5JXAH

Crystal structure of ligand-free vrc03 antigen-binding fragment.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
235
structure length
231
Chain Sequence
QVQLVQSGAVIKTPGSSVKISCRASGYNFRDYSIHWVRLIPDKGFEWIGWIKPLWGAVSYARQLQGRVSMTRQLSQDPDDPDWGVAYMEFSGLTPADTAEYFCVRRGSCDYCGDFPWQYWGQGTVVVVSSASTKGPSVFPLAPSSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VRC03 Heavy chain
publication title Somatic Hypermutation-Induced Changes in the Structure and Dynamics of HIV-1 Broadly Neutralizing Antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 231
sequence length 235
ec nomenclature
pdb deposition date 2016-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxaH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxaH01
4OZGE 3GJFA 4UOJA 2NX5E 3CFJB 3GSUB 3E2HC 2XFXA 4Z7WE 3RVXD 1A6UH 5HDBF 2DLHA 3FQWA 2C4FU 1ZGLA 1C08B 3CPLB 3F8UB 3LN9A 5H35B 1WF5A 3QIUB 2CLVB 4XVUD 4PJAF 3LD8B 4WTZA 1WAAF 4ZUSB 4L1HA 3W81A 2QEJA 5DJYB 5SWSE 4IIQA 3RGVD 2WWMD 1X7QB 3F7RA 3VCLA 1RUKH 1IT9L 4NHUA 4G9DA 5T1LB 4L8SA 3JWDH 1AD9A 4AK1A 4K8RH 1FYTE 2VZ1A 4N90D 3BKCH 4KQ4H 1XF5A 1B88A 3E6FB 4JHWL 2VJXA 4LU5H 4X6FB 3CAFA 4LVEA 3PHOA 4S1RL 4WEBL 5DHVA 4HFWB 2BVOB 2F54B 1RZGB 2MHAB 3BSZH 1ZANH 3NA9H 1IC4L 3O4LB 4MXQC 4TQEL 4TOYH 4JB9L 4K94C 5AYUH 1C16B 4PB9L 4QHNB 1Y6MR 5EOQH 1HQ4B 4R7NA 1YEFL 1FC2D 4J12A 3RVTC 2AV1A 3GM0A 3SOBH 3MRNB 5DWUH 5D2LB 4DGYL 5SWZA 3EO1A 1N8ZA 5DJ0B 2VL5B 5C07E 1UZ8A 1KB5B 4D0DB 4QYOA 1IQDA 4ZSOE 4WFGE 4JCMA 3TJHC 4HJJH 3O4OB 3OKDA 3ULVE 1JUFA 5HPMB 1C7SA 4NWTH 1LNUB 2VLLB 3E8UL 2M1KA 4ZPTB 2VL4A 3BT2L 3K4DA 1MAKA 3NVQA 4YXHL 3RWHB 3VWKC 4QCIA 1DFBH 2EE2A 3WIHL 1OAUL 1MJ8H 5IMOB 3WUWA 3S5LB 3RWIA 5GS1A 2AJZB 1MI5A 1LO2L 3MGTA 2H9GA 1TJGL 3ARYA 1OAKH 1S7SA 1QRKA 4P23C 2NY1C 1VEOA 2Z92B 5JO5B 4OGYL 1P84K 4EOWL 2FGWH 1NBVL 2FJFA 1WICA 4AENA 4ENEC 1T0PB 4DN4H 5DQ9B 4Y0GA 4KGLA 4C83A 4TVSa 1N4XH 1PKQE 2YPVH 4MD4B 3HLAB 3STZA 2CDFB 2NTFB 2VNCA 4BSVA 3ZT7A 3WIIL 2X40A 4Z7OF 2GJ6B 1K4DA 1IBGH 1LO3L 4D9QE 3H9SD 3MRLB 1KCKA 1ZEAL 4WFHD 3KHQA 4MA3A 1CLCA 1ZA6A 4MJIA 4P3DB 4R0LA 4P2RB 5D2NE 2GCYA 5E5UB 4L3CB 3R8BB 4F7TB 5F7FA 2BNUA 5HDQL 4FTVB 3BPLB 5EOCJ 4WCYL 4QTHA 1QFWM 4AH2B 4Y89A 5D71H 1XH3A 4OCRH 1P4IH 3PGCA 4YDIL 1EEZA 3E0GA 4PY7B 1UM6L 3KLHC 4N8VG 1CU4H 4P5TD 2W0PA 1VKXB 3PE9A 3VRLF 5LVEA 1A6VH 3FONA 3IU3B 3OL2A 3PL6D 2YD2A 5FCSH 3V4VL 1K8DA 3QZWB 5ADPH 4ONHA 4PRHE 3H9ZA 2AS5M 3NABH 1FLRL 2H41A 1HH9A 3L3IA 4OGAD 2P8MA 4QRUA 2J6EL 1FCCA 4XX1G 1HI6A 3NCYP 1HHJB 3AS0A 1FHGA 5H8DA 5HJ3B 4JFHE 1CFNB 4R96A 5SX5H 4HS3A 3IDNA 1KN2L 3IJHA 3PUCA 5L2KA 5MEQA 2AK4B 2WQRA 5D6DC 1CG9A 4PJCE 4RGOH 3I85A 2ZUTA 4WUUA 4ZUTA 3O6KH 3ZO0A 3RVWC 4Y1AD 1HHKA 2YKLL 1G7JA 1NCWH 4LSQH 1RFDL 3IVKA 2ICWA 3RA7H 2AABH 4K23H 3BGFC 5IG7A 3QUYD 1LK2A 1DVFD 1ORQB 2ICWJ 2APFA 4HC1H 4MDJB 1TDQA 5K93A 4DW2L 2VAJA 4ZNCD 1A47A 4Z6AT 1DQQB 3TIEA 4O9HL 1QSED 4BH8B 3LKOB 2MKLC 1ITCA 4Y4HB 4MCZB 1YDPA 5L0QC 1AHWC 3MV8A 3QUZD 5D96C 2OM5A 1YYLH 1YEDA 4PJBE 4GRWB 1UJ3B 2AJ3B 3IKCA 4PRPD 3CFEA 4P2QA 1T2QH 4LCWE 1AXTH 1FPTL 5EIVA 3A6CH 5EU3B 4S1SL 4PFEA 1S7VA 3GSNH 4ZXBB 2LU7A 4RX4A 2JJTC 2ORBH 1NCBL 1AGDB 3IB4A 4PJ5E 2VLKA 4Y16D 1K6QL 4L9LB 5IB4B 4PG2A 2E7LC 2YSSB 2A74B 1W0WB 4Y5XC 2QSCL 5H94A 4Z78B 4OV5B 3HG1B 4JO4H 4HUWB 4XPBH 3DXAD 1JGEA 3EOAA 1WIPA 5B4MD 1WQVT 3C6LD 2VDOH 5L9DH 1A9BB 3EDEA 5CWSB 1D6VL 2BVQB 4F37F 2WM0A 4JVUA 3QI9C 4JKMA 3OR7B 4R4NC 3CH1A 1A4JB 2VITB 2X05A 3P77A 4N5EC 3F12A 2W0KA 4B0MM 4YIQB 3DX7A 5GS2D 4FOMA 4TULH 3VFRA 5BO1H 1W0YT 1N64H 3RVUD 5KG9B 3P9LB 1DLFL 1IGTA 2BNRB 2VLMD 4UNTA 1NGZA 1GC1C 4IIQB 4KVCH 3SY0A 1CIUA 3IAQA 1EUUA 1JHTA 5AZ2H 1FVEB 5ETUA 3B5HA 1MIMH 1EMTH 3WSQH 3WFHA 4JEGB 4NHUB 4K2UH 1AD9B 1PEWA 1VFAB 4GAGH 1BQHB 4XP1H 4LVOB 4JQIL 1RZJL 3PWVA 3ARXA 1UB5A 2YZ1A 5JIKA 1R3HB 2PYFA 2ERJB 2O61A 5E1AB 5CKGA 1ES0A 2IAND 4O2CB 3CFKB 3WYRA 4WRLA 4Y2DA 2GJZA 1IGML 5E95B 4PJDE 3T2PA 4L8SC 1KOAA 1KPUB 1MVUA 2XA8L 2MQ0A 3KXFD 4DVBB 3Q1SH 4LVOC 4XP6H 7FABL 3UTSA 3UJTL 4R7NB 3G08A 4M7LT 3FQTB 5GRZA 4PS4H 4KUCD 4NQEA 4GUPA 4WO4D 4HKBA 4YGVA 1HDMB 4GRLD 3MBXL 5SWZB 1A3RL 4YWGL 2VR4A 2ZP0T 4U1SA 4KI5F 4NO2B 3T09A 1UCTA 1N6UA 3WLBB 2NXYB 3G5ZB 5TQ0L 1P53A 2X4OA 1EHLL 1T20A 3QHFH 4M5ZL 5L88H 1HILA 1P4BL 4H5SA 1LK3L 3I75A 3MNZA 1OL0A 4LDLB 2P4AB 1U95B 3QR2A 3BP4B 4HS8H 5DEZA 5I8KH 3RL1B 3BMVA 2ADGA 4JM2D 4IHOA 5EPMB 3D2UA 1QFUL 4AEHL 5TDOA 2XN9A 3DGCR 4HS6A 3QH3B 2FH6A 1J8HD 5K33A 3RWIB 1BBDL 3LKNB 5C7XL 1MI5B 1TENA 3MGTB 5HHNA 1KBGL 4ZUUA 3ULUC 1S7SB 1S9XB 3TA3D 5I1IL 3NA4A 3O3EA 4X5LA 2V2TA 5SX4H 4MNGB 2F58L 5TGBA 5C0JB 2NQCA 2FIKA 4C83B 5IKCA 1LDSA 1HCVA 2ZCHL 4Z7WB 3MJ8A 3KHOA 4QGTA 5GS1C 2QJDA 4HUXA 3FCTA 4PB0H 5DJ8B 1IAOB 3A6BL 3DETC 5J6GB 5T1KB 4FQCH 5C0BA 4MA3B 4MAUH 4X9BA 4HGMA 4Q6IA 3IXAB 1NLBH 3W9DA 3LQAH 4R0LB 4ODHH 5E4EB 2CK2A 5EBGA 4NC0B 3S7GA 4HPYH 1FZMB 4X6BA 1WFNA 1C7TA 1TQBC 1P5VA 5FO9B 5DHYB 4F7EB 2FO1A 4GH7B 1G9MH 4QTHB 3V6OA 2P24A 1KCSH 4WFEE 1CL7I 1FYTB 3TPKA 1XH3B 4X9FA 5HYJB 2FR4A 1WWBX 5DVKA 5E2UL 4YQXL 3SE9H 2HFFA 5K9JH 2B7DT 3EYUH 4LSUL 2XYCA 3RUGF 