5JYIA

Trypsin bound with succinic acid at 1.9a
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
219
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trypsin bound with succinic acid at 1.9A
rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 53
structure length 219
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5jyiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5jyiA02
1TGSZ 2VNTA 3RMLH 5FAHA 1P3EA 1C5SA 4MPUA 1TQ7B 5EW1H 3DT0H 1UTOA 2F9VA 4ABIA 8LPRA 2KAIB 2DE9A 2PW8H 1V2OT 5EU8A 2O8UA 1GDQA 2FOAA 3VXFH 3URDA 4OS1A 3ZZAA 4BTIB 3CENA 3LH1A 1GHAF 2BY6X 2XRCA 1O3IA 1O5AB 2P59A 1O2QA 4IC5A 1EOLA 3BTTE 3A83A 4GUXA 2WPIS 4XBDA 3TJUA 3S9BA 1V2JT 4O97A 4I7YH 3P95A 1V2VT 2F91A 1EPTC 1C2JA 4K1SA 1GI4A 1SGFA 2P16A 3Q3KA 2QN5T 4F49A 3PB1E 3FZDA 1SL3A 1QB1A 3UWJH 4IN2A 2ZA5A 1WYKA 3P8FA 3W95A 1AWFH 2J95A 5T6FA 1PQAA 1PPZA 4YTAA 3QLPH 3NCLA 2OBQA 1F5KU 1F0SA 2ZHFH 1ID5H 3PMBB 4A1VA 1C1UH 1AZ8A 3RXBA 1LQEA 3B9FH 3MU5A 4AGKA 1H9IE 3RU4D 3UUZA 1G3DA 1EZUC 3K2UA 4CR5A 3MFJA 2ZEBA 2VJ1A 1AFQB 1OSSA 1C5XB 1DLKB 1J14A 2JH0D 4LXBH 1D6WA 1YPJH 1Q2WA 1SQAA 4JYVH 4AORA 4ZHMU 1HJ8A 1A4WH 2BYAX 1FLEE 3A7TA 1LVYA 5CMXH 3TH2H 3H7TA 3TU7H 1OWKA 5EQQA 3LKWA 5F8ZA 1E37B 1MD8A 1AFEH 4ABDA 1P2JA 3UNQA 3QGJA 1T4VH 4SGAE 1W11U 3IWMA 4I8LA 4BAMB 1C2EA 4NSVA 3NKKA 2ZZUH 1IQIA 1RTKA 1SHYA 1AO5A 1WTHD 3SJ8A 2HOBA 3P8GA 4FU7A 1Y3YA 2PWXA 2HNTF 2PV9B 1HGTH 1VZQH 2QXIA 1BT7A 1EP6A 2G52A 2F9PA 3NUMA 1AY6H 1GBJA 2BXTH 4Q80A 3O8DA 1PQ8A 1MKWH 2ZGXH 1SQOA 1Z8IB 1ESAA 3LC5A 1TNGA 2VIDA 3DFJA 5DG6A 3BTQE 1O2OA 3BEFB 2VWMA 3M7UA 4WXIA 3LIWA 2FOFA 1GHWH 4X0WU 1HDTH 1XKAC 2W7UA 4O3UA 5EXLA 2F9OA 3ATKA 1G3BA 2GP9B 1J15A 1PQ7A 2CHAC 1HAYB 5GXPA 1BQYA 1KXAA 2G55A 2BM2A 1GBKA 3LGTA 1MTSA 5J4SA 4A1TA 1V2WT 2GD4B 2BD8A 2WINI 2TIOA 2FLRH 4NIYA 5I46H 2ZNKH 2G00A 4JZEH 3D65E 4BXWA 2ZTXA 1GG6B 2QCYA 1HFDA 1TMTH 2C4FH 1TNJA 1VJ9U 5E8EH 1WUNH 3RXGA 4ABFA 2ZFTA 1RFNA 1W7XH 2WYGA 4E7NA 3FP6E 1BTHH 1PFXC 5LPFA 2O8WA 1RXPA 2ULLA 1ELVA 2J38A 4MTBA 4YESB 5AF9H 8GCHF 2J94A 2ZU3A 3W94A 1O33A 5GJ4B 1SHHB 2PUQH 5F03A 1GI1A 1JBUH 3UTUH 1KXDA 3ESTA 4Q7XA 1LCYA 1Y3UA 1SGQE 1TRMA 2BOKA 2HGTH 4H4FA 5EQRA 1SLXB 3SGQE 1LHGH 1AHTH 1ARCA 1P02A 1G36A 5AFYH 1SVPA 1V2RT 2ZO3H 2NWNA 4X1RU 2ANKH 1UVOA 1C1NA 1HYLA 4X2XA 3BTWE 4FUDA 2ZHDA 2GX4A 3TGKE 2GTBA 3LC3A 4ZMAH 3U69H 4JZDH 3P70B 1LO6A 1XM1A 1T8OA 1NRPH 4GPGA 1TGBA 3E91A 2BLVA 1ZHPA 1J17T 1YCPM 2PHBA 2SFAA 1SQTA 2WUCA 4Y8YA 4B2CA 3KL6A 2FESH 2P93A 3NWUA 3K6ZA 3TH3H 1QCPA 1C5TA 4AYVB 1O2YA 2GZ8A 1FV9A 1ZJDA 1LVMA 3BV9B 2F9UA 1FXYA 4NZLA 3RU4T 4LOYH 1MMJN 2A7JA 1HPGA 2C90B 4KTUA 1CA0C 1VCQA 1GHBG 1D9IA 1EASA 1Z71A 3OX7U 3NPSA 4X8TH 5F8TA 3U8TH 3RXEA 2ZCLP 1YPGH 4CHAC 1O3NA 3UNRA 5HM2A 5GWZA 4Y10E 1BMAA 1BHXB 1T4UH 2BY9X 1IQGA 3FANA 4XDEA 3PTNA 3T25A 5LH8A 3RXTA 1UVTH 1TLDA 9ESTA 2J9NA 1DY9A 3EAJA 1DPOA 1O32A 1SG8B 1KDQA 3EE0B 4WVPE 3RXRA 2XWBI 1QRWA 1N8OC 4YT6H 1K1PA 4BNRA 1GJDB 1EXFA 1O35A 1O3EA 4BAQB 2GCHF 4AFQA 2SGDE 4NWLA 2OC1A 1AI8H 1NRNH 1TRNA 1P0SH 1K21H 1ZSLA 3A85A 1W0YH 4TWWA 1K2I1 1LHDH 2FI3E 1XXDA 3V12A 1S5SA 1EAXA 2R9PA 1MTUA 3Q00A 1YPHC 2DUCA 2W7SA 2XW9A 2ZECA 4LZ1H 2KAIA 3BTEE 1ANEA 2BY5X 1O5EH 5LGOA 2QF3A 3BIVH 1UTMA 1W8BH 2D26C 1HIAA 4NA9H 4K1EA 3TJOA 1HJAC 3VXEH 3UWIA 3GY4A 2ALVA 3BTHE 2HNTE 2YNBA 3ZZCA 3LH3A 1H8DH 2BDAA 1FN6A 2GGVB 2A7HA 3TVJB 1H9HE 3B23B 5J4QA 3S7KB 2FIRH 1O5BB 2V0BA 2ZC9H 2GCTC 4I33A 4UFFH 2VGCC 1GBMA 7GCHF 1YBWA 1WAYB 2ZPSA 1NESE 3QTOH 2HVXA 5AVDA 2RDLA 4GCHG 1QR3E 4WMFA 1GG6C 1BTXA 4A7IB 5FCKA 4NZQA 1HB0B 1RIWB 1Z1IA 2Q6FA 1BA8B 1SOZA 1XVOA 1TMBH 1QHRB 2BD7A 1PYTD 2BOHB 3MWIU 3SJIA 2FP7B 2ZCHP 3A82A 1O3GA 1TYNA 4AYYB 2TGTA 1SPJA 1GMDG 4I8KA 4O9VA 3MNXA 3SQEE 1SLVB 1YLCA 1NRRH 4BTUB 1V2MT 3ZZBA 2QXHA 5FXLA 2H9HA 1K28D 2ZDVH 3HKIB 3QUMP 5E0GA 1WQSA 2ZP0H 3STJA 4M7GA 5EODA 1THRH 2W26A 1KLJH 3PLKA 1WSSH 2W3KA 3DUXH 2V3OH 4KELA 1FAKH 4X1SU 2GMTC 1AN1E 4CH2B 1INCA 2Y7ZA 1C9TA 2Z3DA 2Y5GA 2PGQB 1RGQA 1EZQA 4IGDA 1WQVH 5TCAA 1DM4B 4RKJB 1RTFB 1EQ9A 1TNIA 4HFPB 4DGJA 1TBQH 2ZPRA 4O3TA 3MH6A 5DGJA 1S84A 4GHTA 1SC8U 1A7SA 1SGFG 2ZDAH 4UD9H 2IN2A 2FZZA 1NS3A 2FMJA 3K65B 3QDZB 2VVCA 3MU8A 1AKSA 3A8DA 3PROA 4D7FA 2BTCE 3D23A 3NXPA 2Y80A 4J1YA 3SUEA 1E38B 2VWLA 4GLYA 2ZQ2A 2UWOA 1AVWA 1YPKH 2FYQA 1EAWA 4KP0A 3T29A 1AVGH 1BZXE 3TPIZ 1NFXA 7LPRA 1ELGA 3VB4A 2SNWA 3GDUA 1E0FD 2PKAB 2PFEA 1ZZZA 2AS9A 1S0QA 4ESTE 3IITA 2OXSA 4UFEH 1TGCA 3MU0A 1D4PB 3WY8A 1GI2A 2RA3A 1QRXA 1GWAA 1MBMA 2ZF0H 1Z8GA 1IOEA 3M3TA 1P2MA 4RN6A 2GV7A 4D9RA 2WPLS 2STBE 4Y0ZE 1A0JA 3KF2A 1AIXH 3MU4A 4FUEA 3SOSA 3VPKA 1CGIE 1BTZA 3M35A 3UREA 1CA8B 3RXUA 3M5MA 1N6XA 1GJCB 3ZZ6A 1PPHE 3I29A 4OS5A 3I77A 1P57B 1B7XB 2TPIZ 1DWBH 1C1SA 1PPCE 1ZGIA 2BVXH 3U8RH 1YC0A 1B5GH 3EYDA 3ZZ7A 