB 1P4BL 4HH8A 2Q3ZA 4JRXB 5IM7A 4EBQH 1YN7B 4EN3B 5JPMB 2X7LA 1JNNL 1EFXB 5C8JA 1IGFL 1MNUH 2M2DA 2XWTA 3D3VB 1LK3L 4OCYL 1HI6A 4PRNA 1A7NH 3MLZH 1JHKL 4WW1A 1YEFL 1WF5A 3O3DA 3QIUD 1A5FL 3RDTC 1BIIA 4AT6A 5L0QB 5D1QC 2OQJB 1UKTA 1A1MA 1I75A 2VDPH 5KSVB 5E2TL 2ADGA 1MH5B 5LVEA 1CDHA 1CFSB 3JVGC 3DURA 3RGVA 4F7CA 1CIUA 5I8CA 4PRIA 1F4YH 1RZ7L 2DKUA 3SKJL 3S96A 3RTQB 4H0IA 4GBXB 4JFEA 4Y8DC 4C83B 1C7TA 2GAZB 5AYUL 4QY8B 5D6CB 1FNAA 1OAQL 4XXCA 5EU7C 3X3GL 3C5JA 1EO8H 4UIKL 3CDYA 1A1OB 3L3KB 3MBEA 3RPIB 1TLKA 1S3KL 3TV3L 3D0VA 4G6KL 4JG0H 1I3RB 3Q1SH 5C6TH 1NFDA 3I02B 5I17B 1S9VA 1VEOA 4ODBD 4XNXH 4DGYH 5ITBL 3ULVE 5CZVL 4I48A 3ARGA 2XWBA 1KCUL 4DJMA 2Q8AH 3IB4A 1F2QA 1GOHA 3VXQA 4RA3A 1FVCA 1NGXA 1MWAA 3HPJB 5D5MA 1NGQH 4NQEE 5JIPA 5LWYH 4HC1L 3MOQA 1U3HA 2Q7YB 1FSKB 3QQ3A 3QXAA 2M1KA 4OQTL 4QO1A 1RJYB 4RFEA 5GZOC 4YE4L 4D0CB 1S7UB 4S1RL 1FL5A 4K23H 4MCYA 4OZFA 1AQKH 4YPGB 1I9RH 3MRCA 4LVNC 5DYOB 3RVTC 5I1KH 1DQTA 1LDPL 3O6FA 1H8SA 1NUDA 3BRDA 1CD1A 4FTVE 4PRPB 3D85D 2BVOB 1C1EH 1M7DB 2F8VA 1NGPH 1J18A 3TCXA 4LHJB 4GUPA 4XGZA 3U0WL 2KZWA 4N0CC 1TTUA 2ICWB 2WQ8A 2XTJB 3ILPB 2CMRH 1AKJB 2VLKA 2NW2A 4P0DA 5DFTA 3MUGA 4GJTB 5DD1H 1VPOL 1EHLL 3PHQA 3LV3A 3MXWH 3JV6A 3OHXA 4R26L 1R5VA 2FHBA 4FQHB 1WTGT 2VB5A 3N9GL 1R5WB 4D9QE 5HJ3A 4XP5H 4LLVA 2YUZA 4DN4L 2BOCB 4QYOB 4OCNC 4NRYA 4U1LB 3LIZL 2X4RA 5FYKU 4KZDL 4WTZG 4NQSB 3HE7D 2V5SA 1NBZB 4ZO7A 3BQUD 5FM5O 2N7AA 1KTRL 3HZKB 2Y7QA 3UTPE 4D8PA 2H32A 4R4BA 3GHBL 1AD0B 4OCLC 3L3OB 1SEQH 3CDGA 5IBLD 1MCPH 2EE3A 4ODVH 5FA3B 1HK6A 3FB6A 2DQTL 4J8RA 3KPSD 3TIDB 5DEGA 3OAYH 3C5ZD 2HYMA 4FFWD 5GSVB 2APBA 3QDGA 2IAND 5C7XH 5ERWA 2B5IC 3PQYB 1OF2A 2VLRA 3ZYZA 3MREA 3I85A 3GSUA 2W91A 1KJ2L 4OF5A 4TSBH 4WWKC 2F54B 4DKDC 2R0KL 3G6DH 4U0QB 1NLBH 3QBTB 4CADA 4JY6B 4PJEE 2VDKH 1JPSH 4XC3L 2J2ZA 3DTXB 4QTHB 5F96L 3SPVA 4WUUD 2ICES 2VC2L 3LZFH 4Y19D 3H2WA 4KUZH 5FKAB 1NDGB 4MXQC 1WWBX 5C0BA 4ZTPL 2V7HA 5ICYA 1VGKA 1YJDH 1VESA 4GXVL 4PREA 5ALCH 3DSFL 2GSIB 1ZV5A 1MCEA 3BPLC 4J12A 3BN9C 1PSKL 3U46B 3MRMB 3F7PC 4HLJA 1WEJL 3SJVE 1Q94B 1PEWA 4J6RH 4PJ8D 1QFWH 1TVDA 4XPBL 2YN3A 4FQXA 3QFDA 2A74B 4CKVX 4I2XA 2C3XA 2ZKHL 4Y5XB 3KPRB 5F3BA 1DR9A 4XPAH 1DE4B 3FFCB 2VXQH 4U33A 4P5TD 2F5BH 2AKRA 4HUWA 3TESA 1DVFB 2PTTA 3VXSA 4WHTA 2L7UA 4QOKD 2WBJD 1HN1A 4ZUSA 3MRDA 4QEGA 1EA9C 2Y4SA 1IAMA 1IKNA 3DNKA 5IB1A 4S2SB 3V6OC 4LARH 2XY1A 4L3ED 3ARBD 2CLRA 35C8H 3L5WA 4G3YH 5IVXA 1QFUL 3QIBB 1CICA 4HIXH 3EOAA 4HMDA 3QEHA 1CGYA 4KRMB 3C6SA 2MHAA 3BAEH 2HKFH 2KPNA 3FB5A 5DZNA 5K9OA 1JTPA 1MJ7H 5EBMB 4UV7H 2R0WH 4M6NL 3O11B 1J0YA 4JGJA 2SEBB 3W0WD 4OCRL 3ULUD 1NCWL 4Z76A 1U8JB 5ESQA 3QCUL 1CR9L 2EDBA 4HMCA 4M1DL 1R3JA 3GB7A 4Y2DB 5BRZE 1TITA 1UM4H 3BH9B 3CLEL 4IEFB 2WWMD 2VZTA 3CFEB 1A0QH 3P9WB 3QIWA 1OAXH 3B5GA 2MOVA 4PGCA 4FQ1H 1A1NA 5GQBA 3IJSA 4XVJL 1RSFA 3QA3B 3SE8L 2BSTB 4NYLA 4P99A 1NEZB 4JJ5A 3HUJB 5C2UB 2UUDH 2WW8A 2FZ3B 5T3XL 4P5KB 5CINL 1WZLA 3HZMA 2R2EB 1SYVB 1T21A 1FYTA 5F3HA 5T5NF 1S9WB 4ONGH 5E95B 2E5EA 2VXVL 4OD1L 3QXWA 4JANA 3MRKB 5GGRY 3NGBC 4JFFE 1I3GH 3IYLW 4P9HC 2GTZB 2IBZX 1ZA3A 4NT6A 4WEMB 1UACL 3EHBD 4WTWA 1WITA 1A9EA 3RI5F 2BHUA 5CD3A 4FFYL 1A2YB 5I1GH 5CCKH 2CH8A 4ZOCA 5GGUB 3BRGC 1R3IH 1S7XB 1QLRA 1FORL 5C0IB 1YN6B 5F7FA 4MQ7B 1WZ1H 4XPFL 3ZDXF 1I1AA 1LO0L 4KAQL 2OTPA 2CO6B 5CWSA 4N8CH 1I9JL 2CDGB 4JVWA 2XZQH 1HWGB 2A6DB 3OKKA 3TIEA 1RULL 5I15H 4OCSL 1HWHB 5KG9A 4PGEA 4LVOC 2HFFA 3F58H 4NUGL 1SM3H 1CLOL 3U2SA 2NZ9D 4W6YB 4O2FB 1MQ8A 5CUSL 3STZA 1HSAB 3TN0D 5DRXA 2AJSL 2ZNWA 3D87B 4UBDD 4X6FA 2I9LA 5BQ7A 4WW2C 1FP5A 5CSBA 1EEZA 3LVEA 1OSPL 2LTQB 5MHSE 1S5HB 3B5TA 4XPGH 3QO1A 1KJMB 