2WBWB 2Y07L 2J8UF 5T3ZD 1KYOJ 3QDJE 2B5IB 3DTXA 4XC3L 1TTGA 3BKYH 1DN0B 3BVNA 1U8QA 2Y4SA 3D0VB 3GK8H 1L0XA 4F57H 1MAMH 2HT4C 3Q0HA 1NCNA 4NKOB 4M6MH 3L3IB 4JRYE 5C0NC 1PX4A 2C4FT 4L1DA 4WI5A 2DF3A 2QQKH 1JMXA 2BSSA 4XPGL 1F6LL 1HI6B 3UBXI 4PJIA 4I3SH 4BH7A 3QO0B 1RJYB 2Y5TA 4R96B 2V2WA 2HLFC 4WWKB 4XWOC 3IJHB 4OSUL 1FSKB 3W5MA 1J1PL 2YRZA 1D5MB 2ZUXA 3QJHA 4LQ1A 2IPTH 1XF4A 5DSCA 3MRPB 3NCEB 4KV5E 4MZ2A 3C09B 4ZSOB 4G6JL 4YBLB 3UBXG 2Q7YA 4OLXL 1U91A 4GBXB 1HHKB 1G7JB 1U36A 3MCG1 3F58H 5JMOC 1PQZB 4GOSA 1LK2B 4M6OH 5ANME 1BFVL 1P7HL 4M61A 4N0UB 4JAMA 4WI9A 3VGGA 4JFOB 1G7MA 2CK0L 1D7FA 3TIEB 3AY4A 3IDJB 3DX8A 1MWAB 4DWHA 5FYKD 3JVGA 1IAKA 1GGCH 3RWEA 5LJYH 4FP8H 3WFDH 1KNOA 5CUSH 1L9NA 4JY6A 2QQLH 5EO9B 5HHXL 1I7RA 5ACLA 5IMMA 3U0WH 1ZLWK 5CHNA 5F71A 1T1WA 1NKRA 2OSLB 4Q0XH 1EJOL 2QBWA 5DMKA 3IFOB 4JDVA 1LE5A 2J7LA 5DA0B 1BD2E 4U6HB 1IE5A 2EEBA 4DGIL 1Q9KB 3LQZB 2FX7L 4QOKD 1JP5A 3N1PC 5DZOA 3U46A 4JFDA 3CIQA 5MP6L 4NO0A 5C0RH 2G2RB 3GKZA 4L4VA 4OB5L 1FVDA 4PUBL 4UAOB 2H2SC 4JJ5B 4R97B 1EH9A 2LE9A 5D2NB 5DVLA 2BDNL 3HCVA 1U58B 3GMRB 1J5OL 1WUNT 4F7CA 2P48B 1ZT1A 3D5OF 4OZ4B 4XC1H 1P2CB 3CVHH 4NUGL 3TCLB 4GG8B 4GS7C 4PG2C 1DBAL 1HIMH 2MOVA 4PJGF 2ATPA 4A6YH 3F12B 4WVRA 3SGKA 4R97C 1S7WB 5B38G 1T4KB 4NN5B 2YEZA 4PYHA 3DRQB 5ENWA 5IQ9B 1ACYL 1S8DB 4PRHB 4J23A 2X4SB 1B0RA 1NGZB 1UC6A 1V3LA 2OK0H 1HSAB 3JBG7 4N0YL 3TJEH 5CGYC 4POZD 1KC5H 3TH2T 1IGFL 2ITCA 4U7MA 3RDTB 1BM3H 3CMOL 4YDJA 4RGNE 3T3ME 5D4QA 4WEMB 4YDLC 4WUKH 1LGVA 1WZ1H 1D5ZA 4YLQT 1S9YA 5CJOH 4X7CC 5HI3D 5IVXA 3PP4H 4JFYA 3MCLH 1J9CT 5GGVL 1JF1A 2GHWB 4GAJL 5CEYA 1BVZA 4X6DE 4HGKC 4PJCB 3GB7A 1PYWA 1UVQA 2O61B 3ZKXB 3UZQA 3OAZH 3HI6L 2BMKA 4DKFH 3ARVA 1RJLA 4NQCD 2VXUL 2COQA 5H2BB 3BDYL 4GXUN 3FOLA 4R4FL 1MVUB 4HC1A 5CJQH 3WHXB 2AAVA 5DUBB 4J4PC 2I9TA 2H2PD 2GW5A 5L8KB 3TESA 1BLNB 3P30H 1JRHI 1MCQA 4K3DH 5IROA 4AQ1B 3C5JB 1NUFA 35C8H 4GUPB 2YD9A 5HHPA 4Y2DC 4YGVB 4LKCB 4LP5A 4U1IB 3TYGH 1J18A 1QA9B 2MCG1 5JOPE 4QTIH 2E5EA 2ATKB 2G5BA 1JYWA 3TWCH 3INUL 1VPOL 3F7YB 4DUWA 2AEPL 3OF6D 1NUNB 4JN1L 4PP2A 1JGLH 1KEGH 2X4OB 4QRRD 4XBEL 1QRND 3GSNA 5JZ7D 1NMBL 3PV6A 5DXWA 4P9HL 3WFBL 3S35L 1R3IL 3MRGA 1X5HA 4HIJB 4EUPH 3ZYZA 5ICYB 3GBNL 5ITBL 1LDPH 3WKMH 1GC1L 5FKPA 3S88L 1NDMA 2HFEB 2ADGB 2YRLA 3D2UB 1QSFB 3QHZH 4IOFD 2OJZH 1MUJA 4HIIB 5BS0A 4HS6B 4P59L 3DYOA 3U4EB 2BFVH 1R3KA 5C0IA 5T3XD 1A14H 5L7XL 3EW3B 1BFTA 2EDJA 1KGCD 4UDTA 4XP5H 1KCUL 3ZE0F 3BAEH 1S9WB 1EO8L 3B9KB 5DRZB 5L6YH 4WNQB 1CDGA 4IRSA 5J89A 1A8JH 4N0RA 3S36H 4GW4A 2ZSWA 1MLBA 4KKLC 4LSVL 4O02H 4AEIL 1QO3B 4ZUWA 3U7WH 1S7QB 1OD7A 3SO5A 3ROLA 3UO1H 1UJTA 4OF3A 3K4AA 3SDXF 2X42A 4D0CA 2Y23A 4LLVA 4Q6IB 4LFHD 2P43B 1INQB 5C09A 4BZ2L 4F7PB 2GEEA 3ZMRA 1JWMA 5IEKA 3O11B 2DL9A 4NO5B 4M62L 1OWRM 1Z3GL 3VG9C 4HLJA 3LCYA 1YN6B 4FQPA 3RU8H 2DYPA 3BYTA 3FJTA 5DJXA 5J7CC 5B3JF 5I9QC 1P69B 5FHAL 1BJ1H 2QQQA 5KVEH 2OQJA 4YFLI 3AREA 4DEPC 1S7RA 3BQUA 4U6YA 2CUMA 2HFFB 4JFPB 4MVBC 4XNUH 4KXZH 3P0GB 5JW3L 4MNHB 3TEUA 4PJEA 3MLYL 1I1FB 4RZCB 4K8RC 4ZO8A 1GVIA 1PBYA 4I9WE 4XPAL 1FNEB 4HKJA 3V6OC 4PG9A 4HT1L 4OM1L 2Z35B 4IJ3C 3U0TB 4CNIA 2AI0L 3ARDB 2DMBA 1CIDA 4M4PA 3LN4A 5IMKB 5B3NA 2X89D 3TCXA 4ZO7A 4N9OB 5HHVL 4HK0B 3U0PB 4DGVL 4PJIB 5A2LH 2AK1L 3DMMB 4QRTB 2ESVE 4L3AA 5E8DH 1RU9L 1AD0A 3VXRD 1EEYA 1P7KB 3Q6FB 4CN6A 2R69L 2ZG3A 4ZYKB 5DSCB 2YK1H 5HD8D 3VWJD 3IFNL 5KS9F 3P73A 4PRDB 1QLEL 1UACH 1MVFA 3FMGL 5LWYL 3G6DH 3DUUA 1O7VA 2DN7A 1UYWL 3MV7D 4I2XA 3NZHL 1X3DA 5A3ID 4L8DA 4JAMB 3CC5A 5I73C 2YPLD 4UTBL 3QDHA 2ICEA 4M02A 3N06B 4UUJA 2XWBB 4OZGF 1JNLH 1ZWIB 3AU1B 3IFPA 3OB8A 3QSKB 3K74B 3QIUD 3RAJL 2HWZH 3P4OB 3IRZA 1T1WB 3R0NA 5EOCL 5D9SB 3VU2A 3AY4C 4RGMC 5IHBA 4OCYH 3JVGC 4Q2ZA 4G6ML 3ZT6A 3BIKA 2ZOLB 1MHCA 1T7WA 2A6KB 5KAQF 3PWUB 1EGJH 1R3JA 5T1LD 5JPNB 1J0JA 2RFXA 4UINH 2Q86B 3DUSB 1NGXA 5F7DB 4JR9H 1B0GB 3QUML 5B39G 1OAZH 2NY4C 2D7MA 4QEGA 1A7RL 1CFVH 2PO6B 1W72L 5BVJA 1IVLA 2F54D 4QRSB 1CD8A 3U9UB 4F7CB 5DK0A 3KS0J 4G8FA 1VENA 3O4LD 2ATPB 4CVXA 4M7KH 1A1OA 4ONGH 4XRCB 4XBPA 3UZVB 3C8KA 3ALPA 3CFDA 1F5WA 3QDJB 2BY2A 4Y5VB 2P7TB 4RMQA 5IWLA 2OXHA 4O58H 2RAMA 2C7UA 2AEQL 1SEQL 1E4XI 1Y0LB 3KJ6H 4OZFG 1KLUB 1QBML 5FF6B 4JRYB 1QHPA 2MCPH 4PGCB 4LIQL 2VAAA 4YDJB 3SGKC 4WY7H 3D39A 1MCLA 1YMMA 2E7CA 1D5ZB 5CEZD 2F5AH 1GRWA 2YA2A 4PJ8B 3OB0K 2AV7A 4BUHA 1JF1B 3KPMB 2NY1D 1Y6KR 2F19L 3JTTA 1QD0A 1PYWB 4ENED 5F88B 3TO2A 3MJ6A 2PYEA 3HUJA 4CKVX 5EB9A 5CZXD 2R9HD 4BFGA 3ZTJG 5MENA 4XCNB 1CFQB 2VLJB 5J56B 3KLDA 1QOKA 1QLRA 5JIIA 4HCRH 3LS4H 5ANMB 1YEEH 1MJ7H 2FJHA 1UG9A 5DFTA 3RNQA 1XGRA 1JPGA 1V3MA 4HJGA 3UAJC 1JGVL 1FN4B 3QJFA 3BDBA 3L5WB 4FS0A 2OZ4H 3VA6A 1F8TL 3H7LA 2A9NH 5F7EL 1RHHA 2MNUA 2HJLA 3FQUA 1KELH 1MCPH 2GJ6D 4JO2H 1PZ5B 2WP3T 3QXDB 4HBCL 5GGUA 2AJVL 4PP2B 5ISZA 5E9DA 4Y19A 5IROC 1A7QH 3F7PC 3HAEH 4HWBH 1XFPA 5KVDL 5MERA 4ZNEA 1KV3A 4P2RD 4NKIH 3V8CA 4XVJL 5T5FL 3OKKA 3VXQA 3MRGB 1AP2B 4TRPL 3EJJX 3SO3C 5ITFA 3QXWA 5IB2B 4FTVD 3AAZA 5GGSA 4BKLB 3PP3K 1H8OA 1SEBA 4UIMA 4D9LH 1GZQA 2E8ZA 1KIRB 3CFCL 4I0CC 3DO7A 1UQSB 1MUJB 3VMPA 3QEUB 3B3IA 2Q1EA 