5JYIA

Trypsin bound with succinic acid at 1.9a
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
219
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Trypsin bound with succinic acid at 1.9A
rcsb
molecule tags Hydrolase
total genus 53
structure length 219
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5jyiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5jyiA02
5L2YH 4IS5A 2ODPA 3P92A 5LPEA 3M5OA 2HALA 4AFUA 2IJOB 4CHAB 1GGDB 4Y0YE 4BOHA 1O3NA 2FS9A 2GVFA 1W0ZU 1QNJA 2J2UA 1SL3A 2GDEH 4Y11E 1QB9A 2NU0E 1T8MA 1QJ6B 4IBLH 1NFXA 1SLXB 2J95A 1XUFA 4CR9A 2GT8A 2M5TA 3GCOA 1W14U 2FTMA 1IQMA 1AB9B 1D4PB 1TA2A 2BOHB 1Y8TA 2ZDAH 3TJVA 1W7XH 3PB1E 2PTNA 3BN9A 1AZ8A 1O33A 4AZ2B 1O2WA 4ZUHA 1XVOA 1K2I1 3BTGE 5A8XA 1ZRKA 1MTUA 1P57B 4X6PA 4JZIA 2C4FH 4NIWA 4TY6A 3KQBA 2BDIA 1PYTD 1LMWB 4I8HA 3RXTA 2WPIS 1D3DB 5C1XA 1P0SH 3ZV8A 3A8BA 4ISOA 2NU4E 3LKWA 1MCVA 4X6NA 5EOKA 4YOJA 1NRNH 2LPRA 3P6ZB 3S69A 2GD4B 1WU1A 9ESTA 2BD4A 4Y7BA 2TBSA 5A2MH 1TNKA 3TH2H 1TB6H 1KIGH 1NN6A 3F68H 1VZQH 2XBWA 1Y5AT 1TBZH 1WYKA 1AWFH 1IQHA 1TAWA 1TNJA 3GOVB 2VVUA 4WF8A 4BAKB 1GBEA 2AGGX 1BMMH 3T62A 1K22H 2TGAA 2B5TB 1FIWA 1GI4A 1MU8B 1SFIA 2VIDA 5GDSH 2OQUA 1UO6A 1O5FH 1ETTH 2P95A 1GBBA 2HGTH 1KLIH 5A0AE 3I29A 2NU2E 2H9EH 4MPWA 3L6PA 1LCYA 4YZUA 2EA3A 1P8VC 3TITA 4XBBA 1C2HA 1GBAA 1UVUH 2F9UA 2F83A 2P8OB 4YESB 1OYTH 4WXIA 5A8ZA 1EAXA 1V3XA 3DA9B 2PHBA 2VVCA 3TGIE 3QN7A 1KXFA 1C1OA 1GJ4H 1EP5A 1OYQA 1ETSH 3Q00A 1GBCA 3QUMP 3U9AH 4JZDH 4D8NA 3VB6A 2ZZUH 1SBWA 2GGVB 1TGTA 2FTLE 3GCTG 4GAWA 1F0TA 1TX7A 4JCNA 1P2MA 3ESTA 4FU8A 1UVOA 1BTXA 4OGXA 2J4IA 2VGCC 3TK9A 1WSSH 4K1SA 1OWEA 1V2KT 5EQSA 5FPTA 3F9FA 2ZTYA 3SO3A 1RRKA 1EOJA 1XVMA 3MU5A 5GCHG 1TA6A 3MO6A 1O3KA 1Q3XA 4ZKNU 4ABBA 3HATH 1BTHH 1J14A 1O30A 1B0FA 2QV1A 4X1RU 2FODA 1DWBH 2TGPZ 4NG9H 2A5KA 3FP8E 4ISIH 3MNCA 1WOFA 3SJ9A 1CT0E 5TCCA 4Y8XA 3QGNB 2BD5A 4NZLA 1GHVH 4B71A 1AKSB 1ZTJA 5DKMA 4D7FA 2XW9A 1ZTLA 3EA8A 4Y8ZA 1CHGA 1TPPA 1C5WB 1SHHB 4RSPA 1XUIA 1GHAG 3BG4B 1EQ9A 2BVSH 2THFB 4CH8B 1BOQA 3RXEA 1V2ST 5EU8A 1CU1A 5BRRE 3E16B 2WPLS 4TPYA 3H7TA 2ZU5A 4WXVA 1TGBA 2Z9IA 2FP7B 1C1MA 3V3MA 1HJAB 4TYDA 1ZRBA 1O3BA 3S9BA 1A5IA 3IITA 1WBGB 4BTIB 2CHAB 2BYAX 4E05H 1HAZB 1GJCB 4ZKOU 1O2LA 4ABGA 2LNCA 1GMDF 1DWDH 2SNWA 1BMNH 2P3UB 2HWLB 4AFQA 4XE4A 5DP6A 1F92A 1C5VA 3RXHA 1P04A 1U6QA 5AFZH 1VCPA 4AN7A 3ATMA 1SB1H 1LHEH 1FY3A 1BBRH 3SU2A 1UK4A 3LH3A 1O0DH 1A46H 1ELDE 1GI0A 1O3GA 3KNXA 5CE1A 2ZDMA 4QT8C 3CS7A 1Y3UA 2FLRH 2A4RA 2ZEBA 1ZSLA 1BIOA 1O2ZA 1Z8GA 1KLJH 5EQQA 2C3SA 2W26A 3P8GA 1V2JT 4XFQA 4YOIA 1SGRE 1BMAA 1G3BA 2Y7XA 2AFQB 1FPCH 1NT1A 2WINI 4FXGH 1FXYA 1S5SA 1TMTH 2VIOA 3RM2H 3D49H 1PQ5A 3A85A 1C1PA 1BMLA 3TNSA 4WWYA 3W95A 4X8VH 1FAXA 1GCTC 1XMNB 3U8RH 1NM6A 1O2PA 3RXIA 1OWIA 1AUTC 1UMAH 1OP8A 1HBTH 4H6TA 3TK5A 1AN1E 2ZDLA 4FUCA 1INCA 2PR3A 4NSVA 1EB2A 2J34A 1ANBA 1JXPA 1O2HA 2ZCKP 5F03A 1C2LA 3F9EA 1BTPA 1BHXB 2ZF0H 4JYVH 3SGQE 1CT4E 3H5CB 1QQ4A 1XKAC 1FONA 5FCRA 5E2OA 4TY7A 1GJ6A 2ZP0H 1C5SA 1GJDB 5FX6A 4AOQA 2JH5D 2O8TA 2VIQA 4HI3A 2Z9JA 3VEQB 4KGAA 4GCHF 2ZDVH 3EYDA 2P3TB 3SU1A 5E0JA 2WV4A 1QIXB 4DIIH 1Y5UT 1ZMNA 1DOJA 1XUGA 9LPRA 1AE8H 3B23B 3M61U 3MYWA 3SUEA 5I46H 1QRXA 3GDVA 1T8OA 3NK8A 4MPUA 1TOMH 1SGQE 4IC6A 1DE7H 4Y6DA 2AMDA 2ZTXA 1FN6A 2BDHA 4NZQA 1MU6B 4LOYH 4B76A 4MTBA 1ORFA 4OS2A 1LTOA 2UWOA 1HXFH 2Y5GA 1E0FD 2FOCA 2GDDA 1O5CB 2JH6D 3NZIA 4ZHAA 3PLBA 3ZZDA 2PKSC 1BT7A 3ZVFA 1ZPZA 1F0UA 2J92A 1T8LA 1ZHPA 3SJ8A 1G9IE 2VJ1A 1PQ7A 1AI8H 3E90B 3PWBA 1P11E 2ZHWH 3T25A 1JOUB 1YC0A 5EW2H 3MWIU 3STIA 1QB1A 1SLVB 1EAIA 2RCEA 3NWUA 3P8NA 2FEQH 1AQ7A 1GMCF 2J9NA 2PV9B 4J2YB 2A45B 1FUJA 4XSKU 2ZHQH 1DT2A 1HAOH 4Y7AA 1O2XA 5FAHA 5JDUB 3A8DA 4GVUA 2HLCA 4OS4A 5DJ7A 1IQNA 1BA8B 1YPJH 4K60A 3CENA 1C5UA 1P05A 4SGBE 4Q7XA 1ETRH 1HV7A 2DE9A 1C5PA 1M9UA 2ZI2H 4A92A 1S81A 3ODFA 2A2XH 3QZQA 3SUDA 1GJ7B 1NFWA 1VCQA 5L2ZH 1HAHH 1QBNA 2O8MA 4BTTB 5ESBA 1EPTA 1G2LA 8GCHG 4IMZA 1ANDA 4FVDA 1F5KU 1Z6JH 1SR5C 1SGIB 3O8RA 3RMMH 4X6OA 3SHCH 6GCHF 3OY5U 4I8LA 2VGCB 2XRCA 5GXPA 1NRPH 4LZ4B 4NSYA 5C5NA 4U2WA 3PMHB 2AMQA 1C1WH 1C5RA 1GBIA 4AG1A 4FUBA 1FAKH 1ZPBA 4IC5A 1SQTA 2GTBA 2ZU1A 2QCYA 5TJXA 1D6RA 4NGAH 4ISHH 2H5DA 1TRMA 4XOJA 3SV7A 2Q6FA 2ZFFH 2GV6A 1O2JA 4BXWA 4IW4E 1J17T 2UUFB 3LC5A 1TNIA 4DJZB 3SUGA 2BDGA 4JK6A 1O3JA 5EQRA 3ZZCA 4FUJA 3LJJA 1C1VH 1IQEA 1MTNC 2P3FH 8KME2 1GDUA 3BTWE 3SJIA 1BJVA 2XCNA 3GISB 1SI5H 2BDBA 3TPIZ 5IDKA 1UCYE 2STAE 1DX5M 2ZU2A 1ELAA 3M5LA 2P94A 1MQ5A 1QRZA 1QTFA 4RN6A 4K1EA 2PKAA 2ZHEH 2QN5T 1E38B 3CS0A 2A32A 3K6ZA 1CHOF 3ZVEA 1MTSA 2PUXB 1P2QA 1TLDA 2AGIX 2OQ5A 4FUGA 3TJNA 4A1VA 4I7YH 3UNRA 3S7KB 4KTCA 4ISLA 3G01A 1EJNA 1KXEA 3GCNA 3S0NA 1ESAA 4K5ZA 2BVRH 3QTOH 3QLPH 2H6MA 2HVXA 1O2KA 4KKDA 1UCYK 1AY6H 4ABIA 1K1MA 2XXLA 3PWCA 3SZNA 2FIRH 1EUFA 7GCHG 2WV5A 2ZGHA 3KGPA 1AUJA 3ZZ7A 2J38A 2OD3B 1MZDA 3T5FH 2WPHS 3RXGA 3ATWA 1UHBB 2GP9B 1E34B 4GUXA 5JBAS 1S0QA 2NWNA 4R0IA 3V7TA 1BTUA 1O5EH 1MTWA 4B1TA 2FOGA 1S85A 4WVPE 3PTBA 3GYLB 2BY7X 1W10U 3QX5H 2XC5A 2AMPA 3SGAE 4Y0ZE 