1MTWA 2H5DA 3A89A 3VGCB 3M37A 1SLWB 2STAE 3RXIA 3F9GA 1P3CA 3LJOA 2G81E 2TGDA 4B71A 4XFQA 4AN7A 1O3JA 1TWXB 4YLQH 1AVXA 3P17H 2BD9A 2XCFA 1P2KA 1YCPK 3SN8A 1GL0E 3KNXA 1C1RA 1O3CA 2CF8H 1OWJA 1WTGH 1MZAA 4AFSA 2P3UB 3A87A 4FUJA 3RXAA 2OBOA 2ZDMA 1GJBB 2BD4A 3SU2A 3MH7A 3TIUA 2I6QA 5LPEA 4KGAA 2O9QA 1BRCE 1C5RA 1FMGA 1XUIA 4B2AA 1LHEH 1IQKA 1H4WA 1Q31A 2F9BH 2UWLA 1QJ6B 3E90B 1YYY1 3TITA 5FPYA 1EB2A 2Z9GA 5GCHG 3ATWA 1C5WB 3ATIA 3SNCA 1BBRE 5FPSA 3T26A 2WV4A 3CS0A 1W10U 4JK5A 3E0PB 1DWCH 4B73A 2UUJB 1E35B 2H2ZA 2C8ZB 2IJOB 4DCDA 1QRZA 4MPVA 1FY8E 2BDYA 4K8YA 1OP0A 2A32A 1EATA 2SGPE 2QC2A 5FX6A 1O30A 1ZGVA 4BANB 2H1UA 1ZHMA 1YCPH 3MH4A 3F1SB 1OWIA 1IQLA 4ZKSU 4IS5A 3E16B 4UFGH 1ZMNA 3VEQB 3PO1C 3S7HB 2OLGA 4ISLA 1GVKB 2R3YA 1AE8H 1BMMH 1OYQA 3C27B 1ZTLA 1JMOH 5T6GA 1WV7H 1HJ9A 4NWKA 3RLYH 4WMDA 1LPGB 1GJ4H 1ZSKA 1LDTT 1WBGB 3V3MA 5GCHF 1T8MA 1CE5A 4E05H 2ZQ1A 1ESTA 1K1JA 1NY22 1GJ8B 2K1QA 1HAGE 1F5LA 2AIPA 3GY6A 3GCOA 2PSXA 1BMNH 2TBSA 5HYOA 2OCVB 1KTTB 4UFDH 4WF8A 1G37A 4K3JA 2VWNA 1BMLA 2ODYB 3DHKH 4IC6A 2AMDA 2AMQA 1SOTA 1O2NA 3FP8E 1RD3B 3A8BA 3T28A 2ZDKA 2B0FA 5FBEA 4BAOB 2YNAA 1S0RA 2B7DH 1ESBA 4MNYA 4E7RG 3RC5A 1P06A 1CO7E 2BHGA 1UTQA 2ZTYA 3L33A 2Z3CA 2VINA 4GVUA 1O3DA 4WY3A 1UCYK 5A8ZA 3UNSA 1V2UT 4FVBA 1RS0A 2BX3A 3QGNB 1V2TT 1ZRBA 1F0TA 1SFQB 4YOGA 1C1WH 1DLEA 2FOHA 3ZZ4A 4YOJA 2GCTB 1G3CA 1MCVA 1YGCH 2P3FH 2V35A 3E6PH 3QTVH 1LKAA 1VITG 1C2IA 1K1LA 2XC5A 4X8SH 1QQUA 5DP5A 4HZHA 1ELDE 1FY5A 2BZ6H 2ZU4A 2HPQH 1SGYE 3ENSB 5H4IB 4OS6A 1SB1H 4X1PU 1YPLH 3PWCA 1C5YB 1TABE 1JIRA 3AAVA 2EC9H 2ZFSA 4IMZA 2AGGX 2A1DB 3BF6H 2Y5FA 1W0ZU 1O2IA 3GY8A 3MI4A 1C2LA 2QXGA 1VJAU 4Y7AA 1P11E 1ZPBA 1WOFA 1FZZA 3LDXH 1GHXH 4OS4A 3RXDA 4OGXA 3ZZ8A 1ELTA 1RIWC 2AIQA 3LGWA 1TBRH 1HAOH 2SGQE 4ABAA 1LHFH 2OC0A 1T32A 1SGRE 2WV5A 4FUIA 1IQHA 5JPMH 4X6PA 3VB5A 1ETRH 3SNAA 6LPRA 1HAZB 1UVPA 1T8NA 2SGAA 1O31A 4OS7A 3SBKA 1BJVA 2VB0A 1NM6A 1ZPCA 2BDCA 2A2XH 2ILNA 4H6TA 4R0IA 1C2GA 1TB6H 1SSXA 1C1PA 5GDSH 4R8TB 1TNKA 1Z8RA 3Q3XA 1GGDB 1G3EA 1C2DA 3F9FA 4NA8A 1Y59T 6CHAC 4NIWA 2Q6GA 1QB6A 5DP7A 5TCCA 4F4OC 3AVZA 1LVOA 2FWWA 4CRAA 1O34A 1SI5H 2JH6D 3GCHC 3TJVA 2BY8X 2EI7A 4THNH 4WH8A 2NU4E 1GI3A 3BEUA 3RC4A 1HAXB 2AERH 3F68H 1KY9A 2FXRA 4D9QA 1FQ3A 1D3DB 2OQUA 1KSNA 3Q77A 1SGNE 5DJ7A 5EW2H 3KGPA 1CVWH 3M61U 1YLDA 3RXMA 2FO9A 1BDAA 1GHVH 1FY4A 3ZYDA 2FTMA 3D62A 3SJKA 4A6LA 1O5GH 3R0FA 2C3SA 1DSTA 1IAUA 3RM2H 3PO1B 1TGNA 4K2YA 2ZDNA 3VB7A 3U1IB 1ANCA 1PYTC 3V7TA 2A4RA 3VB6A 3BG8A 4Z6AH 2HWLB 1TNLA 1MU6B 1ETSH 1GL1A 2G8TA 1L4DA 4NSYA 5T3HA 1PPBH 1OXGA 3KQCA 1EJNA 2H6MA 3SV2H 3A7ZA 1QBOA 1FUJA 1O37A 2ZI2H 1DT2A 1ZOMA 1GDNA 3KIDU 3GICB 5E2OA 3SU4A 1MQ5A 2GZ9A 3SQHE 1EAIA 5TJXA 1O3FA 1NO9H 2XWAA 1HAHH 1QA0A 1HAVB 1N6YA 2ZFPH 1AUJA 2A5AA 5EPNA 2XC4A 1EZXC 1M9UA 1N1LA 2BD2A 5JYIA 1UTLM 3T27A 3EA9A 2CGAA 1KTSB 2AGEX 2PUXB 1KLTA 3SJOA 5DK1A 3QX5H 5C2ZA 4IW4E 1AE5A 1TGTA 3UQVA 1A1RA 4MG3A 5I25A 1Y3VA 1HUTH 3M36A 1O0DH 3VFEA 2D8WA 2VU8E 4MQAA 5A0AE 1H8IH 2VIWA 5L2ZH 1TE0A 3F9HA 1P04A 5ABWA 2BLOA 4DIIH 3U1JB 2HLCA 1O2LA 4TY6A 1C1QA 1NC6A 3RM0H 3M7QA 1F0UA 1C5OH 2WPKS 3SI4H 2A31A 1Y5AT 1GMCG 1FDPA 4FVDA 1IQMA 1GDUA 4Y6DA 1HNEE 2Y81A 1P2OA 2XBWA 5FX5A 4CHAB 3SV6A 1D6RA 2FI5E 3EQ0H 2FM2A 4NIXA 4JCNA 1C5VA 1C5PA 4MDSA 4KKDA 3SU1A 1NFUA 1NTPA 1XUFA 2SNVA 1AFQC 4TY7A 2UUYA 1ZMJA 1O2TA 2HPPH 2I6SA 1UCYH 1KXFA 4K5ZA 3SJ9A 5C1UA 4UE7H 1MH0A 1ELEE 3LU9B 1E36B 2PKSB 2ZWLH 1RJXB 1B0EA 1QBNA 6GCHG 2ZCKP 2PTNA 2BDHA 4I8HA 1CGJE 1ZTKA 2ZGBH 2IOTA 1KXCA 3F9EA 3ATMA 1OKXA 4DURA 5EXMA 4B2BA 1P2NA 1THPB 3KHVA 1QNJA 2B8OH 4VGCC 3ZZ3A 1ARBA 3UIRA 2XCNA 4LZ4B 4Y8XA 2HALA 5E0JA 1O2HA 2F83A 2W3IA 3FZZA 3SU5A 1UMAH 1TIOA 1O2UA 4ABEA 1SFIA 1GJ5H 2FI4E 3SNEA 2OQ5A 3MO9A 1VITH 3V0XA 1IQNA 5ESBA 1GJ9B 1O2WA 3PMJA 1HXEH 3KQEA 2BY7X 1GGDC 2Y82A 1ORFA 1V2LT 6CHAB 3H7OA 2ZIQH 4MVNA 3OY6U 4JZFH 1RRKA 3QO6A 1J8AA 4XBBA 3UPEA 1DWEH 1UHBB 1O2ZA 1ETTH 2PKAA 2UUFB 3MHWU 2AMPA 3RXLA 2BB4A 3UY9A 3M7TA 2FTLE 1W12U 2M5TA 2LPRA 5PTPA 1OP8A 3UR6A 3MO6A 4MNXA 2VH6A 5SGAE 1YKTA 3UQOA 2NU2E 2GDDA 1VCPA 5DKMA 2IPHA 1O5DH 1S6FA 3E8LA 2ZKSA 2VVVA 1ELAA 1O3LA 1O3BA 3AW1A 3RP2A 4RSPA 1TPOA 1HAIH 1BBRH 2Q1JA 1C1VH 4JMYA 1GCTC 1DS2E 2WPHS 1QGFA 1YPHE 1KIGH 3RXJA 1BRUP 1OWDA 5C67A 2WYJA 1SR5C 1JWTA 1AUTC 1K9OE 1Z8JB 2ASUB 4WJG2 1HXFH 2ODPA 2A45B 3KQDA 5F8XA 3STIA 1JXPA 2Z9IA 5AHGH 4HGCA 1LQDB 3ZZ9A 1P2QA 1DXPA 2ANMH 3BIUH 3ZVCA 5F6MA 1S81A 4Q2KA 4X1NU 2C8YB 1ZPZA 1QA7A 3GOVB 3HATH 3OU0A 5DP8A 4NG9H 5BRRE 4XBCA 1TRYA 2JETC 1FPHH 1ZMLA 1CT2E 1KXBA 2ZHWH 3QN7A 2JKHA 2VVUA 4X2YA 1GBFA 3S9CA 1O36A 1AWHB 5HXFA 2DE8A 1GBEA 4D76A 1EJAA 2G5NA 1DOJA 4ZROA 4XSKU 1S83A 4FUBA 1P05A 1HJAB 3AW0A 2P94A 1ELCA 3SV9A 1BTYA 1C2MA 2BD5A 5FCRA 4Y79A 1ZYOA 2Z7FE 1O3KA 2Z6BD 