5J4MA 3KYNB 1JZ7A 1C08A 2Y72A 3CFCH 3TGXA 1FVDA 3B2UC 5F97E 3VFMB 1WBZB 1ZLVK 3QDME 2P4AB 5J1AA 4X5XA 2PCPA 4LASL 1C5DB 4P46C 5DQ9B 4M43H 5IVOA 4JZOA 1N59A 5J8OA 3CDCA 3NN8B 4Y7MA 4HWUA 4OF3A 1KJ2B 4DAGL 1JGVH 4LQFL 2VDMH 1JRHI 4O58L 1ADQA 4NKMA 4OLUL 5C0CB 2OTUA 1AJ7H 1CDUA 5MEQA 2FO4B 4AEEA 5C0AD 1VGEL 1RK0B 4LOUD 5C08A 4RGNE 5E6ID 3DVNA 4X6DB 3TPUA 4LFHG 1UXSA 2XA8H 2VR9A 3TFKC 4YR6B 4ZNEE 1M05A 3CMOH 4OBSA 5DC9B 2DQUL 3GMRB 3FT2B 4XCYA 3G5VA 3PDGA 3T65A 3UYRH 3AREC 5FYJE 5AEAA 1ZHBB 5F6IC 3WS3B 4YDJA 5HHMB 1HKLL 2COQA 1KCRH 3BIKA 1K5NB 3L5JA 3ULUH 3I75B 3IDIB 1PFCA 2NLJA 3VMOA 4N8VA 3UTOA 2MNUA 3PABB 5DK2B 5C0RL 2AEPH 4PJXE 1SYSB 4L4VA 3RVWC 1G9ML 4Y5YC 4FZEL 2JIXA 1SJXA 3WHXB 3MYJA 3SDAD 1I3UA 4KPHH 4NM4L 5C07E 1QSFA 4TN9A 4WW2F 4F7PB 1MJ8L 1RIHH 2OQJA 1M7XA 4LCWD 3Q0HA 4HUVB 4RNRB 1NSNL 5E4EC 1UJ3A 1TZHA 4ETQA 1IARB 3I6KA 4MA8H 4LNRB 3NACH 1ROWA 4MNHB 4XVUD 1H15B 2O5XH 5E2UL 4A6YA 3RTQA 1KPVB 2X70A 2OCFD 4OV5B 1KCVL 5CEZL 3UBXI 4E41D 3P30H 1Z5LB 2GAZA 1B4JH 1INDH 5FM4A 3NZHH 1LEGB 2AQ2A 4WDIB 1WZMA 2Z91B 1BBDL 2YRPA 1G84A 3PUCA 1Z9OA 2X4UA 4C56D 3MNZA 3S36H 4HPYH 4PFEA 1HHHA 4YC2C 4M48H 1KEGL 1TFHA 1PJ9A 5DZLA 1RIUL 4QGTA 3RWIA 2HH0H 1WSST 3HI5H 1QFWM 1A7RH 4QGYA 5HI4C 3RFZC 1KJVB 3WIHA 1BVZA 1GGBH 3FO2B 4FZ8L 5K9KA 3EDEA 3VXOA 4LLUB 3HC3H 1QRNE 4PJFB 3MV9D 1JYVA 1U3ZA 4D0CA 3ULVF 2PO6B 3DRTB 5CS7A 4U1JB 3VD4A 1XH3B 2E7CA 5ISZE 3CSPA 2BC4A 4BSVA 1R3LB 1SJHB 4QXUL 4P3CH 1GGCH 5D70L 2R8SL 1UYWL 4Z7WE 2V9TA 1CLZH 4XMLH 4PRPA 4TTDD 3OPZH 2DDQH 1QBAA 1CK0L 1U3YA 4MQSB 4L4TA 2NY3D 3LQZA 4PB9L 3D48R 3DUSA 5FB8B 3IJYA 1WBXA 1F4HA 4YWGL 2FL5B 3NAAL 4S1SL 3ILPA 1FFRA 5I74B 3VWJA 3IS0X 1EEYB 2A2QT 2YD5A 5FCUH 1OW0A 4HUUA 5JDJA 1IGML 2AXGA 3IDNB 3PWUB 4TVPD 4LHUA 15C8L 5IWLC 3MACH 4NKQB 2VR5A 1RFDL 2ZUXA 1U2CA 1U6AH 5ENWB 4JY5H 3CZFB 2ESVB 5HTSA 4O4YL 1YMMA 4QYOA 2FGWH 1X6LA 4JFPB 2E7LC 2HKHH 5IBTL 3PWVA 4HX1B 3WCYA 2UZIL 1UKSA 1NUGA 3LKNB 3C6LD 4TQEL 4WUKH 4YK4B 1VDGA 1G0XA 2FWOB 5J6GA 2BDNH 3OBAA 3OF6D 5F6HJ 4R7DB 3FN0L 1AD0A 5HYSG 4N68A 3O6LH 1J7VR 1ZHNB 3D0LA 4APQA 4V1DA 5CZXD 3P4NB 1DDHA 1FZMB 1T7VA 4NQUA 4JPWL 5CFHA 3OX8B 2AV1B 5GSVA 2J5LB 4FQXD 2B0SH 5KOMC 4XWGL 1CIDA 4N90D 2ZUVA 1MRCH 1UA6L 5JUEL 4PJDA 3KPPA 3IAPA 1YEDB 3KPMA 2YSSA 1WIUA 3IVKA 1S7SB 3JXAA 1OAYL 3L7FB 3BGFC 3T77A 1RZKL 4N0UE 4K2UH 5CSZB 3MC0A 2R4RL 5D2NE 4NOBA 1I8LC 3U0TB 3ZTNL 3FN3A 4OCWL 4Z95L 4ZUUB 1JNLH 1PLGL 1Q38A 3A6CL 3DTXA 5HVFB 2CSPA 2IADA 4PLNC 2C4FU 1CICD 4NQXB 1J87A 4XH2B 4IMKA 1QR4A 2V2XB 3FMGH 3VI3E 4G8GE 4NQDA 2QQNL 4WGVB 4WRLA 1SEBB 4UT9H 5I18L 4OD3H 2P5WA 4KXZH 3U46A 4OKVA 3Q48A 1Q94A 5HYFA 1JPGA 3OB0K 2DTMH 1AGBB 2DQJL 2H9GA 3FO9A 5CBAA 12E8H 4WI6A 3HMWL 4PJEF 4AMKH 1QHOA 4AM0A 3KPRA 5JORB 5MENB 2CLVA 5B3NA 3IFLL 4XRCA 5EUOB 5KN5B 4IRJA 3EYVB 1FG9C 2P5EE 4KZEL 3HE7C 5CP7B 2YN5A 1MVUA 4LDOB 5A16A 1CD8A 1PAMA 4JFQB 4LSVL 1IGIL 5ID0B 4N0YL 2IQAA 3FZUC 2R23A 4I18A 3PGCB 5H8DA 1F8TH 3MR9B 5DJ0A 3EFDL 4KRLB 3GSNL 3K0WA 5DS8B 3CLFH 3SDYL 3F8UB 3ROLA 4PLOB 3O11A 3NBNA 2SEBA 3G5YA 3OAUL 3O4OB 1NC2B 4YO0B 4KROD 1BF2A 1WWCA 1KUMA 5ITFA 2W0LA 3LQAL 3UJTH 4Y2DA 1IC5H 2H8PB 3U83A 5HPMA 1I1FB 4PJAA 3Q6FB 2IGFH 1UZ8A 2CDEA 1YPZA 3L3IB 1WT5A 1GGYA 3N06B 3OJVC 4ODTH 3VXUD 4K8RC 2BSTA 3RAJL 4F37F 4GW1A 5DJAA 4M5ZL 4LVHC 1FGVH 1H5BA 5HI3D 4P5KA 3LRSB 1EAPB 1ZHKA 2Y06L 2YPLD 4I3GA 2XA3A 1PKQE 4TVPH 1XZ0B 3LAFA 1QKZL 1KB5A 1GGIL 2CRIA 1A21A 1HQ4B 2E7MA 3NCJH 1Q0YL 4IOSD 3MJ9H 2OP4H 2ITCA 4ZAKA 5DFVC 1JF6A 2WBJC 3EOTH 3PGFH 4XP4L 3KYKH 1KN4H 1BZ7A 3EYUH 4CVXB 3S88H 2FSEA 1F4WH 5HGGS 3KPNA 2F15A 3BDYH 5FGBA 1N5YL 5C0IA 4PRHA 5C0GB 4KKAC 1QFPA 