2W7UA 1IQFA 4JMYA 5H4IB 1Y3XA 3MHWU 2FOEA 3TJUA 3SU0A 1KXCA 4CRCA 1G36A 1GCTB 1J15A 1YPEH 1O5AB 1WUNH 2A1DB 3UR6A 4ABAA 4MDSA 3LC3A 1TGNA 2C8YB 4MNWA 1TBQH 1W2KH 5GJ4B 3BEIB 3SNBA 2ZGBH 1ZJKA 2ZU4A 2OCVB 2F9OA 1DY8A 1TMUH 5A8YA 1BDAA 2WYGA 1SGYE 1JRTA 2VIPA 3UY9A 1TRYA 3SNAA 5E0HA 3SUFA 2JETC 1ZOMA 2BM2A 1FY8E 4BXSA 1BRAA 2VINA 1VJ9U 1A3BH 1O3EA 2BTCE 1GBJA 3TIUA 1KYNA 1P02A 1V6DA 2ZWLH 5HMAA 1RGQA 3TGJE 1DXWA 3O8DA 1LKBA 3BTEE 3HK3B 3U69H 4UD9H 1HAVA 5FHTA 5AFYH 1C2DA 1SGFG 4B2CA 3A7ZA 3ZV9A 1LVOA 2AERH 3RXRA 1V2LT 1J8AA 1YPMH 1YCPK 4CRFA 1CA8B 1GI3A 4OS7A 2H9TH 1ZPCA 4LXBH 2G4TA 3AVZA 2AGEX 1UVPA 2A4GA 4GPGA 1IHSH 1MD7A 1DUEA 3A8CA 1L1JA 3HGPA 3IWMA 2SGEE 2GCHG 1FJSA 4PROA 1MAXA 1V2VT 4IMQA 4BNRA 1KDQA 1TMBH 2A7JA 1W0YH 3ZVDA 2QAAA 1D3QB 4MVNA 2R3YA 3K9XB 1GMHG 1H9HE 1LPKB 2XYAA 3A86A 3M7QA 1DDJA 3LU9B 3RM0H 3A81A 4YLUA 4X1NU 2ZKSA 2PKSB 3QDZB 2ZDKA 4ZH8A 4FUHA 2HNTF 1Z71A 4NA7A 3GY4A 5FBIA 3M35A 1GBFA 2Y80A 1O35A 1DICA 4CRBA 1TPOA 1K28D 3V13A 4E7NA 1A1RA 3BTDE 3E6PH 3TGKE 4ZROA 1W3CA 2C8WB 2PUQH 4DURA 3UOPA 2A7HA 4WJG2 2SGPE 1MKXK 1Y3VA 1O36A 3GCTF 1C5YB 1ARCA 1CA0C 2OLGA 3BTTE 1HAPH 1B0EA 1N1LA 4DVAU 1K9OE 4AX9H 1SQOA 5DP3A 4HZHA 1GVKB 3KIDU 2GZ9A 4OS1A 2VWOA 5BPEA 4UFEH 2V3HH 4ZHMU 4MPVA 5GCHF 1GDNA 3SN8A 3Q3XA 2P59A 3UPEA 3RMOH 3ODDA 3NKKA 3D62A 1O3OA 4O3TA 1P10A 4UONA 1BRCE 4Y71A 2BOKA 1W7GH 3SJKA 2G55A 1IQLA 1K1JA 1ZMJA 1GHWH 1V2PT 1Q31A 2OP9A 2ZCLP 2XBXA 4INLA 4YT7H 3MO3A 1BJUA 1A61H 3LH1A 1K1OA 1GHAF 2BD3A 1MBQA 3ZZ3A 2C8XB 2YNBA 5HM2A 5K0HA 5CHAC 4AYYB 1VCWA 1E36B 3A7VA 3A7YA 4FU7A 3TK6A 3ZVCA 4AG2A 2HPQH 4D76A 4RKJB 4CBNA 3URCA 5DGJA 2WUBA 3O8BA 4Y79A 1S84A 3FZDA 1ELFA 1F7ZA 4AFZA 1DSUA 4MPXA 5C20A 2XWBI 2IN2A 2A4OA 1GBLA 1WCZA 5DP5A 2CF9H 3U8OH 1PQ8A 1CT2E 3NCLA 1FV9A 3DD2H 1OP0A 3LGTA 3BIVH 4DW2U 1JIMA 4NWKA 1HLTH 1TBRH 1TONA 3SNDA 3KEEA 1CO7E 3GY6A 1MTNB 4MQAA 1QA7A 3M37A 2UUJB 2W3IA 3F9GA 2W3KA 3PO1C 1C5NH 3BTFE 1EP6A 1GHYH 2FWWA 2QA9E 3JZ1B 1C1UH 2ZGJA 1SOTA 4Q80A 1SGDE 3RDZA 1HAYB 5LH8A 4U32A 1WTGH 5FBEA 2QY0B 3PROA 2HPPH 5J4QA 1GHZA 3RP2A 1HJ9A 1NRRH 3QGJA 1OSSA 2Z3CA 1B5GH 3A8AA 4THNH 2F9BH 2H9HA 2QYIA 1QL7A 2F9NA 2WPKS 2Y81A 1O3PB 1GDQA 1C4Y2 1ESTA 3RC5A 4JZEH 2O8WA 1ESBA 1GI8B 3VPKA 3ATIA 3BSQA 1G3DA 2BDYA 3K6YA 3Q3KA 1HAGE 1O2RA 1ID5H 3OTJE 1GHBG 1YKTA 2A0QB 1OKXA 1C2IA 2F91A 1SGEE 1UTJA 4A1TA 3URDA 2XBYA 3VXFH 5FPYA 1GI2A 3RXSA 4BAHB 1P9UA 4XBCA 4ABDA 2VWNA 1LVBA 4TWWA 1CBWC 4X2WA 1YF4A 5LPRA 1JMOH 1UJ1A 5TCAA 1YP9A 3SI3H 3MNBA 3R3GB 2D26C 2Z9LA 5CMXH 1TNLA 2BB4A 3EE0B 3SI4H 3EA7A 1EPTC 1ARBA 5JBCS 3GY8A 2XCFA 1OWDA 1SC8U 2BDAA 2QGRA 1YYY1 5FCKA 1DUAA 3NPSA 2BLOA 1SQAA 2VNTA 1ZGVA 1OOKB 4E7RG 1L4DA 1ELEE 2ANKH 1LHGH 1P3EA 3OYPA 1FIZA 2JETB 3QWCH 2QXJA 2Z94A 3LOXA 2RA3A 4ABJA 1PQAA 2ZDNA 2B7DH 2GZ8A 1BQYA 2QF0A 1CQQA 1O3LA 3ZZAA 1V2MT 1J9CH 1JIRA 2ODYB 4J1YA 5AHGH 1TGSZ 1TIOA 1OWKA 1TE0A 3BTME 3DUXH 5GWZA 1D3TB 1C5OH 1TX6A 1CVWH 3KCGH 5FX5A 4ISNA 1BTYA 3SORA 1O5BB 2TRMA 3SU5A 2K1QA 3FFGA 4SGAE 2A4QA 4GHTA 3LT3A 2G5NA 2FDAA 2V6NA 1YPHE 3SV8A 1EB1H 1OP2A 2PGQB 3QK1A 3S9CA 1EOLA 1QBVH 1F5RA 2TPIZ 1SGTA 4YT6H 4YO9A 2BHGA 1FMGA 1HB0B 3RU4D 4BAQB 4DY7B 2FX6A 3SOSA 2OXSA 2B9LA 2FX4A 3E1XB 3RXCA 1A5HA 3M36A 4JYTA 1XKBC 1QB6A 1DPOA 1BBRE 7KMEH 1QRWA 3KF2A 4X8UH 1NFUA 2C8ZB 4ZMAH 1RIWC 2GCTC 1GI7B 3ENSB 1LO6A 3HPTB 1CE5A 3I78A 1FY1A 2G81E 2A5IA 4AYVB 5EXMA 4B2BA 3GY3A 2AH4X 5AVDA 3SW2B 3P17H 3ATLA 3C1KA 3TH4H 2STBE 2EI6A 4NA9H 1Z8IB 1O2TA 3SQHE 5EODA 1IQIA 2IPHA 1O3AA 1S83A 2BY9X 1HCGA 2HNTC 3KN2A 5GPIB 4D9QA 4XBDA 3TH3H 2FOFA 8GCHF 1CA0B 2ZQ1A 1LPGB 1DSTA 5HM9A 3MU0A 3GDUA 1BBRK 5JPMH 1E37B 1P12E 1PPGE 4GHQA 2Y5FA 1GBMA 3AASA 3F6UH 1ACBE 2ZQ2A 2FMJA 2FI3E 4D7GA 2AIPA 1W8BH 1CGJE 4JZFH 2D1JA 3PMAB 3RXPA 2QF3A 1THRH 3MH7A 2R3UA 2KAIA 1TPAE 1C1SA 4K2YA 3SNCA 5C1UA 3E3TA 1T31A 1O2SA 4Y10E 1S0RA 1OWHA 2J94A 5DK1A 2R0KA 1MKWH 2G52A 4HFPB 4K8YA 1LPZB 3EA9A 4CBOA 1IQJA 4XDEA 2TGTA 4DG4A 4B74A 3RMLH 5CHAB 1T8NA 2CGAA 2FESH 5JBTA 1GBTA 1O2VA 1IQGA 2FOBA 1FQ3A 3GYMA 1BCUH 1ABIH 1AFEH 3ZVGA 2ILNA 1SG8B 1SGFA 2XWAA 2Y82A 3UQOA 1G37A 2ZCHP 4B73A 1BUIA 1EAUA 3MH4A 2UWLA 1V2TT 3RUOA 1EZSC 3ZZ6A 1N6XA 4ABHA 1TX8A 1NROH 4MG3A 1HFDA 4KTUA 5HXFA 1EJMA 3E0NB 1BTZA 1K1IA 1SHYA 1ZJDA 2GZ7A 1AD8H 2BY8X 2B0FA 1O3HA 1H4WA 1SPJA 2FLBH 2FYQA 1XM1A 3UNQA 2Q1JA 3UQVA 3BG8A 4DGJA 2Z6BD 2O8LA 4FUDA 5K7RA 2BQ7B 5JB8S 1C2KA 2DE8A 7GCHF 3W94A 1ANEA 3MI4A 3ZZBA 2QC2A 1UTQA 2SGFE 4HGCA 1GI5A 1K1PA 1OXGA 3HK6B 2ESTE 1GI6A 6ESTA 1EZUC 3S7HB 1GVZA 1P03A 1HIAA 5C3NA 1SSXA 3ELAH 2RA0A 3L3TA 2ULLA 2Z3EA 3MO9A 1LVYA 1QJ7B 1VR1H 4AORA 4MNVA 1O2UA 3OU0A 2JH0D 3P8OA 2HOBA 4R8TB 6LPRA 1D3PB 4YOGA 2SFAA 5C2ZA 1VITG 1UTMA 3DT0H 1QHRB 1P2OA 1O3FA 1LDTT 2Z9KA 1NESE 3KQCA 3GDSA 2ZGXH 3ZVAA 1OPHB 1WTHD 4ASHA 3BIUH 3D65E 2XC0A 1H9LB 2BY5X 1MZAA 1C1TA 2BX4A 1H8IH 2I6QA 3PV4A 5A0CA 2OINA 1AVXA 3LGIA 1CBWB 1PPZA 1PPBH 1BZXE 1CGHA 2QXGA 1HGTH 1FLEE 3ZZ8A 3MH5A 1GVLA 4VGCC 2VIWA 1O39A 1A0HB 1EZXC 1G30B 1V2OT 1YLCA 1WV7H 2OC0A 2DUCA 2SGAA 1YM0A 1SVPA 1YPHC 1O38A 