4KTSA 5A8XA 3E0NB 3U8OH 1IQJA 3QZQA 2AFQB 1BHXF 1C4Y2 2EI8A 3T5FH 2G4UA 1EB1H 2NU3E 4Y0YE 3BTME 3SHAH 1UK4A 3A88A 4ZHLU 2QYIA 1AGJA 2A7CA 3M3VA 5BPEA 1C2FA 3P8OA 3N7OA 1Z6JH 3O8RA 5JDUB 1CU1A 2TRMA 7KMEH 1NROH 2A4GA 1O2MA 4X2VA 2PSYA 1X7AC 3EA8A 5A8YA 3ZV9A 2Y5HA 3GCNA 1SLUB 3O8BA 1WU1A 1FAXA 4X1QU 4JZ1A 4VGCB 1O3OA 4XE4A 4JK6A 5C20A 2J34A 3UFAA 1MU8B 1QL9A 1DE7H 1EOJA 2PGBB 1ELBA 3TLOA 2XBXA 3LOXA 1C4V2 2GKVE 1TA2A 1ZSJA 2A2QH 1FIZA 4ABBA 1NFYA 4DT7B 2YOLA 2ZHQH 3HK6B 4DOQA 1ANBA 1K22H 2XC0A 4CBNA 4O03A 1ELFA 1KXEA 3ATLA 1FPCH 2W5EA 1V3XA 4BTTB 1XUJA 1AKSB 2R0LA 3TNTA 1UTJA 4A5TS 3RXHA 5E2PA 1CQQA 1K1OA 1J9CH 2NU0E 3URCA 2CMYA 3S69A 1KDQB 4AFUA 2FS9A 1UTPA 4NCYA 4UDWH 4ZKNU 2TGAA 4AGJA 1IQEA 2XXLA 3S9AA 1V2KT 4ZXYH 1BCUH 3PV4A 4YO9A 1Q3XA 2OC8A 5C1XA 1PQ5A 4U30A 3ITIA 3SUGA 5IDKA 4WMEA 1GMHG 1P01A 3SI3H 2Y7XA 3A80A 1S6HA 1EUFA 1VITF 1AU8A 1KYNA 4HTCH 1MAYA 3EA7A 1ABJH 3RU4E 4CRBA 2AYWA 1F7ZA 1GBAA 1OWHA 4BAHB 1ACBE 1CSOE 3LGYA 1C1MA 3BTDE 1GBLA 3SNDA 4AG1A 4I8GA 3ODDA 4QT8C 2B9LA 1NPMA 2C8XB 2GCHG 4B1TA 8KME2 2R3UA 1P9UA 4CRFA 1GBTA 1LPKB 1DY8A 1BB0B 3A7XA 4HI3A 3GY3A 3SUFA 1MZDA 2ZGJA 2UUKB 5C5NA 5AFZH 1NT1A 1T7CA 4RKOB 1HLTH 2A4OA 1EKBB 3BG4C 2FOCA 4YOIA 4IBLH 1TPAE 2UWPA 2RG3A 3MOCA 3S0NA 2CHAB 5HM9A 1C2KA 3JZ1B 3B8JA 1CT0E 1EJMA 2ESTE 2CF9H 2F9NA 1DICA 3EDXB 3Q3YA 3BTGE 3A7VA 3TGIE 2QXJA 1CBWB 4K69A 4X2WA 4U01A 1DUEA 1G30B 1VCWA 5C1YA 2VH0A 3A7YA 3RC6A 4YLUA 1BRBE 1CA0B 1A2CH 2J4IA 1SGTA 1QURH 1EZSC 1L1GA 5FBIA 3P92A 1QL7A 4JYTA 5JB9S 5C3NA 2JH5D 3U9AH 3TK6A 1ANDA 2BQ7B 2QA9E 2ZDLA 5ESTE 2VIOA 3F6UH 1SMFE 4GCHF 1C1TA 1O3PB 4TWYA 1CHOG 5E0HA 1GBHA 3GY7A 1UCYE 7ESTE 5CE1A 4NFEA 2H5CA 2SGFE 4ABGA 5HGGA 3L6PA 3K6YA 3MTYA 3RXOA 2A5KA 3SGBE 1DDJA 1XX9A 4X6OA 2BMGB 2FEQH 4ZAEA 1C9PA 4IN1A 1XUHA 5JBBS 2OC7A 1SGIB 1HV7A 4U2WA 4Y71A 3IG6B 3UOPA 3LONA 1HCGA 4ISNA 4DY7B 4MPWA 1MAXA 3NK8A 4YM9A 1Y3WA 1A5HA 3GY5A 1O5CB 1V2ST 3RXPA 2Y6TA 3HKJB 4NFFA 1L1NA 2H9TH 1MTNB 4I8JA 3TK5A 1SGEE 3BTKE 2PTCE 1GHYH 1GI6A 1W13U 1V2NT 3KCGH 4ZH8A 1A5IA 3KN2A 1NZQH 4X8VH 3ZZ5A 1UVUH 5K0HA 1F2SE 1BBRK 3R3GB 1O2RA 3JZ2B 3A7WA 2ZGCA 1BRAA 1FNIA 2P8OB 8ESTE 5EOKA 1BIOA 1LKBA 2BDIA 5A0BA 2ZPQA 1YF4A 3ZVDA 1GMCF 1BTUA 3VGCC 1MBQA 2BQWB 3RXCA 1VGCC 3BN9A 3AASA 1D3PB 1W14U 1A46H 2ZHEH 4CH8B 2A4QA 2LNCA 3T62A 1P10A 1L4ZA 2ZGHA 1Y3XA 2XYAA 1TX7A 4MLFB 1QBVH 1A3EH 1GI0A 4FUFA 1A0HB 1QFKH 1FY3A 4TPIZ 1A0LA 4BAKB 2P95A 5CHAC 2FDAA 1BTWA 2FLBH 1S82A 1GMHF 1TX6A 2ZFRH 3PLBA 1MCTA 2CXVA 2QGRA 4UONA 2VWOA 1PPEE 3ZVEA 1TQ0B 3GCTG 2FOGA 2VGCB 4K60A 1DUAA 1NRSH 3DFLA 1ZTJA 4LK4A 4AX9H 1MKWK 5T6DA 4DJZB 3MH5A 2AH4X 1V2PT 4NIVA 1MTNC 2QF0A 1TOMH 4A1XA 4X8UH 2VIPA 1OPHB 5JBCS 3MU1A 4JZIA 3MNCA 1P2IA 1U6QA 1XKBC 2XBVA 3PTBA 4Y7BA 3SGAE 2GT8A 4ISIH 1FONA 1C4U2 4CBOA 2HNTC 1O2JA 3RXQA 4U32A 1O2XA 2BD3A 4CRDA 2WPMS 1GI5A 3PLPA 1L2EA 1GCTB 3RXFA 1UK2A 4FUCA 5EG4A 5JBTA 3BEIB 2J92A 4NGAH 5L2YH 4ABJA 2RA0A 1O2SA 3SU3A 3GYMA 4MNVA 1A61H 1TNHA 3OY5U 4DG4A 2Z9LA 5DP4A 2O8MA 3RXSA 1QIXB 3RLWH 2QIQA 1YPEH 4K1TA 1TPSA 2GV6A 3M5OA 1BJUA 1OP2A 3CS7A 4D8NA 1C5QA 1CHGA 4ZUHA 1DVAH 2JETB 1ZLRA 1GHBF 2RCEA 4J2YB 3SV8A 1YP9A 3UR9A 3I78A 5FHTA 1H1BA 3L3TA 2CV3A 1VR1H 1CBWC 3LGUA 3TK9A 1FY1A 1A5GH 3GDSA 2Z94A 3SU0A 1DWDH 1FI8A 1H9LB 3A8AA 4YZUA 3ELAH 2OTVA 2ZFFH 4OS2A 4AZ2B 4MNWA 1BITA 4TPYA 1D3QB 1ZRKA 3QWCH 4CR9A 3ODFA 1GHAG 1OX1A 1YPMH 1NU7B 2ZU5A 1XUGA 5FPTA 4DIHH 1QB9A 1IHTH 1CGHA 1GI8B 4GAWA 1TOCB 1TA6A 3A8CA 2AEIH 2EEKA 3LJJA 1XXFA 1Y5BT 3GDVA 1EX3A 3GCHB 3MNSA 1F0RA 5ETXA 1XUKA 4B75A 5EXNA 1CT4E 1SGCA 3CP7A 2V6NA 2FOEA 3NZIA 2Z9KA 1LVBA 1EP5A 3ZVFA 2FX4A 2CN0H 1THSH 1W7GH 3DA9B 1T31A 1G2MA 2BX4A 2B5TB 5L30H 3HGNA 4CRGA 4FU8A 1L1JA 2BDBA 1TMUH 6ESTA 1XVMA 4ZHAA 3GYLB 2Z3EA 5HMAA 2P8OC 2G51A 3UOUA 4ISHH 4B76A 2Z9JA 1TBZH 2AGIX 1O2PA 1F92A 1FIWA 3PM3A 3BG4B 1AMHA 5G4BA 2GT7A 2PLXA 2HRVA 3V13A 3ZZDA 4DVAU 3TNSA 1P12E 3LT3A 2PR3A 1UTNA 4FU9A 5EGMA 1UTKA 1C1OA 3O8CA 2VIQA 3D49H 3HGPA 1QQ4A 1GBBA 4A92A 3BTFE 1B0FA 4AFZA 5JBAS 2FX6A 1EPTB 2BVSH 2ALPA 1O3AA 3LPRA 1P9SA 1UVSH 4I32A 1AZZA 4UEHH 1C5UA 2P3TB 1GBIA 2FS8A 1DANH 3GCTF 1O5FH 3M5LA 3SO3A 4AB9A 4ZXXH 1K1NA 2A0QB 1F5RA 1C5NH 2ZFQH 1MQ6A 3FFGA 1K1IA 3SUDA 1DFPA 1LHCH 5DP6A 3RXVA 2O8LA 3ZV8A 3AAUA 4I31A 5IYTA 2D2DA 5EQSA 3TGJE 1P8VC 1EPTA 2XNIA 4DW2U 3M5NA 4ISOA 1JOUB 3MNBA 2GDEH 1HRTH 2BZAA 1PPFE 1GJAB 3GY2A 4B74A 1Y5UT 2QAAA 2Q6DA 2OUAA 3K9XB 4K8BA 1W3CA 3RUOA 3QK1A 3VB3A 3EGKH 2V3HH 3RDZA 2GZ7A 4H42U 1TX8A 3M3SA 1D3TB 3GISB 3RXKA 1BTPA 1UHBA 1Z6EA 1G32B 1QL8A 3P6ZB 1V6DA 4YT7H 1O39A 1E34B 4INHA 2GMTB 3SU6A 2ZG0H 2EI6A 3SV7A 1K1MA 1N8OB 1DITH 4Y8ZA 2GVFA 1SGDE 3U98H 1CHOF 1C2HA 3KQBA 1IQFA 1SGPE 1UJ1A 4ZKRU 2C8WB 1HIAB 4E06H 2FYRA 5A2MH 1PJPA 2H9EH 2QV1A 3ZVBA 3PWBA 5DP3A 5DP9A 