5JXEA

Human pd-1 ectodomain complexed with pembrolizumab fab
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
113
structure length
97
Chain Sequence
PPTFSPALLVVTEGDNATFTCVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISKESLRAELRVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for blocking PD-1-mediated immune suppression by therapeutic antibody pembrolizumab.
pubmed doi rcsb
molecule keywords Programmed cell death protein 1
molecule tags Immune system
source organism Homo sapiens
total genus 17
structure length 97
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jxeA00
1RIVH 3IGAB 4YFDB 3PIQB 1U36A 1W8NA 3GI8H 2OJZH 2VLJA 4K3GA 5BOPA 5DUPL 3ALPA 4YGVA 5AAMA 4RMVA 2MCPL 4EOWH 4LLQA 4LOUC 3UX9B 4EUPH 3HC4H 3P4MA 1CBVH 3EOBA 5IT2L 4PRPE 4EBQL 3K2UL 5E08L 4PIRF 1XGUA 3KYNB 2A0LD 4QYOB 3T0XA 2A83B 4HBCL 3HTLX 5IF0A 4Z7QF 3U30B 5H2BA 3P3YA 5D2LB 1G7PB 25C8L 1YC7A 2CDGA 1IM9D 4DGYH 1T66C 2FEDC 4N0CD 3BRGC 3IETB 5HDOA 2IGFL 2NX5D 5F9JB 5LAXB 1GZQA 2X4QA 2GSGB 4HMEA 2F8OA 1KPRB 2ADJB 2X89A 5DMGD 1V8HA 3QCUH 4P2OB 3KDMB 4MJIB 1RY7B 1YQVL 1MCHA 4HIHB 1KACB 2ADFL 1G7LB 2EXWC 3D0VB 2YSSA 5GZND 5ECJE 1F58H 4HLZG 1KGCD 1NCAL 4KVNH 2D7PA 5BV7L 2NX5E 4PP2A 2VIRB 5DMIL 1FLTX 5DHYA 3UBXI 2XRAL 3HG1E 4JDTH 1K3ZA 4JLRA 1AR1D 4O5LL 5D1XD 5EO9B 3WXVH 5A16A 3W0WB 3GJEB 1XEDA 5GGSY 5EDXA 4PGDB 1WIUA 3BGAA 1HH6B 5T1MA 5T3XE 4HUWB 3ZDXE 1P1ZA 3FQWB 2H8PA 3GSOA 3B9KB 5D4QA 4ODSH 5DQDH 5F7HA 2MPAH 4PJ5E 4AQOA 2F19L 2P8MB 4O9HL 1DE4A 4OT1H 3T4YA 3V6ZB 2QQNH 2EEAA 4GAGL 5HI5D 2A6KB 3NABH 1QLEL 1BIIA 1GOFA 2X4NA 4JJ5B 2DI7A 5KOVC 2CR3A 5F1OB 1HK6A 2FWOA 3TBWA 5SX4I 4GUPA 5GRVL 3SDDC 5BVJA 2Z35A 2BMKA 1NH6A 3VH8A 3B5GA 4MJ6B 3CH8A 3EO9L 43CAB 4MD0A 5JPNA 2DMBA 1GCFA 4HIEB 4FQCH 3OAYK 1B6UA 2HKHL 3RTQD 4JFDD 3ZHKA 4P46B 2MWCA 5CJQH 2AEQH 3TO2B 1KJVA 1GGTA 4TVPL 3NCJL 3STBA 5T5FH 3RVVD 3MCLL 3GIZL 3MOAL 4XCFL 5JW3L 3LQZB 3VG9C 2VWEC 1OM3H 5J9PB 5DSCB 1R3HB 4U1HA 4EUPA 2EH7L 1NCCL 2V2WA 4OCYL 2H41A 4AEHL 2EZ0D 3TIDB 1IAII 4G8FA 1WZ1H 3HNSL 4LLVB 2Q7YA 1YMMB 4O2CB 1FL3A 4E41D 3IS0X 3GMQB 3ZKND 4M1DL 3IXTB 3X14A 1Z5LA 1BVZA 5K93A 5T1KA 2GJ6B 5I74C 3CLEL 4M6ML 3UTSB 4PJFE 1E27B 2APWA 1EEQA 3FTGA 3DHJA 3MCG1 4M8QB 1CIDA 4N0UA 1CGSL 1Q0YH 4IHOB 3HE7C 1E4JA 1RFDH 4U1SA 3V52L 1ACZA 1D5XA 4O2FB 4E41E 4TUKL 1G6VK 3P9LB 3SDDA 3ZDZE 4UDUB 1MCJA 3MV7D 5EN2B 4OZIB 3DUUA 3OXSA 5DMKA 5HVFB 3FQTB 2APFA 3GHEL 1OD9A 1YEKH 5KSAB 2G60H 1FNLA 5I1HL 3UJIH 1U2HA 4OGXL 1INQA 1OD7A 4GQ9H 1Y18B 3SQOL 4LLYB 4NOBA 4KXZI 1ED3B 4J8RB 1JUFB 2GHWB 3D0LB 4HQQH 3PNWB 1Y0LB 4J12A 3WKML 4JKPH 4DGIL 2MQ3A 2DKUA 1CDJA 2R1XA 5DVNA 5B3JF 4EKXA 3PHQA 1G6RH 3MV7E 4K3EH 5DYOA 1XF4B 3QUMB 3FAXA 4P4KA 2AI0H 1JFQL 2X89D 1YEEL 3WHE0 2XG4A 1T6WA 1II4E 3LY6A 3LS5L 1W72L 2I5YH 1TVBB 2QEJA 4XBEL 3NTCH 3DV6A 4HG4J 5JZ7C 1U8NA 2VZTA 2H2PD 3PJSB 4XGZB 3OKMA 5INDA 1B4JL 5F7EH 5H35A 2HT2C 2CO6B 5T3ZH 1HE7A 1KNOB 2OTUB 3BP7B 2G5BB 2QLVB 4K3DH 4PBWD 2BVOA 3D2UA 3WNNA 2B4CL 3ZT5A 4ZPVB 3C6LD 3MRJA 1J1XL 2RFXA 2DLTA 1B0RA 1QACA 2C3VA 4OF3A 4LOUD 3UJTH 2WM0A 3HE7A 4FFVD 4F7MB 4L4VD 4RRPA 4Y1AB 1FGNH 43C9B 2NY6B 1FVDA 1T2XA 3WS3A 4ZTPH 4OFKA 4XNYL 4X7TB 3D48R 4JFEE 4JO4L 1YA5A 1IAIL 4LHQB 5D7IF 1EJOH 3PDDA 2VITA 5FHBL 5FK9B 4XNZC 4U1NB 4RZCA 5FYJH 4K9EH 3V8CA 2VC2H 3G08A 5ALBL 5IHBA 4L4VE 4XHQA 1P6AB 1BVKA 2FEDD 4UB0H 5AD0B 4OZHB 1HKFA 2DLEA 3SDAC 4QTIH 2V2XB 3MRKB 2UV3A 1RI8A 4MX7A 4N1EA 4MQSB 2NY3B 1BECA 1QRKA 3SKNA 1C5BH 4KK9C 3SKMA 1QYGH 5DDHA 5IB3B 3FRUA 4AJ0A 1I9IH 4UU9B 2YMXH 2EXWD 3QEQA 1MFAL 5I1EL 4HAFA 1N6QL 3M1BA 3S5LB 4BH7B 5J12B 4ZAKB 1D9KC 4ZD3L 1BGXL 1RZFH 5EIVA 1EHNA 4P3CH 4KV5E 2O26U 4DVRL 4JHWH 4QCIB 1A7RH 5C0AA 2E7HA 4OIIL 4HEPG 4Z7OF 4RA3A 5IMOB 1Z9SA 2XACC 3Q5TA 5JOFB 3QXUA 2R39A 1PAMA 1PSKH 1DFBL 3DYOA 2FLBT 5CEYA 5FOBB 4ESKA 3MACL 1J8HA 2OMBA 2OXHA 4LAQH 1QLFA 4X5LA 2JJUA 4J3TA 5FYLH 1YECL 3LKSA 4R2GC 3ZTJG 5IFJB 1M1SA 4K9EC 5T1KD 5HYJA 1T03L 1XGPB 4G42B 1OB1B 5DJDA 3TYFB 4R8WL 5I1KL 1KB9J 5DT1L 1RZJH 1DDHB 1G6RA 2FSEA 3QHFH 5EOQH 1EMTL 2X9YA 4X4ME 4XCNA 2R29H 3B6SB 1FCGA 1UZ6E 4FZEL 3K81A 4HX1A 4X5WA 4YDIL 3HPLB 1Z3GL 3SDDD 2CUMA 5I1JL 2OR7A 4Y0GA 3WEXB 3TO4B 3UPCA 1CLYL 2H26B 3EYUH 4WJ5A 2R1YA 2P44B 3QNYA 3BYYA 1X5LA 1S7VB 3OR7B 2NW3A 3VW3H 3WHXA 4M5YH 5E94B 4X5XA 1D9KA 3KPSB 3H6JA 5IVZA 3QNZA 5EUOF 2F54B 1JPTH 1WAAE 4NBZB 5HDLA 3H0TB 2Z4QA 3GK8H 2QV2A 4JFZH 4Z0BL 3V4PL 4XPFH 2FD6H 4OLWL 2GT9B 5DJ2B 5I9QB 4LF3B 5IHZA 5JA8B 4TRPH 5MEOB 3ARTA 2GCYA 3MZGB 1FRGH 3QFDB 1A6VH 5C0IA 3U2SB 1G7HB 3NCEB 2F5AL 3THMH 4ZUTA 3TEUA 3FQRB 2APVA 5DHXB 1CF8L 3CVIL 1NMBL 2AJ3B 3ARBD 1OTTC 1A14L 4XVTH 5CKGA 5FUOH 3MFFA 4HC1L 3ARFD 4U6YA 5DQJB 1IBGL 4ZO7A 2VWEE 1JGUL 1KCSL 2RAMA 4YDKL 3FHAA 3VE0B 4WWKC 2YPVL 1E4XH 3LZFL 2AXGA 4PRAB 3RVUD 1KXVC 1RZJC 3TBVB 4OV5A 4D9QD 4LNRA 1WGOA 2RJMA 4PJ8C 1XFPA 3X13B 3S4SA 1NCNA 4AM0A 1GRWA 3VFMA 1L9MA 4CUCA 5JUEL 5I8EB 2QSVA 2EKSB 2XZAL 1NGQH 1OLLA 4LCUA 5C0BA 3U9UB 4PRID 2X4SA 1HDMB 2IBZX 3HE6B 1NDGB 2WIIB 4FQXC 1YEFL 1MJJB 1T5WB 3IYLW 1IEAA 2PCPB 1I9RH 4WW2C 1Q1JL 