3SNEA 3HGNA 2OUAA 1EPTB 2ZFSA 1FZZA 1KTTB 3UOUA 1L1GA 1UK2A 2GX4A 4LK4A 3E91A 2V3OH 1O34A 4I33A 1MCTA 1O2OA 8LPRA 1DFPA 3RXVA 4HTCH 1D6WA 1UVSH 4O3UA 1MAYA 4X1SU 3LJOA 1TNGA 2UWPA 4X8SH 2FXRA 1NTPA 1CSOE 2BZAA 1A4WH 1KSNA 1A0JA 2GCHF 1THSH 1EJAA 1GPZA 2FZZA 3KHVA 1K1LA 1AMHA 3DFLA 4M7GA 1O2YA 1UTKA 2ZNKH 2G5VA 2R9PA 1RS0A 5DO4H 1GMHF 4FVBA 4Q7ZA 1C1NA 3F9HA 4O9VA 5T6FA 3LGVA 2Q6GA 2G00A 1L0ZA 4NIYA 4BANB 1TNHA 1KXAA 2ANYA 1LHFH 4X2XA 1F0RA 5DP8A 2OBQA 3VB5A 1S6HA 1Z7KA 1H8DH 4ZXXH 1F5LA 2R2WU 3MU8A 4Y8YA 4X6MA 1C1QA 2BD8A 3PMBB 4MNYA 3T2NA 1P2JA 3M5NA 2PKAB 2H1UA 1GG6C 2ZPSA 1W11U 3S9AA 3Q3YA 1Z1JA 1P01A 4OGYA 3M3VA 4K8BA 3UUZA 4IN2A 3KQEA 4FUFA 2Q6DA 5EPNA 1RIWB 2ZFPH 2GCTB 2BVXH 3R0FA 4UDWH 3TNTA 4YM9A 5A09A 1C5TA 3RXJA 3EDXB 1HRTH 2FOAA 1ZZZA 2XC4A 3FZZA 3A84A 2Z7FE 1IHTH 2Y5HA 1PFXC 4F49A 4DIHH 3RU4E 3EQ0H 2Y7ZA 3ZVBA 1O3MA 1DVAH 1BTWA 1QL9A 1C1RA 1UTNA 2CV3A 2CJIA 3UREA 2BD9A 2BXTH 2JKHA 3BEFB 3OSYA 3LONA 3PTNA 2IOTA 1RTLA 1O2NA 2ZC9H 2ZTZA 2ZHFH 1C5LH 3GY2A 1FY5A 1LHCH 1XUKA 3A7XA 1O2MA 5DP4A 2CN0H 4NIVA 1NU9A 3H7OA 4A7IB 1AO5A 1W13U 1EKBB 3DFJA 4NFEA 2BQ6B 4YTAA 5F6MA 3SQEE 2BD2A 2OC1A 1GJBB 3RXLA 2Z9GA 1AKSA 3MFJA 2R0LA 3PLPA 1Y5BT 5C1YA 2I6SA 1TQ0B 5EGMA 3SU3A 4BTUB 4I31A 2PWXA 1HUTH 4WMEA 1DLKB 1AVWA 4ESTE 3LIWA 1Y3YA 1P06A 1SGPE 1WAYB 3T26A 4Q2KA 1MD8A 1GBDA 1SLWB 1AFQC 2NU1E 2PSXA 5F8TA 2BD7A 2ZECA 1SFQB 1L1NA 1SGCA 1ZR0A 1OX1A 3MH6A 1QR3E 5JB9S 2QXIA 1SMFE 1ELBA 1AGJA 1RD3B 3FANA 3U8TH 4ZXYH 1NU7B 4JYUH 1GJ5H 2ANMH 3T29A 4NCYA 1HAVB 2BLQA 4CRGA 3GY5A 1O3CA 1E35B 3E8LA 1ZSKA 1Y3WA 1RXPA 1J16A 4KELA 1LHDH 1BITA 1P2KA 3ITIA 1MTVA 2HNTE 3UR9A 5PTPA 1C4V2 1D9IA 2BMGB 5I25A 2BX3A 1HAXB 1W12U 3NXPA 4H42U 1Z6EA 2ZA5A 1P3CA 2SNVA 1KDQB 3ZYEA 1O32A 1GHBF 2FM2A 1ZHRA 2C93B 3RXBA 3ZZ4A 3A89A 1O5DH 3E0PB 2A7CA 3PLKA 1H1BA 4X2VA 1Z1IA 5DG6A 3LGYA 5FPSA 1C5MD 2CXVA 5E8EH 1T7CA 3RXDA 1FN8A 2PLXA 4O97A 1C2MA 1WQVH 1DWCH 4TWYA 1EAWA 1AVGH 1N8OC 3C27B 3BTQE 2O8UA 5C67A 2OTVA 3M7UA 1ZYOA 3T28A 2VH0A 4B2AA 5E0GA 3VB7A 2CMYA 2F3CE 1HYLA 2BXUH 2Y6TA 1C2EA 4AFSA 5EW1H 2PFEA 1O2QA 1BRBE 4CRDA 2WYJA 1N6YA 1AZZA 1JRSA 2QXHA 1EX3A 4BAOB 4UE7H 1GL1A 3P70B 1NRSH 1X7AC 1BRUP 1DXPA 2ZFTA 2FOHA 1RFNA 4I8JA 2OC8A 5DP7A 4RKOB 1YBWA 2OBOA 3MNSA 2YNAA 2ZPRA 1S6FA 2G8TA 4VGCB 5SGAE 1T4VH 3F1SB 3RXQA 2G4UA 3OX7U 3GCHC 3TVJB 2XTTB 1BB0B 1AIXH 1GWAA 1P09A 4X1PU 3K2UA 1C2FA 3UFAA 1O37A 1VGCC 5DP9A 3MU1A 1RTFB 4FUEA 2GMTC 1O3DA 4X0WU 3UWIA 1Z8JB 6CHAC 2WUCA 5B6OA 3LGUA 1PPCE 3FP7E 1T4UH 3VGCC 4BAMB 2VVVA 1FI8A 4MNXA 2FO9A 5FXLA 1QGFA 1YPGH 3MMGA 1YPLH 3FP6E 4O03A 3O8CA 1H9IE 2VWLA 2D2DA 2UUYA 5ETXA 1NS3A 1TPSA 8ESTE 4UEHH 1C5XB 1A3EH 1G3EA 1GI9B 1K21H 4KTSA 2V0BA 1OS8A 4IN1A 3A80A 3B8JA 2GKVE 1TOCB 4Y76A 3SHAH 1F2SE 2BY6X 1C9PA 2ODQA 1A0LA 2FOMB 2ZFQH 4FU9A 3SV9A 1QCPA 3UTUH 1A2CH 1QA0A 2CF8H 4X1QU 5EG4A 3QZRA 1GMDG 1EATA 2BQWB 1GG6B 4AGKA 3U1JB 1IAUA 5A0BA 4OS6A 3SGBE 3BTHE 1P2IA 1Z8RA 4GSOA 3RXFA 3WY8A 1ZLRA 1BHXF 1Y59T 2P93A 4NA8A 5T6GA 4I32A 2H2ZA 1YCPM 5EPYA 3IG6B 1DM4B 4Z6AH 4WH6A 1HXEH 3A7WA 3BEUA 1QURH 3A82A 1LKAA 3U98H 3KQDA 3ZYDA 1O2IA 1V2UT 5HGGA 4X8TH 5EXNA 2AYWA 3FVFB 1YGCH 1XX9A 4KP0A 5T6DA 1L4ZA 3U1IB 1DANH 1HNEE 5GIBA 4X2YA 1TABE 1AWHB 1MMJN 1TQ7B 1ABJH 3CP7A 4ABEA 3SU6A 2W7SA 4CHAC 2BDCA 1GGDC 4MLFB 1PPHE 5LGOA 1FNIA 1YPKH 2F9VA 1NFYA 1IOEA 1RTKA 4K69A 2ALPA 5T3HA 1LQDB 2ASUB 1KTSB 1FDPA 5E2PA 1C2JA 1QY6A 5IYTA 1AB9C 1IQKA 2B8OH 4OS5A 3AAVA 1EXFA 1ELGA 1UK3A 4F4OC 2FI4E 2OC7A 1XXDA 1NO9H 3HKJB 2VB0A 2EI7A 3LGWA 3I77A 1XXFA 1MUEB 4U01A 3MTYA 2XBVA 3A88A 5C5OA 3RLWH 3ATKA 4GCHG 1DITH 1AFQB 5F8ZA 1C4U2 1C9TA 2Z3DA 2WPJS 1DS2E 2NU3E 1DY9A 3LDXH 1F0SA 2ZFRH 1GCDA 2PGBB 1DLEA 4AB9A 1P2NA 1UCYH 4DOQA 2HRVA 4LZ1H 2R2MB 3RC6A 1TWXB 3GICB 3PMJA 1V2NT 3A87A 1PPFE 3RXAA 3N7OA 1TFXA 4U30A 1O3IA 4INHA 1MBMA 4CH2B 1ELVA 4K1TA 3A83A 1SOZA 4E06H 1G2MA 4TPIZ 5ABWA 1WQSA 2FI5E 3PYHA 4ZHLU 2ZG0H 1VITH 1RJXB 3RMNH 4CR5A 2FS8A 1AU8A 2ZGCA 2EC9H 1MH0A 1T32A 1UHBA 3GY7A 3MU4A 1JWTA 3TJOA 1TALA 1VITF 3RLYH 2P8OC 4H4FA 2ZPQA 1B7XB 1PJPA 5F8XA 3M3TA 5HYOA 2BZ6H 5DPAA 1GBHA 2TGDA 1HJ8A 3QO6A 3Q76A 2A31A 1KLTA 3STJA 7LPRA 4NFFA 1GJ8B 4B75A 4I8KA 3PO1B 4A5TS 1G3CA 2C90B 3UNSA 1GMCG 4WH8A 1QL8A 5J4SA 2SGQE 4WMDA 4INKA 1N8OB 3A7TA 2RDLA 5L30H 1QQUA 4K3JA 1LVMA 1NRQH 5JBBS 2W5EA 2V35A 3RC4A 2A2QH 2PTCE 2EI8A 2YOLA 3RXOA 2QIQA 1EZQA 1XUJA 4ZKRU 2ANWA 1QBOA 2GT7A 1NC6A 4CREA 4I8GA 1FY4A 3PM3A 3TU7H 2ZIQH 3V12A 3AAUA 3DHKH 4WY3A 4NIXA 1V2QT 3MOCA 3BF6H 2VIVA 1YCPH 1A7SA 1TGCA 2AEIH 2SGDE 4NWLA 2AS9A 3GCHB 5L6NH 1UVTH 3SV2H 1PPEE 6GCHG 4GLYA 1THPB 4JZ1A 2GV7A 2F9PA 2KAIB 2UUKB 3BG4C 2G51A 2ZO3H 3VFEA 3RXMA 3AW0A 1GBKA 1L2EA 2TIOA 2EEKA 1GJAB 1VGCB 4UFGH 1TRNA 1GL0E 3M5MA 3M3SA 1HJAC 2GMTB 4AB8A 1AE5A 3EAJA 3ZZ9A 5AF9H 6CHAB 1C5QA 5ESTE 2XNIA 4Z0KA 4JK5A 5EXLA 3VGCB 2H5CA 3HKIB 2CHAC 1MKWK 1QJ1B 3B9FH 4CRAA 3VXEH 1TYNA 4IGDA 2FPZA 4AGJA 3SV6A 2WPMS 2PW8H 2VH6A 1MQ6A 1NY22 1GI1A 1C5ZB 1HDTH 1JBUH 1UTLM 1A5GH 1QFKH 1S82A 1AHTH 3VB3A 1ZGIA 1G32B 4DCDA 1MKXH 1YLDA 4D9RA 3RU4T 3T27A 1SLUB 1O5GH 1OWJA 1ELCA 3UWJH 1KXDA 3RXKA 3ZZ5A 1SGNE 2ZU3A 3OY6U 7ESTE 1ZSJA 3P95A 3VB4A 1KXBA 1CGIE 1CHOG 1O31A 3QTVH 3MNXA 1C2GA 1V2WT 1P9SA 3P8FA 3TLOA 1V2RT 5LPFA 1ZHMA 3V0XA 2VU8E 4Q7YA 2AIQA 2VWMA 3M7TA 1NPMA 1UTOA 4H6SB 1K1NA 1ZMLA 3EGKH 2P16A 3AW1A 2ALVA 3BV9B 1Q2WA 2D8WA 2BLWA 1GJ9B 3K65B 4YLQH 3D23A 4FUIA 4ZAEA 5JYIA 4ZKSU 1VJAU 3SU4A 1NZQH 2BLVA 3LPRA 1HAIH 1LQEA 1XUHA 1HIAB 3Q77A 3RXUA 5G4BA 4DT7B 4WMFA 1ANCA 4UFFH 2ZHDA 3KL6A 2FYRA 3UIRA 1EASA 2RG3A 4A1XA 1GHXH 3BTKE 4A6LA 4ABFA 3JZ2B 3L33A 1DWEH 1UTPA 4UFDH 3SJOA 2PSYA 1ELTA 2A5AA 2O9QA 1KY9A 1ZTKA 1FPHH 1O2GH 3FAOA 3NUMA 1HPGA 3SBKA 1PYTC