3HN3A 4X4XB 1JWUA 1R3KB 4PLKD 1SMOA 1X4ZA 1S5HA 5AZEH 3CVHA 2YRPA 1FRGL 1FL6A 2DQTL 4UDTB 3EHBD 4RFOH 3EDKA 1C12B 4RQQB 3QWRD 2P5EE 3UC0L 4A6YA 1H8SA 4IRSB 1OF2A 3BKJL 3GM8A 4H26A 4OIIH 4K71C 2ZSWB 1GSMA 2D7TH 3RL2B 1ZHNA 3HI1B 1UWGH 2BOCB 3RVWD 4LKXA 5J12B 3KYMA 4AY0A 1ZVYA 3BOVA 4FQQA 4RBPK 1J0IA 3B2VL 5IW6A 4OJFL 4M7LH 1IAIL 3ETBF 1AXSA 2AK4D 4IRSC 3M8OL 2EIEA 4FQIH 5EBLB 2J12B 1MCSA 1ORSA 1SBSL 4NGHH 4RGNB 3O2WL 5EN2A 3HNTL 3OGCB 4KRPC 1HINH 1N59A 1NBZB 5D7IE 4FXGA 4RRPA 1FDLL 3DGGA 4U6YB 4G5ZH 3ZTNH 1V7ML 4GKZB 3UZEA 2VDRL 4X6DB 1TJHL 2B4CH 5ECJE 5EOTB 3PWJB 3MZGB 1JNJA 1D5IH 5DFVD 1ETZB 2X4NB 5C2BL 3BPCA 5MEPA 4Y4HD 4P4KA 5HI5C 2NY3C 3KNBA 4OQTH 2XT1B 4P2YA 3DV6B 3B8YA 3AREC 5DD1H 3BQUC 3WL9A 4CNIB 3MLZL 3MOBL 1UKSA 4JG1L 2ZUQC 4WIQA 3I02A 4MJIE 4MA7H 4JDTL 1N3NA 4PJBF 4U1GB 1NSNH 3SDYH 4OCSH 1CLZL 4U1MA 5HGDA 4Z5RA 2KZ1B 4HPOL 2CJUL 3CXDH 2OR9L 1YPZE 3PABB 4JLRA 5D70L 4KHXL 3HE6A 4ZXBD 4PJXE 4MQSB 4BZ1H 1FFPA 1PDKA 1KJ2H 2DWDA 4P49A 2R8SL 3DX6A 1O5DT 4FZEH 3QI9D 5IJVB 2PW1B 1FNGA 5CZKA 5HVGB 4RMSA 3HZMB 2WLYA 5E8EB 4EUPA 5HPOA 3HG1D 4YBQD 1G6VK 3HNSH 3WNNA 3U1SH 3KYAA 1U8HA 4XXDB 4P5MB 1RQ5A 4X6CE 5JORA 1FNHA 5DLML 2VDQH 4IMLA 1JGDA 1A6UL 4L8DB 1HHGB 3CC5B 1HNGA 1BOGA 5F9OH 4KC3B 2DQHL 3L5JA 4JVWA 3NPZB 4UUJB 4HSQA 1NCCH 2FSEA 5KTEH 2GK0A 2R0WH 1NLDH 3BX7C 1JPSL 4N1EA 1N6QH 2C3XA 3AMKA 1Z9OA 5C0FA 2ARJA 3FN0H 1CGTA 2XKUA 5DA4A 2WBKA 4IBLT 4UZGA 2BNRD 2FEEI 3GSWA 3O3DA 2NY6B 1LP9F 3HMWH 1AH1A 3JWDL 2AGJL 3VRIB 4K8RL 4WUUE 5CD5D 5DC4B 4LIQE 3BKCL 4KQ4L 4WW2B 4MQXD 3SCMB 5CZVH 1FIEA 4LU5L 3RWDB 4E0RA 1U8PB 4LAQH 2VDLL 1YYML 3BKMH 5HYSB 5I19H 4O2EA 5DC0A 4Z7VA 2NY5H 5DEFA 3O6FA 1G1CA 1ZANL 3NA9L 4TOYL 2HT2C 5AYUL 1AKJA 4QHKJ 3LQAC 1DUYA 3OJVC 1BJ1J 1MY7A 4GW1A 3SOBL 4PJDF 5DWUL 5E6ZA 5JMRA 3GBMH 2EKSA 1A1OB 3H0TA 4Q9CA 4P2QE 4KKCC 5LQBL 5C6WH 1G9MC 5D7JA 3CFDB 4NM8L 5DT1H 1I8LA 2F74B 3T0VA 5SWZD 1TCRA 4OCXH 5I1KH 1VADA 3RPIA 3D0LB 1PAMA 1MFNA 5AD0B 4DUXA 5A43C 4P9ML 4YAQB 4Z7UF 3SKNB 4NWTL 1SY6A 4I77H 2NXYD 3D39B 4RAUA 2UUDH 4JPWH 3TLRA 1RSFA 3LVEA 4I48B 1PG7W 1SM3H 1H5BA 5IWLC 2ESVB 2FH8A 4V1DE 2F8VA 3SDCB 3BUYA 1NJ9A 3RNKB 3O6MH 4LCUB 3IU4L 5DR5H 3ZKSD 1OAKL 2JE8A 3I84A 4QHMA 5GGRA 3CDYA 4CJ1A 2X4PA 5DQJA 2BVUA 2FGWL 1MI5D 1BVLA 3U7AA 2ZSVA 3E6HA 4LVHC 3AXLA 3FRUB 4FQXB 1CTNA 3NIGE 2OTWA 2R1XA 2YPVL 3TVMB 3VGAC 5DRNB 5C3LD 1XGRB 8FABB 2VISA 3T0EE 2FEDC 4ZOBA 2FB4L 3JWNC 2OMBA 4NC2B 5GGTH 1CR9L 2H1PH 5CSGA 5C0DB 4PJFA 2GYSA 3MRMA 4XNZB 1MFCH 3BISA 4M8QB 3LHPL 3CVIL 5DUPH 4U3HA 5IQ7L 1X6LA 1MCKA 5I74B 2XWJA 3MLPA 2B0SH 5T1KD 2WK2A 4YX2H 2WBJA 5FUOH 3A6OA 3EOBB 3I9GH 2AEWA 5GSVB 2F8OA 5D71L 3VXQB 1RULH 3RQ3A 1EGJA 4M1GH 4OCRL 4XNZC 2P45B 1T6WA 1JZ2A 1CU4L 5DJAB 2HT4D 1GZQB 3SKUD 5F1NB 1S7TB 4WHTA 2DI7A 1FYTD 5C0ND 5HYJD 3UTSE 5ADPL 1JPFB 1BQLL 1MSPA 3EYQD 3NABL 1F11B 1S5HB 3BPOC 4G43B 1NGPH 1UA6H 3KPOA 1FL6B 4P46B 4PGBA 4OI7A 3RY4A 1A4KB 5C1MB 2NZ9D 3H3PH 3O3AB 3T77B 4M48H 3IRPX 3M1BA 1M7DB 5CGTA 1KXVC 2OL3L 2Q3AA 3Q5YA 4XCCH 3KYMB 2X9YA 5IW1A 4RGOL 4FQQB 3D3VB 4OLZL 5I6XC 1DEEA 5K9OB 4WWKD 1OSZB 5BZWB 5L2KD 3O6KL 3J8F7 1CGWA 1NGYA 1ZGLM 3C2AH 3QEQA 1RZ8A 2R2HB 2WMPA 3TO4A 1LD9A 1CWVA 5EN2B 3MJ7A 1EPFA 4KROC 4GBXD 1F2QA 4RWHA 3V5DA 4BSWA 3VG0L 4HC1L 1QBBA 2JCCA 1Z9SA 1U93A 4MA8H 3ULVD 3QQ3B 1RD6A 2Q20A 1MPAH 2K1MA 5I1DB 1CE1L 1KYOK 2X1QA 3K1KC 5D72H 1T7YA 4YHNB 5D1QA 4APQA 5GGVY 5MEPB 4HCRA 4CVZB 5FXCH 5EU5B 1QFWI 3DJ9A 1AXTL 4K07A 5FGCE 1GAFH 1A3LH 5C0BE 5AAWA 4LRNH 3V52H 3T0XA 2OZ4A 3MRQB 3DROB 3BIBX 3BWAB 2ORBL 1E28B 1Z6JT 4WI2A 3ZSSA 1XF3B 3RVVD 2NY0C 2VC2H 4P4KC 4HKXA 2D7NA 1FFPB 2YR3A 3V6OE 4NQXA 4WI8A 3DX6B 3HAEA 4JO4L 4NCDA 2VLKD 3I3EA 4XPBL 2M26A 2O93L 1NMAH 3FQXA 3R06A 1AC6A 5CBEB 4G6FB 5IIEA 1ZHKA 1KFAH 2ZUUA 4Q74A 3VRJA 2DICA 1U8HB 4PREA 5M7QA 2DLIA 3IDYB 1M7IB 4CMHC 12E8H 1LEKA 3HE6C 4IMLB 1IEBB 4LGSB 3C5SA 1HYRC 5DD6B 5I17A 1YECH 2HTKC 1BOGB 4CDHA 1UZ6E 1WEJH 2GTZB 3UJJH 5DD0H 4BELD 4TULL 1N64L 2GK0B 3HC0A 4UIKH 2YD4A 4YDVA 3FO1A 3D9AL 2ARJB 3IDIA 4PRNB 4KVCL 4ORGB 4HUVA 3KPPB 4P4RA 5GZNC 2P5WA 4NKDB 3O9WB 5AZ2L 3QFDB 1OWWA 5C0EA 3X12A 5IR1A 2XZCH 4PRHD 1MIML 1EMTL 2AQ1A 2P5EB 3BH9A 3WSQL 43C9A 3L5IA 3SKOA 2C1PB 4ZD3L 4YEEA 1KTLA 5F93C 4K2UL 2CRMA 3QPQD 2DOCA 3RDTD 1FGNL 4XP1L 1I75A 3OJDA 3WS3B 3ILPA 1MEXH 5KW9H 3GMLB 3TN0A 2BNQB 1FO0H 1MF2H 4D8PA 2V7NA 1A6WH 2BOBA 5C3TA 3IGAA 4JFHD 1AXIB 4UV7L 4U1KA 4X4MA 3BHBA 4ODSH 4F33A 1BREA 4NHCH 4O2EB 4G8EA 1QLFB 3CLFL 3C9NA 1U3ZA 3MRKB 1MFEH 5HHQA 1X5GA 1IC5L 5GS2H 4OT1H 1F4XL 1IKNA 3Q1SL 4XP6L 2FLBT 1ODAA 4OFKA 1DUYB 2YD3A 5D7IB 4P5KB 4RNRA 3D85B 3S34L 2J5LC 3HFMH 3G6AA 3QPXH 4M4RA 3DVFA 3H0TB 1FFQA 3O6FC 4AL8H 2P42B 4JFQA 5AWNH 4OQTA 4KGJA 1SHMA 3GGWB 4F3FA 1WBYA 4IDJH 2ADIA 2UZYB 2DBLH 1OM3H 3S97C 1VADB 1Y18A 2IADB 5JTWA 4LMQI 3DV4B 3QHFL 4TSAH 4JFDE 3NPSC 3JV0A 3C6SA 1FE8H 4Z7QE 4L4VE 4MJ6B 3S3SA 1F3JB 3WNMA 4HS8L 5I8KL 1U42A 1VFUA 3KPSA 5D7JC 5HYFA 2F53A 5SX5K 1I8LC 3KWWA 1T7VA 5FECA 4F80A 2IGFH 1KJ2A 1CICA 5FGSA 4PJXB 4NYLB 1I8MA 1BQHG 3JXAA 2NY2B 2VZVA 4AYFA 4KMLB 3EYVB 3D2UD 1QSFD 