4R0LC 4GS7B 1DQDH 4PYHA 1N4XL 5F93C 4IJ3C 4GLRI 3BUTA 1D5BB 2Q76B 2BOCA 3U7YL 1MFEH 1ZLSH 3QFJD 4HXBH 2AEPL 4LCIH 4KJPD 1A3RH 5D6CB 4YPJA 4JFXB 4PRIE 1UWGL 3I3BA 1NC2B 2GSIA 1IL1B 4LRIC 1XF5B 3TIEA 2W0LA 5DK0A 3GZKA 3WIIL 4ZNEA 1RURL 5D1QB 2ZG1A 5JZ7D 1FFOA 2LU7A 3NIGE 1ADQH 2F5BL 3BQUD 4FQ2L 3QFJE 2VDKH 5KJRL 2A6JB 1UQSB 3TGXA 1D5IH 3K0WA 5DJ0A 1G9MH 3DNKA 3SE9L 3A6BL 3G5YB 5TDOB 4GAYB 4NNXA 4WWKA 5FF6B 1CFSB 2H3NA 5C0AD 1VPOL 3UPRA 3C8DA 2NY7H 3KXFA 3SO3B 4F33A 1LO2L 1UB6A 4I3RH 5HPMB 1P7KA 2Y23A 4FQXA 3REVA 1BF2A 5E56A 1I4FB 4KROC 1A4KB 3DGGB 4PTUA 2CJUH 4WW2A 5I8OH 4WEMB 2EO1A 4JRXA 3OGCB 4R0LA 3N85L 3V79C 4FFYH 4NGHH 3UAJD 3OXRA 5HYJD 5E2TH 3CFBA 3P0YL 4ONFL 3MXWL 2C3HA 3ZKQD 4HIIA 5HXMA 5ACLA 3SDAD 2VXVL 3HI1B 5CAYB 4JO2H 5GRJL 1QTYT 1JNLL 3X11B 3S7GA 2OL3L 4UT7L 4G3YL 3FHQA 5GS0H 4I2XE 4PJAA 3NAAH 4RQQA 3LIZL 1JPGB 4RISL 3PDOA 5HHNA 1KB5H 5I1CH 1FZKA 1YPZB 1RUPH 4JB9L 4XVJH 1D9KD 5T3ZD 1G9MC 3CVHL 2OZ4L 3BH9B 3QUYB 5KSBF 1MJUL 3BISA 1JWSA 1EFXA 1MWAH 4RGOL 3UZEA 1I3GL 2DQCL 4HUVA 3U0PA 5HYSB 2O5YH 3VMPA 2FBJH 3LRHA 4EVNB 2BNRA 2AXJA 1HHJA 3AB0B 3MNWA 2UYLB 5DUPH 5IB4A 3DROB 5T3ZE 4EIGB 3MNVB 1AC6A 5FKPB 1I8KB 2CK2A 5GGVY 2P8PB 4UIKL 3RA7L 4JPKL 1FZMB 1WEJH 3TA3B 2JE8A 5IT2H 3F12B 3QPQC 4R2GD 5FYJD 3DARA 1JZ7A 2Y7QB 4L4JA 3MJ8B 1X5AA 4MCYB 4HBCH 3B8SA 5GZOD 1XT5A 1MAKA 3JXAA 1S9XB 2LTQC 1WIPA 5HBBA 2B0SL 25C8H 2P49B 4QHUB 4PLJC 2YZ8A 1KXQE 2XXCB 3HR5A 3WO4C 4Q9RH 2GAZB 1O5DT 4PS4H 1AHWC 4WO4B 5FUCC 3Q6GH 1FORH 5E7BA 1HHHA 1Z9OA 2IH1A 5FYJE 5GS0C 3VXQA 1PQZA 2EYTA 2VMFA 2VSCA 4IRJB 1I8IB 2VDNH 1ADQA 5DD3L 5JHDA 4M6NH 1C16B 5TE6L 1U9KA 3MX0A 2VERN 3EDJA 2G75B 2ARWA 5IIEB 2EE6A 3QAZB 1UC6A 3QEGL 2ADFH 4JFQB 1CQYA 2YPLB 3P73B 4RMUA 3R0NA 4F80A 3IDNA 4OZGF 1NCAH 1N64L 1MIEL 3KPRD 4NIKB 5DMIH 3TH2T 3V4UL 1I75A 3O6FC 2CDEB 1ZKAA 2ITCB 3B9VA 4RFOH 4KHXH 4O5LH 3K8LA 1SMOA 4XP5H 2ZSWA 1X4XA 5FKAA 2CRYA 2ZOLA 4ERSH 4KRMB 2C3XA 5FYLD 2FH6A 1ZT7A 4LDOB 2UWEE 2Y5EA 3HUJE 2BDNH 1C5DA 5DGQA 3REWB 5GGSB 5D5ME 1NAML 3KPRE 3LKOA 4P5MB 4WWKD 1Q94A 1OAZL 3HZMB 1EIBA 3JTTB 2BOBB 1ZS8A 2GK0B 3AAZB 4PJ8D 3I6LD 1X5HA 3B2UD 1GYAA 3HZKB 2D3VA 2D7TL 1QFWM 1U3HD 2WBWB 5I76B 2MOVA 4PLNC 5IHUH 1AHWA 4O9HH 1LE9B 4TOYL 4TNWF 3DRQA 1YNKL 4G8IA 1CLZL 5HHMD 4GAGH 2IANB 1QLEH 1R5IA 3RL1B 3LKQA 2V5SA 5C09D 4GG6F 1JNJA 2I24N 3RWHA 1MRDH 3PWNB 1DLFL 1IKFL 3E6FB 4PY7B 3OGOE 3QCVL 2AK1L 5B39A 1UGNA 1CR9L 5DRNA 2XKNB 4ZFFA 2V9TA 4ZS6C 1JZ4A 1MWAA 2BNQA 3UTTB 1G7MA 1CXLA 2JELH 4Y5XC 1Q8MA 1T04A 3S88L 4X4YA 4Y4KC 1U8PB 3T3PF 5C09E 1JGLL 3O6FA 4NQCD 3SGDH 4TVPH 3NCJH 2IH3A 5I1GH 3GIZH 3MOAH 5DJZA 5JW3H 2D9QB 2NY2B 1A6UL 1QA9A 5L8JB 4XNUL 4D9LH 2R4SL 3LEXA 4AK1A 3EJJX 5DS8A 4WUKL 3MLZL 3MR9B 1MCQA 5LGJB 3HNSH 5KSUB 1FVEA 1EFXD 3CC5B 3MJ7A 3OKNB 4X6CE 4K71C 3TWCH 3Q1SL 3GSUB 4JDVA 4NQCE 5HHPA 2W9DL 1LP9E 3RWGA 4HW6A 3FMGH 2VO5A 4N9OB 1NBYA 3RRQA 5E4EC 2X70B 5C6TL 3D85D 3LEYL 4OFPA 2BNRD 1HQ4B 4PGEA 4CMHC 2CLRA 2PETA 4BKLB 2LAGB 2H2SC 3FRPA 2AJXL 4WDIB 5JNYB 5JDSA 3DIFB 4C55A 1ORQA 3BKML 1CGSH 1OP9A 2GEEA 3QHZH 1JHTB 4WGWB 4KROD 5ICXA 5FO7A 5F1IA 3IU3B 3R4DA 4TUKH 1KEGL 5I16B 1U8KA 2CKBL 2QKIB 5FGSA 1YY9C 3OB0H 3GHEH 4XRCB 3LCYA 1PFCA 5ACZA 3NPSB 1DSFL 5CINH 4Y5XA 4OB5H 3SQOH 4Y4KA 5IQ7L 1FPTL 1WTGT 3H3PL 3RZCC 2EDNA 5KSBB 4DGIH 1FL6A 1HHGA 1TJGH 2Q8AL 5DMJB 2LFGA 3PL6B 5J1TC 4YR6B 2Z8SA 4RFEA 3CAFA 2R4RL 4LKXB 3MV01 1RJYA 1YEEH 1JV5A 4YO0B 5DC0A 3WDJA 1QNZH 3QA3B 1W72H 4QRRA 2CIKB 2EE9A 5TF0A 5BZWB 4CVUA 5DJAA 5EZLA 1B4JH 5L2KD 3QEUB 3DX8B 3MBXH 3LMJL 1JNHB 1OAYL 5IBLC 2Y07L 3BZFA 4YBLB 4S2SB 1J12A 4AIZA 1RK1B 4LPTA 2B4CH 1Q9WA 1WWCA 4V1DB 1J1XH 4MQTB 3D9AL 2EC9U 3NFNA 1WITA 5IB1B 5KVEL 2MHAA 4OCWL 2OR9H 1P69B 4K2UH 4JO1H 5HHQB 5D93C 5EBLB 4NZRL 5L2KE 2IFGA 4XNYH 5INCB 1U8HA 2FHBA 3NZ8A 4PG2C 5EA0H 3B83A 5F1SA 1IAIH 1MUJB 5KVDL 4HK0B 4H88L 1HH9A 1VDGA 3PGDB 5CEXA 5FHBH 3IXAB 3MLRL 3D25A 1RVFL 2D0GA 3EYVB 3ZSTA 4PLJD 3VU2A 3MO1A 3L3DB 1FSKC 3MYZA 1FNFA 1HHIA 5ALBH 3B3IA 1ZHNA 3DVNA 4W6YB 3QHTC 3LPFA 3RZCA 5GS0D 1VA9A 3I84A 4QRQA 2FH8A 1LEKB 2ED9A 1A4JA 3BEWB 1K4CA 1FNGA 5HGHB 1WUNT 3IDUA 2RGSA 4KPHH 1TTUA 3VXME 4IIQB 4GBXB 4XHJD 2EO9A 1JZ5A 2IADB 1W0VB 1I7RB 5L8KB 3ZZ1A 1QP1A 4JJHA 2BNQD 3VFGL 2EEBA 2HRPH 4R6UA 5E99L 4HIXL 4IEFB 5I1EH 2LU3A 3L3JB 2Y1VA 3F65A 4GKNA 1N6QH 2ZSVB 4HT1L 5L0QC 1K8IB 4HJJL 1GZPB 1P4LB 1BGXH 5HJ3A 4JZJB 3JUZA 3O6FD 1V3LA 2B4CC 4NJAH 4DFIA 4DVRH 1R3KA 3AM8A 4LLWA 2ZP0T 1IQWH 3HZVA 3UBXA 1WBYB 3IDMA 4NQSB 1LEGA 1S7SA 3QDGD 4PJGF 2DD8L 1MHCB 3O6KL 5C92A 2VUOA 1AFVH 4NO3A 3IFLL 3ULVL 2DLHA 4K3HA 4PG2A 3HRPA 4L29B 4MDJA 4NP4L 1L7IH 4LLMB 1EHLL 1E28B 1T83C 3L9RB 5FCUL 2WSKA 2DWDA 4GG6B 1JGVL 4ODTH 4TSCL 1T03H 3QDGE 3UMTA 2XTJC 4JRYD 4U1KA 4XMPL 4LASL 4ZOCA 5EUKA 5I1KH 5BO1H 4ETYA 5DT1H 4H1LH 2VE6B 3DJ9A 1TENA 1UM4H 4PJFF 5TE4H 2WQ8A 1EMTH 1OPGL 5MHSD 1QVOB 4FZEH 5HYQB 5H94A 2WBJD 4JZNA 5IW6B 5CKAA 1WC7A 8FABA 1GGBH 1ZSDB 1Z3GH 4G7VL 3UTQA 1A5FH 3MV11 2WMPA 1X7QB 1W72A 4OD2B 2ZOKB 3U46B 4W6WB 3ZDZF 1MLBA 1C08B 3V0AC 3NGBC 1U8OA 3DTXB 3QDJA 1MJ8L 2GFBB 