chains in the Genus database with same CATH superfamily
5L2YH 4IS5A 2ODPA 2QE7D 3P92A 5LPEA 3M5OA 2HALA 4AFUA 2IJOB 4CHAB 1GGDB 4Y0YE 4BOHA 1O3NA 2FS9A 2GVFA 1W0ZU 1QNJA 2J2UA 1SL3A 2WSSD 2GDEH 4Y11E 1QB9A 2NU0E 1T8MA 1QJ6B 4IBLH 1NFXA 1NBME 1SLXB 1XUFA 2J95A 4CR9A 2GT8A 2M5TA 3GCOA 1W14U 2FTMA 1IQMA 1AB9B 1D4PB 1TA2A 2BOHB 1Y8TA 2ZDAH 3TJVA 1W7XH 3PB1E 2PTNA 3BN9A 1AZ8A 1O33A 4AZ2B 1O2WA 4ZUHA 1XVOA 1K2I1 3BTGE 5A8XA 1ZRKA 1MTUA 1P57B 4X6PA 4JZIA 2C4FH 4NIWA 4TY6A 3KQBA 2BDIA 1PYTD 1LMWB 4I8HA 3RXTA 2WPIS 1D3DB 4FETA 5C1XA 1P0SH 3ZV8A 3A8BA 4ISOA 2NU4E 3LKWA 1MCVA 4X6NA 5EOKA 4YOJA 1NRNH 2LPRA 3P6ZB 3S69A 2GD4B 1WU1A 9ESTA 2BD4A 4Y7BA 2TBSA 5A2MH 1TNKA 3TH2H 1TB6H 1KIGH 1NN6A 3F68H 1VZQH 2XBWA 1Y5AT 1TBZH 1WYKA 1AWFH 1IQHA 1TAWA 1TNJA 3GOVB 2VVUA 4WF8A 4BAKB 1GBEA 2AGGX 1BMMH 3T62A 1K22H 2TGAA 2B5TB 1FIWA 1GI4A 1MU8B 1SFIA 2KX4A 2VIDA 5GDSH 2OQUA 1UO6A 1O5FH 1ETTH 2P95A 1GBBA 2HGTH 1KLIH 5A0AE 3I29A 2NU2E 2H9EH 4M9FA 4MPWA 3L6PA 1LCYA 4YZUA 2EA3A 1P8VC 3TITA 4XBBA 1C2HA 1GBAA 1UVUH 2F9UA 2F83A 2P8OB 4YESB 1OYTH 4WXIA 5A8ZA 1EAXA 1V3XA 3DA9B 2PHBA 2VVCA 3TGIE 3QN7A 1KXFA 1C1OA 1GJ4H 3N7DA 1EP5A 1OYQA 1ETSH 3Q00A 1GBCA 3QUMP 3U9AH 4JZDH 4D8NA 3VB6A 2ZZUH 1SBWA 2GGVB 1TGTA 2FTLE 3GCTG 4GAWA 1F0TA 2PP6A 1TX7A 4JCNA 1P2MA 3ESTA 4F48B 4FU8A 3FO8D 1UVOA 1BTXA 4OGXA 2J4IA 2VGCC 3TK9A 1WSSH 4K1SA 1OWEA 1V2KT 5EQSA 5FPTA 3F9FA 2ZTYA 3SO3A 1RRKA 1EOJA 1XVMA 3MU5A 5GCHG 1TA6A 3MO6A 1O3KA 1Q3XA 4ZKNU 4ABBA 3HATH 1BTHH 1J14A 1O30A 1B0FA 2QV1A 4X1RU 2FODA 1DWBH 2TGPZ 4NG9H 2A5KA 3FP8E 4ISIH 3MNCA 1WOFA 3SJ9A 1CT0E 5TCCA 4Y8XA 3QGNB 2BD5A 4NZLA 1GHVH 2HLDD 4B71A 1AKSB 3FOAA 1ZTJA 5DKMA 4D7FA 2XW9A 1ZTLA 3EA8A 4Y8ZA 1CHGA 1TPPA 1C5WB 1SHHB 4RSPA 1XUIA 4ACAA 1GHAG 3BG4B 1EQ9A 2BVSH 2THFB 4CH8B 1BOQA 3RXEA 1V2ST 5EU8A 1CU1A 5BRRE 3E16B 2WPLS 4TPYA 3H7TA 2ZU5A 3DCLA 4WXVA 1TGBA 2Z9IA 3F3BA 2FP7B 1C1MA 3V3MA 1HJAB 4TYDA 1ZRBA 1O3BA 3S9BA 1A5IA 3IITA 1WBGB 4BTIB 2CHAB 2BYAX 4E05H 1HAZB 1GJCB 2QF5A 4ZKOU 1O2LA 1SQRA 4ABGA 2LNCA 1GMDF 1DWDH 2SNWA 1BMNH 2P3UB 2HWLB 4AFQA 4XE4A 5DP6A 1F92A 1C5VA 3RXHA 1P04A 1U6QA 5AFZH 1VCPA 4AN7A 3ATMA 1SB1H 1LHEH 1FY3A 1BBRH 3SU2A 1UK4A 3LH3A 1O0DH 3NRLA 1A46H 1ELDE 1GI0A 1O3GA 3KNXA 5CE1A 2ZDMA 4QT8C 3CS7A 1Y3UA 2FLRH 2A4RA 2ZEBA 1ZSLA 1BIOA 1O2ZA 1Z8GA 1KLJH 5EQQA 2C3SA 2W26A 3P8GA 1V2JT 4XFQA 4YOIA 1SGRE 1BMAA 1G3BA 2Y7XA 2AFQB 1FPCH 1NT1A 2WINI 4FXGH 1FXYA 1S5SA 1TMTH 2VIOA 3RM2H 3D49H 1PQ5A 3A85A 1C1PA 1BMLA 3TNSA 4WWYA 3W95A 4X8VH 1FAXA 1GCTC 1XMNB 3U8RH 1NM6A 1O2PA 3RXIA 1OWIA 1AUTC 1UMAH 1OP8A 1HBTH 4H6TA 3TK5A 1AN1E 3KYFA 2ZDLA 4FUCA 2V3MA 1INCA 2PR3A 4NSVA 1EB2A 2J34A 1ANBA 2HVYB 1JXPA 1O2HA 2ZCKP 5F03A 1C2LA 3F9EA 1BTPA 1BHXB 2ZF0H 4JYVH 3SGQE 1CT4E 3H5CB 1QQ4A 1XKAC 5KECA 1FONA 5FCRA 5E2OA 4TY7A 1GJ6A 2ZP0H 1C5SA 1GJDB 5FX6A 4AOQA 2JH5D 2O8TA 2VIQA 4HI3A 2Z9JA 3VEQB 4KGAA 4GCHF 2ZDVH 3EYDA 2P3TB 3SU1A 5E0JA 2WV4A 1QIXB 4DIIH 1Y5UT 1ZMNA 1DOJA 1XUGA 9LPRA 1AE8H 3B23B 3M61U 3MYWA 3SUEA 5I46H 1QRXA 3GDVA 1T8OA 3NK8A 4MPUA 1TOMH 2WPDD 1SGQE 2KCPA 4IC6A 1DE7H 4Y6DA 2AMDA 2ZTXA 1FN6A 2BDHA 4NZQA 1MU6B 4LOYH 4B76A 4MTBA 1ORFA 4OS2A 1LTOA 2UWOA 1HXFH 2Y5GA 1E0FD 2FOCA 2GDDA 1O5CB 2JH6D 3NZIA 4ZHAA 3PLBA 3ZZDA 2PKSC 1BT7A 3ZVFA 1ZPZA 1F0UA 2J92A 1T8LA 1ZHPA 3SJ8A 1G9IE 3U28C 2VJ1A 1PQ7A 1AI8H 3E90B 3PWBA 1P11E 2W6JD 2ZHWH 3T25A 1JOUB 1YC0A 5EW2H 3MWIU 3STIA 1QB1A 1SLVB 1EAIA 2RCEA 3NWUA 3P8NA 2FEQH 1AQ7A 1GMCF 2J9NA 2PV9B 4J2YB 2A45B 2K0QA 1FUJA 4XSKU 2ZHQH 1DT2A 1HAOH 4Y7AA 1O2XA 5FAHA 5JDUB 2JIZD 3A8DA 4GVUA 2HLCA 4OS4A 5DJ7A 1IQNA 1BA8B 1YPJH 4K60A 3CENA 1C5UA 1P05A 4SGBE 4Q7XA 1ETRH 1HV7A 1YWUA 2DE9A 2LP6A 1C5PA 1M9UA 2ZI2H 4A92A 1S81A 3ODFA 2A2XH 3QZQA 3SUDA 1GJ7B 1NFWA 2J98A 1VCQA 5L2ZH 1HAHH 1QBNA 2O8MA 4BTTB 5ESBA 1EPTA 1G2LA 8GCHG 4IMZA 1ANDA 4FVDA 1F5KU 1Z6JH 1K0HA 2V7QD 1SR5C 1SGIB 3O8RA 3RMMH 4X6OA 3SHCH 6GCHF 3OY5U 4I8LA 2VGCB 2XRCA 5GXPA 1NRPH 4LZ4B 4NSYA 5C5NA 4U2WA 3PMHB 2AMQA 1C1WH 1C5RA 1GBIA 4AG1A 4FUBA 1FAKH 1ZPBA 4IC5A 1SQTA 2GTBA 2ZU1A 2QCYA 2F4LA 5TJXA 1D6RA 4NGAH 4ISHH 2H5DA 1TRMA 4XOJA 3SV7A 3PRBA 2M2AA 2Q6FA 2ZFFH 2GV6A 1O2JA 4BXWA 4IW4E 1J17T 2UUFB 3LC5A 1TNIA 4DJZB 3SUGA 4Q4LA 2BDGA 1YLNA 4JK6A 1O3JA 4ACBA 5EQRA 3ZZCA 5C17A 4FUJA 3LJJA 1C1VH 1IQEA 1MTNC 2P3FH 8KME2 1GDUA 3BTWE 1H8HD 3SJIA 1BJVA 2XCNA 3GISB 1SI5H 2BDBA 3TPIZ 5IDKA 1UCYE 2STAE 1DX5M 2ZU2A 1ELAA 3M5LA 