6GCHF 3SNBA 1TALA 3E3TA 1GJ7B 4X6NA 1XMNB 2TGPZ 1NN6A 1OS8A 1LMWB 1BUIA 1GCDA 5JB8S 4INKA 4H6SB 3FVFB 1HBTH 1O2GH 3H5CB 5EPYA 1SBWA 5A0CA 4Y76A 2NU1E 1C5LH 2QY0B 7GCHG 1NU9A 1UO6A 1ZR0A 2BDGA 2D1JA 5DPAA 4Q7YA 3MYWA 5CHAB 3FAOA 1UK3A 1Z1JA 4AB8A 4OGYA 8GCHG 4BXSA 3P8NA 1TPPA 1O38A 3DD2H 1TFXA 4SGBE 2OP9A 1DX5M 2A5IA 3LGVA 4PROA 4INLA 3OSYA 1LTOA 4FUGA 4FUHA 5K7RA 4WH6A 2R0KA 1VGCB 3SZNA 1ZJKA 5C5OA 3PMAB 2FOBA 1QTFA 3RMMH 3PMHB 1KLIH 3E1XB 1MUEB 4IMQA 4TYDA 1QJ7B 1GMDF 3KEEA 3T2NA 5LPRA 3MO3A 2ODQA 1GJ6A 3HPTB 4ASHA 1AQ7A 2THFB 3SHCH 1JRTA 1IHSH 2ZU1A 3FP7E 1GHZA 4FXGH 4NA7A 2WPJS 3OYPA 1OWEA 2OINA 4Z0KA 3SW2B 1DXWA 1QY6A 4X6MA 4Y11E 1AB9C 4D7GA 1GBCA 1L0ZA 3TH4H 1G2LA 2ZU2A 1MKXK 3A84A 1Y8TA 4KTCA 1RTLA 1ZHRA 4CREA 1PPGE 5A09A 2C93B 2WUBA 2ZTZA 2BXUH 1HAPH 1J16A 1LPZB 1W2KH 4BOHA 3TJNA 3OTJE 1HAVA 1S85A 1GI9B 5L6NH 2EA3A 2G5VA 4AOQA 4WWYA 2O8TA 1AD8H 2ANYA 3SORA 5GPIB 4WXVA 4GSOA 4AG2A 1GVLA 2FOMB 9LPRA 1JRSA 1QJ1B 2FPZA 1ABIH 1OYTH 1MKXH 3A81A 3A86A 3RMOH 5B6OA 1FN8A 1MTVA 3RMNH 1Z7KA 2BQ6B 1TAWA 1G9IE 3Q76A 4GHQA 2PKSC 1OOKB 5GIBA 1DSUA 3QZRA 4Q7ZA 3MMGA 2VIVA 1WCZA 1GI7B 2XBYA 3C1KA 1AB9B 3G01A 1O2KA 1NFWA 2G4TA 4CRCA 2J2UA 1MD7A 1P03A 4XOJA 1TONA 2FODA 1BOQA 1FJSA 2R2MB 4ABHA 3LGIA 1GBDA 2OD3B 3PYHA 1NRQH 3BSQA 1A3BH 1V2QT 2ANWA 2R2WU 2F3CE 1T8LA 1YM0A 2BLQA 2CJIA 1C5ZB 3ZYEA 1EAUA 4ZKOU 1C5MD 1GPZA 2XTTB 1O3MA 1O3HA 5DO4H 4MPXA 4JYUH 1JIMA 1O2VA 2SGEE 3ZVGA 2BVRH 3HK3B 2BLWA 3ZVAA 1P09A 1GVZA
chains in the Genus database with same CATH superfamily
1TGSZ 2VNTA 3RMLH 5FAHA 1P3EA 1C5SA 1E1RD 4MPUA 1TQ7B 5EW1H 3DT0H 1UTOA 2F9VA 4ABIA 8LPRA 2KAIB 2DE9A 2PW8H 1V2OT 5EU8A 2O8UA 1GDQA 2FOAA 2CK3D 3VXFH 3URDA 4OS1A 3ZZAA 4BTIB 3CENA 3LH1A 1GHAF 2BY6X 2XRCA 1O3IA 1O5AB 2P59A 1O2QA 4IC5A 1EOLA 3BTTE 3A83A 4GUXA 2WPIS 4XBDA 3TJUA 3S9BA 1V2JT 4O97A 1KMHB 4I7YH 3P95A 1V2VT 2F91A 1EPTC 1C2JA 4K1SA 1GI4A 1SGFA 2P16A 3Q3KA 2QN5T 4F49A 3PB1E 3FZDA 1SL3A 1QB1A 3UWJH 4IN2A 2ZA5A 1WYKA 3P8FA 3W95A 1AWFH 2J95A 5T6FA 1PQAA 1PPZA 4YTAA 3QLPH 3NCLA 2OBQA 1F5KU 1F0SA 2ZHFH 1ID5H 3PMBB 4A1VA 1C1UH 1AZ8A 3RXBA 1LQEA 3B9FH 3MU5A 4AGKA 1H9IE 3RU4D 3UUZA 1G3DA 1EZUC 3K2UA 4CR5A 3MFJA 2ZEBA 2VJ1A 1AFQB 1OSSA 1C5XB 1DLKB 1J14A 2JH0D 4LXBH 1D6WA 1YPJH 3OAAD 1Q2WA 1SQAA 4JYVH 4AORA 4ZHMU 1HJ8A 1A4WH 2HLDD 2BYAX 2F4LA 1FLEE 3A7TA 1LVYA 5CMXH 3TH2H 3H7TA 3TU7H 1OWKA 5EQQA 3LKWA 5F8ZA 1E37B 1MD8A 1AFEH 4ABDA 1P2JA 3UNQA 3QGJA 1T4VH 4SGAE 1W11U 3IWMA 4I8LA 4BAMB 1C2EA 4NSVA 3NKKA 2KX4A 2ZZUH 1IQIA 1RTKA 1SHYA 1AO5A 1WTHD 3SJ8A 2HOBA 3P8GA 4FU7A 1Y3YA 2PWXA 2HNTF 1E1QD 2PV9B 1HGTH 1VZQH 2QXIA 3PRBA 1BT7A 1EP6A 2G52A 2F9PA 3NUMA 1AY6H 1GBJA 2BXTH 1SKYE 4Q80A 3O8DA 5F53A 1PQ8A 1MKWH 2ZGXH 1SQOA 1Z8IB 1ESAA 3LC5A 1TNGA 2VIDA 3DFJA 5DG6A 3BTQE 3F2GA 1O2OA 2OK5A 3BEFB 2VWMA 3M7UA 4WXIA 3LIWA 2FOFA 1GHWH 4X0WU 1HDTH 1XKAC 2W7UA 4O3UA 5EXLA 2F9OA 3ATKA 1G3BA 2GP9B 1J15A 1PQ7A 2CHAC 1HAYB 5GXPA 1BQYA 1KXAA 2G55A 2BM2A 1GBKA 3LGTA 1MTSA 5J4SA 4A1TA 1V2WT 2GD4B 2BD8A 2WINI 2TIOA 2FLRH 4NIYA 5I46H 2ZNKH 2G00A 4JZEH 3D65E 4BXWA 2ZTXA 1GG6B 2QCYA 1HFDA 1TMTH 3WW7A 2C4FH 1TNJA 1VJ9U 5E8EH 1WUNH 3RXGA 4ABFA 2ZFTA 1RFNA 1W7XH 2WYGA 4E7NA 3FP6E 1BTHH 1PFXC 5LPFA 2O8WA 1RXPA 2ULLA 1ELVA 2J38A 4MTBA 4YESB 5AF9H 8GCHF 2J94A 2ZU3A 3W94A 1O33A 5GJ4B 3FKSD 1SHHB 2PUQH 5F03A 1GI1A 1JBUH 5EJ1A 3UTUH 1KXDA 3N7EA 3ESTA 4Q7XA 1LCYA 1Y3UA 1SGQE 1TRMA 2BOKA 2HGTH 4H4FA 5EQRA 1SLXB 3SGQE 3GS9A 1LHGH 1AHTH 1ARCA 1P02A 1G36A 5AFYH 1SVPA 4P00A 1V2RT 2ZO3H 2NWNA 4X1RU 2ANKH 1UVOA 1C1NA 1HYLA 4X2XA 3BTWE 4FUDA 5HKKD 2ZHDA 2GX4A 3TGKE 5DSFA 2GTBA 3LC3A 4ZMAH 3U69H 4JZDH 3P70B 1LO6A 1XM1A 1T8OA 5GNDA 1NRPH 4GPGA 1TGBA 3E91A 2BLVA 1ZHPA 1J17T 1YCPM 2RFKC 2PHBA 2SFAA 5CDFE 1SQTA 2WUCA 2J97A 4Y8YA 4B2CA 3KL6A 2FESH 2P93A 3NWUA 3K6ZA 3TH3H 1QCPA 2HVYB 1C5TA 4AYVB 1O2YA 4B6FA 2QF5A 2GZ8A 1FV9A 1ZJDA 1LVMA 3BV9B 4YXWD 2F9UA 1FXYA 4NZLA 3RU4T 4LOYH 1MMJN 2A7JA 1HPGA 2C90B 4KTUA 4XD7D 1CA0C 1VCQA 1GHBG 1D9IA 1EASA 1Z71A 3OX7U 3NPSA 4X8TH 5F8TA 3U8TH 3RXEA 2ZCLP 1YPGH 4CHAC 1O3NA 3UNRA 5HM2A 5GWZA 4Y10E 1BMAA 1BHXB 1T4UH 2BY9X 1IQGA 3FANA 4XDEA 3PTNA 3T25A 4I86A 5LH8A 3SYJA 3RXTA 1UVTH 1TLDA 9ESTA 2J9NA 1DY9A 3EAJA 1DPOA 1O32A 1SG8B 1KDQA 3EE0B 4WVPE 3RXRA 2XWBI 1QRWA 1N8OC 4YT6H 2JIZD 1K1PA 4BNRA 1GJDB 1EXFA 1O35A 1O3EA 4BAQB 2GCHF 4AFQA 2SGDE 3AK5A 4NWLA 2OC1A 1AI8H 1NRNH 1TRNA 1P0SH 1K21H 1ZSLA 3A85A 3ZIAD 1W0YH 4TWWA 1K2I1 1LHDH 2FI3E 1XXDA 3V12A 1S5SA 1EAXA 2R9PA 1MTUA 3Q00A 1YPHC 2DUCA 2W7SA 2XW9A 2ZECA 4LZ1H 2KAIA 3BTEE 1ANEA 2BY5X 1O5EH 5LGOA 2QF3A 3BIVH 1UTMA 1W8BH 2D26C 5IK2D 2KM0A 1HIAA 4NA9H 4K1EA 3TJOA 1HJAC 3VXEH 3UWIA 3GY4A 2ALVA 3BTHE 2HNTE 2YNBA 3ZZCA 3LH3A 1H8DH 2BDAA 1FN6A 2GGVB 2A7HA 3TVJB 1H9HE 3B23B 1W0KD 5J4QA 3WWBA 