1TDQA 4JRYE 4Z76A 2X9XA 2IMNA 1ZVSB 4XPHH 2MQCA 1FP5A 4QF1A 5HGAA 1T1YB 5C0DB 2X7LB 2AK4B 2H1PL 5DD6A 1FZOA 4K23L 5ICYB 4FQLL 5BQ7B 4ELMA 1IJ9A 1OVZA 4Z0BH 1N0XL 1SY6L 3V4PH 4HS6A 2X05A 1MRCL 4OLWH 1CFQA 4HZLB 3S3SA 1X4YA 2F5AH 1AGCB 1S8DB 3QR2A 3G04A 4W68A 3CVIH 4NNPL 1AO7A 2FO4B 3I6KB 1NMBH 4LSSH 1MCKA 5DQ9B 2DQGH 1A14H 2AAVA 3AS0A 4NN6C 1NBVL 4WNQA 3T2NH 3WUZA 2VYRE 4GRLC 1T83A 3IJYB 1B2WH 1N59B 3RDTB 3QXAA 1PX4A 5HI3C 2ZUWA 1KCSH 5GRXG 3U4EB 1A3LL 4G5ZH 1VHPA 4NZUH 1WCQA 3FB7A 1UZ8A 2J5LB 3QZWG 2BSTB 2DL9A 4Z7VA 5ADPL 1FDLH 1IT9L 1X6LA 4AEEA 5F6HI 2R56L 4ISVB 2NXZB 1B6DA 3JBG7 4GMTL 3FT3A 3GHBL 4Y4FD 5DA0B 3EKCA 1VGEL 1YEFH 1YY9D 1JF1B 4U6XA 4LSTL 5J57B 3N9GH 5JW5A 1OGTA 3MRRB 3AREC 1Q1JH 1J8KA 1F00I 2H9GA 3BXNA 4LHUD 1DL7L 1T22A 4TNVF 3MRPB 1JHKH 3KHQA 5IK3A 5TQ2L 3WIHH 4C56A 1UACL 4X6DA 4TVPD 2HTKD 4PJ7E 3AMKA 2ADIA 1A7NH 3CMOH 1GGCL 1AXSB 1IARB 1ZHBA 1A6ZA 4OTXL 3TBTB 3U83A 4AQ1B 3H9HB 2HLAA 4BZ2H 1I1FA 1KTKE 3KLHC 1I1AA 5KG9A 3CSGA 4XMKL 2EICA 3UYRL 3WIIH 3GB7A 5GGUB 1U8LB 1RURH 2DF3A 4P99A 4NC2B 2RBLA 5E8OA 1K8DB 4QHLB 2BVTA 3V5HA 3RWDB 4FQ2H 4GRLA 2F8XC 3HG1B 5KJRH 4S0TD 3K8MA 1C5CH 4N5UA 5FO9A 5IBLD 4FXGB 3MROA 3BO8A 1KULA 3SE9H 3A6BH 5C08A 2DQJL 1ZGLA 1RIUL 4X8JB 1WCBB 1D6EB 4MD4A 4Z5RB 1RZ8B 3S3PA 4H1LA 1VPOH 3WNMA 2C5DC 4Y89A 4KV5F 1NGWB 2HN7B 1XGRA 4FQ1H 4XI5C 1LO2H 2RHEA 4MYWB 1UADC 3ROLA 3BPOB 2UVEA 4X7CC 1WLHA 3BHBA 5I18L 3IDXL 1DANT 4PJ5B 5FGCB 4FNLH 3OKKB 2V7NA 4CKVX 2VDOH 1E6OH 2Y25A 3AREA 3ME0A 1VEMA 4AT6B 3MRDB 3ESVF 3O3BB 4L3ED 3HS0B 3FAWA 4ONFH 4FQIL 1T4KA 1D5ZB 1SJEB 4ZUWA 4XTRC 3ZE2E 2J8OA 3GMRA 5GRJH 1DN0B 3VXSE 1JNLH 1F90H 3V8OA 1I7ZB 1NLDL 3GSVA 3OJDB 1XR8B 2PXYC 4JM4L 4PJDA 5C2BL 4GSDL 4L3EE 1OAXL 5FECA 3LDBC 1YEGH 3LIZH 2DBLL 4JM2B 4E5XB 1A2YB 4NN5C 3QDJD 2LQRA 2XY1A 4XAWL 2HMIC 1KT2B 3AROA 1S9WB 4PJGB 3RIAK 4Y2OA 1JGDA 4KFZC 3CVHH 5CILL 1MJUH 3IFNL 1CDGA 4TPRH 2VL5A 4OLEA 4RGOH 1I3GH 3T4AA 4G6AC 1WAAF 1P7HL 4IBLT 4AH2A 1HINH 1LO0L 2FL5B 1P7QA 2YPKA 4J1UB 4U3HA 4I3SL 1RULL 2GJZB 3QDJE 4Y7MA 5K9KB 1K5NA 3BDYL 4NWTL 3FQUB 3M07A 4JG1L 5JPMB 1NCUA 5CD3A 4DTGH 4F37F 1AO7D 3G9AB 4YFLF 4UIKH 3RA7H 3VI3E 4PJFB 3O4OC 4JPKH 1HXMB 4P5KB 4X6BB 5KS9A 1U95A 4PP1C 3X3GL 3U4BL 3GMNB 1EEZA 4DK6A 3VA2C 4OI9A 4WVRA 1WZMA 3TV3H 2XTJD 1CFVL 1AKJA 1KCUL 1CTNA 4I9WD 4OCLC 2C4XA 3NCFB 4R3SA 5E9DD 5JQ6L 4S10A 1DQQA 4EI5C 5E5MB 2BY0A 4ZXBC 1AO7E 3WUWG 1IKNC 5EO0A 2IAMC 4JFOB 3O3EA 5EPMB 2PXYA 3P2TA 4X7DC 2APXA 5E5RB 3KNBB 5HYEA 4U1JA 2YXFA 4Q58C 1HSBA 4DN4L 1UXWA 2EH8L 4I9WE 5E9DE 5JDJA 4UILH 5F97E 1DEEA 2X5PA 1MI5B 2DMKA 4MAUL 4MJ5A 5SX5K 4XZUB 3MFGB 1TETL 4L8SB 3L3IA 4LVOC 5HHVL 5K9JH 4H8WH 3QEGH 3QULA 5D7SL 1CE6A 1FG9C 1PKQA 1I9EA 5IMKB 3RGHA 1EVTC 1N64H 1TTGA 3H9SA 3TZVC 3O3DB 1ACYL 3ROOA 3V4UH 3GKWL 3GIVB 4JPIB 3OKEB 4UUJB 2JIXB 4KVCL 1IGFL 4LAJH 4YUEL 2NQCA 1I3RB 3QQ9C 1A7QL 5E8NB 4EIZC 2Q86A 5E2WH 4AG4L 2QQLL 2XQBL 1JZ2A 2NTFA 4GRLD 3QCTL 4D3CH 3FFCA 3GJFA 3IU4H 4S1RL 3NIGF 2ENSA 1CICD 3MRGA 4F3FB 1CGUA 2BCKB 1NEZG 1S7UA 4FRWA 3LH2L 3MV9A 1NAMH 5LGKA 4I0PC 3EYOA 2EDWA 4RMRA 1T0MB 4EI5A 5B8CB 3O11A 4BSVB 4JFEB 4PRHB 5C0CE 1AIFB 4P5TC 2D7TH 4ZXBA 1IKNA 1HXYB 3K4ZA 4OM1H 2OL3A 2IAMA 3GSXA 1NGPL 1RUKH 1YNKH 4GKSB 1ZTXL 3EZJB 2F53D 1J10A 2A6IA 4LLUA 4P23B 4ONOA 3SDCB 1RZIA 3ARED 4P3WA 2BRRH 5AYQA 1A64A 4XMLH 1NC4B 1BPVA 1S5HB 3CVHA 1QR1A 2NLJB 1CR9H 4M93C 4LFHD 4QRUA 4PJHB 3VRIA 4H8WC 5CZVH 5BRZA 1QD0A 2IC2A 4J3OC 4QRSA 5HGGS 1R3IL 4TUJA 1PEWA 4KK6C 3ZL4L 2F53E 3BFOA 3S88H 3TZVA 1VKXA 3V5KB 1GC1L 1HHKB 1FLRH 3KLHD 2BY1A 4RFNC 5IJVB 5E6IB 1GGUA 5C07A 5A2LH 2E9JA 1V3KA 1A6UH 1FG2B 3UP1A 1BD2A 4HWZB 2WUBH 2CLZB 4LSQH 1RU9L 1J87A 3G6AB 4ZUSA 5JW4Q 4WUKH 2YKLL 1L0XA 3T65A 3R1GL 3RWFA 2FJGB 4YWGL 4PTTB 5D2NB 3VFNB 4LCYB 4RGNE 1KCVH 4XBGA 3STLB 5IM7A 5M7QA 5F71A 2W9DH 3TPKA 3VGHA 4MHHG 4P5TA 1P7QD 5C6TH 2L7UA 3HA0A 1IAKB 4G9FA 3LN9A 4HF5L 5HHOD 5D96C 1R3LA 3ZT7A 1IC5L 1XIWC 3G9VA 4UTAL 3GMOA 4OCSL 2JJSC 5JW4R 4FZ8L 3BKMH 2O5XL 3MYJB 2BJML 5IB5A 2BHZA 2YRLA 4G43B 1KEGH 5CBEB 3G5ZA 2I25N 4APQD 4MNGB 2CKBH 5ICZA 3S96A 2B1AH 1FAIH 2I9TB 1KXTB 4ZG1A 4G8GD 1AKJD 3VD3A 4PRDA 5HHOE 1GIGH 1LVEA 2ZUUA 4XTRD 1DSFH 1YEIL 2EXYD 5E03A 4RSVA 3O8XB 2JK5B 2Z31B 4MMXC 5CGYC 1FPTH 1QSFE 1LEIB 3RNQA 2ICWI 1U58B 2Q8AH 3HMXL 1R5VB 4UT6H 2EYRA 3G6JB 2DM3A 4OD1H 2DMCA 4G6JL 3P4NA 4QHNB 4KKBC 4N0YH 4GT7A 4LHUG 1CDIA 1BHGA 3D39A 1HIMH 1MAJA 2R4RH 4G8GE 2HMID 1FL5A 1U92A 2X4PB 5LG1A 4D8PA 1LQSR 1PZ5B 1NAMA 5HGBB 4J6RL 2VH5L 2WLYA 3TN0B 5DRWB 5HPOA 1KTLB 3LMJH 2X4OB 1OAYH 3H9SD 5KZCB 3QIBD 2EDTA 3KLSA 2Y07H 4QT5B 1ORSA 3U30C 3D87B 4M6OL 5H37G 4GW1A 4DKFH 1XIWA 3GJFK 2ZWLT 4K7PH 2JJSA 1CGYA 5KVEH 1K4DA 2K1MA 4ODBD 1OTUC 4OCWH 4YIQA 3AVEA 3DX7B 4KKNA 1CGTA 3DETD 4LSUL 1NJ9A 4MNHA 2XPGB 4PP1D 2UWEF 2HVJA 3MV9D 3HUJF 3QSKB 1T1ZA 3MGOA 4LPYA 5T1LB 1RZGB 5D5MF 4H88H 3EFFA 4LP5A 4P2OC 4EI5D 3ARFB 4ZFGH 1RVFH 5EO1A 2QSQA 4XBPB 4ZXBD 2X4UA 1XH3A 15C8H 2ARJQ 3HC3H 1U93B 2VXUH 4Y2DB 2IAMD 3CFEB 4X6FA 3PWLB 5FB8A 2XA8H 5GGRA 5FA3A 3K46A 4OLVH 3IGAA 3CFCH 3P9WB 1P53A 