2J5UA 2P94A 1MQ5A 1QRZA 1QTFA 4RN6A 5EJLA 4K1EA 2PKAA 2ZHEH 2QN5T 1E38B 3CS0A 2A32A 3K6ZA 1CHOF 3ZVEA 1MTSA 2PUXB 1P2QA 1TLDA 2AGIX 2OQ5A 4FUGA 3TJNA 4A1VA 4I7YH 3UNRA 3S7KB 4KTCA 4ISLA 3G01A 1EJNA 1KXEA 3GCNA 3S0NA 1ESAA 4K5ZA 2BVRH 3QTOH 3QLPH 2H6MA 2HVXA 1O2KA 4KKDA 1UCYK 1AY6H 4ABIA 1K1MA 2XXLA 3PWCA 3SZNA 2FIRH 1EUFA 7GCHG 2WV5A 2ZGHA 3KGPA 1AUJA 3ZZ7A 2J38A 2OD3B 1MZDA 3T5FH 2WPHS 3RXGA 1H8ED 1UHBB 3ATWA 2GP9B 1E34B 3FN8A 4GUXA 5JBAS 1S0QA 2NWNA 4R0IA 4HG6A 2WV9A 3V7TA 1BTUA 1O5EH 2AHME 1MTWA 4B1TA 2FOGA 1S85A 4WVPE 3PTBA 3GYLB 2BY7X 1W10U 3QX5H 4TT3D 2XC5A 2AMPA 3SGAE 4Y0ZE 2W7UA 1IQFA 4JMYA 5H4IB 1Y3XA 3MHWU 2FOEA 3TJUA 3SU0A 1KXCA 4CRCA 1G36A 1GCTB 1J15A 1YPEH 1O5AB 1WUNH 2A1DB 3UR6A 4ABAA 4MDSA 3LC3A 1TGNA 2C8YB 4MNWA 1TBQH 1W2KH 5GJ4B 4ZCNA 3BEIB 3SNBA 2ZGBH 1ZJKA 2ZU4A 2OCVB 2F9OA 1DY8A 1TMUH 5A8YA 1BDAA 2WYGA 1SGYE 1JRTA 2VIPA 3UY9A 1TRYA 3SNAA 3N7EA 5E0HA 2KCAA 3SUFA 2JETC 1ZOMA 2BM2A 1FY8E 4BXSA 1BRAA 2VINA 1VJ9U 2L74A 1A3BH 1O3EA 2BTCE 1GBJA 4XD7D 3TIUA 1KYNA 1P02A 1V6DA 2YMSC 2ZWLH 1RGQA 5HMAA 3TGJE 1DXWA 3O8DA 1LKBA 3BTEE 3HK3B 3U69H 4UD9H 1HAVA 5FHTA 2KFWA 5AFYH 1C2DA 1SGFG 4B2CA 3A7ZA 3ZV9A 1LVOA 2AERH 3RXRA 1V2LT 1J8AA 1YPMH 1YCPK 4CRFA 1CA8B 1GI3A 1E1RD 4OS7A 2H9TH 1ZPCA 4LXBH 2G4TA 3AVZA 2AGEX 1UVPA 2A4GA 4GPGA 1IHSH 1MD7A 1BMFD 1DUEA 3A8CA 1L1JA 3HGPA 3IWMA 2SGEE 2GCHG 3WWBA 1FJSA 4PROA 1MAXA 1V2VT 4IMQA 4BNRA 1KDQA 1TMBH 2A7JA 1W0YH 3ZVDA 2QAAA 1D3QB 4MVNA 2R3YA 3K9XB 1GMHG 1H9HE 1LPKB 2CK3D 2XYAA 3A86A 3M7QA 1DDJA 3LU9B 3RM0H 3A81A 4YLUA 2XOKD 4X1NU 2YMSD 2ZKSA 2PKSB 3QDZB 2ZDKA 4ZH8A 4FUHA 2HNTF 1Z71A 4NA7A 3GY4A 5FBIA 3M35A 1GBFA 2Y80A 1O35A 1DICA 4CRBA 1TPOA 1K28D 1WDIA 3V13A 4E7NA 1A1RA 3BTDE 3E6PH 3TGKE 4ZROA 1W3CA 2C8WB 2PUQH 4DURA 3UOPA 2A7HA 5B6LA 4WJG2 2SGPE 1MKXK 1Y3VA 1O36A 3GCTF 1C5YB 1ARCA 1CA0C 2OLGA 3BTTE 1HAPH 1B0EA 1N1LA 4DVAU 1K9OE 4AX9H 1SQOA 5DP3A 4HZHA 1GVKB 3KIDU 2GZ9A 4OS1A 2VWOA 5BPEA 4UFEH 2V3HH 4ZHMU 4MPVA 5GCHF 1GDNA 2KCYA 3SN8A 5C0TA 3Q3XA 2P59A 2KR7A 3UPEA 3RMOH 3ODDA 3NKKA 3D62A 1O3OA 4O3TA 1P10A 4F55A 4UONA 1BRCE 4Y71A 2BOKA 1W7GH 3SJKA 2G55A 1KMHB 1IQLA 1K1JA 1ZMJA 2KZ4A 1GHWH 1V2PT 1Q31A 4Z1MD 2OP9A 5HIYA 2ZCLP 2XBXA 4INLA 4YT7H 3MO3A 1BJUA 1A61H 3LH1A 1K1OA 1GHAF 2BD3A 5EJZA 1MBQA 3ZZ3A 2C8XB 2YNBA 5HM2A 5K0HA 5CHAC 4AYYB 1VCWA 1E36B 4P02A 2XNDD 3A7VA 3A7YA 4FU7A 3TK6A 3ZVCA 4AG2A 2HPQH 4D76A 4RKJB 4CBNA 3URCA 5DGJA 2WUBA 3O8BA 4Y79A 1S84A 3FZDA 1ELFA 1F7ZA 4AFZA 1DSUA 4MPXA 5C20A 2XWBI 2IN2A 2A4OA 1GBLA 1WCZA 5DP5A 2CF9H 3U8OH 1PQ8A 1CT2E 3NCLA 1FV9A 3DD2H 1OP0A 3LGTA 3BIVH 4DW2U 1JIMA 4NWKA 1HLTH 1TBRH 1TONA 3SNDA 3KEEA 1CO7E 3GY6A 1MTNB 4MQAA 3F0OA 1QA7A 3M37A 2UUJB 2W3IA 3F9GA 2W3KA 3PO1C 1C5NH 3BTFE 1EP6A 1GHYH 2FWWA 2QA9E 3JZ1B 1C1UH 2ZGJA 1SOTA 4Q80A 1SGDE 3RDZA 1HAYB 3H09A 5LH8A 4U32A 1WTGH 5FBEA 2QY0B 3PROA 2HPPH 5J4QA 1GHZA 3RP2A 1HJ9A 1NRRH 3QGJA 1OSSA 2Z3CA 1B5GH 3A8AA 4THNH 2F9BH 2H9HA 4AC9A 2QYIA 1QL7A 2F9NA 2WPKS 2Y81A 1O3PB 1GDQA 1C4Y2 1ESTA 3RC5A 4JZEH 2O8WA 4FOUC 1ESBA 1GI8B 3VPKA 3ATIA 3BSQA 1G3DA 2BDYA 3K6YA 3Q3KA 1HAGE 1O2RA 1ID5H 3OTJE 1GHBG 1YKTA 2A0QB 1OKXA 1C2IA 4TSFD 2F91A 1SGEE 1UTJA 4A1TA 3URDA 2XBYA 3VXFH 5FPYA 1GI2A 3RXSA 4BAHB 1P9UA 2WZQA 4XBCA 4ABDA 2VWNA 1LVBA 4TWWA 1CBWC 2VBCA 4X2WA 1YF4A 3OE7D 5LPRA 1JMOH 1UJ1A 5TCAA 1YP9A 3SI3H 3MNBA 3R3GB 2D26C 2Z9LA 5CMXH 1TNLA 2BB4A 3EE0B 3SI4H 3EA7A 1EPTC 1ARBA 5JBCS 3GY8A 2XCFA 1OWDA 1SC8U 2BDAA 2QGRA 2WHXA 1YYY1 5FCKA 1DUAA 3NPSA 2BLOA 1SQAA 2VNTA 1ZGVA 1OOKB 4E7RG 1L4DA 1ELEE 2ANKH 1LHGH 1P3EA 3OYPA 1FIZA 2JETB 3QWCH 2QXJA 2Z94A 3LOXA 2RA3A 4ABJA 1PQAA 2KCOA 2ZDNA 2B7DH 2GZ8A 1BQYA 2QF0A 1CQQA 1O3LA 3ZZAA 1V2MT 1J9CH 1JIRA 2ODYB 4J1YA 3EE7A 5AHGH 1TGSZ 2YMSB 1TIOA 1OWKA 1TE0A 3BTME 3DUXH 5GWZA 1D3TB 1C5OH 1TX6A 1CVWH 3KCGH 5FX5A 4ISNA 1BTYA 3SORA 1O5BB 1FX0B 2TRMA 3WWFA 3SU5A 2K1QA 3FFGA 4DT4A 4SGAE 2A4QA 4GHTA 3LT3A 2G5NA 2FDAA 2V6NA 1YPHE 3SV8A 1EB1H 1OP2A 2PGQB 3QK1A 3S9CA 1EOLA 1QBVH 1F5RA 2TPIZ 1SGTA 4YT6H 4YO9A 2BHGA 1FMGA 3PRDA 1HB0B 3RU4D 4BAQB 4DY7B 2FX6A 5GNDA 3SOSA 3W1EA 2OXSA 2B9LA 2FX4A 3E1XB 3RXCA 1A5HA 3M36A 4JYTA 1XKBC 2LELA 1QB6A 1DPOA 1BBRE 7KMEH 1QRWA 3KF2A 4X8UH 1NFUA 5FL7D 2C8ZB 4ZMAH 1RIWC 2GCTC 1GI7B 3ENSB 1LO6A 3HPTB 1CE5A 3I78A 3OTPA 1FY1A 2G81E 2A5IA 4AYVB 5EXMA 4B2BA 3GY3A 2AH4X 5AVDA 3SW2B 3P17H 3ATLA 3C1KA 3TH4H 2STBE 2EI6A 4NA9H 1Z8IB 1O2TA 3SQHE 5EODA 1IQIA 1EFRD 2IPHA 1O3AA 1S83A 2BY9X 1HCGA 2HNTC 3KN2A 5GPIB 4D9QA 4XBDA 3TH3H 2FOFA 8GCHF 1CA0B 2ZQ1A 1LPGB 5EJ1A 1DSTA 5HM9A 3MU0A 3GDUA 1BBRK 5JPMH 1E37B 1P12E 1PPGE 4GHQA 2Y5FA 1GBMA 3AASA 3F6UH 1ACBE 2ZQ2A 2FMJA 2FI3E 4RT1A 4D7GA 5IK2D 2AIPA 1W8BH 1CGJE 4JZFH 2D1JA 3PMAB 3RXPA 2QF3A 3OEED 1THRH 5EIYA 3MH7A 2R3UA 2KAIA 1TPAE 1C1SA 4K2YA 3SNCA 5C1UA 3E3TA 1T31A 1O2SA 4Y10E 1S0RA 1OWHA 2J94A 5DK1A 2R0KA 1MKWH 2G52A 4HFPB 4K8YA 1LPZB 3EA9A 4CBOA 1IQJA 4XDEA 2TGTA 4DG4A 4B74A 3RMLH 5CHAB 1T8NA 2CGAA 2IJD1 2FESH 5JBTA 1GBTA 1O2VA 1IQGA 2FOBA 1FQ3A 3GYMA 1BCUH 1ABIH 1AFEH 3ZVGA 2ILNA 1SG8B 1SGFA 2XWAA 2Y82A 