1N0XH 2MSPA 2XN9D 2Q8AH 1OGAB 3BN3B 5DQJB 3CDCA 3GMMA 3QUMB 5HTSA 3ZKMC 1BVLB 1DE4B 5MI0C 3ULSA 5DK3A 4G8IB 1H5BC 3WO4B 2OYPA 4X6CB 3MRIA 1W72B 2VDNH 3GEWB 2DLFH 5JPMB 5KSUA 3BP5A 3B9KD 3AB0B 3ZYIA 4S1DD 4M93C 4L29B 1IEAA 5KVGH 32C2A 1D9KB 4MAUL 3VXUA 5FB8A 3LB6C 4PJFB 4M7JH 3MRMB 2PETA 1HH6A 3LQAL 4NDMA 2O26U 4ODHL 2XWJB 5FM8A 4HPYL 1LO4L 4BYHA 1H3UA 2XV6B 5E08H 3IDGB 3DSFH 1DN2A 2IMNA 4DN3H 2PCPB 5I8OH 1Q8MA 5I15H 2ZUWA 4LPYA 1PFCA 2AXJA 4OD2B 2G5RA 3PGFH 1NFDF 3SE9L 5K9JL 1R5IB 4I4WA 5DGQA 1L7TL 1I1YB 3IJYB 4UT6H 4WHTB 2C3HA 4FFWD 2WBJC 4R8WH 1E4JA 3S4SA 3BKYL 1BHGA 2GKIA 2DQGL 3GK8L 4F57L 4M1DL 1MAML 3SDDB 4D3CH 1A7OH 3KJ4C 2IMMA 2VRAA 3LRSA 5F6HJ 3CCHB 4M6ML 2IH1A 5FUZL 1S7XA 2AJXH 2QQKL 1YEIH 3U30C 2CKBH 4C58B 5F3BA 1DQMH 4V2BA 5EZJA 4I3SL 3MLXH 1T1ZA 4LLUA 1J0KA 3ARDD 1NAKH 5FYLL 2O5YL 3QDAA 5AUMA 4JO3H 2APWA 3DVNB 3UPAA 2B1HL 3DMMD 5JHDB 3QDME 4X7TB 4YUEH 3U4AA 2CH8A 1YNTB 1NFIB 1AR2A 2ZUSA 2D4DA 3OWEA 5T3ZH 2B39A 1IQWL 1VGEL 1XGQB 2V7HB 4BSWB 4M6OL 1R3LB 5EBWB 5KAQG 3MFGB 4WGVB 5D1ZC 1TJIH 2JCCB 5DUML 1U93B 3D1MC 2W0FA 1KIQA 1GGCL 1JTPA 4V1DB 1QSVA 4FP8L 3QNXA 3WFDL 2UYLB 4GXVL 2CO7B 4XWGH 3BN9C 3TO4C 4B5EA 5D1QB 2YMXL 2QQLL 1B4JH 3OAYH 3U6RA 3X13B 3R0MA 3W9EB 4NQDE 4LBEA 4NRXA 5GRXG 3FQRA 4XGZB 4Q0XL 2JIXB 5KOMC 2R56H 2Z91A 4PTTA 4TUJB 3DPBA 4QWWD 3TBSB 5C09E 1JE6A 2AXGB 2EIZB 4LCYA 5GGTA 2CIKB 3T0EB 4H1LG 3JWOH 5D1QC 5C0RL 2B8OT 4APQC 2EDLA 4CAGA 3Q5TA 2HTLC 3KVQA 4N8VB 3VFUA 4JKWA 3WFEH 2R1WB 3ARBC 3HE7B 2NCMA 4HEPG 3NFNB 4QXUL 4NQXB 4LCIH 3DIFB 2ED7A 3L3DA 1N0LA 1G7PB 4QXTA 5FYKH 3TBYB 2RGSA 1EAPB 1IKFH 3FQXB 1ZHLA 5EU7E 5CLTA 1VFBB 2HJKA 5BQ7B 3CVHL 3OKLA 2HKFH 3QUXA 1R24B 2PO6D 1HIML 4OM0H 5HYQA 3C5SB 4LHUG 5I17B 1UXSA 3DO3A 2PW2B 4ELMF 1NQBA 4MHHI 4P48A 2VKWA 3W0WB 5BMFH 2C9AA 1AQDB 4ZFFA 5KSBA 3H9SA 3GHBH 3GUTA 4X99A 1F58H 4CU7A 1DBBH 1E4XH 3IDIB 3F5WB 1KC5L 2G9HB 2FCBA 5HYEA 3KYOB 1BM3L 5C0EB 3X12B 3QULB 5IR1B 2Z4QB 4MHHG 1ZSDA 43C9B 4RIRA 3B6SA 2BVPB 3X14B 1WZ1L 3UTTA 1F00I 5ICXA 4ELKA 4JRYD 5FYJL 4YO0A 3TBVA 2HJFA 8CGTA 2YUXA 4WHYG 5KN5A 4XZUA 4P5TA 4DKFL 4PJ8D 3F6LA 2VLRB 3BHBB 1WFUA 2QKIB 2YWZA 4JKLA 1R0AL 4G8EB 3MCKB 4YHKH 3PL6A 4OZIE 2GSGB 5I1HH 3BFOA 1G6RA 3ARFB 3OXSB 3UAJD 3DRTA 3LRGA 5CJQL 1HOCB 1JV5A 4HWZB 4AEEA 3SQOH 5EC2B 3TN0C 5HVFB 4Z0XB 4LCCA 4K3DL 2VLJD 35C8L 4YDKH 3ZT5A 1AR1D 5MEOB 1BQUA 5JNYA 3TYGL 4Z7NF 3PWPE 3ARQA 1ZLUH 4RISH 3MBEC 4PBXA 4JFQB 4QTIL 3D69B 1IKNC 3TWCL 5TH2A 3B2UC 1Y18B 3GSRA 4FXLA 5F89A 5E70A 1I3RB 2YOCA 5FGCB 3C6SB 3QEHA 4Y1AA 4NQSA 2B4CC 1I9IL 4ZFZB 3UEZA 4PV9B 4XAKE 2IPUK 4ETQA 4R90L 1PGRB 3QUYA 3VFSB 1DVFA 1C1EH 3H3KA 4PJ9A 4X7FC 5FECB 3TIDB 3QHZL 4PLJC 3MLWH 5B38A 1I8MB 1QSEA 2BFVL 4ZG1A 3UTOA 2XQBH 3X17A 3G9AB 4PD4J 5D5MA 5F70A 2FGZA 5FHBH 3QUZA 3BP7A 3QA3A 3BAEL 3GMNA 4LNVA 3HZKA 3SGJA 4PRPA 1CICC 1PY9A 3MLUH 3MRIB 1A5FL 3N85H 3FRPG 1B2WH 4O02L 1PY4A 1RZKH 3WJLA 1GOGA 3U7WL 3UO1L 4IRSD 2R0ZH 5FIEA 4NNXA 4Y16A 1NC2B 3T4AB 3VFWA 5FYLE 3LH2L 1T7ZA 3BZFA 3RFZC 3ZDYE 1RZIB 2EICA 1WBZA 3O45A 3RWGA 4E42A 1GPOL 4WDIB 4JKPL 3RU8L 3V6ZA 2ZZUT 3C6LA 3ULUF 5LBSL 1M6OA 5T3XH 2QV2A 1T04A 2IPKA 1FO0A 2PYEE 3HUJE 4GAYA 4M1CD 4N9GA 4RGND 1TZGH 1J0HA 5MENE 4A2LA 4I4WB 1G7QB 2OI9B 2R2BB 4XNUL 5JQ6H 4PJAE 1LILA 1WAAE 3LEVH 1WC7B 1U6AL 1CXIA 2Y5EA 1CQKA 2YBRA 1GXEA 5EUKA 5EZIH 1BQSA 5FO8B 5CP7B 2CRYA 1YJDH 4E5XA 2F8XC 5D93C 4R9HA 3IFLH 5BRZB 4Z8FH 4MD5A 4JRWA 1YY8A 2NY5C 5E5MA 5ISZE 5DC9B 4FQJH 1CLOL 3GHEH 4ZNEE 2XI9A 2IWGA 2XTJE 4MLIA 5IFHH 4L3EA 1A6ZA 4YZFE 3MYJA 2OXGA 2YD5A 2L7JA 1PLGH 2WWMC 3TT3H 2IANA 4OLVH 1S5IH 3G6DL 1IZJA 5JOPD 5I8CA 2B2XH 1CXHA 3K2UH 1T2XA 1YPZF 5C0GB 4GMTH 4NT6A 4PJHA 5DK2B 3KXFA 3I6KA 3VXMB 4X98A 2WP3O 4G8GB 5BXFA 4LEXL 1EERB 2YUZA 1JHKL 2FDBP 1FZOB 1P1ZA 4HHAA 5SWQB 4RAVA 3Q3GB 4WO4A 3SKJL 5KJRL 1Q1JL 4F7MA 5L2JB 3BPNB 1JNLL 3OAZK 4GRLA 3RWFA 4ZTOH 4TUOB 3DECA 3BZ4B 1VERA 3QO1B 3MRFB 3ZE1E 4GAFB 2FZ3A 2HWZL 3T04D 3OR6B 3DUHA 1WCBB 4LBEB 1HEZA 3FQRB 1QYGL 3GI8L 1CD9B 3L95B 3B9DA 4XVSH 1G7LA 4LSPL 4W4NA 1RY7B 1DCLA 3QIBB 3JV6A 1F4YH 3H2WA 2NY6D 3NFSH 1OD9A 2VIRA 5IFJB 5I75C 4HDIB 1BOYA 1JN6A 5JR1H 4JR9L 3IXTA 5FYJE 1Q72H 1OAZL 3SCMD 1EX0A 2OL3B 1MOEA 1J8HA 1GGIH 1QUNA 4YNYA 4HH9B 4I0PB 5J6HB 4UU9A 3WCYA 1YY9D 1KUMA 4J6RH 3TA3A 3L3GA 2HJKB 5C9KA 4GKSB 4QF1B 5CS7A 3QUXB 5IVZB 1OB1A 4QHUB 3HA0A 2KH2B 2FHFA 1CZ8L 5FK9A 1QBAA 2BVEA 4QNPE 3BXNA 4NM4L 1D6EA 1J1OH 5KSBB 3TH4T 4OAWA 4DZ8B 5IB3B 4X99B 4R4BB 3AFLA 1UXWA 4O58L 1RJCA 1PEZA 1F13A 3LDBC 4PJ7A 5E2TH 4LOUC 3UBXB 4DAGH 3U83A 4G9FA 2CKBA 3LMJH 4I9WD 4WI4A 4WY7L 4LLMB 1FZJA 3JTSB 4ELKB 2F5AL 4KK9D 4F15C 5DI8A 4YO0B 2HJFB 2W59A 3GJEB 4Z9KB 3D39D 4P57A 4U3CA 1QSZA 3F7VA 1GIGL 4TTGA 3VRLE 3HPJA 4TSBL 1M1SA 2OTUA 4NIKB 3VXNB 2Y7QA 3V4PH 3K8LA 1DQLL 2ESVD 1CXLA 3OV6A 4X4ZA 4NRYA 4RMRA 3SDCD 2AQ2A 1ZVSA 4HUUB 1G6RB 3LSOB 5E1HB 3GSOA 5I8EB 1U8LA 3DRTB 2FEDD 3M45A 1CE6B 2IJ0C 4DTGH 4HCRL 1QTYT 3LS4L 3B9EA 4LCCB 3LEXA 4DUVA 4UQ3A 4YK4C 4C56E 1OTUD 1DLHA 1D3CA 1U92B 4P5TC 5T33H 1KB5H 5DJDB 4F2MA 4FQXD 4D0BB 3FAXA 3TVMD 4MQTB 3S96A 3PL6C 3TM6A 3VXOB 