3GGWA 3TESA 2FLRT 1IEHA 1CLOH 2ICES 4LIQL 4LVEA 3PGCB 1JWMB 5ETUA 4U6VL 1T5XB 3BZEA 1WISA 1A21A 1IGML 2R0WH 1RZ7H 5CS7A 4YQXL 5D7KD 3VFGH 3C5ZD 5IR1A 5JTWA 5T33H 5E99H 4HIXH 4U7KA 4NNYB 4OF7A 4Q9QH 3KYNA 5E8EB 1U41A 4HT1H 4QYOA 5AAWA 2A83A 2V2TB 3T09A 4EN3B 5SV3A 1MCFA 1UM6L 1XGYL 1G7PA 3RVTD 3KJ4B 5C07D 1MF2L 1CD8A 3QQ9D 5D7KE 1BD2D 4L1HA 2YD8A 3KHOA 2DD8H 3LSOB 3B9EA 3AU1B 3O6KH 2HWZL 3VFUB 2D31B 3IETA 2V5RA 3QQ4B 2CKBA 3IFLH 3ULVH 5LAXA 4ZPTA 4I0PD 3MOBL 2GSGA 1KPRA 2ADJA 3O45B 5GS2H 4NP4H 4XH2A 2ZKHH 4KMTL 1D6VL 1EHLH 1DEDA 2E7LC 4N5EC 4P2OA 2I27N 3OAZH 4X6CF 1NCBL 1ONQB 4P5TD 5KBNC 1LP9F 4G9FD 1G7LA 2D4DA 3D0VA 1YN6B 5A3IC 5DJCB 4XMPH 5EC2A 4LASH 1UFUA 2DQDL 2GTZA 4KC3B 4WHYH 1CU4H 1V7NH 1EAJA 5C0GA 3BP6B 4P46C 4J3VA 2VIRA 3VFVB 3F7VB 4ZTOH 4PV8A 4P2QA 1SVZA 2VN7A 1IRAY 1AY1L 4G7VH 5EO9A 3I9GL 4JKWA 4XC1H 1ITBB 3FN0L 4G9FE 3VXNB 2HT3D 1MJ8H 3CIQA 3MA9H 4XT1C 3K1KC 2P8LB 3MRIA 2VDLH 4PGDA 1HH6A 3S36H 5CGMA 3L5XL 1JPSL 4K23H 4FQLH 1G0DA 5IVXE 3OG6B 4Z7WB 4YHML 1Q0XH 1SY6H 4ODHH 4YLQT 5B3NA 1MRCH 3D39D 3HRZB 1Z6JT 4L9LB 1PG7L 3NCYS 4MAYB 1BQLH 3BT2L 5I71C 3K2MC 1T7XA 2A6KA 4JFFB 4JFYA 3ULVC 2IPKB 3EDEA 3MNZB 4IRZH 3TLRA 1INDL 1I7UB 4J3SA 2E7LA 1NBVH 4HV8A 3ARWA 1RK0B 3EHBC 4U7MA 4MJ6A 3WDHA 3OWEA 43CAA 2P5EE 3HNVL 5F89B 1TCMA 1MCWM 2M1KA 4HIEA 3WFCH 1XIWD 2PUQT 2WUCL 1J1OH 4Z77A 4LP4A 1S7XB 5ADPH 1KIUA 4QTHB 1F6FB 2DICA 4R7DB 4NFCA 2FECI 4CMMB 5F44A 3GHBH 1VGEH 5DSCA 1VADB 3LPWA 1WF5A 2B5IC 5F7KC 4LSTH 2PTTB 3EOAA 2MCG1 4HFWB 3TIDA 1OY3B 4UV4L 1I8LC 4LLVA 1YMMA 3SE3C 3TVMB 5CGYD 1WQVT 1NL0L 1UENA 3IXTA 1PY9A 4QRPB 3V0WL 4MZ2A 3RIFK 1FVCA 3WKNA 1GGCH 2GJ6A 3RX8A 3UTSA 2Q1EA 1E27A 4MLSA 1KCRH 1NGZB 4XMKH 5I1DA 3QDME 2FZ3B 4IHOA 5DJYA 4QOKA 5JHLL 3RKDC 4O2FA 4XC3L 1MCDA 3BPLB 4WHDA 3G5VA 2NY6C 4UDUA 5JXAL 4M6AA 5KANG 2Q7NA 2WBKA 2Z0BA 1JZ3A 4DVBB 1BJ1H 3FQTA 2KL6A 4NCC2 3SJVA 4Y16C 5K9QI 2UWEB 3C2SA 3HUJB 3LB6C 3U7WL 4MA1B 1Y18A 4LLYA 4HXAL 3L5WB 1ED3A 4J8RA 1IZKA 2VL4A 5D5MB 1JUFA 3D0LA 1OTUD 3MRNA 4YDLC 2H6PA 3PNWA 4Z78A 1OCWH 2G2RB 1JMXA 3VXPB 4FMKA 1RHHB 2JKXA 1XF4A 3TNMA 2OLDA 4FTVE 3DX9B 1EXUB 1GJIA 5FXCH 1A6WH 3IDXH 3KYAA 3D18B 1OP5H 1HSAB 1GHFH 5D2LE 2M26A 4MJID 3QZWB 1TVBA 3T8XB 3O6LL 3SE3A 4GKOA 1S78C 1ZANH 4KQ3L 4PRBB 3EBAA 4FQIH 4XGZA 5J12C 4LQ1A 3LQMA 4ZAKC 1KNOA 1SY6A 2OTUA 2YEZB 3BP7A 5CP3A 4MXVE 1NCWL 3WV0A 4HPYL 4ZPVA 1OHQA 4K7FB 4MJIE 2XN9A 3DBXB 4OF6A 3W0WD 5I0DA 1EEUA 2A73B 3L3HA 5CSZA 3GBNH 1X5ZA 1QPXA 2DM4A 1RMFH 4NQEB 4EUPG 3VGFA 3U0TB 4X7TA 3DUSB 4KY1H 5TE7L 2XQYK 2A1WL 3IFNH 1OAKH 2WV3A 4JG0L 4KUZL 4Y16A 4IMLA 3EDFA 4U1NA 3VFRA 3B9KD 1P4BL 4HKZB 4F57L 2AV7B 1BFTA 1BBJB 4ALAH 3W0WE 4POUB 3ZO0A 3C2AL 2B8OT 3KPNB 4I3SH 4QXTA 3TNNB 1XF2B 3QO0A 5AD0A 4NQCB 1UH4A 5IV2A 4UV7L 4JG1H 4P2RA 2PF6A 32C2B 4CNIA 3MRKA 4Q0XL 4M02A 3O9WC 1TLKA 2Z8WC 3TYGL 4NO0A 1RUMH 1NGYB 4MWFB 3FOMB 3JWDL 5ENWB 5IB3A 3G5XB 3JV6A 3P4OA 2Z92A 3EYQC 3VXTA 1G7QB 3EZ8A 3U4BH 1DBJH 4D0BB 3WNOA 4MJ2A 3O0RH 3RY5A 3S5LA 1A7OL 2BSSB 1T3FA 5JQ6H 3NACL 4ZAKA 4P46D 5SWQA 4F7EB 2DQTL 1MFCL 2FRGP 4KDVA 3D3VB 1SYSA 2N56A 3RWJA 4CL7A 4OKVB 3BAEL 4QCIA 5HYIA 5BOZG 5I9QC 1UVQB 2YXMA 4LSVL 1R0AL 5L88L 3WLWD 4DN4H 2EH8H 3VDAA 3KLDA 5MEND 2AEWA 1QRNA 4PLKD 1YMMD 1VFOA 3B2VL 1BWMA 1DUZB 4JVUA 4B7IA 1EK3A 5HHVH 4Z95L 1C7TA 1VGKA 1OT2A 2EIZA 5D7SH 1HKLL 4KZEH 1M6OB 3PE9A 5IFJA 1FYTA 5KN5B 2GJ6D 4ZSOE 3TF7C 4PJ7F 5I73C 1KPUB 4X6EA 3UTSD 1OB1A 4GAJL 4HJ0C 1EO5A 3JV0A 3DVIA 2GITA 1DDHA 1FJ1B 2FR4A 5C8JB 4NQUA 5HDBE 5MENE 4BZ1H 1YMME 1H3PL 4YUEH 1Q9KB 3P4LA 5GS2D 1F11B 4G6ML 4MA7L 1A7QH 3O9WA 4AG4H 4YAQA 2XQBH 3U0WL 3WEXA 2BVUA 4RRPG 2Q3ZA 4S1RH 3DLQR 3UC0L 4ZQKB 5EC1A 5HGDB 3UTSE 3LH2H 4JN2B 5KSAD 1S7VA 3OR7A 2CLVB 2OBGA 5JOEA 5E94A 2BP3A 5DVLA 1KOAA 3KPSA 3RQ3A 4GS7C 5LBSL 3FOLA 2OR8A 3QPXH 3RUGE 4KRNA 3H0TA 4JQXC 4U1LA 5TQ0L 1TJHL 4U1MA 4OZIE 2GT9A 5DJ2A 5CMAB 5F72S 4LF3A 1QKZH 3DXAA 5MEOA 4OCXL 3QFDA 3U2SA 3U6RB 3NA9H 2OTPA 4HKXB 2AGJL 3VXRA 3I02B 4JPVL 5D1QC 3WUWB 1KEML 2AJ3A 1AGDB 2PO6C 4UT9H 3VXMB 4MS8D 2VUYA 3DV4A 1R3IH 3RAJH 5DQJA 3WSQH 5HVGB 3ZL4H 4D94A 3F7QA 3ZE2F 4PRNA 4L3CB 1F3JB 3VE0A 1BM3L 3TP4A 1GC1H 5I15L 4PRAA 4LKCA 1SEBB 1YEDB 1T1WB 3X13A 3F5WA 4CU8A 1IGJB 1MRFL 4HUUB 5T1DL 3SO3C 3LQAL 2HRLA 4Y1AD 3L3GB 2AABL 1ZT1A 4WW1B 2NY6D 4D2NA 1OL0A 3PHOB 3TBYA 3U1SL 1HDMA 4Z7UE 4MQ7B 1E6JL 1T5WA 1UJTA 3OPZL 1EO8L 3L1OL 5DD1H 4KJWD 4YWGH 4K3JL 2VLKD 3WHE1 5DO2C 3HC0B 1KIQB 2C1PB 3ES6B 1OP3H 5AYUH 5EORH 1T7WA 4CVZA 1D5MB 3BPNC 4Y1AE 1D5BA 5TDNA 4JQXA 5JR1H 4JFXA 1MHHB 1NEZB 1YC8A 3DVFA 1KLGB 4GRWB 5EIIA 3ARDB 2ZUVA 2OS7A 4FZ8H 2O5XH 1NC2A 4H25A 3JV4B 2NY3D 1FV1A 2BJMH 1XF5A 3PABA 1NCDH 4MVBC 2QR0A 2VLKE 1ZVYA 2VAAA 1D7FA 3VI3F 4AEIL 3N50A 5D1QA 1MHPH 2Y36L 5C3LD 2NY0D 1S78D 2AJYH 2ZCHL 4J3XA 2EC8A 2PO6A 4CBPA 2DQIL 4OZHE 2A6JA 1CXEA 1UQSA 3ZMRA 1S7TB 2IWGA 4RAVA 1FNHA 3L6FB 4ZAKD 4NHUA 1YEIH 3G5YA 4U05A 1N26A 5FGBC 3BGMB 2HKFL 5GSVB 4CN1A 1CFSA 3FB8B 1GC1C 5FYKD 4NT6B 5D7IA 2CUIA 2IBZY 5DEFB 4G6JH 2Y4SA 3QUXC 2OI9B 4NKDB 4ODUB 5HPMA 3AB0C 4Q2ZA 1KYOJ 5DI8B 