3UQOA 1G37A 2ZCHP 4B73A 1BUIA 1EAUA 3MH4A 2UWLA 1V2TT 3RUOA 1EZSC 3ZIAD 3ZZ6A 1N6XA 4ABHA 1TX8A 1NROH 4MG3A 1HFDA 4KTUA 5HXFA 1EJMA 3E0NB 1BTZA 1K1IA 1SHYA 1ZJDA 2GZ7A 1AD8H 2BY8X 2B0FA 1O3HA 1H4WA 1SPJA 2FLBH 2FYQA 1XM1A 3UNQA 2Q1JA 3UQVA 3BG8A 4DGJA 2Z6BD 2O8LA 4FUDA 5K7RA 2BQ7B 5JB8S 1C2KA 2DE8A 7GCHF 3W94A 1ANEA 3MI4A 3ZZBA 2QC2A 1UTQA 2SGFE 4HGCA 1GI5A 1K1PA 1OXGA 3HK6B 2ESTE 1GI6A 6ESTA 1EZUC 3S7HB 1GVZA 1P03A 1HIAA 3KQ5A 5C3NA 1SSXA 3ELAH 2RA0A 3L3TA 2ULLA 2Z3EA 3MO9A 1LVYA 1QJ7B 1VR1H 4AORA 4MNVA 1O2UA 3OU0A 2JH0D 3P8OA 2HOBA 4R8TB 6LPRA 1D3PB 4YOGA 2SFAA 5C2ZA 1VITG 1UTMA 3DT0H 3DSOA 1QHRB 1P2OA 1O3FA 1LDTT 2Z9KA 1NESE 3KQCA 3GDSA 2ZGXH 3ZVAA 1OPHB 4XRNA 1WTHD 4ASHA 3BIUH 3D65E 2XC0A 1H9LB 2BY5X 1MZAA 1C1TA 2BX4A 1H8IH 2I6QA 1S6LA 3PV4A 5A0CA 2OINA 1AVXA 3LGIA 1CBWB 1PPZA 1PPBH 1BZXE 1CGHA 2QXGA 1HGTH 1FLEE 3ZZ8A 3MH5A 1GVLA 4VGCC 2VIWA 1O39A 1A0HB 1EZXC 1G30B 1V2OT 1YLCA 1WV7H 2OC0A 2DUCA 2SGAA 1YM0A 1SVPA 2J98B 1YPHC 1O38A 3SNEA 3HGNA 2OUAA 1EPTB 2ZFSA 1FZZA 1KTTB 1MABB 3UOUA 1L1GA 1UK2A 2GX4A 4LK4A 3E91A 2V3OH 1O34A 4I33A 1MCTA 1O2OA 8LPRA 1DFPA 3RXVA 4HTCH 1D6WA 1UVSH 4O3UA 1MAYA 4X1SU 3LJOA 1TNGA 2UWPA 4X8SH 2FXRA 1NTPA 1YY3A 1CSOE 2BZAA 1A4WH 1KSNA 1A0JA 2GCHF 1THSH 1EJAA 1GPZA 2FZZA 3KHVA 1K1LA 1AMHA 3DFLA 4M7GA 3OFND 1O2YA 3CNRA 1UTKA 4ASUD 2ZNKH 2G5VA 2R9PA 1RS0A 5DO4H 3WW7A 1GMHF 4FVBA 4Q7ZA 1C1NA 3F9HA 4O9VA 5T6FA 3LGVA 2Q6GA 2G00A 1L0ZA 4NIYA 4BANB 1TNHA 1KXAA 2ANYA 1LHFH 4X2XA 1F0RA 5DP8A 2OBQA 3VB5A 1S6HA 1Z7KA 1H8DH 4ZXXH 1F5LA 2R2WU 3MU8A 4Y8YA 4X6MA 1C1QA 2BD8A 3PMBB 4MNYA 3T2NA 1COWD 1P2JA 3M5NA 2PKAB 2H1UA 1GG6C 2ZPSA 1W11U 3S9AA 3Q3YA 1Z1JA 1P01A 4OGYA 3FKSD 3M3VA 4K8BA 5KEDA 3UUZA 4IN2A 3KQEA 4FUFA 2Q6DA 5EPNA 1RIWB 2ZFPH 2GCTB 2BVXH 3R0FA 4UDWH 3TNTA 4YM9A 5A09A 1C5TA 3RXJA 3EDXB 1HRTH 2FOAA 1ZZZA 2XC4A 3FZZA 3A84A 2Z7FE 1IHTH 2Y5HA 3F0PA 1PFXC 4F49A 4DIHH 3RU4E 3EQ0H 2Y7ZA 3ZVBA 1O3MA 1DVAH 1BTWA 1QL9A 1C1RA 1UTNA 2CV3A 2CJIA 3UREA 2BD9A 2BXTH 2JKHA 3BEFB 3OSYA 3LONA 3PTNA 2IOTA 1RTLA 1O2NA 2ZC9H 2ZTZA 2ZHFH 1C5LH 3GY2A 2QF4A 1FY5A 1LHCH 1XUKA 3A7XA 1O2MA 5DP4A 2CN0H 4I86A 4NIVA 1NU9A 3H7OA 4A7IB 1AO5A 1W13U 1EKBB 3DFJA 4NFEA 2BQ6B 4YTAA 5F6MA 3SQEE 2J97A 2BD2A 2OC1A 1GJBB 3RXLA 4OM9A 1QZ8A 1AKSA 2Z9GA 3MFJA 2R0LA 3PLPA 1Y5BT 5C1YA 2I6SA 1TQ0B 5EGMA 3SU3A 4BTUB 4I31A 2PWXA 1HUTH 4WMEA 1DLKB 1AVWA 4ESTE 3LIWA 1Y3YA 1P06A 1SGPE 1WAYB 3T26A 4Q2KA 1MD8A 1GBDA 1SLWB 2F43B 1AFQC 2NU1E 2PSXA 5F8TA 2BD7A 2ZECA 1SFQB 1E79D 1L1NA 1SGCA 1ZR0A 1OX1A 3MH6A 1QR3E 5JB9S 2QXIA 1SMFE 1ELBA 1AGJA 1RD3B 3FANA 3U8TH 4ZXYH 1NU7B 4JYUH 1GJ5H 2ANMH 3T29A 4NCYA 1HAVB 2BLQA 4CRGA 3GY5A 1O3CA 1E35B 3E8LA 1ZSKA 1Y3WA 2RFKC 1RXPA 1J16A 4KELA 1LHDH 1BITA 1P2KA 3ITIA 1MTVA 2HNTE 3UR9A 5PTPA 1C4V2 1D9IA 2BMGB 5I25A 2BX3A 1HAXB 1W12U 3NXPA 4H42U 5DN6D 1Z6EA 2ZA5A 3VG8A 1P3CA 2SNVA 1KDQB 3ZYEA 1W0JD 1O32A 1GHBF 2FM2A 1ZHRA 2C93B 3RXBA 3ZZ4A 3A89A 4Q63A 1O5DH 3E0PB 2A7CA 3PLKA 1H1BA 4X2VA 1Z1IA 5DG6A 3LGYA 5FPSA 1C5MD 2CXVA 5E8EH 1OHHD 1T7CA 3RXDA 1FN8A 2PLXA 4O97A 1C2MA 1WQVH 1DWCH 4TWYA 1EAWA 1AVGH 1N8OC 3C27B 3BTQE 4RI0A 2O8UA 5C67A 2OTVA 3M7UA 1ZYOA 3T28A 2VH0A 4B2AA 5E0GA 3VB7A 2CMYA 2F3CE 1HYLA 2BXUH 2Y6TA 1C2EA 4AFSA 5EW1H 2PFEA 1O2QA 1BRBE 4CRDA 2WYJA 1N6YA 1AZZA 1JRSA 2QXHA 1EX3A 3OEHD 4BAOB 4UE7H 1GL1A 3P70B 1NRSH 1X7AC 1BRUP 2EQNA 1DXPA 5HIZA 2ZFTA 2FOHA 1RFNA 4I8JA 2OC8A 5DP7A 4RKOB 1YBWA 2GJGA 2OBOA 3PV2A 3MNSA 2YNAA 2ZPRA 1S6FA 2G8TA 4VGCB 5SGAE 1T4VH 3F1SB 3RXQA 3KYGA 2G4UA 3OX7U 3GCHC 3TVJB 2XTTB 1BB0B 1AIXH 1GWAA 2IPQX 1P09A 4X1PU 3K2UA 1C2FA 3UFAA 1O37A 1VGCC 5DP9A 3MU1A 3SZEA 1RTFB 2W6ID 4FUEA 2GMTC 5DSFA 1O3DA 4X0WU 3UWIA 1Z8JB 6CHAC 2WUCA 5B6OA 3LGUA 1PPCE 3FP7E 1T4UH 3VGCC 4BAMB 2VVVA 1FI8A 4MNXA 2FO9A 5FXLA 1QGFA 1YPGH 5C0UA 3MMGA 1YPLH 3FP6E 4O03A 3O8CA 1H9IE 2VWLA 2D2DA 2UUYA 3MQKC 5ETXA 1NS3A 1TPSA 8ESTE 4UEHH 1C5XB 1A3EH 1G3EA 1GI9B 1K21H 4KTSA 2V0BA 1OS8A 4IN1A 3A80A 3B8JA 2GKVE 1TOCB 4Y76A 3SHAH 1F2SE 2BY6X 1C9PA 4P00A 2ODQA 1A0LA 2FOMB 2ZFQH 4FU9A 3SV9A 1QCPA 3UTUH 1A2CH 1QA0A 2CF8H 4X1QU 5EG4A 3QZRA 1GMDG 1EATA 2BQWB 1GG6B 4AGKA 3U1JB 1IAUA 5A0BA 4OS6A 3SGBE 5CHBA 3BTHE 1P2IA 1Z8RA 3F2HA 2L6OA 4GSOA 3RXFA 3WY8A 1ZLRA 1BHXF 1Y59T 2P93A 4NA8A 5T6GA 4I32A 2H2ZA 1YCPM 5EPYA 3IG6B 4B6EA 2RDEA 1DM4B 4Z6AH 4WH6A 1HXEH 3A7WA 3BEUA 1QURH 3A82A 1LKAA 3U98H 3KQDA 3ZYDA 1O2IA 1V2UT 5HGGA 4X8TH 1NBMD 5EXNA 2AYWA 3FVFB 1YGCH 1XX9A 4KP0A 5T6DA 1L4ZA 3U1IB 1DANH 1HNEE 5GIBA 4X2YA 3SYJA 1TABE 1AWHB 1MMJN 1TQ7B 1ABJH 3CP7A 4ABEA 3SU6A 2W7SA 4CHAC 2BDCA 1GGDC 4MLFB 1PPHE 5LGOA 1FNIA 1YPKH 2F9VA 2JJ2D 1NFYA 1IOEA 1RTKA 4K69A 2ALPA 5T3HA 3F2GA 1LQDB 2ASUB 1KTSB 1FDPA 5E2PA 1C2JA 1QY6A 5IYTA 1AB9C 1IQKA 2B8OH 4OS5A 3AAVA 1EXFA 1ELGA 1UK3A 2K8IA 4F4OC 2FI4E 2OC7A 1XXDA 1W0KD 1NO9H 3HKJB 2JDID 2VB0A 2EI7A 3LGWA 3I77A 1XXFA 1MUEB 4U01A 3MTYA 2XBVA 3A88A 5C5OA 3RLWH 3ATKA 4GCHG 1DITH 1AFQB 5F8ZA 1C4U2 1C9TA 2Z3DA 2WPJS 1DS2E 5T1VA 2NU3E 1DY9A 3LDXH 1F0SA 2ZFRH 1GCDA 2PGBB 1DLEA 4AB9A 1P2NA 1UCYH 4DOQA 1E1QD 2HRVA 