3S7KB 2FIRH 1O5BB 2V0BA 4ZCNA 2ZC9H 2GCTC 4I33A 4UFFH 2VGCC 1GBMA 7GCHF 1YBWA 1WAYB 2ZPSA 1NESE 3QTOH 2HVXA 4M9FA 5AVDA 2RDLA 4GCHG 3PV5A 1QR3E 4WMFA 1GG6C 1BTXA 4A7IB 5FCKA 4NZQA 1HB0B 1RIWB 1Z1IA 2Q6FA 1BA8B 1SOZA 1XVOA 1TMBH 1QHRB 2BD7A 1PYTD 2BOHB 3MWIU 3SJIA 2FP7B 2WHXA 2ZCHP 3A82A 1O3GA 1TYNA 4AYYB 2WPDD 2L6OA 2TGTA 1SPJA 3FOAA 1GMDG 4I8KA 4O9VA 3MNXA 3SQEE 1SLVB 1YLCA 1NRRH 4BTUB 1V2MT 3ZZBA 2XNDD 3N7DA 2QXHA 5FXLA 2H9HA 1K28D 2ZDVH 3HKIB 3QUMP 5E0GA 1WQSA 2ZP0H 3STJA 3N99A 4M7GA 3F3BA 1THRH 2W26A 1KLJH 5EODA 3PLKA 1WSSH 2W3KA 3DUXH 2V3OH 4KELA 1FAKH 4X1SU 2GMTC 1AN1E 4CH2B 1INCA 2Y7ZA 1C9TA 2Z3DA 2Y5GA 2PGQB 1RGQA 1EZQA 4IGDA 1WQVH 5TCAA 1DM4B 4RKJB 1RTFB 1EQ9A 1TNIA 4HFPB 4DGJA 1TBQH 2ZPRA 4O3TA 3MH6A 5DGJA 1S84A 4GHTA 1SC8U 1A7SA 1SGFG 2ZDAH 4UD9H 2IN2A 2FZZA 1NS3A 2FMJA 3K65B 3QDZB 2VVCA 3MU8A 1AKSA 3A8DA 3PROA 4D7FA 2BTCE 3D23A 3NXPA 2KFWA 2Y80A 4J1YA 3SUEA 1E38B 2VWLA 4GLYA 2ZQ2A 2UWOA 1AVWA 1YPKH 3H09A 2FYQA 1EAWA 4KP0A 3T29A 1AVGH 1BZXE 3TPIZ 1NFXA 7LPRA 1ELGA 3VB4A 2SNWA 3GDUA 1E0FD 2PKAB 2PFEA 1ZZZA 2AS9A 1S0QA 4ESTE 3IITA 2OXSA 4UFEH 5EJLA 3OFND 3MQKC 1TGCA 3MU0A 1D4PB 3WY8A 1GI2A 2RA3A 1QRXA 1GWAA 1MBMA 2ZF0H 1Z8GA 1IOEA 3M3TA 1P2MA 4RN6A 2GV7A 3FN8A 4D9RA 2WPLS 2STBE 4Y0ZE 1A0JA 3KF2A 1AIXH 3MU4A 4FUEA 3SOSA 3VPKA 1CGIE 1BTZA 3M35A 3UREA 1CA8B 3RXUA 3M5MA 1NBME 1N6XA 5DN6D 1GJCB 3ZZ6A 1PPHE 3I29A 4OS5A 3WWFA 3I77A 1P57B 1B7XB 2PP6A 2TPIZ 1DWBH 1C1SA 1PPCE 1ZGIA 2BVXH 2K0QA 1YC0A 3U8RH 1B5GH 3EYDA 3ZZ7A 1MTWA 2H5DA 3A89A 3VGCB 3M37A 1SLWB 2STAE 4FETA 3RXIA 3F9GA 1P3CA 1MABB 3LJOA 5HIYA 2G81E 2TGDA 4B71A 4XFQA 4AN7A 1O3JA 1TWXB 4YLQH 1AVXA 3P17H 2BD9A 2XCFA 1P2KA 1YCPK 3SN8A 1GL0E 2J5UA 3KNXA 1C1RA 1O3CA 2CF8H 1OWJA 1WTGH 1MZAA 4AFSA 2P3UB 3A87A 4FUJA 3RXAA 2OBOA 2ZDMA 1GJBB 2BD4A 3SU2A 5HIZA 2M2AA 3MH7A 2I6QA 3TIUA 5LPEA 4KGAA 2O9QA 1BRCE 1C5RA 1FMGA 1XUIA 4B2AA 1LHEH 1IQKA 1H4WA 1Q31A 2F9BH 2UWLA 1QJ6B 3E90B 1YYY1 3TITA 4Q63A 5FPYA 1EB2A 2Z9GA 5GCHG 3ATWA 1C5WB 3ATIA 3SNCA 1BBRE 5FPSA 2W6ID 3T26A 2WV4A 3CS0A 1W10U 4JK5A 3E0PB 1DWCH 4B73A 2UUJB 1E35B 2H2ZA 2C8ZB 2IJOB 4DCDA 1QRZA 4MPVA 1FY8E 2BDYA 4K8YA 1OP0A 2A32A 1EATA 2SGPE 2QC2A 5FX6A 1O30A 1ZGVA 5EIYA 4BANB 2H1UA 1ZHMA 1YCPH 3MH4A 3F1SB 1OWIA 1IQLA 4ZKSU 4IS5A 3E16B 4UFGH 1ZMNA 3VEQB 3PO1C 3S7HB 2OLGA 4ISLA 1GVKB 2R3YA 1AE8H 1BMMH 1OYQA 3C27B 1ZTLA 1JMOH 5T6GA 1WV7H 1HJ9A 4NWKA 3RLYH 4WMDA 1LPGB 1GJ4H 1ZSKA 1LDTT 1WBGB 3V3MA 5GCHF 1T8MA 1YLNA 1CE5A 4E05H 2ZQ1A 1ESTA 1K1JA 1NY22 1GJ8B 2K1QA 1HAGE 1F5LA 2AIPA 3GY6A 3CNRA 4F48B 3GCOA 2PSXA 1BMNH 2TBSA 5HYOA 2OCVB 1KTTB 4RI0A 4UFDH 3W1EA 4WF8A 1G37A 4K3JA 2VWNA 1BMLA 2ODYB 3DHKH 4IC6A 2AMDA 2AMQA 1SOTA 1O2NA 3FP8E 1RD3B 3A8BA 3T28A 2ZDKA 2B0FA 5FBEA 4BAOB 2YNAA 1S0RA 2B7DH 1ESBA 4MNYA 4E7RG 3RC5A 1P06A 1CO7E 2BHGA 4FOUC 1UTQA 2ZTYA 3L33A 2Z3CA 2VINA 4GVUA 1O3DA 1UW7A 3EE7A 4WY3A 1NBMD 1UCYK 5A8ZA 3UNSA 1V2UT 4FVBA 1RS0A 2BX3A 3QGNB 1H8HD 1V2TT 1ZRBA 1F0TA 5C0TA 1SFQB 2J98B 4YOGA 1C1WH 1DLEA 2FOHA 3ZZ4A 4YOJA 2GCTB 1G3CA 1MCVA 1YGCH 1OHHD 2JDID 2P3FH 2V35A 3E6PH 3QTVH 1LKAA 1VITG 1C2IA 4ACAA 1K1LA 2XC5A 4X8SH 1QQUA 5DP5A 4HZHA 1ELDE 1FY5A 2BZ6H 4B6EA 2ZU4A 2HPQH 1SGYE 3ENSB 5H4IB 4OS6A 2VBCA 1SB1H 4X1PU 1YPLH 3PWCA 1C5YB 1TABE 1JIRA 3AAVA 2EC9H 2ZFSA 4IMZA 2AGGX 2A1DB 3BF6H 2Y5FA 1W0ZU 1O2IA 3GY8A 3MI4A 5T1VA 1C2LA 2QXGA 1VJAU 4Y7AA 1P11E 1ZPBA 1WOFA 1FZZA 3LDXH 1GHXH 4OS4A 3RXDA 4OGXA 3ZZ8A 1ELTA 1RIWC 2AIQA 3LGWA 1TBRH 1HAOH 2SGQE 4ABAA 1LHFH 2OC0A 1T32A 1SGRE 2WV5A 4FUIA 1IQHA 5JPMH 4X6PA 3VB5A 1ETRH 3SNAA 6LPRA 1HAZB 1UVPA 1T8NA 2SGAA 1O31A 4OS7A 3SBKA 1BJVA 2VB0A 1NM6A 1ZPCA 2BDCA 2A2XH 2ILNA 4H6TA 4R0IA 1C2GA 1TB6H 1SSXA 1C1PA 5GDSH 4R8TB 1TNKA 1Z8RA 3Q3XA 1GGDB 1G3EA 1C2DA 3F9FA 4NA8A 1Y59T 6CHAC 4NIWA 2Q6GA 1QB6A 5DP7A 5TCCA 4F4OC 3AVZA 1LVOA 2FWWA 4CRAA 1O34A 1SI5H 2JH6D 3GCHC 3TJVA 2BY8X 2EI7A 4THNH 4WH8A 2NU4E 1GI3A 3BEUA 4ACBA 3RC4A 1HAXB 2AERH 3F68H 1KY9A 2FXRA 4D9QA 1FQ3A 1D3DB 2OQUA 1KSNA 3Q77A 1SGNE 5DJ7A 5EW2H 3KGPA 1CVWH 3M61U 1YLDA 3RXMA 2FO9A 1BDAA 1GHVH 1FY4A 3ZYDA 2FTMA 3D62A 3SJKA 4A6LA 1O5GH 3R0FA 2C3SA 1DSTA 2LP6A 1IAUA 3RM2H 3PO1B 1TGNA 4K2YA 2ZDNA 3VB7A 3U1IB 1ANCA 1PYTC 3V7TA 2A4RA 3VB6A 3BG8A 4Z6AH 2HWLB 1TNLA 1MU6B 1ETSH 1GL1A 2G8TA 1L4DA 4NSYA 5T3HA 1PPBH 1OXGA 3KQCA 1EJNA 1EFRD 2H6MA 5CHBA 3SV2H 3A7ZA 1QBOA 1FUJA 1O37A 2ZI2H 1DT2A 1ZOMA 3KYGA 1GDNA 2KR7A 3KIDU 3GICB 5E2OA 3SU4A 1MQ5A 2GZ9A 3SQHE 1EAIA 5TJXA 1O3FA 1NO9H 2XWAA 1HAHH 1QA0A 1HAVB 1N6YA 2ZFPH 1AUJA 2A5AA 5EPNA 2XC4A 1EZXC 1M9UA 1N1LA 2BD2A 5JYIA 1SQRA 1UTLM 3T27A 3EA9A 2CGAA 5C94A 1KTSB 2AGEX 2PUXB 1KLTA 3SJOA 5DK1A 3QX5H 5C2ZA 4IW4E 1AE5A 5B6LA 1TGTA 3UQVA 1A1RA 4MG3A 5I25A 1Y3VA 1HUTH 3M36A 1O0DH 3VFEA 2D8WA 2VU8E 4MQAA 5A0AE 1H8IH 2VIWA 5L2ZH 