1I4FA 1VFBB 3E1F1 1A4KA 2J4WL 3HB3C 5ERWA 5FYKE 4J6RH 3OGCA 3SE4C 2C26A 2VH5H 5AG8A 3ULUD 2B7DT 3WNLA 3SGEI 4B41A 5JO5B 3IDGB 1UEMA 1JGEA 4LARH 4Y4HB 3MRLB 2N1KA 4LEOB 1A6AA 3KGRA 4H0GA 1X5JA 2WWMC 4WO4C 1HOCA 4HIJB 1N3NB 5HDQL 4YDVB 3TO4D 4DZBB 4LSUH 3EYQD 1ODAA 3ULUE 4IRJC 1JPGA 4YHZH 2DI8A 2PTVA 3VMOA 5DLML 4U7SA 1NEUA 5HY9B 1A1OA 1GGYA 1XR9B 3C09B 3KPSD 3C6SB 4F8QA 3GMMB 1HQRA 4JQIH 2F54D 5FGBA 4FFWC 2VLMD 4YFLI 4NJ9L 4TSBL 5L6YL 4YHIB 2C9AA 1H3WM 2WINB 4DKEH 3PWJB 2Z8RA 4EVNA 3QUXA 4QKXB 4FABH 3ARGB 2ESVB 4BFIA 4O4YL 3DROA 3KPSE 1KSRA 4U6VH 5FKPA 5F8QC 1I8KA 4DJMA 2F54E 1FNEB 2P8PA 4PB0L 5KOMC 1IGMH 3P9MB 1T21B 4Z0XA 1CXFA 5DEGB 1KG0B 4XNQB 1FZMA 3SE4A 2Y7QA 1CN4A 2XNAB 4ZUUB 1YNTB 4LHUB 4MCYA 1H3XA 3V4VL 3ZKXC 2BNUA 1UM6H 4FP8L 4J23A 4HBQA 4R26H 2J8HA 5JIHA 4UIMB 2HVKA 3WFDH 1AGBB 1MF2H 1U0QA 3STZB 2OJZL 5IGXH 1DQTA 4WO4A 1J0ZA 1MVUB 5C0JB 3O2WH 5IBTL 4F7TA 2IQ9L 5EUOA 4EOWL 2HWZH 5JORA 3HE6D 2R0ZL 4IRJA 1I8IA 2VZ1A 1CBVL 4LEXH 2F74A 3LS4L 1CD1B 1TVHA 1C16A 2FIRT 1D6VH 4KMTH 5TDPA 4DKAA 4FQHB 2G75A 3S3JA 1W0WB 5IIEA 3GSWA 1NCBH 3VFTB 4BK4A 1WBZB 2YPLA 3GO1L 4ODVL 4MD5B 1IMHC 3O4LE 4P4RB 2M8XA 4ZS7L 8CGTA 1J1PL 1A7PL 1NC2D 2Z93A 4MQXD 4DGYL 1YYML 1NDMB 1UJ3C 2CDEA 2ITCA 4HGWA 4HWNA 2YUVA 4NZDA 4URTB 5D1QD 4P9HL 3VXSB 3VDCA 5J6HB 2EE3A 1LILA 3FN0H 5DJ8B 3QCUL 4TSAH 3F8UB 3CJJA 4BFBD 1CFTB 5GGSA 4UAOB 4JFHD 3L5XH 4P5MA 1JPSH 3ARQA 1F58L 2NMSA 3EJYC 3HZMA 4WU7B 2LVEA 5TF1L 2GK0A 1ETZA 4KVNL 3P40A 4YHMH 3DUHA 3WJJC 4LCWD 4GW5B 1EZVX 5JXEC 1BP3B 1PG7H 1OARL 2IG2H 4S11A 4FQQB 3WXVL 5L9DL 1K2DB 2R2HB 4JFHE 1N5YL 2E7BA 4QNPE 5DC9B 4MNQB 2X1XR 3PWNA 5DO2D 4PY7A 2UUDH 4RBPH 1IAOA 5DD5H 2XKNA 2EIBA 4LCWE 1BZ7A 4LCCB 4P59L 2Z91B 2VDRL 4XCEB 1G7JB 2FX9H 3HNVH 5D1ZC 3NPSC 4ODSL 1ZXQA 5DQDL 1QBLH 2MPAL 2WUCH 1CD0A 4NM4H 4ZFZB 2FX7H 4R9HA 3V7MA 3MCKA 4LK4A 1A1MB 1UJ3A 2E8YA 2DQFB 4RA0C 4MVBD 2B2XH 1X5YA 2MKLC 4PB9L 3PL6C 4JKMA 2FB4L 4A6YB 3MJ9L 2W0KA 1UWXK 1DUYA 2OK0H 1RJZB 5M94B 2YN5A 3QUYD 4GMSL 3SO5A 4QHMB 3CC5A 3OKNA 4C57C 3GSUA 4OFVA 1FIGH 2Y72A 3V0WH 3Q3GA 2X42A 5CJQL 2AEQL 3WJJA 2X70A 4M3KB 5F7YC 5J6GB 1E4WL 3MLUL 4MA3B 1OAUL 3WO3B 5JXEA 4BKLA 5T5FL 1MCNA 4WDIA 5JNYA 1YPZE 1OM3L 3UYPA 1FO0L 3A6CH 2EDLA 4NO2B 5JHLH 1JN6B 2QHLA 5F6IB 4XC3H 2I9LA 1QO3B 3TA3D 3GSQA 5DA4A 3EYFB 5I16A 5JXAH 2QKIA 4XVSL 1PW3A 1QSED 4RWYL 1UXSA 3IKCB 1W2KT 1CE1H 1MCBA 5D1ZA 3CFDB 5IOPB 2VLJB 4YGVB 3QIUC 4HXAH 2WWMD 3F7PC 2NY1C 4WO4D 3P4MB 5KSBA 1T2QH 3EOBB 3PL6A 3MV8A 2BSED 1IM3B 5JOPD 1XGUB 4IRJD 5C0CB 3DO7B 3SE8H 1QSEE 5ID1B 4LKXA 4IDJH 3WIFA 3E3QC 4P2YA 3VD9A 2DQHH 5CP7B 1CICB 3QA3A 4YGAB 1KLUB 4FFWD 2IPUK 3O6LH 1YEKL 1R6VA 2YPLD 3UJIL 3FCTB 4FOMA 4KQ3H 4GQ9L 5BZWA 3ZYIA 4RAUA 5CWSB 3DX8A 1PYWB 5JOPE 1H15B 1F4YH 1H0DB 4I0CC 4S2SA 1RK1A 2VZUA 1GZQB 4HPYH 4PV9B 4TTGA 1YUHA 2MSPA 3GNML 3DSFL 5IB1A 2AI0L 2F53B 4PJEE 5GGQL 3X12A 4EI6A 4PD4K 1S9VA 3RJQB 3U79A 1LE5A 5HHQA 2ZG2A 1B0GA 2FBOJ 3LKRB 1RIHL 5EBLA 4W4OC 2I5YL 5INCA 3NTCL 3FO0L 4PP2B 3T0AA 4KUCD 1MUJA 5TE7H 4KUZH 4WI3A 1T89C 3R0MA 5C0ND 2NW2A 5T3ZL 3EYVA 3L3DA 3QIUA 4F57H 3BDXA 5IVXF 1DJSA 2YUZA 4OQTL 1YY8B 3C2AH 3FFDA 4M43H 4RGNB 5IMLB 1HYSC 3NCCB 1RJLA 2E27H 3PQYD 3FRPG 4ORGA 4X99B 2IAND 5HGHA 5C6WH 2E6QA 1FGNL 1P1ZB 3MQIA 3TYGH 3JWOL 3ZTJH 1BQHA 3QRGL 4ZTPL 2H8PB 3JWDH 3GMLA 1U8QB 3UTTD 5I75B 1T80A 1DBAL 1YN7A 2R2CA 3L3JA 1DCLA 5FYJL 2V7HB 3T4YB 2HFEA 1A7OH 2SEBA 4HS3B 4K9EL 3PQYE 2VC2L 1K8IA 3NACH 3WFBH 2IANE 1P4LA 3PF2A 2DQTH 1BIIB 2X4NB 5E00A 4UB0L 4FXKB 2FWOB 3TBWB 4GUPB 4QXGH 3BAEH 4X98A 4UQ3B 3BWUC 5FO8B 2CGRH 2Z35B 2NY2D 3UTTE 4P3DB 1MHCA 2I07B 1R0AH 1C5BL 1QSFB 4MD0B 1QYGL 5JPNB 5L88H 1O0VA 4KJQD 5LQBH 4W4OA 5DFVC 3C5JB 5ANME 3LV3B 3B2VH 1J05B 3ZDYE 4M4PA 5TJWK 4LLMA 1KJVB 2QQKH 2P5WE 1E28A 1T89A 3L9RA 3O41A 4GG6A 3ZYOA 4DN3L 3L7EB 1E4XI 4P3CL 4CAGA 1NMAL 2OSLB 2VABA 4GAJH 4U1HB 3ZKMC 4EUPB 1H5BA 2GIYA 2J5LC 2VE6A 3A67L 4GXVL 5T3XH 4PBXA 5IW6A 1PSKL 5ITFB 2BXZA 4KKAC 1ZSDA 2NXZC 1C1EL 3TT3H 3JWDC 3X14B 1OSZB 2ILLA 3UC0H 1OGAE 4ORZC 3U46A 1C08A 2P7TB 4H20L 5DRZB 5EZIH 5GRUL 2GFBA 2AQ3A 4CRPA 1MY7A 1ZVSA 3FTGB 5A2JH 5JMOC 5C0DA 2X7LA 2AK4A 4N0UB 1PG7X 5LBSH 5ICYA 5BQ7A 3E6HB 1RZJL 4EXKA 3TJEL 3QHFL 3LD8B 1FN4A 3PL6D 1RHFA 2EC9T 5TQ0H 2R29L 3OXSB 5F9WB 1HI6B 4WY7H 1TNMA 2MTPA 4ODWB 4PJXE 1AGCA 1S8DA 1T0PB 5EU5A 4JPVH 1MCPH 5D2LF 2FO4A 2BVEA 1KEMH 3I6KA 5DQ9A 5BXFA 5DMGC 4M5YL 3O3AA 2OP4H 3IJYA 4UBDC 1N59A 3MPCA 3U4EA 4P4KB 4NO5A 4M1CD 4LVHB 2EDJA 3E2HB 4G6FB 3JSSA 5I0ZA 3MUGA 4V1DD 4JFZL 1BM3H 4PRPA 3L3OB 4ONGL 3V9FA 1S7QA 4MXVF 5I15H 4BQ6A 3KR3L 2FD6L 1U42A 2DLIA 4RX4D 1LGVA 1MRFH 3LQAH 1LDPH 3UBXG 4DEPB 1F5WA 4ISVA 5DK3A 3W39A 1P5UA 1CG9B 3THML 1AJ7H 1PEZA 4IOFC 3U1SH 3BW9B 3DO3A 4NZTL 3KYOA 5INDB 5JIIA 1MCCA 2PNDA 3OPZH 1EO8H 2XZCL 2ZUQC 3L1OH 4OZ4B 5I74B 2NZ9C 5GGVH 4K3JH 3D2UB 4V1DE 3BPCA 5DF0A 1EBPA 3LN4A 3PUCA 4WTWA 4RDQF 5IMMA 2XXMB 2RFXB 2IBGA 2ZJSH 1B0RB 1A8JH 3MRPA 4RCAA 4M00A 5DUML 1E4XL 3H7BB 4Q97A 5DEZA 2G5RA 4CW1B 1KN2L 1AXSA 5EWIH 1P4IH 1IM9A 2DYPB 4AMKH 4P57A 3TBTA 1NGQL 5CD5D 