1IEHA 1KCVH 4QRPE 3NIGF 1MCPL 4JO2L 4EBQH 5CEZH 1MIEH 2F9BT 2ZNWA 1MFBH 2OJEB 4HIHB 1FFNB 3GO1H 4OGAC 4LCCC 3IKKA 4LASH 4NQDB 4HWBL 3FB5A 3WUZA 2VH5H 1X5FA 2AW2A 4NWUH 1N7ML 2EE6A 5C9JB 2H32A 4J1UB 1KLGA 4NUJB 5LCVH 3T1FA 4AT6A 1H3PL 3FT3A 4LLDA 2VE6B 4PJ9B 4C4KO 4D9LL 4Q7DA 1NANI 2X4TA 3FO0H 5E99H 2ICCA 5F44A 1IL1B 2VZTA 5CCKH 5B38B 3VMNA 5B8CB 1RI8A 4IS6B 3BESR 4OLUL 3IF1A 2YHGA 5I1LB 4YHPB 1NAML 2GSIA 3QCTL 4KU1A 2GFBB 2FWOB 1FV1A 3QUYC 3WBDA 1DVFC 4PGDA 1WIOA 2R4RH 3MO1A 5EFIA 4OIIL 4RSVA 4P46D 3H6JA 2GK2A 1DQJA 1IC7H 1UWGL 1NGQH 1OAQH 3G04B 1WT5A 3MZTA 1HYSD 3MR9A 1W8OA 3QUZC 5CINH 5GRUL 3LKPA 4NNXB 1MREH 4ISVB 3PQYE 4XTRD 5TDNB 2Y06H 5E7BA 2XKNB 1RHFA 2W9EH 4FQIL 1WBZB 4MGXA 1NDGB 4NGHL 2FO4B 4X0KA 3D3VD 4I3RH 3WJLC 4RCAA 2P44B 1FLTX 1K9TA 2XXCB 4LLWB 1M6OB 4XB7A 5DD3L 3RHWK 1HKLH 4NC1E 4G5ZL 4RFEA 1U8MB 4Y16C 5DJ6B 2EO1A 5DJ2A 2Q6WB 2EC9U 4NKMB 5DD5H 4UQ2A 1ZKAA 5GRVK 4ONFL 4WU5B 1R5VA 4OCMC 2A83A 1OARH 1D5IL 3V6FA 3NIDF 1HQRB 5B4MC 1NPUA 3C6LC 3C08H 1LEIA 3GI9H 1MRCL 3NGBC 3NFPB 1QFWH 1R5WA 2NPLX 2YBRB 1RUMH 3NIFF 5INCA 3BRDA 5DD1L 5DMIL 4NZRH 5J9PA 1I4FA 4MNQB 2VABA 4MA7L 5GS0L 1HCFX 2BY3A 1SQ2N 4JZNA 3BO8A 5TQ2H 3IAGC 1NSNL 3SDYL 4OCSL 3ARGB 2VTFA 3KGRA 2AJYL 1YNLL 3HTLX 2GY5A 4YHOL 3KDMB 2XOTA 2XZZA 3PWPB 3RVUC 5IBUG 2OBGA 4N0FB 4HD9A 5BV7L 1XGYH 5A2JH 4L3EB 3KPQB 1XMWA 1N2RA 3QNYA 4FZEL 2XPGA 2OP4L 2CDGA 1WSST 5FAAA 3V5KA 4FABL 1OTSD 5I8CB 1GYAA 4NQCA 4JQXA 3RZCB 3HNSL 5I18H 2YUVA 1FBIH 3U1SL 6FABH 5KZCB 1OQOA 3BEWA 3UPRA 1NGWA 5FEBA 1WBXA 1JCKA 1UGNA 2VDQL 1MLCB 4JDZB 4G6FD 5FUCE 5F7LB 5BXFB 5F9OL 5EZOL 4KTEH 1ADQH 3AS2A 4GSDH 1P1ZB 3T4YB 1I9JH 3O2VH 5IOPA 1E0OB 1NCCL 4AJ0A 4NZUL 5KTEL 2AJSH 2R0WL 2E9JA 4F7MB 4GRWH 5GZOD 3GRWL 1NFKA 1N6QL 4DFHA 3L5HA 3ECBB 3FN0L 5TF1H 1Q94A 4HZLB 2XRAH 3MREB 1VHPA 2EDOA 4E41E 3KPTA 3UTQA 1UZ6F 1I8IB 4U1HB 4S2SA 1Z5LB 4QRRA 2ZKHH 3EZJB 1MJUH 1YN7B 4PRBB 1QRNA 3O9WD 1G7LB 4WO4C 3X3FH 2GI7A 4GRLC 3T8XA 1RURH 2P5ED 1XAUA 4Y5YC 4DVRH 3U4BH 1SYSB 5IGXL 4LEOB 4KY1H 3OHXB 4HF5H 1TITA 2VIRB 4LAQL 3BKML 2EDBA 1DQTA 1FNLA 3VFNA 2BNQD 1Q0YH 3NOIA 2NY5L 3GJFH 4YNYB 5MHSE 4FQ2H 3P9MA 1XZ0A 5D6CB 2RR3A 2FIRT 1T5XA 3IDUA 3MROA 2Y36L 4WV1A 3AVEA 3HR5B 1XGTA 2X7LA 4MJ2A 1D5XA 1YEHL 1T1YA 1CDCA 2HFGH 3QFJB 5HGHB 1DTUA 4PJAB 1TPXC 3D85D 3AROA 3OZ9H 4XCEA 5DT1L 1AI1H 2W65B 1XCQA 3TA3C 5CD3A 5I1JL 1IGYA 3MMEB 5I1KL 4KJYA 2HP4A 3ZYOA 4NN7C 3L3OA 1U41A 3MJ9L 4G9FB 4TN9A 3QDGE 5CSZB 4JPWL 5D7LE 3M17B 4NCC2 3G5VB 1GZPB 1SM3L 4ZPVB 1Q9WB 5DI8B 5HHOA 4TTDC 5F9JA 1V3KA 3NN8B 5DRWB 2GTWB 3HPJB 4Z7QF 3O6ML 3OTTA 4GMSH 3BI9X 3D18B 1PW3A 1B6UA 1MCIA 2R39A 4K3JH 1LE9A 1T21A 1FL5A 2NY2D 2DJ4A 3WIFA 3HI5H 3EGSB 5IT2H 2A9ML 4XH2B 4GQPH 4MMXC 4GG6E 3X11A 2WINB 1OGAD 4LPWA 1L6ZA 3LEXB 4UQ3B 2VQ1A 5E6IB 4HUNB 2N7BA 1TZIA 5HBBA 1BZQK 2H1PL 3VGEA 1I1AA 3P4MA 1MFCL 2RJMA 3CSYA 5CFHA 3H7BA 3VXRA 1K8IB 2B0SL 3LEYH 2H6PB 5IM7B 5B39B 3ULUH 4NO3A 3VWJA 4KJQC 1D9KD 3G6JA 4YX2L 3GIVA 2NY7H 3I9GL 3ET9F 4L4TB 4CW1B 2VYRE 2BERA 3K80A 5CJ5A 5BCAA 5IV2A 1MNUH 3T1FB 3MV7A 5IVXF 4JRXE 3LOWA 4LLDB 5EO0B 2UZIH 4HG4J 1Y6NR 5BJTA 2X10A 1ZGLP 4I13B 3SGDI 2BC4B 4HJ0D 5ACZA 2YPLA 1I85A 4N68A 5DHXB 3GSUA 1IC1A 4QLRA 3IF1B 5F7WC 4CGTA 3JWOC 4M8VA 3EO0B 5J13C 1KENH 4ZODA 3MGOA 2GSIB 2AKRB 5GGSY 3T3PF 3CPLA 1C5CH 4OZFB 2EYSB 5H35A 3QIUA 5ADOL 2CLVA 2FX8H 5LG1A 1HXYB 4ZUSA 4RBPH 3LKSB 2W9LA 4M48L 2XG4A 5DJYA 2NLJB 2ZJSL 4PY8J 2DRUA 3UDWA 4XCCL 3MR9B 1KTRL 5H37G 1DBJH 5T1LA 1BP3B 1DJSA 1ED3B 3I6LD 3C2AL 3EYSH 3E6FA 2JB6A 4X6FA 3TZVB 3WD5H 1FJ1B 3EO9L 3AGVA 3WN5B 4MDIB 5JHDD 3FT4A 2YXFA 2BVOA 2F54A 1FG9C 4GRMB 4PRIE 4W4OA 4ZOAA 5DDHB 1RZGA 3I2CH 4ZFGL 4PJGE 3PV7A 2MHAA 4MA8L 4FZ8L 1S3KH 1MPAL 2GUOB 4RFEB 2R2EB 4BK5A 2DS4A 3O4LA 1MCRA 3O8XA 1Q9LB 1C16A 5D72L 1HQ4A 2ZCLH 2QR0B 2VXQH 2WW8A 5EIIB 4V1DD 4CN1A 2X4UB 5D2LA 3WE6A 4OF5A 2KDGA 2VL5A 4UT7H 1GAFL 1A3LL 5D1QD 1KB5A 4D0DA 4LRNL 4UILH 4O5LL 1JMZA 3VFVB 2JIXD 4F8QA 3V0AC 4ZS7H 2VC2L 1LNUA 2VLLA 4QRPB 4ZPTA 3T0ED 1E6JH 1B0WA 5FKAA 4X9IA 3ULVH 4POZC 3QXAB 4G7VH 2N7AA 1ZLVH 2XZQH 3RWHA 2BY1A 3FFCE 3CU7A 3ZHKA 5ELIA 3HE7D 4YHYB 4ZFOL 5F6IC 4AMKH 1RZFH 3CZFA 1KFAL 1N6VA 3S5LA 3BE1H 2AJZA 2QADB 2O5XH 1QBLH 2UUDK 3BEWB 1MWAH 4CBPA 2XWTB 3UPRB 2PR4H 12E8L 3DBXA 3CLEH 1AE6H 1MCDA 2AP2A 3WEXB 1YECL 2Z92A 4F9PA 2EDQA 1WEJL 2BHUA 5CEXB 3UJJL 5IOPB 5DD0L 3WXWL 4KZEH 1N5YH 1K5NB 2EH7H 1QQDB 2XNAB 2V9RA 5E7FA 1XR9B 4MB5A 5HSFA 5EA0L 2ADJB 2EDWA 4MD4A 4PJEF 3HLAA 4JQXC 4ZAKB 4OCNC 2CDFA 4EDXA 2DQIH 2NTFA 3B9VA 4V2CB 3W0WD 3IDMB 3DVIA 4WHYH 2GJ6A 4L9DA 2H2PC 2XZCL 4S2SB 4XHJD 5E03A 4ODVH 2FJGB 4P3DA 3V7AE 1SJEA 4ORZC 4TPRL 5CBAB 4L8CA 4L3CA 1MEXL 3NMEA 5KW9L 2YD1A 1FO0L 1MF2L 1A6WL 4YHMH 4FTVA 1CD1B 2WAHA 4ODSL 3PQYB 2H8PA 2EKJA 1RZKC 4HAFA 3SPVA 1YUHB 1MFEL 4PY7A 1IGJB 3EJZD 5JZ7C 2I25N 4GW5B 4E9LA 3ZE0E 2O5ZL 1VKXA 2VLRD 4Y4FA 4IRJB 2YS4A 1Z9MA 4M00A 4Z76B 3QZWA 3O2DA 1ZLSL 3ARFD 5JOFA 5ALBL 4IOFC 4J7RA 3HFML 4OZIF 2X7LB 4YHZL 4UNUA 3B2UD 1VACA 1K3IA 4LRIA 4LQFH 3FKUS 5E24E 1KXQE 5EIQA 4M9OA 1HHJA 1XIWB 4R7DB 5HJ3A 2DBLL 4KJYB 2VXTL 