1TE0A 3F9HA 1P04A 5ABWA 2BLOA 4DIIH 3U1JB 2HLCA 1O2LA 4TY6A 1C1QA 1NC6A 3RM0H 3M7QA 1F0UA 1C5OH 2WPKS 3SI4H 2A31A 1Y5AT 1GMCG 1FDPA 4FVDA 1IQMA 1GDUA 4Y6DA 1HNEE 2Y81A 1P2OA 2XBWA 5FX5A 4CHAB 3SV6A 1S6LA 1D6RA 2FI5E 3EQ0H 2FM2A 4NIXA 4JCNA 1C5VA 1C5PA 2K8IA 4MDSA 4KKDA 3SU1A 2LELA 1NFUA 1NTPA 1XUFA 2SNVA 1AFQC 4TY7A 2UUYA 1ZMJA 1O2TA 2KZ4A 2HPPH 2I6SA 1UCYH 1KXFA 4K5ZA 3SJ9A 5C1UA 4UE7H 1MH0A 1ELEE 3LU9B 1E36B 2PKSB 2ZWLH 1RJXB 1B0EA 1QBNA 6GCHG 2ZCKP 2PTNA 2BDHA 4I8HA 1CGJE 1ZTKA 2ZGBH 2IOTA 1KXCA 3F9EA 3ATMA 1OKXA 4DURA 3F2FA 5EXMA 4B2BA 1P2NA 1THPB 3KHVA 1QNJA 2B8OH 4VGCC 3ZZ3A 1ARBA 3UIRA 2XCNA 4LZ4B 4Y8XA 2HALA 5E0JA 1O2HA 2F83A 2W3IA 3FZZA 3SU5A 1UMAH 1TIOA 1O2UA 5EJZA 4ABEA 1SFIA 1GJ5H 2FI4E 3SNEA 2OQ5A 3MO9A 1E79D 1VITH 3V0XA 1IQNA 5ESBA 1GJ9B 1O2WA 3PMJA 3VG8A 1HXEH 3KQEA 2BY7X 2QE7D 1GGDC 2Y82A 1ORFA 1V2LT 3DCLA 6CHAB 3H7OA 2ZIQH 4MVNA 3OY6U 4JZFH 1RRKA 3QO6A 1J8AA 4XBBA 3UPEA 1DWEH 1UHBB 1O2ZA 1ETTH 2PKAA 2UUFB 3MHWU 2AMPA 3RXLA 2BB4A 4Q4LA 3UY9A 3M7TA 2FTLE 1W12U 2M5TA 2LPRA 5PTPA 1OP8A 3UR6A 3MO6A 4MNXA 2VH6A 5SGAE 1YKTA 3UQOA 2JJ1D 2NU2E 2GDDA 1VCPA 5DKMA 2IPHA 1O5DH 1S6FA 3E8LA 2ZKSA 2VVVA 1ELAA 1O3LA 1O3BA 3AW1A 3RP2A 4RSPA 1TPOA 1HAIH 1BBRH 1VKYA 1C1VH 2Q1JA 4JMYA 1GCTC 1DS2E 2WPHS 1QGFA 1YPHE 1KIGH 3RXJA 1BRUP 1OWDA 5C67A 1SR5C 2WYJA 1JWTA 1AUTC 1K9OE 1Z8JB 2ASUB 4WJG2 1HXFH 2ODPA 3DSGA 2A45B 3KQDA 5F8XA 3STIA 1JXPA 2Z9IA 5AHGH 4HGCA 1LQDB 3ZZ9A 1P2QA 1DXPA 2ANMH 3BIUH 3ZVCA 5F6MA 2IPQX 1S81A 4Q2KA 4X1NU 2C8YB 3DSOA 1ZPZA 1QA7A 3GOVB 3HATH 3OU0A 5DP8A 4NG9H 5BRRE 4XBCA 1TRYA 2JETC 1FPHH 1ZMLA 1CT2E 1KXBA 2ZHWH 3QN7A 2JKHA 2VVUA 4X2YA 1GBFA 3S9CA 1O36A 1AWHB 3UB0A 1YWUA 5HXFA 2DE8A 1GBEA 4D76A 1EJAA 2KCOA 2G5NA 1DOJA 4ZROA 4XSKU 1S83A 4FUBA 1P05A 1HJAB 3AW0A 2P94A 1ELCA 3SV9A 1BTYA 1C2MA 2BD5A 5FCRA 3PV2A 2EQNA 4Y79A 1ZYOA 2Z7FE 1O3KA 2Z6BD 4KTSA 5A8XA 3E0NB 3U8OH 1IQJA 3QZQA 2AFQB 1BHXF 1C4Y2 2EI8A 3T5FH 2G4UA 1EB1H 2NU3E 4Y0YE 3BTME 3SHAH 1UK4A 3A88A 4ZHLU 2QYIA 1AGJA 5KEDA 2A7CA 3M3VA 5BPEA 3PRDA 1C2FA 3P8OA 3N7OA 1Z6JH 2KCYA 3O8RA 5JDUB 1CU1A 2TRMA 7KMEH 1NROH 2A4GA 1O2MA 2WZQA 4X2VA 2PSYA 1X7AC 3EA8A 5A8YA 3ZV9A 2Y5HA 3GCNA 1SLUB 3O8BA 1WU1A 1FAXA 4X1QU 4JZ1A 4VGCB 1O3OA 4XE4A 4JK6A 5C20A 2J34A 2AHME 1MU8B 3UFAA 1QL9A 1DE7H 1WDIA 1EOJA 2PGBB 1ELBA 3TLOA 2XBXA 3LOXA 1C4V2 2GKVE 1TA2A 1ZSJA 2A2QH 1FIZA 4ABBA 1NFYA 4DT7B 2YOLA 2ZHQH 3HK6B 4DOQA 1ANBA 1K22H 2XC0A 4CBNA 4O03A 1ELFA 1KXEA 3ATLA 1FPCH 2W5EA 1V3XA 4BTTB 1XUJA 1AKSB 2R0LA 3TNTA 1UTJA 4A5TS 3RXHA 5E2PA 1CQQA 1K1OA 4RT0A 1J9CH 2NU0E 3URCA 2CMYA 3S69A 1KDQB 3NRLA 4AFUA 1BMFD 2FS9A 1UTPA 4NCYA 4UDWH 4ZKNU 2TGAA 4AGJA 1IQEA 2XXLA 3S9AA 1V2KT 4ZXYH 1BCUH 3PV4A 4YO9A 1Q3XA 2OC8A 5C1XA 1PQ5A 4U30A 3ITIA 3SUGA 5IDKA 4WMEA 1GMHG 1P01A 3SI3H 2Y7XA 3A80A 1S6HA 1EUFA 1VITF 1AU8A 1KYNA 4HTCH 1MAYA 3EA7A 1ABJH 2KCAA 3RU4E 4CRBA 2AYWA 1COWD 1F7ZA 1FX0B 1GBAA 1OWHA 4BAHB 5KGOA 1ACBE 1CSOE 3LGYA 1C1MA 3BTDE 1GBLA 3SNDA 4AG1A 4I8GA 3OTPA 3ODDA 4QT8C 2B9LA 1NPMA 2C8XB 2GCHG 4B1TA 8KME2 2R3UA 1P9UA 4CRFA 1GBTA 1LPKB 4TSFD 1DY8A 1BB0B 3A7XA 4HI3A 3GY3A 3SUFA 1MZDA 2ZGJA 2UUKB 5C5NA 5AFZH 1NT1A 1T7CA 4RKOB 1HLTH 2A4OA 1EKBB 3BG4C 2FOCA 4YOIA 4IBLH 1TPAE 2UWPA 2RG3A 3MOCA 3S0NA 2CHAB 5HM9A 1C2KA 3JZ1B 3B8JA 1CT0E 1EJMA 2ESTE 2CF9H 2F9NA 1DICA 3EDXB 3Q3YA 3BTGE 3A7VA 3TGIE 2QXJA 1CBWB 4K69A 4X2WA 4U01A 1DUEA 1G30B 1VCWA 5C1YA 2VH0A 3A7YA 3RC6A 4YLUA 1BRBE 1CA0B 1A2CH 2J4IA 1SGTA 1QURH 1EZSC 1L1GA 5FBIA 3P92A 1QL7A 4JYTA 5JB9S 3OE7D 5C3NA 2JH5D 3U9AH 3TK6A 4Z1MD 1ANDA 2BQ7B 2QA9E 2ZDLA 3DSPA 5ESTE 2VIOA 3F6UH 1SMFE 4GCHF 1C1TA 1O3PB 4TWYA 1CHOG 5E0HA 1GBHA 3GY7A 1UCYE 7ESTE 5CE1A 4NFEA 2H5CA 2SGFE 4ABGA 5HGGA 3L6PA 3K6YA 3MTYA 3RXOA 2A5KA 3SGBE 1DDJA 1XX9A 4X6OA 2BMGB 2FEQH 4ZAEA 1C9PA 1YY3A 4IN1A 1XUHA 5JBBS 2OC7A 1SGIB 1HV7A 4U2WA 4Y71A 3IG6B 3UOPA 3LONA 1HCGA 4ISNA 4DY7B 4MPWA 1MAXA 3NK8A 4YM9A 1Y3WA 4F55A 1A5HA 3GY5A 1O5CB 1V2ST 3RXPA 2Y6TA 3HKJB 4NFFA 1L1NA 2H9TH 1MTNB 4I8JA 3TK5A 1SGEE 3BTKE 3OEED 2PTCE 1GHYH 1GI6A 1W13U 1V2NT 3KCGH 4ZH8A 1A5IA 3KN2A 1NZQH 4X8VH 3ZZ5A 1UVUH 5K0HA 1F2SE 1BBRK 3R3GB 1O2RA 3JZ2B 3A7WA 2ZGCA 1QZ8A 1BRAA 1FNIA 2P8OB 8ESTE 5EOKA 1BIOA 1LKBA 2BDIA 5A0BA 2ZPQA 1YF4A 3ZVDA 1GMCF 1BTUA 3VGCC 1MBQA 2BQWB 3RXCA 1VGCC 3BN9A 3AASA 1D3PB 1W14U 1A46H 2ZHEH 4CH8B 2A4QA 2LNCA 3T62A 1P10A 1L4ZA 2ZGHA 1Y3XA 2XYAA 1TX7A 4MLFB 1QBVH 1A3EH 1GI0A 4FUFA 1A0HB 3F0PA 1QFKH 1FY3A 4TPIZ 1A0LA 4BAKB 2P95A 5CHAC 2FDAA 1BTWA 2FLBH 1S82A 1GMHF 1H8ED 1TX6A 2ZFRH 3PLBA 1MCTA 2CXVA 2QGRA 4UONA 2VWOA 1PPEE 3ZVEA 1TQ0B 3GCTG 2FOGA 2VGCB 4K60A 1DUAA 1NRSH 3DFLA 1ZTJA 4LK4A 4AX9H 1MKWK 5T6DA 4DJZB 3MH5A 2AH4X 1V2PT 4NIVA 1MTNC 2QF0A 1TOMH 4A1XA 4X8UH 3KYFA 2VIPA 1OPHB 5JBCS 3MU1A 4JZIA 3MNCA 1P2IA 1U6QA 