4GBXD 3QH3B 4YHPA 5GRZA 3P77B 5IESH 4RZCB 2NX5A 5GGUA 2R8SL 3G08B 1JI1A 3RWDA 1BVKB 2DQIH 1WZKA 3HG1A 4JQVC 4OUOA 1IAIM 1DQDL 1JMZA 2EDHA 4UI2A 1MFEL 4HXBL 2GUOA 4LCIL 1WCBA 4MX7B 3KAAA 1RZ8A 3ARSA 4HLJA 3SKMB 1S5IH 3UCRA 3C5SA 4M3JA 1NGWA 3FRUB 5A2FA 4TNWK 3LQAC 2VTFA 5KSVA 1X44A 3ARXA 5IVXB 2DBJA 1QBAA 3RVVC 2D9CA 3MRFA 3RPKA 1FFPA 4PJ5A 5J89A 1LWRA 2VDKL 1D5IL 4Z9KB 1FNAA 1BF8A 3MRDA 4F7PB 3O3BA 5E8PB 4XXDA 1M05A 3JWNC 3MZTA 4OM0L 1UH3A 3FKUS 4NHCL 3ZKNC 5J3HD 1U6AH 2NY7L 1DN0A 5CEYB 5T5NG 1J8HB 4HJGB 5HDBF 2L7JA 1QLFB 3QDAA 3H42H 2P5EB 1XR8A 1M71B 1QFPA 1TZGH 4N8VA 5DUBA 3ARRA 4KJYB 2HJKB 1IC7L 1DR9A 3CFJA 4ZFOL 4OAWB 3ZTNL 3TBSA 1S9WA 3BKYL 5LCVL 4FFYL 4NGHL 1KV3A 4PJGA 3IAGC 5L7XH 2FSEB 5D7LB 2AK4D 1MQKL 2VQUA 1SYVB 1VCAA 3VGBA 2BXYA 4BFGA 5C9JB 4JO2L 1B90A 4NJ9H 3B9AA 3RUGF 1ZGLM 3QJHA 2FL5A 4OSUL 1U3ZA 2NR6D 4WJ5B 1CZ8H 4XCYB 2GJZA 2APTA 3QNYB 4OZIF 5HVWA 3TT1H 2A6DB 5GS0L 3MRQA 4POZC 5DFVD 4D0DB 3IKKA 1CVRA 4O4YH 4FMFA 4O02H 1ZLVK 1IGIL 5IVZB 4PB0H 3QNZB 4PJFA 5IEKB 1KB5L 1HXMA 5I1CL 5AUMB 1RUPL 2C4FU 4Q74A 1NMCB 4XVJL 5GISH 3RDTD 3QDMB 3U36B 4Z6AT 1PD6A 2AJVL 3V4VH 4E41A 2R2BA 3ZKMD 2GCYB 3QG7L 4FP8H 1A9BA 1N6UA 5B8CC 2YK1L 4ZUTB 3A0OA 2FBJL 1QLRA 1EGJH 3VXOB 5E6ZA 4NYLB 4JFOA 5E0QA 4JPWL 1AD0A 4KKAD 2XWJB 3PP3K 2NXZD 3C6LC 5IBTH 3LEVH 2IQ9H 2PR4L 1QBMH 3MFFB 5F8RC 5B38G 2R0ZH 3KNBA 5DJXB 4FFVC 4J3WA 4Z7UF 5MEQA 4P23C 1WEJL 3OBAA 3LS4H 1HNGA 3MV7A 4OV5B 4FTVB 4LNRB 2CXGA 4AM0B 4R96B 3HNTH 5BJTA 3GO1H 4ODVH 2VSDA 3SGEH 2BVQB 4HUMB 4PGBA 3WL9B 5C0BB 4ZS7H 4LDLB 3SGDI 2W59A 4Q9RL 4PJ9B 4PS4L 1J1PH 3QXDB 1A7PH 1DN2A 2J8UE 1YYMH 3Q6GL 1FORL 3GIVA 1EVUA 4LSRH 2JIXA 3L95A 5E6IC 2VDNL 3QIWD 1I3RA 4P9HH 5E8NA 4WV1C 3IAQA 1PLGH 2VQ1B 4M6NL 4HCRL 4M7ZB 4S1SL 3HG1D 4PGEB 2BOCB 4UBDD 4X8XA 3VCLA 3M45A 2BCKA 4OZHF 4DK3A 4W70A 4JR9L 4NCDA 5D2NC 3VFWA 4MSWA 3V0VB 1JNNL 1IC4L 4U33A 5DR5H 1T0MA 2MNUA 3TIEB 5TF1H 5B8CA 2QSCL 4BSVA 5LXGL 5DK0B 4JFEA 4PRHA 5T3XD 1AIFA 3EOTH 2E6JA 1HXYA 4BQBA 4L8CA 4RFOL 1TITA 3C6LA 2DRUA 4IOFD 1OARH 2E8ZA 4KHXL 4GKSA 1LDSA 4CU6A 4XP5L 2QL1A 5KVFH 5L9DH 4PJ5D 4WU5B 1N5YH 1OSPH 4L4VA 4ERSL 2NZ9D 2Y9RT 2H3NB 1L7TL 2BDNL 4JY6A 1S5HA 3CSPA 1H3GA 3UPRB 5DMYA 3I6GA 4P59H 1T0NA 1P2CB 4C59B 2VDRH 4DW2H 2KQMA 5FGCE 3CU7A 1HNFA 3O8XC 1EA9C 5IHUL 4FQXB 2DWEB 2JCCF 3V5KA 4P0DA 1HHKA 4JAMA 3REVB 4LPVA 2EDXA 4WW2B 4JRXB 4PB9H 2WK2A 5E6IA 5IJVA 4X4XA 2FB4H 4JM2D 4YBQC 4P9HC 1FG2A 3MJ9H 3PWPD 4MGXA 4A2LA 3CFBB 4WV1A 4IJ3B 4HWZA 2C3GA 2CLZA 3ULUF 2OMNA 1MRDL 1AH1A 3B5HA 1XGTB 4PJIF 4YHKH 4GMSH 2FX8H 4TULL 5D2NA 3VFNA 1ZLWH 4LCYA 3STLA 2FJHB 2JELL 1SQ2N 3TN0C 4ZYKB 5JLZA 5TGBB 4KDTC 1I9JL 4PJAB 1E4WH 4RQQB 3MLUH 1IAKA 3PWPE 1EGJA 1OAUH 3T1WA 2HFFB 4M7KL 5J11B 4XPGH 3PDOB 3UPAA 4AYFA 5HHNB 2XTLA 4PJGE 5I1GL 1FZKB 1WZLA 2FIKB 4R4FH 5D6DC 4ZSOB 3EDDA 1FO0H 1ZHKB 4D9LL 1X9QA 4JHZA 1JWSB 3ALXA 3SGKC 5J1AA 5MENB 4MNGA 4XVSH 4X4MA 1VACA 4NKOA 3RWEA 4RWYH 1UYWL 3BVNB 1TCRA 3ARBC 3TWCL 4NFDA 3ARFC 3FMGL 1HHJB 3MNWB 5GSRB 3V6FB 4OLYH 3RVXD 3ZLQC 4Y2DC 1MH5A 3S8WA 1LEIA 1BQSA 3RVUC 4M1GH 2DB8A 4KHTH 4O00A 3QHZL 5I6XB 1YMHB 4QHNA 2CRZA 1WAAA 2QJDA 3RUGB 3GKZA 1U3JA 3GSNB 2X4PA 1V3MA 1KCLA 1MI5D 2YN3A 3IAPA 4Q9BA 3CFIC 1HZHH 1N2RB 4K8RD 5ESQB 1ZLUH 1N0LA 5JIKA 3HR5B 2P48B 5CINL 3PWUB 3FQXB 4OB5L 2I60H 5DRWA 3WXWL 4BQ9A 2XKUA 1KTLA 1PQZB 3CSYA 2X4OA 4KDTA 4OIBA 3VXQB 2EYTB 4EN3C 5CJOH 1TJGL 4Z18A 1NGXB 4OGYH 4KJPC 2JIXD 5JHDB 4POZD 5E7FA 3GNMH 3DSFH 3SDYH 1MI5E 3KJ4C 5D6DA 5I2IA 5L2JB 5GGQH 5CZXC 3PGFH 4NUGH 3ALWA 3SGKA 1RIHH 2PW1A 1QNZL 1TQBC 3PV6A 1JBJA 3BEVB 4UZGA 1BWWA 3FO0H 3C60B 3ARBA 1H3UA 5T1LA 3BQUC 2VR4A 4OV6F 4ZNCD 3ARFA 3CXDH 3MBXL 2CPCA 4L8DA 4Z7UB 4JFED 4PRHD 3ILQC 4XBPA 3DMMB 5TH2A 3MXVL 4Y2DA 2ZSWB 3AXLA 3CFEA 3F7RA 4OQTH 3ULSA 5DK2B 3PWLA 2AJSH 2ED7A 1C5DB 1VFMA 2OR9L 3MJ9A 4K2UL 1M7IB 4P23D 4JO1L 1ZHLA 3SDCD 1NBZA 1NC4D 3JWOH 4QNPF 3QRGH 2CQVA 4PRIA 4HWBL 1ZS8B 4PRHE 1ZA6A 3KJ6L 5EA0L 2RIKA 2FJFA 3WO4B 2WW8A 5ALCH 1DBAH 5I1LA 2PYFB 4OLUH 1AHWB 1DLHB 1M4KA 3FB5B 4E0RA 3DRQB 2VLKB 2QADD 5E8EA 4CVWA 3UAJC 2V2TA 1EEYA 3SBWC 1R5IB 3RL2A 3LKQB 3QFJA 1FZJB 1QFHA 4PGZA 3UTOA 3RWHB 3BOVA 4ZOBA 5E6ID 4OJFH 1FO0A 4M03A 4PJHE 2X4RB 4KPHL 2DQUH 5DRNB 4ZFFB 4S1DC 3LSOA 4MAYC 1MWAB 3VFUA 1G7MB 5KTEH 4NN7C 3QQ4A 4JDZA 2HRPL 2ENYA 2NY0B 4X4YB 5DVOA 3BQUA 1CD9B 3BP5B 4JANB 2IH3B 5CHNB 4OGAD 3LAFA 4DN3H 2W0FB 1YN6A 3ZE1E 1NMAH 2LAAA 4NJAL 5DJCA 1INEH 2XYCA 4DKDC 3LEXB 1IQWL 3A67H 2N7BA 4GXVH 1UM5L 1YPZF 3F7VA 1VEOA 3EW3B 1SMAA 5D2NE 3VFSA 3MJ7B 1AFVL 3JWOC 5HHPB 4JDVB 1C1EH 3S37L 1TZIB 5GGTH 2JCCB 3RWGB 4MDIB 1NBYB 1L7IL 4YEFA 4H20H 3VXNA 2VDPL 1GH7A 2ARJB 2Q87A 5GRUH 2CLRB 2P8LA 1ZE3C 4I2XA 4ODTL 4DUVA 3O8XD 3OJVC 5CJ5A 1HCVA 2Z31D 4I77H 3TVMC 5GZOC 2P24B 3WCYA 3EIFA 5ICXB 5F7DA 5BO1L 4PJIB 1QBBA 3SDAA 1P5VA 4S0SD 5F1IB 3TJHD 3TJEH 1UM4L 3K3QA 5TE4L 4YX2H 4MNGE 1Y6MR 1U8KB 5D71H 1MAML 4YBQD 2Z8VC 1GGBL 1NKRA 1A5FL 4TTDC 1JCKA 2NXYD 4XNXH 4G7YL 3GMPA 3IRPX 3OKLB 4Y5XB 1T2JA 2IPKA 4Y4KB 5BV7B 3BPLC 3MNZA 1FBIH 3T77B 4GXUN 4WI4A 4XPHL 3BZ4A 