5EUKB 2GKIA 1IGJB 4UMGA 5DO2C 2AJUH 2A6DA 1FNFA 3CJJA 1RZGA 2EDEA 3EO1B 2F53E 3UAJD 2A6JB 5D72H 2CGRH 3JWNC 5JW5B 5BXFA 2X1XR 1IM3A 1XR9B 1EV2E 2WBKA 3KXFD 4PLKC 2ADIA 3CC5B 4U1KB 2AJYL 3D69B 3PP4L 4OZIF 2WWMC 1FBIH 3OJDA 2J6EL 2C1PA 3O9WC 5C08D 4AG4L 5E2WL 1AXSB 4G42A 4GRWB 1F4AA 4KVNL 5E1HB 1Q9OA 5FEBA 1Q9LA 4PJ5B 2OI9C 3TBYA 1EO5A 3KYNA 4YHPB 4XCCH 5HDQH 2NNAB 4ONHB 3SKUD 4KMLB 4WHYH 2FJFB 3SE3A 1CL7L 2DQGH 5D1XA 1QLEL 3WUWA 4ELME 2HFGH 4BZ1L 1C7SA 4CW1B 2EDKA 1RZJC 4NFBA 4TYUA 3LKPB 5IESL 1VFAB 3QXDA 4YIQA 3T1FB 1N4XL 4HGWB 1A6AA 4RAUB 4JRXD 1MFDL 3BZDA 3VGAB 3WIFB 5B8CA 1U8OA 4GRMB 1QFOA 2CJUL 4H26B 2V2TA 1RIVL 1EFXD 4MJ6A 2BY1A 3D3VD 5JMOC 4GG8B 1XGYH 2A9ML 5TE6L 4CMMB 1V05A 4GH7B 3W11D 4MYWB 5E4IA 1FDLH 2IFGA 2IMNA 2IAMC 2BFVH 3U9UA 5D9SB 2QQKL 2ARWA 4CBPA 5HGHB 1CDBA 2EDWA 5KS9A 3FTGB 2FIKA 2X05A 3GMRA 2R69H 1IFHH 2V9QA 3FT2A 5DC4B 4D9RD 3K2UH 3RTQD 3DMMB 4KMTL 4NBZB 4GBXD 3UTSB 5KW9H 2YS4A 1G7LB 3D39A 1FH5H 5T1LA 1K5NA 1T1YB 4JCMA 3HHRB 3GJEB 3QYCA 5F88A 4RAVA 3PV7A 2K3TA 2YMXL 2V2WB 3KHQA 2NY2C 1F13A 1F6AA 4NHCL 4X6BB 1GOGA 5IV2B 1Z6JT 1G7MA 1YEIL 4F57L 2YWYA 1GZPA 3UROR 1PQZA 1UADC 2Y23A 1H3UA 1HZHL 2B4CL 5FUZH 1S78C 1L9MA 2EECA 2AS5M 2FLRT 4PJCF 4YFLI 5DD3L 2YEZA 4Q2ZA 2ATKB 3M45A 5SX4H 1Z9MA 2XWJB 4HUVA 4WFFD 1CBVH 1G7HA 2FNBA 4RNRA 1F2XK 2EDJA 4M6ML 4Z7OF 5I1HH 3GSNB 1T83C 3MLVL 4EVNB 2EYSB 1XCQB 4MJ5B 5JO5B 1G7QB 2HLFD 2A6KB 3LB6C 2FDBP 3MV8E 3WFCH 4MNQB 2EYRB 4M6OH 1D9KB 5IG7A 1ZT7A 1P7QB 4NQVB 4JKPH 2VQ1A 5FDYA 3U7AA 3OKMA 4HWZA 1DQJB 1J8KA 2BNRB 5BS0A 5FHBL 1NMCB 3P0VH 4NRZB 5D7LE 3RY5A 2XICA 1NCUA 4KDWA 1EXUB 5AZEH 4D0BB 2RFXA 4PRPD 3S5LA 4OFYA 4YQXH 1FAIL 5CIPH 3HRZA 2EZ0D 5F44A 3RGVC 1NANH 1K6QH 1TMCB 5EA0H 3ZKXB 2XTJD 3J8F7 3RKDC 1RJCA 2JB6B 4PV9B 1BM3H 1AKJD 1QBML 4LRNH 1RUKL 4WV1B 4XMKH 3VDCA 4XXCC 4RWHA 3AU1A 5DGRA 1MEXH 4KI5E 2CK2A 3RKPA 1QYGL 1G7JB 3B9KA 4RSVA 4KXZI 3MBEC 4L4JA 3ZE1E 2PYEA 3DRTA 5DUPL 1DEEA 4U1JA 2NX5E 1NAKH 4ZPVB 2EEDA 3BUYB 3UEZA 4QXTA 3D2UB 3DUUB 3LS4H 3ARGC 3G6JE 1N3NA 3ZTJH 1C12A 4TPRH 2QSTA 4K71B 1A6VL 4UOJA 4X8JB 5EU6B 5I16B 5F8RC 5JZ7C 4PS4L 1U3HC 1QEWB 4OFVA 3MRBB 5DJ8B 2JK5A 5JR1L 3GSRA 3BPCB 1A7OH 1KNOB 1OSZB 3EO0A 4HLZG 4OLXH 2F8OA 4LPWA 1T7YA 1RU9L 4UUJA 3AAZB 1K8IB 2Y36L 3PQYD 4Z7WF 5JQ6H 1DBMH 2B20A 2VE6A 3O6KH 4PJ9A 3VFWA 4BFBD 4HD9A 1MF2H 1AD9B 3LEYL 2AEQH 3FFDB 5IB3A 1MHEA 3O6FC 3CZFA 2VIRB 3KLSA 2F54D 4DUXA 1ED3B 4QHLB 4KQ3H 3QFJB 1CGVA 2JCCA 4DVRL 2ENSA 5CJQL 3AY4A 4ZTOH 2H2PD 3DX9B 5SV4A 5L2KE 1WIPA 1Z9SA 1UH4A 2C1OA 4LCIH 4R7DA 2AJVL 1Y18B 3RNKA 3CXDL 1W0YT 2R1YB 4WJ5B 3RIAF 1LE5B 5JLZB 2DQIL 4OZHA 2CDFB 4NM8H 4R97B 2X41A 3I3BA 4DCQA 1OD9A 2R56H 1DLFL 4QXGH 2H6PA 1T5WB 5DR5H 1RI8A 3KPRD 5DJZB 4CN4A 1YEDA 3FFCD 2AI0H 5E0QA 4JDZA 4KJQC 1DVFD 3QG7L 3DHMA 5F1NA 3SCMA 1OL0A 2LAGB 4FNLL 1XIWC 4YDIH 5DMIH 6FABH 3U0TA 3LSOB 1A6TB 2XZCL 4PY7B 1FIGL 3U7YH 4WFGE 4PJGB 1KPRA 4L3CB 1PZUB 3NCBB 1R3HA 3HAEH 4LRIA 5KVEH 4NZDA 3H0TB 4IRSB 5F9WB 4WI4A 1E4KA 5HBBA 1DN2A 1Q9WB 3ROOB 3CVIH 3IKCB 1T2QL 4FXKB 3FQNA 4G9FE 2R9HD 5MENA 4ODWA 3FB8A 4WEBH 3MLXH 4Y2DD 3QHFH 4FP8L 4YGVA 5KN5A 1GCFA 4UILH 3MLUL 1CXHA 3C08H 4HJGB 4YXKH 1K3IA 1KXQE 1JWSA 2IFFH 1KIRA 4PB0H 5LAXB 1BLNB 1YC8A 3ZKMC 5ANME 3QDJE 5TH2B 2PXYB 1ES0A 1CE6A 3KPTA 1M7IB 4YHLH 1DBBH 3IU3B 5IMKB 4G6JL 5L2JB 1I7ZB 1XGQB 3GSOB 1HQRB 5FYLL 1MCSA 5K9JH 2AK4E 1FO0A 3P11L 4HFWB 4JHZA 1IQDA 2B1HH 4IS6A 4YHNB 4L8CB 1AGCB 1F58H 1UH3A 3BIAX 1ZHLB 5EFIA 1IL1B 1U0QA 2GI7A 3EAKA 3E0GA 1JFQL 5IHZA 5TQ0L 4KI1A 3WFEL 1IKNC 5H94B 4RGOH 5CBEB 5DVLA 4TTGA 3RU8L 1G7PB 5C09A 5HXMA 3L1OL 1FJ1B 3IDXH 1MI5E 2BOBB 3P2TA 4KHTL 