1XKBC 2XBVA 3PTBA 4Y7BA 3SGAE 2GT8A 4ISIH 1FONA 1C4U2 3F0OA 4CBOA 2HNTC 1O2JA 3RXQA 4U32A 1O2XA 2BD3A 4CRDA 2WPMS 1GI5A 3PLPA 1L2EA 1GCTB 3RXFA 1UK2A 4FUCA 5EG4A 5JBTA 3BEIB 2J92A 4NGAH 5L2YH 4ABJA 4RT1A 2RA0A 1O2SA 3SU3A 3GYMA 4MNVA 1A61H 1TNHA 3OY5U 4DG4A 2Z9LA 5DP4A 2O8MA 3RXSA 1QIXB 3RLWH 2QIQA 1YPEH 4AC9A 4K1TA 1TPSA 2GV6A 3M5OA 1BJUA 1OP2A 2YMSB 3CS7A 1K0HA 4D8NA 1C5QA 1CHGA 4ZUHA 1DVAH 2JETB 1ZLRA 1GHBF 2RCEA 4J2YB 3SV8A 1YP9A 3UR9A 3I78A 5FHTA 1H1BA 3L3TA 2CV3A 1VR1H 1CBWC 3LGUA 3UAIC 3TK9A 1FY1A 1A5GH 3GDSA 2Z94A 3SU0A 1DWDH 1FI8A 1H9LB 3A8AA 4YZUA 3ELAH 2OTVA 2ZFFH 4OS2A 4AZ2B 4MNWA 1BITA 4TPYA 1D3QB 1ZRKA 3QWCH 4CR9A 3ODFA 3OEHD 1GHAG 1OX1A 5C17A 1YPMH 1NU7B 2ZU5A 1XUGA 5FPTA 4DIHH 1QB9A 1IHTH 4OM9A 1CGHA 1GI8B 2GJGA 5C0UA 4GAWA 1TOCB 1TA6A 3A8CA 2AEIH 2EEKA 3LJJA 1XXFA 1Y5BT 3GDVA 1EX3A 3GCHB 2V7QD 3MNSA 1F0RA 5ETXA 1XUKA 4B75A 5EXNA 1CT4E 2QF4A 1SGCA 3CP7A 2V6NA 2FOEA 3NZIA 2Z9KA 1LVBA 1EP5A 2V3MA 3ZVFA 2FX4A 2CN0H 1THSH 1W7GH 3DA9B 4XRNA 1T31A 1G2MA 2BX4A 2B5TB 5L30H 3HGNA 4CRGA 4FU8A 1L1JA 2BDBA 1TMUH 6ESTA 1XVMA 4ZHAA 3GYLB 2Z3EA 5HMAA 2P8OC 2G51A 3UOUA 4ISHH 4B76A 2Z9JA 1TBZH 2AGIX 1O2PA 1F92A 1FIWA 3PM3A 3BG4B 1AMHA 5G4BA 2GT7A 2PLXA 2HRVA 3V13A 3ZZDA 4DVAU 3TNSA 1P12E 3LT3A 2PR3A 1UTNA 2WSSD 4FU9A 5EGMA 1UTKA 1C1OA 3O8CA 2VIQA 3D49H 3HGPA 1QQ4A 2WV9A 1GBBA 4A92A 3BTFE 1B0FA 4AFZA 5JBAS 5FL7D 2FX6A 1EPTB 2BVSH 2ALPA 1O3AA 3LPRA 1P9SA 1UVSH 4I32A 1AZZA 4UEHH 1C5UA 2P3TB 1GBIA 2FS8A 1DANH 3GCTF 1O5FH 3M5LA 3SO3A 4AB9A 4ZXXH 1K1NA 2A0QB 1F5RA 1C5NH 2ZFQH 1MQ6A 3FFGA 1K1IA 3SZEA 3SUDA 1DFPA 1LHCH 5DP6A 3F2HA 3RXVA 2O8LA 3ZV8A 3AAUA 4I31A 5IYTA 2D2DA 5EQSA 3TGJE 1P8VC 1EPTA 2XNIA 4DW2U 3M5NA 4ISOA 1JOUB 3MNBA 2GDEH 1HRTH 2BZAA 3FO8D 1PPFE 1GJAB 3GY2A 4B74A 1Y5UT 2QAAA 2Q6DA 2OUAA 3K9XB 4K8BA 1W3CA 3RUOA 3QK1A 3VB3A 3EGKH 2V3HH 3RDZA 2GZ7A 4H42U 1TX8A 3M3SA 1D3TB 3GISB 3RXKA 1BTPA 1UHBA 1Z6EA 1G32B 1QL8A 3P6ZB 1V6DA 4YT7H 1O39A 1E34B 2JJ2D 2GMTB 4INHA 3SU6A 2ZG0H 2EI6A 3SV7A 1K1MA 1N8OB 1DITH 4Y8ZA 2GVFA 1SGDE 3U98H 2YMSC 1CHOF 1C2HA 3KQBA 1IQFA 1SGPE 1UJ1A 4ZKRU 2C8WB 1HIAB 4E06H 2FYRA 5A2MH 1PJPA 2H9EH 2QV1A 3ZVBA 3PWBA 5DP3A 5DP9A 6GCHF 3SNBA 1TALA 4TT3D 3E3TA 1GJ7B 3U28C 4X6NA 1XMNB 2TGPZ 1NN6A 1OS8A 1LMWB 1BUIA 1GCDA 5JB8S 4INKA 4H6SB 2KCPA 3FVFB 1HBTH 1O2GH 2EY4C 3H5CB 5EPYA 1SBWA 5A0CA 4Y76A 2NU1E 1C5LH 2QY0B 7GCHG 1NU9A 1UO6A 1ZR0A 2BDGA 2D1JA 5DPAA 4Q7YA 3MYWA 5CHAB 3FAOA 2YMSD 1UK3A 1Z1JA 4AB8A 4OGYA 8GCHG 4BXSA 3P8NA 1WXRA 1TPPA 4HG6A 1O38A 3DD2H 1TFXA 4SGBE 2OP9A 1DX5M 2A5IA 3LGVA 4PROA 4INLA 3OSYA 1LTOA 4FUGA 4FUHA 2XOKD 5K7RA 4WH6A 2R0KA 1VGCB 3SZNA 1ZJKA 5C5OA 3PMAB 2FOBA 1QTFA 3RMMH 3PMHB 1KLIH 3E1XB 1MUEB 4IMQA 4TYDA 1QJ7B 1GMDF 3KEEA 2RDEA 3T2NA 5LPRA 3MO3A 5KECA 2ODQA 1GJ6A 3HPTB 4ASHA 1AQ7A 3KQ5A 2THFB 3SHCH 4ASUD 1JRTA 1IHSH 2ZU1A 3FP7E 1GHZA 4FXGH 4NA7A 2WPJS 3OYPA 1OWEA 2OINA 4Z0KA 3SW2B 1DXWA 1QY6A 4DT4A 4X6MA 4Y11E 1AB9C 4D7GA 1GBCA 1L0ZA 2J98A 3TH4H 1G2LA 2ZU2A 1MKXK 3A84A 1Y8TA 4KTCA 1RTLA 1ZHRA 4CREA 1PPGE 5A09A 2C93B 2WUBA 2ZTZA 2BXUH 1HAPH 1J16A 1LPZB 1W2KH 4BOHA 3TJNA 3OTJE 1HAVA 1S85A 1GI9B 5L6NH 2EA3A 2G5VA 4AOQA 4WWYA 2O8TA 1AD8H 2ANYA 4P02A 5GPIB 4WXVA 3SORA 4GSOA 4AG2A 1GVLA 2FOMB 2IJD1 9LPRA 1JRSA 1QJ1B 2W6JD 2FPZA 1ABIH 1OYTH 1MKXH 2L74A 3A81A 3A86A 3RMOH 5B6OA 1FN8A 1MTVA 3RMNH 1Z7KA 2BQ6B 1TAWA 1G9IE 3Q76A 4GHQA 2PKSC 1OOKB 5GIBA 1DSUA 3QZRA 4Q7ZA 3MMGA 2VIVA 1WCZA 1GI7B 2XBYA 3C1KA 1AB9B 3G01A 1O2KA 1NFWA 2G4TA 4CRCA 2J2UA 1MD7A 1P03A 4XOJA 1TONA 2FODA 1BOQA 1FJSA 2R2MB 4ABHA 3LGIA 1GBDA 2OD3B 3PYHA 1NRQH 3BSQA 1A3BH 1V2QT 2ANWA 2R2WU 2F3CE 1T8LA 1YM0A 2BLQA 2CJIA 1C5ZB 3ZYEA 1EAUA 4ZKOU 1W0JD 1C5MD 1GPZA 2XTTB 1O3MA 1O3HA 5DO4H 4MPXA 4JYUH 2F43B 1JIMA 1O2VA 2SGEE 3ZVGA 2BVRH 3HK3B 2BLWA 3ZVAA 1P09A 1GVZA
chains in the Genus database with same CATH topology
1TGSZ 2VNTA 3RMLH 5FAHA 1P3EA 1C5SA 4MPUA 1TQ7B 5EW1H 3DT0H 1UTOA 2F9VA 4ABIA 8LPRA 2KAIB 2DE9A 2PW8H 1V2OT 5EU8A 2O8UA 1GDQA 2FOAA 3VXFH 3URDA 4OS1A 3ZZAA 4BTIB 3CENA 3LH1A 1GHAF 2BY6X 2XRCA 1O3IA 1O5AB 2P59A 1O2QA 4IC5A 1EOLA 3BTTE 3A83A 4GUXA 2WPIS 4XBDA 3TJUA 3S9BA 1V2JT 4O97A 4I7YH 3P95A 1V2VT 2F91A 1EPTC 1C2JA 4K1SA 1GI4A 1SGFA 2P16A 3Q3KA 2QN5T 4F49A 3PB1E 3FZDA 1SL3A 1QB1A 3UWJH 4IN2A 2ZA5A 1WYKA 3P8FA 3W95A 1AWFH 2J95A 5T6FA 1PQAA 1PPZA 4YTAA 3QLPH 3NCLA 2OBQA 1F5KU 1F0SA 2ZHFH 1ID5H 3PMBB 4A1VA 1C1UH 1AZ8A 3RXBA 1LQEA 3B9FH 3MU5A 4AGKA 1H9IE 3RU4D 3UUZA 1G3DA 1EZUC 3K2UA 4CR5A 3MFJA 2ZEBA 2VJ1A 1AFQB 1OSSA 1C5XB 1DLKB 1J14A 2JH0D 4LXBH 1D6WA 1YPJH 1Q2WA 1SQAA 4JYVH 4AORA 4ZHMU 1HJ8A 1A4WH 2BYAX 1FLEE 3A7TA 1LVYA 5CMXH 3TH2H 3H7TA 3TU7H 1OWKA 5EQQA 3LKWA 5F8ZA 1E37B 1MD8A 1AFEH 4ABDA 1P2JA 3UNQA 3QGJA 1T4VH 4SGAE 1W11U 3IWMA 4I8LA 4BAMB 1C2EA 4NSVA 