4LZ1H 2R2MB 3RC6A 1TWXB 3UAIC 3GICB 3PMJA 5F53A 1V2NT 3A87A 1PPFE 3RXAA 3N7OA 1TFXA 4U30A 1O3IA 4INHA 1MBMA 4CH2B 1ELVA 3PV5A 4K1TA 3A83A 1SOZA 4E06H 1G2MA 4TPIZ 5ABWA 1WQSA 2FI5E 3PYHA 4ZHLU 2ZG0H 1VITH 1RJXB 3RMNH 4CR5A 2FS8A 1AU8A 2ZGCA 2EC9H 1MH0A 1T32A 1UHBA 3GY7A 3MU4A 1JWTA 3TJOA 1TALA 1VITF 3RLYH 1WXRA 2P8OC 4H4FA 2ZPQA 1B7XB 1PJPA 5F8XA 3M3TA 5HYOA 2BZ6H 5DPAA 1GBHA 2TGDA 2EY4C 1HJ8A 3QO6A 3Q76A 2A31A 1KLTA 3STJA 7LPRA 4NFFA 1GJ8B 4B75A 4I8KA 3PO1B 4A5TS 1G3CA 2C90B 3UNSA 1GMCG 3F2FA 4WH8A 1QL8A 5J4SA 2SGQE 4WMDA 4INKA 1N8OB 3A7TA 2RDLA 5L30H 3AK5A 1QQUA 4K3JA 1LVMA 1NRQH 5JBBS 2W5EA 2V35A 3RC4A 3DSGA 2A2QH 2PTCE 2EI8A 2YOLA 3RXOA 2QIQA 1EZQA 1XUJA 4ZKRU 2ANWA 1QBOA 2GT7A 1NC6A 4CREA 4I8GA 1FY4A 3PM3A 1VKYA 3TU7H 2ZIQH 3V12A 3AAUA 3DHKH 4WY3A 4YXWD 4NIXA 1V2QT 3MOCA 3BF6H 2VIVA 1YCPH 1A7SA 2OK5A 1TGCA 2AEIH 2SGDE 4NWLA 2AS9A 3GCHB 5L6NH 1UVTH 3SV2H 1PPEE 6GCHG 4GLYA 1THPB 4JZ1A 2GV7A 2F9PA 2KAIB 2UUKB 3BG4C 2G51A 2ZO3H 3VFEA 3RXMA 3AW0A 1GBKA 3GS9A 1L2EA 2TIOA 2EEKA 4RT0A 1GJAB 1VGCB 4UFGH 1TRNA 1GL0E 3M5MA 3M3SA 1HJAC 5C94A 3DSPA 2GMTB 4AB8A 1AE5A 3EAJA 3ZZ9A 3OAAD 5AF9H 3UB0A 6CHAB 1C5QA 5ESTE 2XNIA 4Z0KA 4JK5A 5EXLA 3VGCB 2H5CA 3HKIB 2CHAC 1MKWK 1QJ1B 1UW7A 3B9FH 4CRAA 3VXEH 1TYNA 4IGDA 2FPZA 4AGJA 3SV6A 2WPMS 2PW8H 2VH6A 1MQ6A 1NY22 5CDFE 1GI1A 1C5ZB 1HDTH 1JBUH 1UTLM 1A5GH 1QFKH 1S82A 1AHTH 3VB3A 1ZGIA 1G32B 4DCDA 1MKXH 1YLDA 4D9RA 3RU4T 3T27A 1SLUB 1O5GH 1OWJA 1ELCA 3UWJH 1KXDA 3RXKA 3ZZ5A 1SGNE 2ZU3A 5KGOA 3OY6U 7ESTE 1ZSJA 3P95A 3VB4A 1KXBA 1CGIE 5HKKD 1CHOG 1O31A 3QTVH 3MNXA 1C2GA 1V2WT 4B6FA 2KM0A 1P9SA 3P8FA 3TLOA 1V2RT 5LPFA 1ZHMA 3V0XA 2VU8E 4Q7YA 2AIQA 1SKYE 2VWMA 3M7TA 1NPMA 1UTOA 4H6SB 1K1NA 1ZMLA 3EGKH 2P16A 3AW1A 2ALVA 3BV9B 1Q2WA 2D8WA 2BLWA 1GJ9B 3K65B 4YLQH 3D23A 4FUIA 4ZAEA 5JYIA 4ZKSU 1VJAU 3SU4A 1NZQH 2BLVA 3LPRA 1HAIH 1LQEA 2JJ1D 1XUHA 1HIAB 3Q77A 3RXUA 5G4BA 3N99A 4WMFA 4DT7B 1ANCA 4UFFH 2ZHDA 3KL6A 2FYRA 3UIRA 1EASA 2RG3A 4A1XA 1GHXH 3BTKE 4A6LA 4ABFA 3JZ2B 3L33A 1DWEH 1UTPA 4UFDH 3SJOA 2PSYA 1ELTA 2A5AA 2O9QA 1KY9A 1ZTKA 1FPHH 1O2GH 3FAOA 3NUMA 1HPGA 3SBKA 1PYTC
chains in the Genus database with same CATH topology
5L2YH 4IS5A 2ODPA 3P92A 5LPEA 3M5OA 2HALA 4AFUA 2IJOB 4CHAB 1GGDB 4Y0YE 4BOHA 1O3NA 2FS9A 2GVFA 1W0ZU 1QNJA 2J2UA 1SL3A 2GDEH 4Y11E 1QB9A 2NU0E 1T8MA 1QJ6B 4IBLH 1NFXA 1SLXB 2J95A 1XUFA 4CR9A 2GT8A 2M5TA 3GCOA 1W14U 2FTMA 1IQMA 1AB9B 1D4PB 1TA2A 2BOHB 1Y8TA 2ZDAH 3TJVA 1W7XH 3PB1E 2PTNA 3BN9A 1AZ8A 1O33A 4AZ2B 1O2WA 4ZUHA 1XVOA 1K2I1 3BTGE 5A8XA 1ZRKA 1MTUA 1P57B 4X6PA 4JZIA 2C4FH 4NIWA 4TY6A 3KQBA 2BDIA 1PYTD 1LMWB 4I8HA 3RXTA 2WPIS 1D3DB 5C1XA 1P0SH 3ZV8A 3A8BA 4ISOA 2NU4E 3LKWA 1MCVA 4X6NA 5EOKA 4YOJA 1NRNH 2LPRA 3P6ZB 3S69A 2GD4B 1WU1A 9ESTA 2BD4A 4Y7BA 2TBSA 5A2MH 1TNKA 3TH2H 1TB6H 1KIGH 1NN6A 3F68H 1VZQH 2XBWA 1Y5AT 1TBZH 1WYKA 1AWFH 1IQHA 1TAWA 1TNJA 3GOVB 2VVUA 4WF8A 4BAKB 1GBEA 2AGGX 1BMMH 3T62A 1K22H 2TGAA 2B5TB 1FIWA 1GI4A 1MU8B 1SFIA 2VIDA 5GDSH 2OQUA 1UO6A 1O5FH 1ETTH 2P95A 1GBBA 2HGTH 1KLIH 5A0AE 3I29A 2NU2E 2H9EH 4MPWA 3L6PA 1LCYA 4YZUA 2EA3A 1P8VC 3TITA 4XBBA 1C2HA 1GBAA 1UVUH 2F9UA 2F83A 2P8OB 4YESB 1OYTH 4WXIA 5A8ZA 1EAXA 1V3XA 3DA9B 2PHBA 2VVCA 3TGIE 3QN7A 1KXFA 1C1OA 1GJ4H 1EP5A 1OYQA 1ETSH 3Q00A 1GBCA 3QUMP 3U9AH 4JZDH 4D8NA 3VB6A 2ZZUH 1SBWA 2GGVB 1TGTA 2FTLE 3GCTG 4GAWA 1F0TA 1TX7A 4JCNA 1P2MA 3ESTA 4FU8A 1UVOA 1BTXA 4OGXA 2J4IA 2VGCC 3TK9A 1WSSH 4K1SA 1OWEA 1V2KT 5EQSA 5FPTA 3F9FA 2ZTYA 3SO3A 1RRKA 1EOJA 1XVMA 3MU5A 5GCHG 1TA6A 3MO6A 1O3KA 1Q3XA 4ZKNU 4ABBA 3HATH 1BTHH 1J14A 1O30A 1B0FA 2QV1A 4X1RU 2FODA 1DWBH 2TGPZ 4NG9H 2A5KA 3FP8E 4ISIH 3MNCA 1WOFA 3SJ9A 1CT0E 5TCCA 4Y8XA 3QGNB 2BD5A 4NZLA 1GHVH 4B71A 1AKSB 1ZTJA 5DKMA 4D7FA 2XW9A 1ZTLA 3EA8A 4Y8ZA 1CHGA 1TPPA 1C5WB 1SHHB 4RSPA 1XUIA 1GHAG 3BG4B 1EQ9A 2BVSH 2THFB 4CH8B 1BOQA 3RXEA 1V2ST 5EU8A 1CU1A 5BRRE 3E16B 2WPLS 4TPYA 3H7TA 2ZU5A 4WXVA 1TGBA 2Z9IA 2FP7B 1C1MA 3V3MA 1HJAB 4TYDA 1ZRBA 1O3BA 3S9BA 1A5IA 3IITA 1WBGB 4BTIB 2CHAB 2BYAX 4E05H 1HAZB 1GJCB 4ZKOU 1O2LA 4ABGA 2LNCA 1GMDF 1DWDH 2SNWA 1BMNH 2P3UB 2HWLB 4AFQA 4XE4A 5DP6A 1F92A 1C5VA 3RXHA 1P04A 1U6QA 5AFZH 1VCPA 4AN7A 3ATMA 1SB1H 1LHEH 1FY3A 1BBRH 3SU2A 1UK4A 3LH3A 1O0DH 1A46H 1ELDE 1GI0A 1O3GA 3KNXA 5CE1A 2ZDMA 4QT8C 3CS7A 1Y3UA 2FLRH 2A4RA 2ZEBA 1ZSLA 1BIOA 1O2ZA 1Z8GA 1KLJH 5EQQA 2C3SA 2W26A 3P8GA 1V2JT 4XFQA 4YOIA 1SGRE 1BMAA 1G3BA 2Y7XA 2AFQB 1FPCH 1NT1A 2WINI 4FXGH 1FXYA 1S5SA 1TMTH 2VIOA 3RM2H 3D49H 1PQ5A 3A85A 1C1PA 1BMLA 3TNSA 4WWYA 3W95A 4X8VH 1FAXA 1GCTC 1XMNB 3U8RH 1NM6A 1O2PA 3RXIA 1OWIA 1AUTC 1UMAH 1OP8A 1HBTH 4H6TA 3TK5A 1AN1E 2ZDLA 4FUCA 1INCA 2PR3A 4NSVA 1EB2A 2J34A 1ANBA 1JXPA 1O2HA 2ZCKP 5F03A 1C2LA 3F9EA 1BTPA 1BHXB 2ZF0H 4JYVH 3SGQE 1CT4E 3H5CB 1QQ4A 1XKAC 1FONA 5FCRA 5E2OA 4TY7A 1GJ6A 2ZP0H 1C5SA 1GJDB 5FX6A 4AOQA 2JH5D 2O8TA 2VIQA 4HI3A 2Z9JA 3VEQB 4KGAA 4GCHF 2ZDVH 3EYDA 2P3TB 3SU1A 5E0JA 2WV4A 1QIXB 4DIIH 1Y5UT 1ZMNA 1DOJA 1XUGA 9LPRA 1AE8H 3B23B 3M61U 3MYWA 3SUEA 5I46H 1QRXA 3GDVA 1T8OA 3NK8A 4MPUA 1TOMH 1SGQE 