4MB4A 5T5NG 4ORZC 5KVFL 1L0YA 3O3AB 1S9YB 4M7JL 4OLYH 4EZMA 5EZJB 5BO1H 2X9XA 3H3PL 4PJHE 3MTRA 4BA8A 2A9NH 4R96A 4JZJB 3V0WL 2KBGA 5J6HA 1VACB 1W72A 3X13B 3K74B 2NY1B 4I3RH 2ZPKH 5BCAA 2DQCH 4JEGB 2MCPL 1MFBH 3RUGB 5E08L 4G80A 4GMTH 3Q5TA 1B3JA 2VWEE 4HQQH 1IAOB 4NKDB 2ZZUT 5FUOH 2EIZB 2J8UA 2WUCL 1J1OL 3ULSA 1WCBA 2QHRL 5I8EA 3VFUA 3VXMB 4ODXB 3QIWC 4GAFB 1F6FB 4OF0A 2X9YA 3QQ4B 2OR7A 4YHOL 5LCVH 4F33A 3I2CL 1H3PL 2IBBA 5IK3A 1RUMH 3VH8A 1TTGA 5F7UA 5EUKA 4KVCH 2BVQB 3MV7B 1NFIB 2JJVA 1FN4B 4P57A 2Z92A 2J7LA 3QUMH 2VLJE 4ODSL 5EORL 1F90L 3BVNB 1JNNH 3RIFK 4U2ZA 1IGFH 5FA4B 3BWAB 3H9YA 1CI5A 2XIDA 3PNWB 1QSEB 1LK3H 4OCYH 3EOBA 4MB5A 1G7IA 4KROC 2IQ9L 1JHKH 3FT3B 2CKNA 3HLAA 1YEFH 5IFAL 3EJYC 4FG6C 2KH2B 1A5FH 2P8PA 1FVEA 1O0VA 4U1KA 4X7TA 3D69A 5C0CD 1QBLL 3GSXB 2LU4A 1U41A 1AXSA 5E2TH 1U91A 1FPTL 1X7QB 4OV6F 5EB9A 5F9OL 4ZS7L 4Z5RB 2MPAL 3T3MF 1RZ7H 1I1AC 4ONHA 4ZFZA 3RWFA 3SKJH 1EH9A 4UT7L 1AFVL 4M93C 1KTDA 5HI3C 3LEVL 3KPLB 4X7SH 5AYUH 5IW6B 5ICZA 3OTTA 4XHJC 5E7FA 5HHMD 2AABL 4Z7UA 3LKPA 5DUML 1OAQH 3X3GH 1T22B 1VFAA 4TSCL 4UIKH 5F93C 4HGWA 4N5ED 4PJBB 4I8DA 2L7JA 3KYOB 1BPVA 3S34L 3MRRA 4P2QA 4QT5B 4OLZH 1G1CA 3TV3H 5I1CL 4G6KH 5H35B 3FB7A 3VXTB 5EBLA 5ITBH 1L7TL 3H9SB 2E7BA 4X99A 5CZVH 4Z7QE 4ELMF 5HYQA 3GSQA 1KCUH 2GTWB 4HV8A 4OZGA 2X40A 5A3IC 5F7EL 3NA9L 1WK0A 1DUZB 4B53A 5HGHA 4HC1H 4ENED 1U42A 3SHSA 3O2DL 3E6HB 5KSBE 2I24N 3VXRA 4OQTH 1AC6A 3X12A 2BNQB 4YE4H 1DBAL 1RJZB 4NUJA 3L6FB 3K4AA 4A2LA 4EIZC 3VG9C 5ILTL 3U0PB 3UP1A 1UM5L 4LMQE 4X4ZA 2VSCA 4Y16B 2GITB 1LDPH 3BX7C 2R29L 1NMBL 4EQ3A 5JPNB 1KACB 4GAJL 5FO8B 3RRQA 1OVZA 4YX2L 5GIRA 1HCFX 2AQ3A 2EDQA 4PJIA 2ZOKA 3NCYS 3U0WH 2ATKA 3IJHB 5E5MB 5JHLL 5T3XD 1GVIA 3W39A 4DW2L 1MAML 3BE1L 2EKSA 4CU8A 2XPGA 2PTVA 3TO2B 4BQBA 4U1HA 4OD2B 3RDTB 5ACZB 1VPOH 4EVNA 3QZWG 1EHLH 5DFWH 5JO5A 1G7QA 1UB6A 1QQDB 5D1QB 4R26H 4JLRB 2EYRA 1X9QA 3N9GH 1D9KA 3TM6A 4CGTA 1ZGLB 5CEXB 4DN4H 1MLCA 3S3PA 2PO6D 5CILL 3LIZH 4ZFOL 4KZDH 3QEUA 5H2BA 4NRZA 4CVZA 2X2YA 1IGCL 3MYZA 1EJ6A 4DGIL 4URTB 5GRVK 1EDQA 1NGWB 3KPSE 3ZKNC 5D8JL 1AGEA 3GHBH 1UJ3C 5I71C 4BZYA 2DQTH 3E2HC 5HGDA 4KDTA 3WLBB 1OGAB 3RTQC 3RA7L 1T0NA 2JB6A 4FQ2H 4PV9A 4N9GA 4ZXBB 5CJBA 3PGDB 2JELL 3UXFA 3EYFA 4PR5B 1XGUA 3AFLA 1KJ2H 3OXSB 4I0PA 3HI6H 4J3XA 4U6YB 5GZND 5AG9A 3UTTA 4WUUE 4G43A 1E4WL 4Y19E 4P2RB 4ISVB 4GG6A 4XWOC 1HXMA 2R0KH 2ESVD 1T4KB 3EO9L 4XC3H 5F96H 4HPYL 2X5PA 2VC2H 3JZ7A 3DUUA 1J5OL 4POYA 2AGJH 4ZTPH 3LPFA 4P9HL 4GXVH 3AS3A 3DSFH 4HDIA 4LVNB 3V8CA 3G08B 2W60A 5I16A 1PSKH 4IMLB 1WEJH 1AXTL 3A0OA 1MCKA 5DJ8A 1YQVL 4JJHA 1CTOA 1LP9B 4K7PL 3ZE1F 5A2IH 2FB4L 3QEQA 1RMFL 4L1DA 2ICWI 4QLRA 4QOKE 2ZKHH 4XAWH 5FECA 3I84A 2APXA 3U9PL 3FHAA 3V95A 1PX4A 3G6JF 5FV1L 5JNYA 3GUTA 1K85A 3GGWB 3MOBL 3DROA 4L3EE 5FO7B 2NTFB 3H3KA 4MXVE 4NO3A 1AD9A 5GSRB 3TVMA 1YY9C 5I66A 2EIBA 5I8KL 1FFOA 1Z3GL 2WV3A 3NH7H 4QHLA 3RL1A 5FO9A 3UTQB 3HS0A 1X5FA 1QFUH 5SWSB 1MCLA 1JNHA 2VR4A 4NZRH 3ALWA 1ZE3C 3H7BA 5E99L 2MJWA 4JKKA 1NAMH 3W0WE 3ULUE 4OGYH 3VWJC 4LPUA 1Y18A 1OW0C 4M6NH 5TE7L 4NFCA 2R1YA 1LE5A 2DM4A 4OCRH 2CDFA 3OG4B 1ZGLP 1NCWH 2IALA 1ULVA 2H26A 3QCUH 1CR9H 1WQVT 5DJDB 1T3FA 5EZIL 1QR1A 1LO2L 5DJZA 5MEND 1P7KB 4K7FB 3CLEH 3GMNA 1X5IA 4EDWL 5DC0A 2X1OA 4U1IA 1BREA 4X9BA 4JM2A 1UQSA 4U1NB 4XVJH 4UDUB 3SE8H 2DWDB 4ZPTB 1NBQA 5DJXA 4K94C 3DO7B 5T3XH 4ZO6A 4MJIB 4PJGA 4WWKB 5CINH 2R1XB 4R9HA 5GGTA 4DOHB 1R0AL 1QVOB 4RX4A 4WU7A 1S7QA 3MLSL 4AIZA 4APQC 2Z8SA 5IB2B 2FEEI 4LPVA 1MQKL 2OK0L 4G8IB 4U6HB 5CEZD 4OD1H 4OB5L 2XZAL 2P42B 5D7JA 5K59F 5F1IA 4F7MA 1VFBA 2AJXL 4HIEA 4I5BA 1CLYL 4JB9H 5BOZG 4WI5A 1UACH 3BPLB 5DMGD 1FNGB 