3TN0D 4GW4B 1HHGB 1RK0A 3G6JE 1MCOH 5KZCD 4F9PC 2ITDA 4DFHA 2CD0A 3IFOB 4OQTA 4HKBB 5F89A 4ONGH 4MA1C 3KR3H 4GQPH 3LHPH 1HILA 1S7XA 2IMMA 4QTHA 2AKRA 4PJEF 4QRRB 1EBAA 4ELKA 4L1DA 4R7DA 4F58L 4NKIL 5MERB 2EDYA 4NZTH 1A6TA 5EZLB 4CMMA 5C7XL 1RV6X 3S35H 1VADA 4LSSL 2O61B 4HWEL 3BZFB 2DQGL 2XZCH 5T1LD 3T2NL 4AIZB 4BK5A 4TQEL 1B2WL 4HFWA 2R69L 1CCZA 3OKOB 4OBRA 2WP3O 3KG5A 2C1OB 3TVMA 1A7BA 4Y2DD 4G5ZL 2MHAB 3WD5H 4NZUL 5DUMH 4XX1G 4QRPA 5DJ6B 4WI7A 3MODL 5CEZH 3B2UC 1KN2H 2OCFD 4KTDL 1X6NA 1U3HC 1FDLL 5B21A 3DHMA 1NANI 4JGUA 3O4LB 3I2CH 4KUCF 1F4XL 4WHCA 3D25B 3ARUA 4BFEA 4F9LC 3QO1B 4PREB 1NCTA 2R8SH 4YC2B 3N9GL 4WRLA 1HHIB 1AR2A 3B3IB 5GGRY 3RZCB 1I1YB 1ZA3A 2HJFB 1NPUA 3UJJL 1X5XA 1JHKL 3WIHL 5EU6E 4F9PA 4EN3D 1A4JB 3BZDA 1K4CB 4S1QL 3SDXF 5TFSH 1UEYA 1A7NL 2UWEA 3CMOL 3HUJA 4NQVB 3L5WA 5CZXD 5D5MA 3KPRA 4MA8H 2M2DA 4NCC1 4NM8H 4PGCA 4P48A 2XQYG 4KI5E 4BZ2L 3FONB 2G2RA 3VXPA 2XWTA 5GRWA 5ADOL 3SKJH 1DQLH 2AXFA 4GKNB 2XFXA 3BE1H 1JJUA 3RX5A 3W2DL 5HJ3B 3D18A 4O2EB 4YHLH 1JTTA 3EO0B 1HSAA 2N4IA 4NOFA 1C5CL 3ZDYF 3ILQD 3T8XA 1R3KB 1PVHA 3HZVB 4NSKA 4OM0H 3UBXB 3IDMB 4PRBA 1S7SB 4NHCH 1R5WB 2BY2A 4PJ8A 2BRQA 2YEZA 4FQ1L 3RWIB 1U3HA 1UA6L 4LCWB 2GTWB 1ZOXA 4KU1A 1PDKA 3PV7A 4K7FA 1KJ2B 1AP2A 4F9LA 2DWDB 1BOGB 3NN8A 4FNLL 5FA4A 4FG6D 3HI5H 5C09A 2D7QA 5ILTL 2VDOL 1E6OL 1IC7H 4NQEA 3CDFA 4U1KB 3ZTNH 1KTRL 5EUKB 3DUSA 3BKYH 5LCVH 4WUUE 2VLRE 1MQKH 1FQ9C 3W81A 4QY8A 4D0CB 4LGRB 3VDBA 5H94B 3HPJB 4JZNB 5D8JH 5C0FB 2W38A 7CGTA 1WC7B 5FV2A 3UTQB 2AV7A 1UB5A 1F90L 4LRNH 2E7MA 1IQDA 1W72B 4OSUH 2AQ1A 1AQKL 1NFDB 4S1DD 3KPNA 1MLBB 3OJMB 4MAYD 1U8OB 4LRIA 4X6CA 4ZOEA 4MCZA 4NQCA 3EAKA 3GI9H 1LP9A 4JFFD 1YEGL 4PJXF 4QF1B 5KVGH 1IGIH 1FZOB 2NY5H 3K7UA 5I66A 4ELMB 3KWWA 1Q9OB 4MWFA 3FOMA 5ENWA 4Z7WE 5CLTA 1DP0A 2ZZUT 4KRPB 4HS6B 4TPRL 1Q72H 2AJVH 2X40A 2P45B 3HI6L 4D0BA 2BSSA 3QG7H 4JFFE 1HINL 2YK1H 4YHOL 5F1NA 4WHYG 3TH4T 2UZYB 3E0GA 2BVYA 3D85A 5I8CB 3G04B 3QYCA 3D3VA 1IGTB 3BRDA 3MUJA 4JPWH 4OKVA 1IZJA 2PR4H 4DTGL 4WHTA 4UNUA 1UVQA 3QUZB 5FFLA 3FB7B 4HUXA 1DUZA 1QSEB 3TV3L 3TVMD 4IOIA 2AW2A 4QRPD 4HPOH 1CDBA 2D0FA 2OQJA 3FT3B 1Q38A 4HK3J 4U3CA 1KC5L 3OL2A 3NGBB 4ONHB 4TTDD 1LO4H 1FJ1A 3VFPA 4LPUA 1MCIA 3CFKA 4XP4L 3BXNB 4R4NC 4LU5L 1F11A 3FT2A 2NY5C 5IK3B 3OF6D 4S1SH 4C56B 2OXGA 4HCRH 4N0FA 4QRPE 4RAHA 4UILL 2GY7B 4X6DB 1XGQA 4XHJC 4F15B 2ADIB 2DAVA 3CK0L 4PJEB 3F7YB 3BP4A 5GS1B 5K9JL 1FFNA 4H8WL 1ZHBB 4LNVA 4JR9H 5CBAB 1I85C 1J0IA 3EDKA 1JNNH 1IC4H 3QNXA 1I1AB 5F21B 5L2KA 5LXGH 2QSCH 1KIRA 3IFPB 3MLXH 1WICA 5MEPB 6FABL 5GJSH 4CDGC 2XWBB 4G80A 3ZYZA 3KPMA 3HZYB 1KTDA 3ARDC 5FO9B 5IFHH 5CMAA 4YNYA 4O58H 3BJLA 3BO8B 3MROB 5E2WL 1FNSL 5C08B 4G9DB 4D3CL 1ZGLB 3IU4L 4ZFOA 2E6PA 4EEEA 4N1CA 1L7TH 4Y19B 1ZEAH 4HKXA 4MLIA 1QFUH 1KLFA 1T7VA 3ARVA 3WFHA 4R7NB 1AGDA 3VXMA 2R1WB 5I17A 5B38B 1A9EA 3TFKD 2J1KA 2P46B 1QEWA 3KLAA 4OM1L 2ORBH 1F3JA 2X44D 2BVPA 1RUKL 1M7XA 1YEDA 2V7NB 3IF1B 3PQYB 3SDXB 1IGJA 5D72H 3SKOB 3L3GA 2WBJC 3EGSB 2HLFC 2BRRL 4NQED 1KB5A 4HDIB 4Q7DA 4XMLL 2XOTA 1MEXL 3RNKA 1T4KB 5BVPH 4YHNA 1B88A 3CX2A 3P0VH 3VWJB 4LVNC 5CZVL 4TULH 1FYHB 1I85A 3BRFA 3HC0A 1KIQA 2C1PA 3ES6A 5ANMB 4RMTA 1F3DH 1CXHA 1I9JH 1D5MA 1OT1A 4I3GA 1FLRL 3NFPA 2F9BT 4NQEE 2P5WB 3BUYA 1I1CA 4M7KH 5ESVB 4Y4HC 1NEZA 1CGXA 3ARDA 4IMKC 2YBRB 3JV4A 3QDGA 2WUBL 4LSQL 3PWVA 2VL5B 4LQFH 1IGYA 3O6MH 5GHWH 4AH2B 4OLXH 1AD9A 4CJ1A 3ARYA 2YPKB 4KGLA 3I3DA 4B7LA 1UYWH 1KCVL 5H37H 3FO2B 4NZJA 5CEZD 3C09C 4OFDA 3L6FA 4UDTB 1P84K 3ARZA 1OGAB 3BGMA 2VOTA 3DECA 3D3VD 5IEHB 4JRYA 5LJYH 3KPQA 3SPVB 4V2BA 1UWEL 4NT6A 4YXKH 1G9EA 3ABZA 3OG4B 3GUTB 1J86A 5IVOA 2WBJA 3ILPB 4NKDA 2HG5B 3ARGC 4HCRA 5CEZE 5IHLB 4LIQE 4P2CG 3T3ME 2KDGA 2APBA 4Y4FC 2B1AL 1FAIL 3BJ91 1PJ9A 3D3VE 4DUXA 5KVMC 1GIGL 3NH7H 1BFSA 4PJXB 5EO0B 3T0EB 1KIPB 2PXYB 3N1PC 2OX5A 3UO1L 3WXWH 2DQEH 1A0QH 1CDYA 5JO5A 3HCVB 4WI6A 4NQDD 1FH5L 4LDEB 2YA2A 4NN5B 2HTKC 1UXWB 3MRLA 4UT6L 2J8UF 4OD1L 4BSJA 4MB3A 4IMKA 4KK8C 4N0YL 1HIML 4MJ5B 3VFOB 3RHWK 4L9DA 2BSRA 4HIJA 2O5ZH 3QULB 4XWGL 1MQ8A 4LPXA 2KPNA 4DZBA 5EFIA 2RB8A 2VISB 3RIFF 4NQDE 4LMQE 1XR9A 1URLA 3ROOB 3C6SA 1AQDB 5DURB 3ZE0E 3GMMA 5ISZB 2IQAB 4D9RE 3MXVH 2QTEA 4DKFL 1XF3B 3O4OB 2NTFB 4QGYA 4YHIA 3RGVB 4K7PL 3FFCB 3GJFB 1G7IB 2WINA 4I48B 5GPRA 3CH1A 1S7WB 3L7FB 1IVLA 4QO1A 35C8L 3ARGA 4PJ7A 5E1AB 3IVKA 2HH0L 4HWBH 3O11B 4Y4FA 4A6YH 3QXTA 3KJ6H 4DCQB 3HFMH 1WFTA 4PD4J 3VXMD 1KG0A 4WI9A 4ZFGL 2OL3B 1EHAA 3DRTA 2XNAA 4ZUUA 3MRBA 1YNTA 4LHUA 4UAOC 1IEBB 15C8L 1CDCA 3HC3L 2VXUL 2CDFB 1F8TL 2XA8L 4M62H 1RZIB 3OAYH 4I18C 4OLVL 1MFDL 1HEZA 3FO1B 3WBDA 3CFCL 4UIMA 1AGBA 4R4ND 2HA1A 4R90L 3CVHB 1ZGLP 1EDQA 1B0WA 1RUQH 4KH2A 1QR1B 1CLOL 1GOHA 1QQDA 4LVOB 5C0JA 3FZUC 4WEUD 2EDKA 1SHMA 5BRZB 4QRSB 1BVLA 4PJCE 4TUJB 3ISWA 2R0WL 1RZ7L 2BERA 3MBEB 5T33L 1KJMB 3TZVB 1EO7A 4Q9QL 4PJBE 5BMFL 4KK5D 5F9DC 4OCRH 3VD7A 3ORJA 3LKNB 3VFTA 4YH6A 4LCCC 1WBZA 2EECA 4MD5A 2DJ4A 5E8DL 4P4RA 3VA6A 4JM2F 1K6QL 4ZUSB 3ARDD 1UM5H 3U9PL 5LWYH 3BKJL 4JY4A 3RWFB 1NDMA 3FQNA 4LLDB 2YOCA 4XBGB 2D2OA 1DBKL 2HTLD 5IM7B 