4TSAL 2X09A 2AK4A 4WV1C 1MCBA 2YA0A 3S98A 1TTUA 1TVHB 1BIIB 5TE6L 4J3WA 2ARJQ 3I3BA 2EDYA 1EXUB 2WV3A 2H45A 5HHOB 4BFEA 2IGFL 3NCBB 5IFAL 1F4AA 4AEFA 4MD0B 1T03H 2MFNA 2K7PA 4NPYB 3ARRA 3MRCB 3HC4H 1U8OB 5HVHB 4MDJA 3OAUH 1N0XL 1EA9C 4G6KH 1GJIA 1FL5B 1HK6A 2EECA 1JFQH 4CVUA 4BH8A 3LKOA 4Y4HA 4MCZA 3EOYG 1ADQA 2VDNL 3H9SE 2OMNA 1PD6A 2DLFL 2C3VA 1J8KA 1UJ3A 2AJ3A 5GGRY 3WKNA 2CLRA 4B53A 2OCFD 5EU3A 1I1AB 3MNVA 3BZEB 4M7JL 1SBBA 3CSYB 1TVBB 5KS9E 4U0RC 1MHEB 3HRZB 5E8OB 1LVEA 4ZXBA 5F9AC 1WJ3A 1YA5A 3FN9A 4Q9RH 4HX1A 3CK0L 1AGDA 2AJUH 3QRGL 4G7YH 4DN3L 1NC2D 4AG4H 1F90L 4L9LA 5IB4A 5I8OL 1IT9H 3QXUA 5I15L 3L3JA 1KIPB 4OV5A 3HG1A 1I1AC 3PGFL 4HUWA 1A1MB 4OBRA 5FCUL 1SYVB 4JHWH 2I5YH 2J88L 1A9BA 5ACZB 4UT6L 5HD8C 3VWJC 4ALAH 4S1RH 2EO9A 5C0AB 5CWSA 2BVQA 4R8WL 4WI6A 3OR7A 4ODTL 1A4JA 4PD4K 4Q6YA 2VITA 3HUJF 1A7OL 3AC0A 1P6FA 1BFSA 1J87A 3EKCA 3MGOB 1LMKA 4KFZC 4DCQB 4YIQA 3MV9E 2AJXL 4TQEH 2QSVA 4PB9H 5A3IC 5KG9A 3P9LA 2CKBL 1KT2B 3ALWA 2BNRA 1DQML 3MLXL 4L8BA 3P4NB 2G75A 4DJMA 4PGJA 1KJ3H 1NAKL 4U05A 3CJJA 1FVEA 5BRZD 4HZAA 4Y1AE 4MQ7B 2UWEE 1VFAA 1BQHA 5KSAB 3QIUC 3LD8C 4NRZB 1T22B 1J11A 2JB6B 2D31B 2Z93B 5T3ZL 2WUBL 3C5ZA 1R3HA 3UDWC 3L7EB 2IAMB 5E1AA 3E8UH 3FT4B 1NL0L 1SJHB 3CFKA 4O2CA 5D7LB 1BF2A 4YZFF 4UMGA 1WCQA 1TJIL 2FHCA 4JANB 5HY9B 5C0CB 2F15A 4B50A 1KPUA 1BZ7A 5EBMB 4MS8D 1OAUH 3RUGB 7CGTA 2WUCH 3O8XB 4YPJA 2J8UB 4YHIB 4XWGL 3VXMD 2DLTA 4DVBA 4G8GD 5M94B 1MRDH 4H8WH 2DKUA 4YGAB 1B4JL 3FQTA 1M7XA 3QRFM 3ZDZF 4W4OC 4FN0A 5E8NB 4OGYH 3WE6B 3C60B 1HDMA 4EOWH 1NBVH 2B1AH 4JFEE 4O51B 5GIRB 4NO2A 1F2XK 1NAMB 3O8XC 3WLBA 1KACB 3TH3T 3G5ZA 3JWOL 4XHQA 3MX0A 2DQCL 3ZE1F 1LO3H 1X5IA 3DXAE 3WFEL 1YEJH 1MFDH 3QIBD 1U95A 3BDXA 5FKAB 3ZYJA 3BP4A 2EYRA 3OKYA 4LCIL 3RY6A 3RL1A 4Q9QH 5FYKL 1KPVB 3SE3A 1IKFL 5EPMA 1I7TA 5C86A 3QH3A 3CZFB 1QVOA 2ZCKL 4MCYB 4JM4H 5I1AB 4MJ5B 3LKNA 4ODUB 2HKFL 3O4OC 4I0PD 3DBXB 5LGJB 1S9XA 4JRXB 3TNNA 1FG2A 4UBDD 4WHDA 4EQ2A 4MNGA 3QUXD 5BMFL 2BXYA 4LOUD 3KPRB 1GHFL 5EZLB 5C0JA 1V8HA 5CZXC 2R9HC 4YC2B 1JBJA 4Z7WA 4EDXB 5JA9A 4TSCL 3WXVL 4HLZG 4B41A 1ZXQA 5DO2D 5GJTH 5DJ8A 1IAOA 1PG7X 3MRBA 4QNPF 3TBWB 5J6GA 2VKXA 5T1KA 4F9PC 1QEWB 1ZK9A 2J6EH 2QSTA 3IXAA 3BH8B 3ILQD 4XP9H 1JZ5A 1SJEB 3U82B 4L8CB 1JZ6A 2IANE 2I07B 3DHJA 3NZ8A 2ZPKL 1FZMA 2BSED 4K3HA 1KN2H 2X5PA 5FO9A 4DOHB 3UTTD 5DHYA 4F7EA 3RX7A 1KTDB 2H8PB 4PJHE 5ID0A 1FYTA 1ZAGA 5HYJA 5GRWA 3SPVB 1IAII 4X5XB 5BV7B 1RFDH 3H8NA 1XGUB 4Y4FB 3SBWA 5IF0B 3SQOL 1RUPL 5FDWB 4PRIB 3BPLC 1DN0A 1I9RH 4PJGB 3D0VA 1YMHA 3PJSB 4FMKA 5EU6E 1BBJA 4YDKL 4DW2H 4NKOA 5JOFB 3FO2A 4O9HH 1VACB 3REWA 4K3GA 5ERWB 2H26A 4XPTH 4JZOB 4PLKC 5EORH 2J4WH 2OLDA 1FAIL 4KJPD 3MLSL 1WITA 2NXZB 3QO0A 3EHBC 2HKHL 1RJYA 4WWKA 1INDH 3BJ91 2DD8L 5D7SH 3UYRH 1D5MA 1I1RA 3MRPA 1H3GA 2FHBA 4LRIC 1EV2E 4JFZH 4NQDD 4ZSOA 4GBXA 1C1EL 4DKDC 2BRRH 3FQNB 1NANH 1DDHB 1PSKH 3T0DA 3FB6A 3VGBA 1PQZA 3L1OH 5BOZG 2A6JB 5I1CL 2LVEA 4PJ9D 2XQBL 3QNZB 2JF1A 4N0UA 2ENYA 5FHBL 4JFOA 1I1CA 3G9VA 3FFCB 2HRPL 4Z7VF 3IDJA 1MWAA 2VDMH 3CX2A 5LXGL 3U7YH 2ADFH 5FO7B 5D1XB 1K4CB 5EO9A 4XVTH 1RZKL 3BRFA 2C3VB 5TE4H 2R0ZL 3U9PH 2CLRB 2OSLA 4AIOA 3RGVB 3GMOB 3MNVB 3IFOA 1AGEB 5DFVC 1PKQA 5HGBB 4U6HA 2R0LH 1Q9KA 1KIUA 4Y4HC 3LQZA 3OAYK 4W70A 1DSFL 4LPXA 2QHRH 4HX1B 2D2OA 2G2RA 3H3BC 2D7OA 1UJ3C 1CLYH 2EXWD 3L3JB 5T3XL 4JJ5A 1MHHB 5D2NA 4FG6D 2JELL 1T80A 3VFPB 3H42H 4DZBB 1KF9B 4JQIH 1MCCA 1U58A 1RZJH 4ZXBC 3GMRA 3K46A 5C08E 4OZ4A 3C8DA 1P2CA 3ARTA 1NBYB 3TCLA 4GG8A 1M71B 4L9LC 3P2TA 3LEVL 5JW4M 1G1YA 5FOBB 4IRZH 4NJAH 3JUZA 1NEZB 3MTRA 1S7WA 4YBQC 5GGQH 1NCDH 1T4KA 4JFXB 5TDPB 1YJDL 2VXSH 3LY6A 1LP9E 3DYPA 4FQLH 1EHNA 3DRQA 4LVNB 3IFLL 5IQ9A 1J86A 2V2XB 4LF3B 1ACZA 1S8DA 4PRHA 5F1SA 2X4SA 1CF8H 4L8BB 1HSAA 2G75B 3N1GC 4MNQD 3RDTA 3MBXH 1A3RH 3SDXB 1WGOA 5IFHL 3ARGD 1U8KB 1A21A 2CO6B 3TT3L 3PWPD 4OLVL 5F9WB 1S5IL 5IEHA 4L3ED 3KLAB 3O41B 2B2XL 3K2UL 4IIQC 4PJCA 3C5ZB 3RHWF 1EO7A 5CD5C 5FYKE 2DM7A 3T65A 3LV3B 4MQXC 5JDJA 1FH5H 3N0PB 3RZCD 5H2BA 4XNQB 3FRPA 5KZCD 1BZ7B 4AEHH 4HIEB 4XAKD 3WHXA 5DUBA 2LFGA 1C5BL 5BOPA 2AXFB 3MQIA 1BBDH 2V5SA 4ZTOL 1BLNA 3C5ZC 2X1OA 2FRGP 3RX5A 2ERJC 3C5JA 2BK8A 1T0NB 1RJZB 3MA7B 4Z7UE 4S1QH 4LKCA 3EOTH 2VDKL 4QOKE 1T3FB 4U1IA 1CI5A 1L7IL 1DBMH 5K9KB 1QA9A 4FFZL 5F7NC 2ZCHH 2J8OA 1T2JA 2ATKA 2VWEC 3CFBB 1AGCB 3F7YA 2F5BH 2VR5A 5B21A 3NBNA 4DKEH 3UJIH 1F4YL 3NFSL 2HN7B 1ZLUK 3VI3E 5IBTH 4GKOA 5KS9B 1FGVL 3FOMB 2NYYD 4HIJA 4U1NB 2EYRB 5ICYA 2VUYA 3GSVB 1GGIL 2YPKB 2HFEA 1TETH 2VSCA 5CILH 4X8JB 1I7TB 3TYFA 1KJVA 5JW5B 5CP3A 4PJ5A 1QSFA 4JN2B 4J6RL 4HIIA 2NXYC 5J3HD 3U4EA 1QVOB 5FYLD 4Z77B 5J1SC 2CUIA 5DJCB 1JPST 4XBGB 3SJVB 3TNNB 3W11C 1FG2B 3EDJA 4YQXH 5IW3A 4JFFE 1S9WA 1MAJA 4LSUH 4OZGB 2Y07H 3SE3C 3VE0B 1J1OL 3B9KA 5DRZA 3QB7C 1FL3A 4WNQA 2NX5B 2HLAB 2UY6A 4LSTH 1UH4A 1LO0H 3UTPE 1FNSH 2IBBA 4EIZC 3QFJD 1QO3A 2HH0H 3DX9B 5E2TL 4DAGL 1S7QA 2WSKA 4YJZL 3MV9B 4TTDD 3MRBB 3LMJL 3CUPB 2LABA 4HWNA 4K94L 1INQA 1DEDA 1I3GL 3MRHB 4QHLB 4F7PA 1FP5A 3ZE2F 3O11A 4G9FD 5SWSB 2IBZY 4NO5A 3NZ8B 4PBWD 4ZTPL 1EFQA 1HZHL 1BFOA 1YN6A 4NQCE 