1DN0B 1NC2D 4IOIA 4FFYH 3T4AB 4NO2B 3CMGA 4ZD3L 3I9GL 4Z7VE 3RVUD 2ZUTA 4HEME 4XVSL 1FORH 1JPFB 2UVEA 4P2OA 1AGDA 3WEXA 5SWZA 3FJTA 4XPFH 1T20A 1F02I 5HHNB 4IMKC 3BDBA 1I9JH 4FRWA 2GUOA 4MA1C 2ERJC 3OJMB 1RULH 1S8DA 4OCSH 1W2KT 2D7QA 3EDKA 5M94B 1RZIA 4NUGH 5L2JA 1CLOH 1CS6A 1I7ZA 5F9AC 5SWQB 3GSOA 2VLLB 4MD0B 3E6FB 5CUSH 4BSWA 4Y2OA 1LEIA 3L5XL 2CLZA 4HJ0C 4MSWA 3SO3C 2D4FA 1BQHB 4L3AA 3HAEA 4ZFOB 1SMAA 1TJIL 3T2OA 2RAMA 1IL1A 4IRJC 1OSPH 1GAFL 3BT2L 1R5IA 1MFNA 3MUY1 3OL2A 4I4WB 4LLQB 1NCNA 3DV6B 3LEXA 4E42B 4LLDA 3TBTB 4G8FA 4D3CL 3G04B 3KPOB 4HKXB 2GJ6B 5AUMA 2QQQA 3MBXL 3C2AL 3LKQB 2ED9A 1B0RB 2OSLB 3WNOA 1BHGA 2DM2A 4I18C 3BXNA 4PRAB 1ZK9A 3GK8L 4LASH 1ZLUK 2GJZA 3TJHD 1XF4A 3G5XB 1U58B 2Z4QB 3ESUF 1TJHL 3RWEB 5I76B 4H0HB 1GPOL 1KCLA 4QRRB 3UPAA 5DQJB 3W9EB 3X13A 2EEAA 5C0AE 2MWCA 3HA0A 4DAGH 2D31B 1J0ZA 3IT8D 4O58H 1I8KB 4LFHD 4OLUH 1J10A 3U1SL 3VFTA 4OGAD 1P1ZA 1VGEH 5HDBE 2EXYC 5I0ZA 5DUBA 2GK0B 4O9HL 5TPWL 2EDOA 5TE4L 2RIKA 2D9QB 3NGBB 3UMTA 1WT5C 43C9B 3QQ4A 4PJ5D 3CXHK 2DQUH 5T1KB 4MDJB 1FNSL 4BK5A 1H5BC 1YECL 3HMXL 4FQIL 3V6ZA 1HKLH 3MV7A 1NFIA 4L29B 5IMOA 5HD8D 4NSKA 1JK8A 3V4PL 4D2NA 2VDOL 4KK5C 3QXUA 3BKCL 4XNYH 4DKAA 1O7VA 3QWOB 4M62L 5K93A 2ICEA 4ELKB 4ZAKC 1G9MH 3PNWA 4FZEH 1N0LA 4LCWE 2EO1A 3UYPA 3ZL4H 4OM1L 2APFA 4NM4H 3L95B 4LVOB 5A2KH 3HPLB 4X83A 2GJJA 1JF5A 2YZ1A 3GBML 4KJPC 1MJ8H 1VADB 1SJEA 2YC1A 4UTAL 3VA2C 2I9TB 1ZTXL 1NSNH 3M17B 3LKOB 4E41E 4W4OA 3HN3A 1RQ5A 5D2LE 5INDA 2VDQL 5E2UH 5DRZB 4WW2B 4GW5B 3RL2B 3WKNA 1JYXA 1I7TB 1SBBA 5C2BL 4E5XA 1KCVH 3MRGB 1AY1L 5CEZH 1V7ML 2AXFB 4NWTL 1AHWA 3DMMD 3UTSD 4ZG1A 3LCYA 4C56E 5IFHH 4Q6IA 1BIHA 2HG5B 2F58L 4UQ3A 1FHGA 3GKZA 1BBDH 5DQDL 4RRPG 2ZUSA 4WHCA 2E9IA 1ONQB 1EPFA 2BSSB 4P46B 3ARYA 1I9IL 1BOYA 2W92A 3HR5B 3AMLA 4UNUA 4M5YL 2P8MA 4L1HA 5IIEB 1KEGH 3H9SA 5B38G 2DL9A 2NXYC 1RIUH 5IQ9A 4FXLA 2P24B 4H8WC 5JOFB 2GTWA 3PDOB 2HT2D 2KL6A 4M7LT 3G6AB 3LY6A 5EIQA 3SE3C 1YPZF 5D1XC 3MV9E 4QRQA 2BVYA 3O41B 3L3DA 4GS7C 3E6HA 4FZ8H 5AWNL 4PGJA 1YMHB 3NPZB 3ARVA 5DRNB 1WISA 2EC8A 2AXJA 4ZDHA 2IPTL 1X5KA 4MNQD 3O4LB 1BD2B 1BAFL 5B8CC 1D9KD 2C3WA 4XZUA 5CGYC 5DD5L 3EYOA 5CGMA 1P7QD 2O61B 1A7QL 1WICA 3REWA 2BNRD 3INUL 3AREB 1BJ8A 2CIIB 4M02A 5F6IB 4CN6A 1CGSL 3CPLB 1C16B 3P9MB 5GISL 5D70H 2R8SH 5F7HA 1IGTA 1UYWH 4BH8B 1EX0A 5IT2L 5CD5C 4HS8L 3FAXA 1SHMA 2AVGA 3THML 1CK0H 4MDIB 1Q0XL 4NO5B 4PB9H 3LKSB 3NA4A 4WI8A 3GNMH 1OP5H 4YWGH 3T4YA 4Y5YB 4RQQA 3PXJA 4TVPE 3NAAH 4S1SH 5DMKA 4HUXB 5E5MA 2BXZA 2B2XL 5ID1B 2CKBL 2ZNXA 1JGEB 2DQDL 1IGMH 4OD2A 4U6XB 4GKSB 1J8HA 5ESAB 1F3DH 2DOCA 4ZS6D 1RFDH 3KVQA 4W6WB 2IBZY 5E4EB 3RZCA 4CVUA 1PG7X 5DEFB 1VFUA 4Z8FL 3B6SA 5IBTH 1UWXH 1OAZH 1A9BB 3NFNB 1QLFA 2UZIH 1MUJA 2GSGB 4GRWH 3BP4A 3D2UD 3N0PB 4TQEH 1IAIM 2G2RA 3FN0H 5EU5B 5C0NC 2FEDC 3QRGL 1V8HA 4OTXL 5EU6D 2DL2A 2XQYK 3NIDE 1MAKA 4N90E 1HDMA 1OAKL 1D5ZA 4JPWH 4AEIL 3X11A 3GMLA 4YC2B 5JHDB 4XWGH 5E94A 2A38A 1G9EA 1WFOA 4ZXBA 5GS3A 1UA6H 5J9PB 5JUEH 3MFGB 1GOFA 4UT6L 1OOAA 4PR5A 4XI5D 1QBBA 5B3JF 4K8RL 3OXSA 1OAYH 4P48A 1RZKH 2AEIT 4K3DL 2OL3L 2R4RH 4P2RA 2Q6WA 1U8IB 3ZTNH 4OCWH 3IFNH 4G8EB 5M7QA 1PLGH 1CFTA 2YD2A 5FAAA 1BVLB 4NPYB 3RI5K 3QFJD 4W81A 1ERNA 3L3GB 4L5FL 4IOFD 2YHGA 4YAQB 3RHWF 3QO0B 1B2WL 2ED8A 2QQNH 1II4E 2VQUA 5I18H 4ERSL 3G08A 5IEKA 1JTOA 4NP4L 4IMLA 1DBKL 1NFKA 3QUZA 2EH8L 3BUTA 1HEZA 3DETC 3O3BA 3HMWH 4LPTA 1JN6B 2XN9B 3B9KC 3BZ4B 2QKIA 1V3MA 1RV6X 4X6CE 4XBEL 3DVIA 3PWNB 4OM0L 3GGWA 3BHBB 3IFLH 3VWKA 3UPCA 4KZEH 5D7IE 3MA7B 3MRFA 2FLBT 3U36A 3DX8B 1OCWL 2HRPH 1S7VB 1WFNA 4LSVH 2PYFB 2WAHA 3QUKB 1IGIH 5EO1A 1U9KA 2AQ1A 4YBQC 2YOCA 3AS0A 8CGTA 