3S37H 3VXSA 3VGAB 3AY4C 5J6HA 4I4WB 4PG9B 4WTXA 4JEGB 2ZKHL 4YDJB 4NWUL 5DJ8A 5KW9H 2VDPH 5E70A 1BFVL 1CFTA 1JF5A 4GRWE 3R8BB 2YD2A 4L3EA 3CXHJ 2ERJB 5C0EB 1N8ZA 2ICWJ 4QWWC 4WU7A 5IB5B 1CU4L 1V7NL 2W9EH 4I18A 2OJEB 3G5ZB 4ZTOL 4GW5A 5ICZB 1MAMH 5FDWA 4M93B 2HLFD 4PRDB 3QUML 2OTWA 1V05A 3MGTA 4G7YH 5F9AC 2R2HA 4XC1L 5D7JB 3GM8A 3MA9L 3OKDA 2W91A 2VDLL 3S36L 2VRAA 4RFNB 5I30L 1UCBL 3P4NB 4LCCA 5LGHL 2BC4A 2Z91A 1A3QA 4GRMA 4XCEA 1G7JA 2F8VA 4Y4HD 1FL5B 1Q0XL 4ODHL 4JFPB 1ND0A 2EDEA 4UINH 4ZFZA 2YD4A 5EU7C 4XNMA 4RIRA 3UDWC 1A1MA 4J7RA 5IFAH 1NAMB 2DQFA 1BQLL 4F58H 4NKIH 4HWBA 5C7XH 2R23A 3AY4A 2MJWA 3KYMB 3P11H 4IRZL 4HWEH 4I13B 1G0YR 4BSWB 2DTSA 1DQJB 4TQEH 4O51B 5FIEA 1CICC 2R69H 3F62A 4P9MH 5ABDE 3DVGB 1EZVY 1BOYA 1K4DB 4FN0A 3RI5K 1BBDH 4EZMA 3VWKB 4YIQB 3WFCL 5E9DA 2AV1A 1J1OL 3MODH 5GRVK 1S7RB 1NJ9B 5J6GA 4KTDH 3VRLE 3C8KA 2IPUG 2G9HA 3ARGD 2ESVD 2YUWA 1WBXB 1SJHB 1CWVA 3EFFB 1F4XH 3KPLB 1DBBL 4HHAA 4NO2A 1BFOA 1JN6A 2J8UB 2X4UB 1QO3A 4U3XA 5BS0B 4QGTA 4U0RC 4Z7NE 3I75A 1FC2D 5FB8B 4FQPA 4Q6YA 3UJJH 4OZFH 2Q8BH 4E42A 1OTSD 4NUJA 3IKCA 4M61A 4S1QH 2ESVE 3CFDA 3GGWB 5IOPA 5ETUB 4DQOL 4KK8D 1DQMH 1FHGA 5DGRA 2EIEA 3BZEB 5JQHC 3UDWA 2UZIL 4AL8L 5EG6C 2D7OA 4RGNC 5FYKL 3D69A 3MLWL 1KCRL 5IR1B 4PJHF 3MRCA 1C12A 5ADOH 1IM3A 5C0CA 1A1NB 3DO7A 3QIWB 1JYVA 5ID1A 3W2DH 3LRGA 4TVSa 3C8HA 5J7CC 5CP7A 1CICA 3RU8H 1KLUA 4M7LT 3V6BR 2EYSA 5I75C 3UTZA 3FCTA 4PLOB 1P9MC 5DWUL 1YJDL 4HULB 5CWSA 4L8BB 4GFTB 3ZE1F 1PYWA 3SY0A 2HJLA 4RMWA 3ULUL 4OCNC 4X7FC 1H15A 5EOTB 1R3JB 5CZKA 1H0DA 2CKBB 3H2WA 5IW1A 1UA6H 2BY3A 1OCWL 4ZPTB 3V5DA 2NNAA 3OB0K 4XH2B 4PV9A 1F97A 4N9GB 4R97B 1SEQH 2F53A 3QEHB 1A6WL 3VXSD 1J5OL 5MI0B 2PN5A 4NDMA 4UQ2B 3OHXB 5ILTH 3LKRA 2HFGL 1GHFL 1JTOA 5EC2B 4JGMA 3M17B 3D1MC 2GTZB 4APQC 1XZ0B 5C0GB 6CGTA 1ZANL 1MJ7H 4PV8B 4HSQA 2CSPA 4P2QB 3RPIA 1LK2B 1CGWA 2EXYC 1I1RA 5K59E 2N7AA 5ESAB 1YY8A 3DX6B 3N1QC 1AQKH 4YHYC 3FZUD 5IMLA 4M4RA 3DGCR 1NANH 4X99A 3MRIB 1KGCE 2PYEB 3DURB 3GBNL 3PWPB 3CUPA 4MNQD 1RMFL 1UH2A 5GS3A 3N0PB 4XAKD 1A02N 5IB2A 4KY1L 1U8QA 1OAKL 2PW2B 1K3IA 3G6JF 1H8SA 3KPOB 4RNRA 1P9MA 2Q6WB 3HI6H 2V7HA 1Y6KR 4HS3A 2R2EA 4OLZH 3U7AA 4ALAL 4YHOH 4JFYB 3QIBC 1OF2A 4FXKA 4MNQE 5F96H 1U8IB 5HHOA 2ATPA 4WI2A 3LD8C 4XAKE 5DHVB 4HV8B 4UQ3A 5FO8A 4XCCL 5EOCH 1XCTA 1P6FA 1EX0A 4M7LL 1RUML 1TTFA 4P3DA 2I07A 5F9WC 1QSFA 4OD3L 4RGMC 3MLTA 4LSPH 2YWZA 2J6EL 3DETC 4APQA 3C5JA 1NFKA 3LV3A 4QXUL 4OZFA 1DBJL 3WIHA 2ZPKH 1J05A 4Z77B 1EJ6A 4G8GA 3O0RL 5C9KA 4QWWD 3ZSSA 2YHGA 5F3BB 5FOJA 3RKPA 3L7EA 4IOSD 4P4KC 2XA3A 4LHJB 4LVHC 1F3DJ 3E2HC 3LRSA 2OSLA 1A6PA 1KC5H 4U1IA 3S37X 1NKOA 3EOAB 4F7CB 3Q48A 3KVQA 4JFDE 1BX2B 4OBSA 4XP4H 4LU5H 3HLAA 4DEPC 5ITFA 3CGTA 3PXHA 3P30L 2FATH 5FGRA 3GRWH 1OSZA 4CADB 1FVCB 3CK0H 1F13A 3LPGA 2P7TA 5DRZA 5EU4B 1X4ZA 2ADGB 4L3AA 5SWZB 3C5ZC 3UZVB 4KZEL 2VLJD 4KWUA 2VN4A 3UTPD 5I1DB 5I71B 5DFTA 1L6ZA 3QIBA 3QJFB 5DJYB 3E6HA 4QOKB 4PR5A 4GKZA 6FABH 3G5VB 1OLZA 4KI5F 3RVTC 1UCTA 3FO9A 4BZ1L 2V9RA 5C0CD 5IVNA 2VZ3A 5EBMB 1HI6A 1FNSH 2K3TA 3W11C 3SJVB 4ODWA 1KJ2L 2VLJE 2YD6A 3UTPE 4R4BA 1BQHG 5EU7E 4NC1E 3MRNB 2H6PB 2A74A 4Z78B 2DS4A 3QWOB 3O2VH 4WTZA 2RCSH 3QWRA 4G8EA 1XCQB 3TNMB 5HVHB 3FN3A 3I3EA 3QPXL 4RMSA 4HH9B 5IWLC 3L3OA 2B5IB 1YEJH 4M5ZL 2YD3A 4ODXB 3H3KA 1WVZA 1QKZL 1EH9A 5SWSB 3T0VA 2R0KL 3NA9L 5J1SC 3QG6B 4OKDA 1CG9A 3W9DA 1MEXH 3BW9A 4M48L 3AS3A 2UZXB 4OZ4A 4UT9L 3OZ9H 2IFFL 2HT3C 3C5ZA 3RAJL 4ZDHB 3WSQL 2QADB 4JZOB 2XN9B 5DVKA 4BUHA 4GXUM 5F9OL 1BEYH 1BZ9A 5DZOA 3MLVH 4KMLB 4RGND 3H7BA 3L3HB 5FM5O 5CSZB 3KYKL 2B39A 4CW1A 1T7ZA 5BZDA 2DYPA 1MCSA 4GG8B 4DWHA 2C7UA 3QH3A 1EAPA 4TUOB 4Y16B 1KN4L 4IMLB 3P77A 3VFRB 4XPBH 3CSBA 3R06A 1NFIA 2E7CA 3QUKA 4CGTA 5DRXB 4I0PA 3BGFC 5DD1L 4Z7WF 3JTSA 5AEAA 4YDLB 1T66D 4QXTB 1LK3L 5E95B 1JTPA 1J7VR 3QO0B 5AYUL 5EORL 1CL7H 5IV2B 3TM6A 4HKJA 4P2RB 4CNIB 5IWLA 3BWAA 5JR1L 2VKXA 3QT2A 4Y5VB 4NO0B 1LO5A 1NQBA 3MRHB 1UWEH 3IJSA 3DOSA 4I5BB 4NRYA 5LVEA 4XPAL 3JV6B 3P4OB 2Z92B 3VXTB 2ATKA 1NCDL 1QSFD 4U1GB 4X4ZA 5IVXA 2F58L 4BM7A 5LKNA 3AMLA 3GRWA 1MHPL 1T3FB 2AJYL 5SWQB 1SYSB 4F2MB 1NMCC 1AGEB 3RWJB 4F7PA 1I8MB 5E8PA 5ELIA 1QPPA 3UO1H 1CLCA 2J3SA 1CXKA 1FH5H 1FFRA 2A9ML 1M7DB 5IG7B 1U91A 3EFDL 1CFNA 1FGVH 4JE4B 1QRNB 1AXTH 4HJGA 4V2CB 2VDQH 2P5EA 2Y5TA 4Q6IB 7FABH 1VGKB 2NXYB 5I1AA 2EIZB 1M71A 3MA7B 4XWGH 5IBUG 1FYTB 1WSST 4KJYA 2HJKA 2A38A 3B9DA 3IDJB 4X6EB 4QHKI 1WK0A 2WZPD 4OAWA 1BLNB 4YJZL 3ECBA 2GITB 3OX8A 1TZHB 5C71A 2FR4B 3IB4A 5D7LA 1SYVA 3MJ6A 4XXCC 4FFZL 5K9QG 4LARL 5C9JA 3FB6B 4KQ4L 3O9WB 3FL7A 3TPUB 4AEFA 1Z9LA 4YAQB 3ZKSD 1BIHA 4MXQC 2EDRA 4ZUVB 4PJ9C 5C1MB 5EC1B 4XCYA 5ITBH 2A6DA 3N1MC 1U8MB 3KPPA 35C8H 5CJBA 4D0DA 2HH0H 3TCXA 1IC1A 4N0UE 4YHZL 5IEKA 3FOLB 4QRTA 3DI2B 4M7ZC 5AUMA 4U1LB 3QWRD 5FCSH 3QDMA 4JQIL 5AZEH 4U1MB 3U36A 1NAKH 4P4KD 4H5SB 4BH8B 2W0PA 2DJUA 4G6FD 3DXAB 1F8TH 1CK0H 4FQJL 4HUNB 4JRWA 3I85A 1JIBA 4KRLB 1F4WL 1MFDH 4XPTL 3VXRB 2E9BA 3PIQA 4DKEL 5EU6B 3VXUB 4R90H 3VXOA 4NYLA 1PZUB 4FABL 2FYYB 2XWJA 4M8VA 2B1HL 1G9NL 3DV4B 1F02I 1T20B 5DJXA