2GT9B 4M5YL 1BGXH 3MRJB 5ID0B 3V4PL 3GIZL 4G6JH 2DQFB 3BZDA 2CMRL 3PG2A 4R0LC 2MMXA 4JFPA 5JUEH 4P2OB 5DMJB 5E4EC 4MJ4A 4ZO6A 4KMQA 2EDXA 4MNHA 4XAWH 3U2SA 1I1FA 4RZCA 1YMHB 1FNEA 1BBJB 5T33L 1KB5L 3ELAT 3FO2B 1JWSB 2Z35A 1T83A 4RAHA 4X6EB 4KJQD 1OLZA 4H1LB 5GHWL 3U0TA 3REWB 4BA8A 2PXYB 2CUHA 2H26B 3MRDB 3ARDA 1A3QA 1KCVL 3EYQC 5E6ID 5CEZL 4EBQL 5IMKA 4GG6F 1AO7E 3DURB 4QXGH 3SBWC 2QSQA 5AEAA 1ONQB 1S9VB 1MFBL 4HK0A 5HHXH 3U0PA 3GO1L 2B5IC 3C2SA 3DMMA 2HMID 4QRTA 3F6IA 1HN1A 2VH5L 1P7KA 2NZ9C 3Q6FA 4NWUL 4JFEB 5F9DC 3OJMB 4KMTL 4Y7MA 5C07B 4KRLB 3X3GL 4ZYKA 4ODWA 3D25B 4PRDA 4RA3A 1CT8B 2EH8H 5ESQB 1VGKB 1J88A 4L4TD 2XIDA 5J11B 3FO0L 5E99L 5CCKL 5T3XE 3FB6B 4HFUH 4LHUB 4WJ5A 3DXAB 4OB5H 5IBLD 5JHLH 4WWKC 3V79C 4EDWH 1FSKC 3LN5B 3FHAA 5E2JA 4W6XB 4U1JA 2Z31A 4JPKH 3E1F1 1T0MB 5TFSL 3C09C 5FYJD 3T2NL 1RK1A 4YBLC 1U3JA 4GBXC 2WIMA 1J5OH 2APVA 5EUOE 2XWBA 2BSRB 4YHLH 1ZWIA 4NUGH 5FYJU 3ULVC 3AU1A 1F3DH 1IC7L 4U0QB 1NGQL 1MCNA 3P4OA 4BQCA 5GXBB 5IMLB 5D9SA 1ZT4A 4HIXH 2RCSH 5CINL 2C1OA 1ITBB 1MREL 1PKQB 3VW3H 5JA8B 2HG5A 1X5LA 2Y06L 4XT1C 2GY7B 2W9EL 2ZOLA 5EG6C 2PTTB 2NW2B 2J6EA 2A6KA 4I5BB 5IESH 3PWUA 2LTQB 5JPNA 2Q86A 3CMOH 4I3RL 3DUSA 5F7DA 1MY5A 3RPKA 1B0GA 1A6TB 3L5XH 3RVVC 3TZVD 4TVPD 4JJHA 2WIIA 1OAXH 2PO6A 1EFXB 4HG4K 5E94B 4QRSA 3U9UA 1OSPL 5DD5L 3QWOB 2LQRA 1FVCB 2OR7A 3HI6H 3IYLW 1OARL 3GI9L 4UAOC 2VXUH 3RP1A 5D2NC 4XRCA 4KK6D 3MOAL 4NZRL 2ZNXA 3QDJA 2G60L 2R0KH 4Y5VA 3VXRE 1TQCB 2P7TA 5TQ2L 3A0OA 3C87A 5EU6B 3EUUA 1CBVL 1Y0LA 3QQ9C 1KLUA 5FF6A 4JRYA 2HAZA 1CD0A 3OMZA 4PGCA 3SQBA 4ETYA 1RIHH 2EZ0C 1NCAL 4NNPH 3MLRL 3FO9B 4NN5C 4AM0A 2JK5B 4EJ1C 2YN3A 3QAZB 4PJ8A 4QRPD 1P7QB 3KPMA 5ILTL 1CDJA 5IEHB 4FRWA 1NMBH 1ZTXL 4OZHE 3L7FA 4UV4L 4XI5D 6FABL 5I18L 4P9HH 4P3CH 3NAAH 3WFBH 5F88A 3QPQC 3RDTC 1R3IH 3QYCA 5TJWK 1WLHA 3T65B 2BSTB 3S88H 4KTEL 4XCNA 2QADD 1CFQA 3O2VL 5I1GH 2VLJA 1CXFA 3VXTA 3QCVL 4QGYA 1X6NA 1U8JA 4RMWA 5ANMA 2HT3D 4MZ3A 5TF1L 3T08A 3OSKA 4JY5L 2CR3A 3O0RL 4MAYB 1ZMYA 3ZKXC 4K7FA 1FN4A 3RJDA 4NQVB 1U2CA 1EBPA 3L5WA 1KCUH 5SX4I 1QR4A 3ALXA 4ZAKD 1EO8H 2ZKHL 4Z95H 1EHAA 1MJUL 4PJBB 1PZ5A 4H0GA 3QXDA 3DOSA 4LSVH 1RURL 1TCMA 3U4BL 2R23B 1I8KB 3DVGB 4KY1L 4LCWB 1REIA 4X5WB 5IB1B 1BD2A 1AP2A 1DQDH 1Q0YL 4RFNB 5IB2A 3PGDB 4BKLA 1H15B 4FQ2L 3TYFB 1KJVB 4PJ5B 1KIRA 3PQYD 1UQSA 3QEUA 4UT9L 1F3RB 2WZPD 4OIBA 4X4XA 1RMFH 2X44D 3RTQB 3TV3L 4IOIB 4KKAD 3GNML 4HGWA 4EKXA 4IRJD 5F72S 2DL2A 2X1PA 4PV8A 3BW9B 5C08B 1N5AA 1C12A 1I7UB 4RQQA 3V8OA 3OZ9L 1XGPA 1FL3B 1AI1L 5JLZA 3N50A 2HFTA 1X5JA 1E27A 1F6AB 2D7QA 3LKRA 2I27N 2I9LB 2X4RB 3RL2A 3HI1A 4OM1H 4JVPA 2BOCA 3FB7A 5CEZE 1XIWD 4CMMB 1LP9B 2D0HA 3EFDH 1NFDE 3B9KC 3P0VL 4DGVH 4S1DC 3QG7L 2AK1H 5EBLA 1A9EB 5C71A 5GRJH 1BFOB 1RU9H 5I1EH 3OG4B 2Y9RT 2R69H 3IAPA 3CZJA 1AQKH 3OGCA 4PBVC 5CIPA 3IFNH 5HHOD 1NBZA 2D03L 1A6AB 4RDQF 4KTYA 3MLTB 1IFHH 4Q6IC 1LO5B 2IPUG 4Y8DC 4M3JA 4B7IA 1F4HA 4GKZA 1KB9J 4HWEH 3BUTA 4X6DA 1MH5B 4U4BA 3W2DH 3MOQA 2V9TA 3FFDB 4OF7A 5EOTA 3PWJA 1IM3B 2P8LB 3U2SB 5F7UA 3STLB 3CDGB 2A0LC 4G42B 4PJDB 1ETZA 2X4NA 5A2IH 2EE3A 2ZOKB 3LRHA 3VXSE 3UTZA 4FFWC 3DV6A 1SMAA 1KULA 2A1WH 3WHE1 5E6YA 1MRFH 2ZUYA 4MXWH 4LHJB 2DLEA 4P2RE 3LEYL 4ODXB 4LSRL 5GSRB 3RJQB 3ULUL 1SY6H 4DQOH 3RIAK 5FDYA 4KI5D 1I1AD 4Z7UB 2NY7L 2A73B 3PABA 1OT2A 4FTVE 3BMWA 4H8WC 1T83C 4EZMA 4ODWB 1MNUL 5IJVA 3L3HA 3ARDC 2MQCA 5F7KC 2PW1A 5LGKA 4Z18A 3SE8H 3ES6B 1JIBA 2D7PA 5C92A 3OKOB 3HZMA 4Z0BH 5E8EA 1QR1B 4WJ5B 3DMMC 4XXDA 4R2GB 4P5MA 3QUMH 3FN3A 1CFTB 5ID1A 1XF2A 4U1JB 1HHGA 1KENL 2QL1A 2Z31B 5C0AD 1W72H 2KBGA 1RK1B 1ROWA 1C5CL 1U8IA 3L6FB 2FX8L 5MHSD 2DKSA 5IHZA 1OCWL 5A16B 4JFFB 1MQKH 1KPRA 2AK4E 1JTTA 4I18B 3BEVB 1ZT4B 5CGMA 1DBJL 5HGAB 5I66B 2C1OB 3VRIA 3VD7A 2HG5B 2AEQH 1DR9A 3EYSL 4WW2A 1WTLA 3SCMA 5DJZB 5AAMA 1QBMH 3RWDA 1UB6B 3LKQA 3VJ6A 3WD5L 4IDLA 15C8H 1U8PA 1BZ9B 4QWWC 4JREB 4LIQH 3RWCB 5KVFL 5KSAD 4M7ZB 5HYSA 3I2CL 2UWEF 4NP4H 2LAAA 1S3KL 2BJMH 3FTGB 2WIIB 3RY5A 2IAMD 3P11H 5D7LD 4ELME 4JPIA 4ZDHB 2Y25A 1OP5H 2F19H 2K7QA 2I60H 2ITDB 2GITA 4KAQH 5C0CD 2ZCLL 2VXQL 3V0WH 1U3HB 4FFYH 5D5MF 3MA9L 3GJFK 3NCJH 3O8XD 3GSQB 3V5HB 1IM9B 2XQYK 5K59F 1DUZB 2PO6C 3MUJA 4YFEA 4XPHL 4RRPG 3VFMA 2M2DA 2F74A 3C60D 3PXJA 5C2UB 2DDQH 3D0LA 4OGXL 1JGVH 5HI4D 3RWJB 5AD0A 2PF6A 4PGEB 4XB8A 4KKBD 3SKNA 4YAQA 4ZS7L 1F8TH 3QIWB 5E00B 1QNZL 3FZUD 1E6JL 4EEEA 1AO7B 1H3TA 4AM0B 3HG1E 4I48A 2VN4A 5KVMC 2XZQL 3J7HA 4O4YL 4Y5VC 2ESVA 1BX2B 4AMKL 1RZFL 3SDCA 3BE1L 3EYFB 2ICES 3L7FB 3MNWB 2O5XL 3RNKA 4LCUA 1KCRH 4XVJH 4HLZH 3HZVB 4TRPH 4WU7B 3CLEL 3HPLA 5KANI 4JY4B 2KUTA 1RVFL 4FFVD 4ZQKB 4Z7NE 3CFCH 4KZEL 2EH7L 3VXTB 4PJ8C 5DS8B 1JGUH 4LNRA 3FRUA 1U8JB 4FQXA 4JRXD 1A7NH 5ESAB 3TVMA 1UENA 4JCLA 3ZSTA 5DRNA 2DQIL 1PG7L 8FABA 1RIVH 5I16B 4K7FB 5D6DA 5KANG 3KPRD 4EUPG 2DQTH 1U2HA 1L6XA 3VH8G 1GGUA 3C8HA 5C0DA 2X70A 3UC0H 4ODVL 4M8QA 1R6VA 1JHLH 3BKJH 3LZFL 1F3DJ 4M43L 1AR1C 4X7SL 1JJUA 3W82A 1WVZA 4YHML 1II4E 3EOBA 1DBKL 4J8RB 3I6GB 5I71B 2C4XA 3M07A 5GSVA 1BD2B 1CK0H 5E4IA 5GS0D 2MJWA 4K55A 1ZT7B 2OTPA 4JG0H 4S0SD 4XCYA 5IK3B 1AHWA 