1H3WM 4BZ2L 3EFDH 4YHKL 2IBGA 3T0WA 3SDYH 1A8JH 4RX4D 4MCZB 5HY9B 5FXCH 1KLUB 1CDIA 3MLYL 5AD0B 3GIVB 3DSNA 1FFNB 1NCBH 1ORSA 2HT4D 3OAUH 5B4MC 3REVA 5LKNA 4PJ9C 2CIKA 1TTFA 1I85C 1TETL 3LQAH 3MRNB 2EDXA 1P53A 3WIIL 3KR3H 3LDBC 4WNQB 2YZ8A 2WSKA 3VXUE 4FOMA 4R90H 1P7KA 1RZJL 5JA8B 1MCIA 4ZSOA 1MJUL 2ILLA 5F9DC 3FCTA 2YK1L 3AY4C 1VKXB 4BKLB 2YPLE 3FQTB 2DWDA 4F8TA 1MSPA 1IZKA 2DB8A 3RAJH 2A0LC 4M7LL 3DO7A 4M5ZH 3P9LA 3DRQA 3P4OA 4MJIA 2PXYD 3BGFB 3ARDA 3CSYB 5E8OB 4I77L 4QRPB 1NCAL 2DS4A 3QWRA 1QKZH 3WE6B 1GGIH 3K46A 4OZFG 4UU9B 5DTFA 1Q0YH 1X4XA 3EW3B 4EI5A 3LH2L 5EC2B 3VFNA 5J89A 1F3JB 1DN0A 3SDXE 5FKPB 5E8EB 4GW4B 3SCMC 3T4AA 4HWBA 5IB5B 5DJ2A 1N5YH 1JPFA 1KF9B 4QCIA 5HHNA 1T0MA 5D1ZA 5EO9A 2CKBB 8FABA 3AVEA 3HE7B 3CFKA 3TP4A 5FK9A 3KXFE 3IDGB 4LRIC 1WWWX 2DLIA 1NCCL 4MLIA 4Z77A 4JHAL 1WTLA 4PLJC 3NOIA 1HILB 3DXAE 3HNVH 4MD0A 3E6FA 3L7EA 2NY1D 4Z7VF 1QA9A 1BQHA 2AJYH 2PW1B 3PP4H 3O3UN 5K9QG 2X4NB 1T03L 2J6EH 4AG4H 5E2WH 4KVNH 3PWPB 3VXMD 3PE9A 2D7MA 1YUHB 4QXWA 4LPXA 4DGVL 1XEDA 4NBXB 1CDJA 2VERN 3IGAA 3JV4B 3MJ8B 3GMPA 1XF3A 4OZIB 3RPKA 2WM0A 5HYJB 3MROB 2VLMD 2OSLA 5EIVA 1CL7H 2GIYA 1YC7A 1QLEH 2JCCF 4BZ1H 4JRXE 1MOEA 3SKOA 3OKDA 5I1AB 2XG5A 3EIFA 2AP2A 4ZFFA 2V9RA 5IESH 3MV7D 1ZVSB 2WMPA 1U58A 4HH9B 2Z4QA 1N4XH 3D3VE 3R1GL 4RMRA 4H5SB 3X3FL 1LGVA 3RWEA 5IEHB 5I76A 1MFDH 2IPKB 3QUYC 4UQ2B 3GMOA 1NGYA 2CJUH 3MLWL 4IIQA 1HH9A 3NCCB 4XTRC 3QQ9D 1FFPA 1WAAE 2FJGB 3P73B 4EUPB 2A9MH 4LVHB 1NDMB 1QSED 2OL3B 4JFDA 2VABB 4Z78B 3IDMB 3F5WB 4Z7NE 2GK0A 4M61A 3ZDZF 3QPQD 4MNGA 2DIJA 4JG1L 3VCLB 4EI6B 2QQKH 4D9RE 4LF3B 1HHJB 1NEUA 3QDMB 4QRSB 1YY8A 4UOW0 1UXWA 4YFLF 4ODHH 4O2CB 2WBJB 3CVHA 3TC9A 3QULB 4HZLA 3MLTB 4GAYA 5IW1B 2GFBA 4M4PA 4L29A 1GGTA 1LQSR 3SBWA 3ZKSD 1RZ8B 4XNQB 1I8MB 1J86A 5J13C 2YMXH 1D6EB 3OKOB 4HS3A 1V7NL 2OLDA 3QWOA 2DJSA 4NHCH 1MWAL 5HHQB 3HZYA 5EN2B 4F57H 2J8OA 1KXVC 1BMGA 2XZZA 3CX5J 1G9NC 5E8DL 5AZ2L 4WFFE 1CG9A 1HZHH 1MCHA 2B4CH 3FOMA 4X0KB 1KN2L 5LQBL 4PD4K 3KLHC 3UX9B 3WFHB 3H9SD 5MEPA 5DD3H 2R39A 4HW6A 4QHNA 5DSCB 2QADC 1JWUB 5KOVC 1T1WB 3EJJX 1EAJA 4M6MH 3WSQL 3M17A 3MLVH 4XHQA 4BK4A 2GY7B 4PJCB 4Z0XA 4HG4K 5GGSB 1N5AB 3O9WB 3QR2A 4FMFA 4NDMB 4NQCB 3MRGA 4AY0A 4B0MM 2BNQD 2OI9B 3QCVL 4DTGL 1IBGH 3IETB 3UDWA 1EJOL 1P7HL 2OTWA 2UWEF 3VFOB 5FHBH 4OAWA 2VL5A 4Y16D 4U05A 3QJHA 1UVQA 4NN7C 3OR6A 4DZ8B 3QSKB 5KAQF 3KYMA 3HR5A 3U79A 3TT3H 2XTJE 4EEEA 5LXGL 4HWEH 4N0FA 4DN3L 5KJRL 1U92B 3GMQB 4ZYKB 1FV1B 2YBRB 1DBJL 4JFOB 4GT7A 2DD8L 3M8OL 2UVFA 3WFDL 1QBMH 1T04B 1YMHA 1RUKH 1ZT1B 3RDTD 2DLFH 2IAMB 2OXHA 5BMFL 5FYLD 1L7IL 3VMPA 2DMCA 5EOTA 5D1QD 4E0RA 1QYGH 1A4KA 2OXGA 2XOTA 1JIBA 2WWKO 2YRZA 4AEFA 1MFEL 1UZ6E 1PZ5B 5DUPH 3BO8A 3V52L 3K3QA 3B4NA 2V17L 4Q0XL 1TCRA 4X98A 2CIIA 4TSAL 1TCMA 3HB3C 3CPLA 2ITDB 5MEOB 3V0VB 5D93C 2J8UF 3BESR 3RVXC 5TDOA 2A83B 3QHZL 5DK0B 1HOCB 2I27N 2EDFA 1A6VH 3IFPA 1M6OA 3UCRA 5T33L 4GOSA 4D9LL 2NY2B 4PS4H 3LKSA 1FL6B 5E6YA 4NQEA 2GK2A 4JZNB 2ZSWA 4WFED 1SJVA 3PWJA 4JFHD 4U6VL 3PQYE 5E9DB 1CWVA 1Z2KA 2VH5L 1OGAD 2P45B 5CEYA 5GJSH 1U8PB 4Y1AB 2Y36H 4ZXBD 2F54E 2YPKB 4Z18A 3DVGB 2X4QB 3KLDA 1FLRH 3LEYH 1S9XB 3O8XA 5DEFA 1QNZL 4P2RD 4KGJA 5IM7B 3WO4C 2FHFA 4FTVA 3TO4A 4DVRH 5CJQH 4CNIA 2RBLA 5GZOD 3WO3B 1TQCC 1GC1C 2XWTB 4F7EA 1HI6B 4M9PA 4PRNB 3T04D 2NYYC 1H0DA 4WW1B 1J0HA 2AJVH 3RX7A 4G6AC 3RVTD 1JUFA 3O3DB 4F37K 1EEQA 1BIIB 2B1AL 4AT6B 1A1MB 3FFCE 4GQPH 5FHAL 4P5MA 3WXWL 1DLFH 2R15A 3DURB 3RGVB 5I8CB 4KV5E 4Z7UF 5E2VL 4PRIB 4KMQA 1BBJA 1P2CA 3S96B 4N0CD 1C5CL 1BZ9A 4JDVA 3HNSL 4JFEB 4L9LA 1EERB 1HHGB 4FNLH 3JWDC 2DWEA 2XZCH 1QZ1A 3UJIL 3C5JB 1FIGH 5A43C 1T2XA 3MBEB 