4IC6A 1DE7H 4Y6DA 2AMDA 2ZTXA 1FN6A 2BDHA 4NZQA 1MU6B 4LOYH 4B76A 4MTBA 1ORFA 4OS2A 1LTOA 2UWOA 1HXFH 2Y5GA 1E0FD 2FOCA 2GDDA 1O5CB 2JH6D 3NZIA 4ZHAA 3PLBA 3ZZDA 2PKSC 1BT7A 3ZVFA 1ZPZA 1F0UA 2J92A 1T8LA 1ZHPA 3SJ8A 1G9IE 2VJ1A 1PQ7A 1AI8H 3E90B 3PWBA 1P11E 2ZHWH 3T25A 1JOUB 1YC0A 5EW2H 3MWIU 3STIA 1QB1A 1SLVB 1EAIA 2RCEA 3NWUA 3P8NA 2FEQH 1AQ7A 1GMCF 2J9NA 2PV9B 4J2YB 2A45B 1FUJA 4XSKU 2ZHQH 1DT2A 1HAOH 4Y7AA 1O2XA 5FAHA 5JDUB 3A8DA 4GVUA 2HLCA 4OS4A 5DJ7A 1IQNA 1BA8B 1YPJH 4K60A 3CENA 1C5UA 1P05A 4SGBE 4Q7XA 1ETRH 1HV7A 2DE9A 1C5PA 1M9UA 2ZI2H 4A92A 1S81A 3ODFA 2A2XH 3QZQA 3SUDA 1GJ7B 1NFWA 1VCQA 5L2ZH 1HAHH 1QBNA 2O8MA 4BTTB 5ESBA 1EPTA 1G2LA 8GCHG 4IMZA 1ANDA 4FVDA 1F5KU 1Z6JH 1SR5C 1SGIB 3O8RA 3RMMH 4X6OA 3SHCH 6GCHF 3OY5U 4I8LA 2VGCB 2XRCA 5GXPA 1NRPH 4LZ4B 4NSYA 5C5NA 4U2WA 3PMHB 2AMQA 1C1WH 1C5RA 1GBIA 4AG1A 4FUBA 1FAKH 1ZPBA 4IC5A 1SQTA 2GTBA 2ZU1A 2QCYA 5TJXA 1D6RA 4NGAH 4ISHH 2H5DA 1TRMA 4XOJA 3SV7A 2Q6FA 2ZFFH 2GV6A 1O2JA 4BXWA 4IW4E 1J17T 2UUFB 3LC5A 1TNIA 4DJZB 3SUGA 2BDGA 4JK6A 1O3JA 5EQRA 3ZZCA 4FUJA 3LJJA 1C1VH 1IQEA 1MTNC 2P3FH 8KME2 1GDUA 3BTWE 3SJIA 1BJVA 2XCNA 3GISB 1SI5H 2BDBA 3TPIZ 5IDKA 1UCYE 2STAE 1DX5M 2ZU2A 1ELAA 3M5LA 2P94A 1MQ5A 1QRZA 1QTFA 4RN6A 4K1EA 2PKAA 2ZHEH 2QN5T 1E38B 3CS0A 2A32A 3K6ZA 1CHOF 3ZVEA 1MTSA 2PUXB 1P2QA 1TLDA 2AGIX 2OQ5A 4FUGA 3TJNA 4A1VA 4I7YH 3UNRA 3S7KB 4KTCA 4ISLA 3G01A 1EJNA 1KXEA 3GCNA 3S0NA 1ESAA 4K5ZA 2BVRH 3QTOH 3QLPH 2H6MA 2HVXA 1O2KA 4KKDA 1UCYK 1AY6H 4ABIA 1K1MA 2XXLA 3PWCA 3SZNA 2FIRH 1EUFA 7GCHG 2WV5A 2ZGHA 3KGPA 1AUJA 3ZZ7A 2J38A 2OD3B 1MZDA 3T5FH 2WPHS 3RXGA 3ATWA 1UHBB 2GP9B 1E34B 4GUXA 5JBAS 1S0QA 2NWNA 4R0IA 3V7TA 1BTUA 1O5EH 1MTWA 4B1TA 2FOGA 1S85A 4WVPE 3PTBA 3GYLB 2BY7X 1W10U 3QX5H 2XC5A 2AMPA 3SGAE 4Y0ZE 2W7UA 1IQFA 4JMYA 5H4IB 1Y3XA 3MHWU 2FOEA 3TJUA 3SU0A 1KXCA 4CRCA 1G36A 1GCTB 1J15A 1YPEH 1O5AB 1WUNH 2A1DB 3UR6A 4ABAA 4MDSA 3LC3A 1TGNA 2C8YB 4MNWA 1TBQH 1W2KH 5GJ4B 3BEIB 3SNBA 2ZGBH 1ZJKA 2ZU4A 2OCVB 2F9OA 1DY8A 1TMUH 5A8YA 1BDAA 2WYGA 1SGYE 1JRTA 2VIPA 3UY9A 1TRYA 3SNAA 5E0HA 3SUFA 2JETC 1ZOMA 2BM2A 1FY8E 4BXSA 1BRAA 2VINA 1VJ9U 1A3BH 1O3EA 2BTCE 1GBJA 3TIUA 1KYNA 1P02A 1V6DA 2ZWLH 5HMAA 1RGQA 3TGJE 1DXWA 3O8DA 1LKBA 3BTEE 3HK3B 3U69H 4UD9H 1HAVA 5FHTA 5AFYH 1C2DA 1SGFG 4B2CA 3A7ZA 3ZV9A 1LVOA 2AERH 3RXRA 1V2LT 1J8AA 1YPMH 1YCPK 4CRFA 1CA8B 1GI3A 4OS7A 2H9TH 1ZPCA 4LXBH 2G4TA 3AVZA 2AGEX 1UVPA 2A4GA 4GPGA 1IHSH 1MD7A 1DUEA 3A8CA 1L1JA 3HGPA 3IWMA 2SGEE 2GCHG 1FJSA 4PROA 1MAXA 1V2VT 4IMQA 4BNRA 1KDQA 1TMBH 2A7JA 1W0YH 3ZVDA 2QAAA 1D3QB 4MVNA 2R3YA 3K9XB 1GMHG 1H9HE 1LPKB 2XYAA 3A86A 3M7QA 1DDJA 3LU9B 3RM0H 3A81A 4YLUA 4X1NU 2ZKSA 2PKSB 3QDZB 2ZDKA 4ZH8A 4FUHA 2HNTF 1Z71A 4NA7A 3GY4A 5FBIA 3M35A 1GBFA 2Y80A 1O35A 1DICA 4CRBA 1TPOA 1K28D 3V13A 4E7NA 1A1RA 3BTDE 3E6PH 3TGKE 4ZROA 1W3CA 2C8WB 2PUQH 4DURA 3UOPA 2A7HA 4WJG2 2SGPE 1MKXK 1Y3VA 1O36A 3GCTF 1C5YB 1ARCA 1CA0C 2OLGA 3BTTE 1HAPH 1B0EA 1N1LA 4DVAU 1K9OE 4AX9H 1SQOA 5DP3A 4HZHA 1GVKB 3KIDU 2GZ9A 4OS1A 2VWOA 5BPEA 4UFEH 2V3HH 4ZHMU 4MPVA 5GCHF 1GDNA 3SN8A 3Q3XA 2P59A 3UPEA 3RMOH 3ODDA 3NKKA 3D62A 1O3OA 4O3TA 1P10A 4UONA 1BRCE 4Y71A 2BOKA 1W7GH 3SJKA 2G55A 1IQLA 1K1JA 1ZMJA 1GHWH 1V2PT 1Q31A 2OP9A 2ZCLP 2XBXA 4INLA 4YT7H 3MO3A 1BJUA 1A61H 3LH1A 1K1OA 1GHAF 2BD3A 1MBQA 3ZZ3A 2C8XB 2YNBA 5HM2A 5K0HA 5CHAC 4AYYB 1VCWA 1E36B 3A7VA 3A7YA 4FU7A 3TK6A 3ZVCA 4AG2A 2HPQH 4D76A 4RKJB 4CBNA 3URCA 5DGJA 2WUBA 3O8BA 4Y79A 1S84A 3FZDA 1ELFA 1F7ZA 4AFZA 1DSUA 4MPXA 5C20A 2XWBI 2IN2A 2A4OA 1GBLA 1WCZA 5DP5A 2CF9H 3U8OH 1PQ8A 1CT2E 3NCLA 1FV9A 3DD2H 1OP0A 3LGTA 3BIVH 4DW2U 1JIMA 4NWKA 1HLTH 1TBRH 1TONA 3SNDA 3KEEA 1CO7E 3GY6A 1MTNB 4MQAA 1QA7A 3M37A 2UUJB 2W3IA 3F9GA 2W3KA 3PO1C 1C5NH 3BTFE 1EP6A 1GHYH 2FWWA 2QA9E 3JZ1B 1C1UH 2ZGJA 1SOTA 4Q80A 1SGDE 3RDZA 1HAYB 5LH8A 4U32A 1WTGH 5FBEA 2QY0B 3PROA 2HPPH 5J4QA 1GHZA 3RP2A 1HJ9A 1NRRH 3QGJA 1OSSA 2Z3CA 1B5GH 3A8AA 4THNH 2F9BH 2H9HA 2QYIA 1QL7A 2F9NA 2WPKS 2Y81A 1O3PB 1GDQA 1C4Y2 1ESTA 3RC5A 4JZEH 2O8WA 1ESBA 1GI8B 3VPKA 3ATIA 3BSQA 1G3DA 2BDYA 3K6YA 3Q3KA 1HAGE 1O2RA 1ID5H 3OTJE 1GHBG 1YKTA 2A0QB 1OKXA 1C2IA 2F91A 1SGEE 1UTJA 4A1TA 3URDA 2XBYA 3VXFH 5FPYA 1GI2A 3RXSA 4BAHB 1P9UA 4XBCA 4ABDA 2VWNA 1LVBA 4TWWA 1CBWC 4X2WA 1YF4A 5LPRA 1JMOH 1UJ1A 5TCAA 1YP9A 3SI3H 3MNBA 3R3GB 2D26C 2Z9LA 5CMXH 1TNLA 2BB4A 3EE0B 3SI4H 3EA7A 1EPTC 1ARBA 5JBCS 3GY8A 2XCFA 1OWDA 1SC8U 2BDAA 2QGRA 1YYY1 5FCKA 1DUAA 3NPSA 2BLOA 1SQAA 2VNTA 1ZGVA 1OOKB 4E7RG 1L4DA 1ELEE 2ANKH 1LHGH 1P3EA 3OYPA 1FIZA 2JETB 3QWCH 2QXJA 2Z94A 3LOXA 2RA3A 4ABJA 1PQAA 2ZDNA 2B7DH 2GZ8A 1BQYA 2QF0A 1CQQA 1O3LA 3ZZAA 1V2MT 1J9CH 1JIRA 2ODYB 4J1YA 5AHGH 1TGSZ 1TIOA 1OWKA 1TE0A 3BTME 3DUXH 5GWZA 1D3TB 1C5OH 1TX6A 1CVWH 3KCGH 5FX5A 4ISNA 1BTYA 3SORA 1O5BB 2TRMA 3SU5A 2K1QA 3FFGA 4SGAE 2A4QA 4GHTA 3LT3A 2G5NA 2FDAA 2V6NA 1YPHE 3SV8A 1EB1H 1OP2A 2PGQB 3QK1A 3S9CA 1EOLA 1QBVH 1F5RA 2TPIZ 1SGTA 4YT6H 4YO9A 2BHGA 1FMGA 1HB0B 3RU4D 4BAQB 4DY7B 2FX6A 3SOSA 2OXSA 2B9LA 2FX4A 3E1XB 3RXCA 1A5HA 3M36A 4JYTA 1XKBC 1QB6A 1DPOA