4XNYL 2EDRA 5DJAA 4GQ9L 1SBSH 5F1NA 1S7TA 5TE7L 3HNTH 1JPFA 2P8PA 3IDXH 4PJHF 4LLYB 4HGWB 3WMSA 4EI5B 1F11A 4G43A 4Y4FD 5IVNA 2KZWA 1V7MH 4XPFL 4PRID 4P46A 5SWZE 2PTVA 4PV8B 1NMCB 2BRQA 1N5AB 4KUCF 4U1LB 1A4KA 1TJHH 1XGPB 4U33A 4EN3B 5IBUB 5JLZB 2XACC 3O3AA 3T77A 1E27B 2A6IB 2CR6A 3UCRA 3LKRB 5C2BH 3S36X 1M7DA 4PR5B 1RZJC 1ZHBA 3EDDA 3FB7B 3T0AA 5E8PB 1AJ7L 3E3QC 1UM5L 2E9BA 1G7HA 2JTDA 3ULUE 2NXZD 3VD5A 3PNWB 3D3VA 4JDTH 5ESVB 5K9OA 1OSZA 1UKQA 2BP3A 3FAWA 5BZWA 4YEFA 3H9HB 1JL8A 1KEMH 3KR3H 1CLZH 2UZXB 2R2HA 1HXMB 1JI2A 4HPOH 3JV4B 4UOW1 5F1KC 2OR9H 3E2HB 5D70H 1T03L 1L0YA 2QHLA 4NSKB 5JXAL 1GGYA 4JM2F 3HC4L 1MI5E 5CIPB 5J12C 1KN4H 2R8SH 3PDGA 3OPZL 3SDAA 3VXPB 3ARWA 3QQ3A 4G6KL 4ZS6D 1G0YR 4GKNB 1CN4A 1AIFB 4LK4A 5I1DA 1A1NB 4MNGE 5CJXA 4M1CC 25C8L 2EYTB 4QY8A 2EDTA 4YHNA 3FFCD 3BGAA 4RGNC 5DLMH 5ICZA 1CGUA 2Y72A 1H9VA 5DFWH 2DQHH 3UTZB 2UY7A 4CVZA 5EU5A 2DIBA 5FGBA 5D1XD 3MUZ1 4N1CA 1JPSH 5F97E 3MRQA 2R4SL 3DROA 3OX8B 3BWAA 4RA0C 1E28A 4Q9RL 3DWTA 1XF3A 3S9DB 2XG5A 2AJUL 1Q9OA 4ZUVB 4G7YL 4PJ7F 1U8NB 4AG4L 3W39B 3MXWH 3ABZA 5F3HA 4EI6B 4XMLL 3QQ4A 1D5BB 3QXTA 1EVTC 2AGJH 3L3HB 2AERT 5HYJE 2N56A 4PTUB 3SHSA 4LARH 2YC1B 4OLYH 5CBEA 2I5YL 3L3KB 4YE4L 1G0XA 2IH3B 4U1GC 4ALAL 1T5WB 2VDLH 1YYMH 4HV8A 1M7IA 1AGFA 5ID1B 1ZLVK 1XF2B 1IEBA 2C5DC 1FQ9C 2Q76B 2X1XR 4JE4B 5DD6A 2GTZA 1BWMA 2VMFA 1U8IB 3KYNB 4XNMB 3EYOB 1HSBB 5I2IA 1ZA3B 5IHZB 4PRNA 4ORGA 3KPPA 1KJ3L 2JKXA 3RIFK 2ID5A 1I9EA 4NKDA 3O9WA 3QFDA 4QRQB 5L2KE 4HAGA 3BYYA 1KPRB 1BJMA 1EEUA 1RUKL 2P5EA 4BJLA 5EC1B 5LQBH 2E6JA 4LSSH 3VWKB 5D8JH 4NM8H 2C1PA 3T0WA 1O7SA 2R15A 4B7LA 3RKDD 3HR6A 3WS3A 3MPCA 2H3NB 2N4IA 3GMLA 2BNQA 3LKQB 3VJ6B 4P9MH 5CMAB 4HKZB 3SE4A 3D6GA 2OR8A 3RZWA 1KG0B 4P23B 4HMDA 2NY1B 4J3VA 1NFDB 4N0UE 1QLFA 2NY6C 3BSZL 1UKTA 3MRKA 1YQVH 3C5ZD 4HK3N 1AFVH 4JPIB 2FL5A 2WUCL 2DQUH 4WW2C 3SCMC 5T1MA 2GITB 3MV8E 1MRDL 4H8WL 5EOQL 3IU4H 5D7IA 4P5KA 3D85A 1YY9C 2EDNA 3EZ8A 2B1AL 5BW7A 3VFMB 3GGWA 2V5YA 4FQ1H 4BQ6A 3DARA 3ZLQC 5L8JB 5IVOA 4X4YB 4BQ8A 2IADA 3VXSB 3DV4A 2FB4H 2GJJA 4HJJL 1MFAH 2VLKE 1CR9H 4KPHH 4MJ6A 1YEJL 1MFDL 1F3JA 3LHPH 3CVIH 5IQ7H 2IF7A 4Q9QL 1IGCH 1DFBL 3V4UH 3PWNA 3W11D 1MJ8L 1YPZA 1XCTB 2JB5H 3CSBA 4PJXA 4JM4L 3VI3F 4NYLA 1JK8B 3ZKND 1J05A 4KK9C 3O3BB 4KQ3H 1ZS8B 3QG6B 3DLQR 3EYVA 3ROOB 3HPLB 2NR6D 1OGAA 2DWEB 5FA4A 4KUZH 3QUMA 4YXKH 3SJVD 1DE4A 2AXHA 4PRAB 4DN4L 3GMQB 4LNRB 3HAEG 4G8IA 5I76B 4X6CA 1N4XL 1W72A 1RV6X 3SDCC 1BQLH 2PUQT 5JPMA 5IHLB 5EU4B 3U48A 3B83A 4IOSD 5GJTL 1IBGL 2NX5D 1TNNA 4L29A 4F9LA 1QP1A 4U6VH 4R6UA 1D9KA 1RUQH 3VI4F 2X70B 3T0BA 1OTUC 4XP9L 4LHQB 2I26N 5DRXA 2EDDA 2EXYD 3MV9D 3TP4A 4FQXC 3RKPA 3BGFB 3TVMC 3IDGA 2OL3H 2AEIT 2BVTA 2PCPA 1GH7A 5SWSD 4EQ3A 1CL7H 1CDYA 1JNHB 3EJYD 4OLZH 4OD2A 4KK8D 1P4IL 2AVGA 4OFIA 1HHIB 4XCYB 1R5IA 4C57C 5L0QB 1AHWB 5I74C 5D96B 1I1YA 3IJYA 1A6VL 4ZOEA 2NW3A 4HQQH 3VG0H 1I9RL 2P8PB 4P2OD 3RBSA 4X9HA 3SDDA 4R3SB 5ACMA 4NQEE 5DGRA 4LGPB 3CCHA 4ELMB 3NTCH 1CE1H 4XPTL 5EORL 4XNXH 2J4WL 4KH2A 1XR8B 4WFFE 4G6AD 2PXYD 1S7UB 1INDL 1ZHBB 1CDBA 1EIBA 4Y5XB 2D0GA 5D7SL 3UYRL 1G7HB 3DVNA 4P46C 4JFZL 1BAFH 5JHDA 4X7TA 1JPTH 2BRRL 4JFED 4MX7B 5C07D 4JQVA 1HYSC 1YNTA 1NFIA 2BCKB 1NCWL 1K2DB 1PSKL 3OKMB 3QI9B 4LSQL 1QSFE 4N5UA 3RA7L 2AABL 3L1OL 2XN9E 4K3EH 4K23L 4CJ0A 1H0DB 3L9RB 4XTRC 1YC7A 4XMPH 4AIXA 4WFGD 1XGQA 2V7HA 5EBWA 1R3LA 1G6RH 3NIDE 2E7HA 2DI8A 4RMTA 2KQNA 4LHUD 3SDAB 3NIFE 2VDML 2BVYA 4V1DA 5DTFB 5E2WH 1A2YA 2UYLA 3U7YL 2ADFL 3U36A 3GJFB 4QY8B 1YYLL 2XFXB 5ICZB 9CGTA 4XVTL 1EJ6A 3X13A 5TE4L 3FQWB 3W9EA 1ZGLB 3U9PL 1T2QL 4XGZA 4G80A 2JIXA 3SDAC 2HYMA 4P9HC 3A6CL 4TUJA 5EUOF 4N8CH 3TBSA 2R0LL 3GSNL 2AXGA 5CJXC 2EIZA 3D9AH 4LSDA 2CIKA 1J1XH 2RIKA 3T0EA 2QHRL 5TPWH 1OGTA 1Q9OB 2Q7NA 4N8VA 3VCLB 2R1WA 1CLYL 2BY0A 5F3HB 3HE7A 2XA3A 3QQ4B 3NFNA 4G9DB 4CN4A 4L8SB 4ZD3H 5FGBC 4D9QD 1FGNH 3DIFA 1CVSC 3H42L 1G7PA 4OFYD 4J4PA 3TBYA 5A40E 1EAPA 3WLWD 1XF5B 2VDOL 5L9DL 3PHOB 1VFBA 4TNWK 5BQ7A 5DHVB 2KL6A 1WWAX 4UV7H 4HV8B 1R24A 1EFXD 1AGFB 4Y4KA 1UM4H 3AUVA 2IFGA 4IRZL 3CLFH 4NJAL 1OTSC 3O3UN 5F6HI 5GGQL 1NCDL 1IC5H 2PW2A 3MRRA 3S37H 1F4XH 3W0WA 3QQ9D 2VXSL 4FQLL 5BO1L 1AQDA 4NBYB 4KDWA 2EZ0D 5I2IB 1CF8L 2AV1B 5I0DA 3F5WA 4PJIE 3HB3C 3S34H 3IDYC 2G9HA 2BZDA 3W5NA 4FNLH 3CGTA 3EO1B 3KYOA 1N8ZB 3QULA 5GZOC 4JHAH 5GPRA 3S4SG 5EU6D 2Z4QA 1UZ8B 1UWXH 2BVPA 3X14A 1UCBH 4QYOB 1IQDB 2CDEA 4GAGL 1TIUA 1J12A 1BVKA 1X44A 2W38A 3G6JF 1CYGA 3OKDB 2MTPA 1JUFB 1TLKA 3O9WC 5E5RB 2VLRA 4KJWD 2QKIA 1P7QD 3MCKA 1FH5L 1WISA 4QCIB 2GSGA 5DURB 4JO1H 3ARFA 3OXSA 1HOCA 2FL5B 4OF0A 3V7AG 3WUWB 4HWZA 4OZHF 5GS1B 5EC2A 5T1MB 1QFOA 3MODH 4Z0XA 1JRHH 2H9GB 1P9MA 3P0YH 4PS4L 3SE4C 4BQ9A 2GAZA 1T7XA 4HXBH 4L5FH 3VDAA 4S1QL 5HGGS 5MEOA 3EOTL 2FJFB 3K8KA 4AENB 2P46B 1FCGA 2Q8BH 2C26A 1DBML 1DZBA 4MAYD 5JXED 4ONOA 4KHTH 3D69A 1YNKH 2X2YA 1TQBB 3STZB 1NEZG 2F5BL 4CUCA 3EFFA 2FATH 4DKEL 4BSVB 3UJIL 4MSWA 1K4DB 1I3RA 1EEQA 5L88L 2DM2A 5IBTL 1ZA6B 4MJIB 4ZFZA 4PV9A 5BW7C 1RUAH 3VFSA 3JUYA 2GCYB 1TETL 4LCWD 5CILL 1LO4H 1BMGA 3TIDA 3PWNB 2BNUB 1YPZB 1KXTB 3KS0H 3B9AA 3KYKH