4LNVA 5CP3A 5SWSD 2MTPA 3PG2A 3D0VB 5KVDH 2VDLL 5LGHL 4KDTC 4LBEA 1A14L 1S9VB 4EQ2A 1OB1A 1OQXA 3ARGB 4I48B 1CCZA 2XWBB 1JGLL 3K4DA 3BN3B 2LE9A 32C2B 3VXQB 3QUXB 4JO2L 4I0PC 4XNZC 1NGXB 1MWAB 1T2QH 3QI9A 1U3HB 1AIFA 3MZGB 1PYWA 3QQ3B 3PWNA 4N0UB 3QXAB 5F71A 4QNPF 4YZFE 4Y0GA 5D2NB 1FGNL 2X6MA 4RFEB 3HUJE 4PJEA 2CR6A 3L3JA 3S6CA 2P1YA 1A6ZA 1FL5B 5DJYA 5FOBA 3DYMA 3PP3K 4MCYB 4OZFB 3TYFA 2BSED 4LCUB 5C0EA 3MNWA 4MJID 3O6FB 4NNXA 4DFIA 2HWZL 1CD1B 4G6JH 5FYKL 4CDHA 3WJJC 3VG0L 2W9DL 3ALPA 2E7LA 3SJVA 3H8NA 4JN1L 5FYLH 1CL7I 3P11H 4P2YA 5HGAB 3U4BL 1CF8L 2E6JA 4MS8C 1FFNA 1B88A 4MXQD 4XGZB 5DHVA 4JRYE 4N9OB 3ARFA 5F1SA 1JFQH 4YXLL 4X7DC 5TQ0H 2VLKB 4LDEB 2NW2B 1QACA 3TVMC 3WFEH 3MUGB 2P5EB 3JUYA 3BN9D 2MQ0A 3RU8H 3WD5L 5DVKA 1RJLA 3PHQB 3LV3B 3C8HA 3JV6B 3L1OH 4HLZH 3OHXB 1R5VB 5TDNA 1ETZA 4KHTH 1I7RA 5HJ3B 1VKXA 5KVFH 3FQTA 5J56B 4LLVB 2CRZA 2YWZA 4JREC 1W0VB 4M7JH 1TDQA 4NRYB 4EDXA 2X4RB 1AH1A 2XFXA 3H3PH 5IVNA 3STLA 2EIEA 3V0WH 3CSYA 2NMSA 1XIWB 1AE6L 2Y7QB 5DD6B 4D8PB 2H32B 4R4BB 2MCPH 4HHAA 3CDGB 4BQ6A 1W8OA 1U8NA 1T6WA 4FQQA 3ZE2E 3FB6B 2WUCH 4K7PY 1QP1A 2YUWA 2QHRH 5BRZA 3L9RA 5DEGB 4GRLA 2XNAB 3T0XA 1BEYL 3QDGB 5E8EA 1GZQB 3LN9A 4JM2C 4POUB 5ERWB 4GG6F 4YHOH 3I2CH 4MHHG 1H3PH 2AERT 4L8BA 1IEBA 1OF2B 2VLRB 3JTTA 4M1CD 3MREB 2GJ6D 2AK1H 3VGBA 3B83A 3S3SA 1MRDL 3FONA 4Y4FA 5EOCL 1A3QA 4PP2A 1ADQL 1RVFL 4CADB 3GIZL 3N85L 4ODSH 5EORH 4FQCL 4LHUG 1F90H 1YNLL 3MXVL 4XPTL 3SPVB 2G9HA 5D7JC 1UEMA 4JO4L 1HHIA 5C0BB 5C0CE 4P4KA 1HILA 4JFFA 4QRRD 1AGFA 2V7HB 5ICYB 1VGKB 4PREB 1KCSL 4JY4A 4U3CA 4DK6A 2IQ9H 4J3OC 3P77A 4RIRA 5IB4A 1EGJA 4X6DE 5CSGA 1DQQA 2DMKA 2XKSA 4P23A 4PY8J 3CU7A 3QFDB 1MCJA 4I2XB 4LHQB 1EZVY 2O26U 4P2OC 3SO5A 1IRAY 5F9OH 3ILQD 2X1PA 1YUHA 4OBRA 4ZS7H 5F3BB 3CXHJ 5HHME 1NPUA 1QSVA 2AKRB 4H1LA 1AFVH 4HUWB 4UT7H 5T1KD 5AAWA 5HYJA 3OB8A 2PTTB 3VXSB 3LEVH 4LU5L 4C55A 1SY6A 3ES6A 2D4DA 5IB1B 2AABH 3W2DL 4TSCH 3SQOL 2XKNA 1QO3B 2CLRB 4KJYA 3L5WB 4FQPA 5I1LA 2BY3A 3IXTA 4KKLC 2IPKA 4RZCA 3S34H 4UQ2A 4NGHL 4A2MA 3FRPA 3EOAB 4HPOH 3WDIA 3IRPX 1JPST 1FZOA 3C6SB 2MHAB 4HIIA 4LCCA 4EUPA 3BMVA 5K9OB 1GGUA 3MCKA 3GM0A 2OL3A 1YA5A 4RDQG 4A6YL 2VABA 4MWFA 2J1KA 3F5WA 3MV01 4CRPA 4Q7DA 1KB9K 4MQTB 5F7EH 3NA9H 4Z76B 5ESQB 1IC4L 2VOTA 4JM2F 5GS2D 3O2DH 5GRYA 1R3JB 4ELMB 3QDMA 3GB7B 4MD5A 2YA1A 1XF5A 4LKXA 1IM9A 2NTSP 3QIWB 4PGCB 1A1NB 1DBAH 3IJSB 4I13B 1JWMA 1G6RA 5ILTH 4QHKJ 1NGZA 1U8HA 1KIPA 1XGTA 4JJ5B 4Z7NF 1RZ8A 1EHAA 3ZMRA 3B2UD 3GKWH 4H88H 2RR3A 2R29H 3HZMB 3WIHL 4GAJH 2VDPL 1T21B 1FYTB 4P46D 5F3HB 1EIBA 4YX2H 1MCWW 5T3XE 2A1WL 3BWUC 4X0KA 4JANB 5BV7H 1T66C 1ZMYA 3WFHA 4RBPH 3WNNA 5D71L 4ZNEA 4GQ9L 1JWUA 3I6GA 5JHLH 1D6VH 4NT6B 4PGDA 3UO1L 4DW2H 3BE1H 5C3TA 1OTTC 4LLMA 1A9EB 2JJTC 4PJFE 3JBG7 5IFJA 4KTEL 3MRJA 2C26A 3VFSA 4JO1L 3HZVA 1QLRB 1JF1A 5EC1A 3IETA 3TFKD 3O4LD 1BD2D 1DQLH 1I1AB 3MLRL 5CWSB 1IT9L 4PJXA 5CILH 4M93B 4ALAH 1I9EA 3MRPA 5I1JL 2HFEA 6CGTA 3OKKB 3CFDA 3TIEB 1B0GA 3AS2A 3ARED 3LPWA 4MA7L 5KG9B 4PGEB 1IGCH 3BPOC 5C07A 5D8JH 1NKRA 2V6HA 1NEZG 2BVUA 3STZB 4DUWA 1KG0A 2DM3A 5DRXB 4W4OC 1JVKA 3K81A 1JRHL 4X6FB 1U92A 2I9LB 3RVWD 4DWHA 1EEZB 3HR6A 2FR4A 3RA7H 1BWMA 3QO1B 4H25A 4M9OA 1C08B 3KG5A 4K23L 1AHWC 2JELH 1I9RL 3ARPA 1LD9A 2ORBL 1IGYA 2ESVE 4Q6IC 5I1KL 4QRTA 3UZQA 3BP7A 4LSQL 5C71A 4K94L 5J1AB 5IJVA 4X5XB 2PCPB 1E4WH 3SQBA 5F1OB 5JXEA 5D7LB 1IKFL 4JZOB 1N59B 5MP6L 1RURL 3OQ3B 2OR8A 3D9AL 5IROA 3BP5A 3BIBX 2G60L 1J5OH 2Q8BL 5F7DB 3V0VA 3VG9B 1ZS8B 2LV4A 4X9FA 4P9HH 1KFAL 4R3SA 1M71B 3I50L 1P4IL 5DD1L 1I1YB 2YPVL 2OTUB 5MEQB 1TIUA 2HRLA 1FL6A 3A6BL 1AXTH 2Q86A 1J05B 1WJ3A 1YQVH 5C08B 4K7PH 2AXHA 3DVNB 2FB4H 5CKGA 1RMFH 4Y5VA 3TPUB 3P4LA 1UXSB 1QSZA 5HDOA 3CIQA 5JHDD 1QRNA 1FC1A 3LN5A 3QAZC 3U9PH 1M05B 3KPQA 1CFVL 2EYTA 4PJ7F 5C86A 3MOBH 2YPKA 3GBNH 4XCYB 3G5VB 4Y89A 3LKRB 4UAOC 3T65B 2OM5A 5DRWA 3PF2A 5IMLA 2NY0C 1S9XA 5HI4D 2KQMA 3B9DA 3BIKB 1Z3GH 5FCSH 5DXWA 4HAGA 2Y9RT 3G6JB 2NLJB 4Z7WA 3F6LA 4N8VB 4TUOA 5GS2H 3UTPD 1X6NA 3BKML 4JRWA 3WUWG 3S8WA 1DUYA 5E99H 2R2BB 1P84J 4L4VB 3DV4A 2JIXB 3G5ZA 4J1UA 1MFAL 3MYJB 5TE7H 5E8PB 5F21B 2V5MA 5CHNB 1UB5A 1QSFB 3HNTL 4IDLA 1VEMA 3ARXA 4TSBL 4WO4A 1U8KB 4GLRI 4HT1L 1UJ3B 5LBSL 5EUOE 1TZHB 3RZCC 1JHTA 4ETQB 5I71B 4TNVK 4MZ3A 3I6KB 2XN9D 4M8QA 4HULB 5EZIH 4BH7B 4L8SB 1LO2H 4KY1L 2FYYB 2XTLA 3E2HB 3T2PA 4A6YB 4R8WL 4EDWH 2X70B 3ZT5A 1HHGA 4YUEL 2QL1A 5ALCL 3TT1L 1AQDA 1GH7A 4W70A 5CEZE 1ACZA 2QV2A 3KWWA 5JW4R 1R0AH 4S11A 2K9UA 3FRUA 2X4UB 1N0XH 4DVBA 3MLSH 3MNZB 3C8KA 3RVVC 2OK0H 1HHHB 4OB5H 4K3JL 2PNDA 2XZAH 5F9JA 4PTTA 4ZXBC 2AJXH 1CLYH 2ZCHL 3RWIB 32C2A 3QUXA 3GJFK 2AJZB 2O5ZL 5K9KB 4N0UA 5JOEA 2Q1EA 5TJWK 3VXOB 2E9JA 3I9GH 5D2NA 4ZD3H 4NCC1 4HIXL 4XVSH 3U6RA 5TQ2L 2J12B 5TDPB 2EE6A 1KB5L 3GSVA 3OKNB 1LDSA 1YNKL 2BVEA 2DLTA 5EU3A 3BJLA 2LFGA 1WVZA 5I9QC 4LCUA 4UB0L 4G8GA 2YUVA 2BC4B 4BSVB 3UZVB 1AC0A 3MGOA 3VD5A 3QUZC 4LSTL 2VKWA 3WHE1 4AENA 4YEFA 4QRPD 1K4CA 5JXAL 2FIRT 4HJJL 5HGAA 4L4TB 1UM4L 2BCKB 3LQZB 3HE6A 2DJUA 4X6EA 3DUSB 3IJYB 1A0QL 1TJIH 1WBXB 3IS1X 3VWJB 4XX1G 1GAFH 3BT2H 3VWKC 1NLDL 1N64L 4HUUB 2P5EA 2C7UA 1I3VA 1K8DA 4D3CH 2AXGB 1X3DA 2Z93B 4LHUB 3P0GB 3C2AH 5ANMB 4F2MA 2AV7A 4WFHE 3GK8H 4KC3B 4PYHA 3MUHL 1KTLB 4MD4A 2E27L 1Y0LA 4ONGL 2ZUUA 1YMMB 4HKJA 1W0VA 5I1EL 1TJHH 3FAWA 4R2GD 4RMSA 2NQCA 3PWVB 1E4XL 3SDCA 2AK4B 3A67L 1XIWA 1NBYA 3ME0A 1L4IA 1LEKB 1T5XB 4H8WL 5J6GB 1CXEA 5DD6A 4JR9L 4P2CG 4EKXA 3U1SH 2NW3A 3FZUD 4IDJL 3K8LA 4GRWE 5L88L 3IFOA 3D0LB 2EDRA 1MELA 4O9HH 5TPWH 1GIGL 4APQB 4PJ5E 1JGUL 4V1DB 4MVBC 3HI1A 1DDHB 1WZ1L 2XNAA 1GZQA 3PWPD 1K2DB 2P48B 2AEWA 3O45A 4PJDB 3KPPB 2G5BA 3OAZH 1FNSH 2I07B 3VRJA 3QCTL 3KPMB 2YSSB 3IVKB 3ZSTA 5HYJD 2XXCB 1YECH 3HMXH 4FQIH 1MLBA 3ARDC 3F58L 3T77B 4QF1A 2F8XC 2NY5C 3O3EA 1PKQA 3VFVB 3V4PH 2VDOH 1U8MA 1CZ8H 3BKCH 3V4UH 2IADB 4M62H 4WHDA 2D03L 4UNVA 4EI5C 4K8RD 3DYOA 1FCCA 4NQDB 5GGSY 4MA1B 4P3DA 2ERJB 2AAVA 4OCXH 2P5WB 4OKVB 3JV5A 3K8MA 1UENA 1JPGB 3GBMH 3GJFA 5DDHA 3FO9B 2H9GB 4UTAH 5CBAB 5L8KB 1ZTXH 3SO3B 1ZA6A 2LU7A 2HVKA 2HN7A 1P9MC 4AM0B 2CLVB 2Y6SC 2ZSVA 4O5LL 2VDQH 3QDMD 4S1DC 3UTSE 5D1ZC 4XRCB 1TVBA 5C2BH 4IRJB 2PN5A 5DFVD 1C5BL 2VLJB 3VI4E 4FFVC 4NWTH 1MVUB 2BMKA 4Q9RH 2CR3A 5A16B 3UZEA 2F53A 3C60A 4XNUL 5EO0A 4U4BA 3ZE0E 1DTUA 4X4XA 1QO3A 3ORJA 1NJ9A 2IQAB 4I18B 2R23B 4JAMA 4NWUL 5DQDH 5DJ0B 4KKAD 1I9IH 3BFOA 4YNYA 3TZVA 1G0YR 1A02N 5DO2D 4M5YH 3EKCA 3ROLB 2F5AL 1CFBA 4YHZH 4PD4J 3T0EC 4R7NA 4M1CC 4XP1L 3G5YB 1P69B 1AO7E 4OGZA 5C6PB 5ITFB 5IVZA 3FQXA 4MNQE 4PLKD 4ELMA 2X1WL 1N26A 5AWNH 2VXUH 1KC5L 4HCRA 5HPMB 4PJAB 2J88L 4NIKB 3ZZ1A 3RWGA 1UZ8B 2CDEB 3O9WD 2WK2A 1YPZB 2BNRE 4NQCD 2IPTH 3TEUA 1BAFH 2M8XA 4IIQC 1W8NA 2X4PA 3EGSA 1A7QH 1D5XA 4GW1B 4NJ9H 4BELD 5DJAB 2DQEH 5DEZA 3INUH 1H5BB 1KLFA 3U4EB 1ZHKB 1CGSH 1A22B 4X5WA 2IWGA 1IAIL 1OTSC 4NCDA 4J4PA 4M3JA 4MQXC 5IT2H 2XV6B 3T0DA 1U36A 3SOBL 3THMH 1KB5B 3ILQC 1DLHB 3QISA 2O5XL 3HCVA 3V2AR 2ITCB 4ZAKB 4M3KB 1NBVL 1PEZA 4UTBL 2CKBH 1B4JL 1MCDA 1BZ7B 4OLEA 3SBWC 5EIIA 2FSEB 1OP3H 4F9LC 3VMNA 5FGCB 2IAMD 3KPNB 3QXVA 4PRHB 4LL9A 2W9EH 3FOLA 1CLCA 3GI8L 4M48L 4Z8FH 3SGJC 1RZGB 3QEGL 4CJ0A 4UZGA 5EU6E 1N2RA 5AG8A 3NIGF 5BXFB 1IM3B 2HTLC 2WP3O 1GGBL 3QRGH 2ADIB 2W65B 2NY2D 4PBXA 2B7DT 1OAKH 3OJDB 2X10A 2C1PB 2CK0L 4WY7H 4AEIH 4G42B 1Q9OB 5E9DD