3NKKA 2ZZUH 1IQIA 1RTKA 1SHYA 1AO5A 1WTHD 3SJ8A 2HOBA 3P8GA 4FU7A 1Y3YA 2PWXA 2HNTF 2PV9B 1HGTH 1VZQH 2QXIA 1BT7A 1EP6A 2G52A 2F9PA 3NUMA 1AY6H 1GBJA 2BXTH 4Q80A 3O8DA 1PQ8A 1MKWH 2ZGXH 1SQOA 1Z8IB 1ESAA 3LC5A 1TNGA 2VIDA 3DFJA 5DG6A 3BTQE 1O2OA 3BEFB 2VWMA 3M7UA 4WXIA 3LIWA 2FOFA 1GHWH 4X0WU 1HDTH 1XKAC 2W7UA 4O3UA 5EXLA 2F9OA 3ATKA 1G3BA 2GP9B 1J15A 1PQ7A 2CHAC 1HAYB 5GXPA 1BQYA 1KXAA 2G55A 2BM2A 1GBKA 3LGTA 1MTSA 5J4SA 4A1TA 1V2WT 2GD4B 2BD8A 2WINI 2TIOA 2FLRH 4NIYA 5I46H 2ZNKH 2G00A 4JZEH 3D65E 4BXWA 2ZTXA 1GG6B 2QCYA 1HFDA 1TMTH 2C4FH 1TNJA 1VJ9U 5E8EH 1WUNH 3RXGA 4ABFA 2ZFTA 1RFNA 1W7XH 2WYGA 4E7NA 3FP6E 1BTHH 1PFXC 5LPFA 2O8WA 1RXPA 2ULLA 1ELVA 2J38A 4MTBA 4YESB 5AF9H 8GCHF 2J94A 2ZU3A 3W94A 1O33A 5GJ4B 1SHHB 2PUQH 5F03A 1GI1A 1JBUH 3UTUH 1KXDA 3ESTA 4Q7XA 1LCYA 1Y3UA 1SGQE 1TRMA 2BOKA 2HGTH 4H4FA 5EQRA 1SLXB 3SGQE 1LHGH 1AHTH 1ARCA 1P02A 1G36A 5AFYH 1SVPA 1V2RT 2ZO3H 2NWNA 4X1RU 2ANKH 1UVOA 1C1NA 1HYLA 4X2XA 3BTWE 4FUDA 2ZHDA 2GX4A 3TGKE 2GTBA 3LC3A 4ZMAH 3U69H 4JZDH 3P70B 1LO6A 1XM1A 1T8OA 1NRPH 4GPGA 1TGBA 3E91A 2BLVA 1ZHPA 1J17T 1YCPM 2PHBA 2SFAA 1SQTA 2WUCA 4Y8YA 4B2CA 3KL6A 2FESH 2P93A 3NWUA 3K6ZA 3TH3H 1QCPA 1C5TA 4AYVB 1O2YA 2GZ8A 1FV9A 1ZJDA 1LVMA 3BV9B 2F9UA 1FXYA 4NZLA 3RU4T 4LOYH 1MMJN 2A7JA 1HPGA 2C90B 4KTUA 1CA0C 1VCQA 1GHBG 1D9IA 1EASA 1Z71A 3OX7U 3NPSA 4X8TH 5F8TA 3U8TH 3RXEA 2ZCLP 1YPGH 4CHAC 1O3NA 3UNRA 5HM2A 5GWZA 4Y10E 1BMAA 1BHXB 1T4UH 2BY9X 1IQGA 3FANA 4XDEA 3PTNA 3T25A 5LH8A 3RXTA 1UVTH 1TLDA 9ESTA 2J9NA 1DY9A 3EAJA 1DPOA 1O32A 1SG8B 1KDQA 3EE0B 4WVPE 3RXRA 2XWBI 1QRWA 1N8OC 4YT6H 1K1PA 4BNRA 1GJDB 1EXFA 1O35A 1O3EA 4BAQB 2GCHF 4AFQA 2SGDE 4NWLA 2OC1A 1AI8H 1NRNH 1TRNA 1P0SH 1K21H 1ZSLA 3A85A 1W0YH 4TWWA 1K2I1 1LHDH 2FI3E 1XXDA 3V12A 1S5SA 1EAXA 2R9PA 1MTUA 3Q00A 1YPHC 2DUCA 2W7SA 2XW9A 2ZECA 4LZ1H 2KAIA 3BTEE 1ANEA 2BY5X 1O5EH 5LGOA 2QF3A 3BIVH 1UTMA 1W8BH 2D26C 1HIAA 4NA9H 4K1EA 3TJOA 1HJAC 3VXEH 3UWIA 3GY4A 2ALVA 3BTHE 2HNTE 2YNBA 3ZZCA 3LH3A 1H8DH 2BDAA 1FN6A 2GGVB 2A7HA 3TVJB 1H9HE 3B23B 5J4QA 3S7KB 2FIRH 1O5BB 2V0BA 2ZC9H 2GCTC 4I33A 4UFFH 2VGCC 1GBMA 7GCHF 1YBWA 1WAYB 2ZPSA 1NESE 3QTOH 2HVXA 5AVDA 2RDLA 4GCHG 1QR3E 4WMFA 1GG6C 1BTXA 4A7IB 5FCKA 4NZQA 1HB0B 1RIWB 1Z1IA 2Q6FA 1BA8B 1SOZA 1XVOA 1TMBH 1QHRB 2BD7A 1PYTD 2BOHB 3MWIU 3SJIA 2FP7B 2ZCHP 3A82A 1O3GA 1TYNA 4AYYB 2TGTA 1SPJA 1GMDG 4I8KA 4O9VA 3MNXA 3SQEE 1SLVB 1YLCA 1NRRH 4BTUB 1V2MT 3ZZBA 2QXHA 5FXLA 2H9HA 1K28D 2ZDVH 3HKIB 3QUMP 5E0GA 1WQSA 2ZP0H 3STJA 4M7GA 5EODA 1THRH 2W26A 1KLJH 3PLKA 1WSSH 2W3KA 3DUXH 2V3OH 4KELA 1FAKH 4X1SU 2GMTC 1AN1E 4CH2B 1INCA 2Y7ZA 1C9TA 2Z3DA 2Y5GA 2PGQB 1RGQA 1EZQA 4IGDA 1WQVH 5TCAA 1DM4B 4RKJB 1RTFB 1EQ9A 1TNIA 4HFPB 4DGJA 1TBQH 2ZPRA 4O3TA 3MH6A 5DGJA 1S84A 4GHTA 1SC8U 1A7SA 1SGFG 2ZDAH 4UD9H 2IN2A 2FZZA 1NS3A 2FMJA 3K65B 3QDZB 2VVCA 3MU8A 1AKSA 3A8DA 3PROA 4D7FA 2BTCE 3D23A 3NXPA 2Y80A 4J1YA 3SUEA 1E38B 2VWLA 4GLYA 2ZQ2A 2UWOA 1AVWA 1YPKH 2FYQA 1EAWA 4KP0A 3T29A 1AVGH 1BZXE 3TPIZ 1NFXA 7LPRA 1ELGA 3VB4A 2SNWA 3GDUA 1E0FD 2PKAB 2PFEA 1ZZZA 2AS9A 1S0QA 4ESTE 3IITA 2OXSA 4UFEH 1TGCA 3MU0A 1D4PB 3WY8A 1GI2A 2RA3A 1QRXA 1GWAA 1MBMA 2ZF0H 1Z8GA 1IOEA 3M3TA 1P2MA 4RN6A 2GV7A 4D9RA 2WPLS 2STBE 4Y0ZE 1A0JA 3KF2A 1AIXH 3MU4A 4FUEA 3SOSA 3VPKA 1CGIE 1BTZA 3M35A 3UREA 1CA8B 3RXUA 3M5MA 1N6XA 1GJCB 3ZZ6A 1PPHE 3I29A 4OS5A 3I77A 1P57B 1B7XB 2TPIZ 1DWBH 1C1SA 1PPCE 1ZGIA 2BVXH 3U8RH 1YC0A 1B5GH 3EYDA 3ZZ7A 1MTWA 2H5DA 3A89A 3VGCB 3M37A 1SLWB 2STAE 3RXIA 3F9GA 1P3CA 3LJOA 2G81E 2TGDA 4B71A 4XFQA 4AN7A 1O3JA 1TWXB 4YLQH 1AVXA 3P17H 2BD9A 2XCFA 1P2KA 1YCPK 3SN8A 1GL0E 3KNXA 1C1RA 1O3CA 2CF8H 1OWJA 1WTGH 1MZAA 4AFSA 2P3UB 3A87A 4FUJA 3RXAA 2OBOA 2ZDMA 1GJBB 2BD4A 3SU2A 3MH7A 3TIUA 2I6QA 5LPEA 4KGAA 2O9QA 1BRCE 1C5RA 1FMGA 1XUIA 4B2AA 1LHEH 1IQKA 1H4WA 1Q31A 2F9BH 2UWLA 1QJ6B 3E90B 1YYY1 3TITA 5FPYA 1EB2A 2Z9GA 5GCHG 3ATWA 1C5WB 3ATIA 3SNCA 1BBRE 5FPSA 3T26A 2WV4A 3CS0A 1W10U 4JK5A 3E0PB 1DWCH 4B73A 2UUJB 1E35B 2H2ZA 2C8ZB 2IJOB 4DCDA 1QRZA 4MPVA 1FY8E 2BDYA 4K8YA 1OP0A 2A32A 1EATA 2SGPE 2QC2A 5FX6A 1O30A 1ZGVA 4BANB 2H1UA 1ZHMA 1YCPH 3MH4A 3F1SB 1OWIA 1IQLA 4ZKSU 4IS5A 3E16B 4UFGH 1ZMNA 3VEQB 3PO1C 3S7HB 2OLGA 4ISLA 1GVKB 2R3YA 1AE8H 1BMMH 1OYQA 3C27B 1ZTLA 1JMOH 5T6GA 1WV7H 1HJ9A 4NWKA 3RLYH 4WMDA 1LPGB 1GJ4H 1ZSKA 1LDTT 1WBGB 3V3MA 5GCHF 1T8MA 1CE5A 4E05H 2ZQ1A 1ESTA 1K1JA 1NY22 1GJ8B 2K1QA 1HAGE 1F5LA 2AIPA 3GY6A 3GCOA 2PSXA 1BMNH 2TBSA 5HYOA 2OCVB 1KTTB 4UFDH 4WF8A 1G37A 4K3JA 2VWNA 1BMLA 2ODYB 3DHKH 4IC6A 2AMDA 2AMQA 1SOTA 1O2NA 3FP8E 1RD3B 3A8BA 3T28A 2ZDKA 2B0FA 5FBEA 4BAOB 2YNAA 1S0RA 2B7DH 1ESBA 4MNYA 4E7RG 3RC5A 1P06A 1CO7E 2BHGA 1UTQA 2ZTYA 3L33A 2Z3CA 2VINA 4GVUA 1O3DA 4WY3A 1UCYK 5A8ZA 3UNSA 1V2UT 4FVBA 1RS0A 2BX3A 3QGNB 1V2TT 1ZRBA 1F0TA 1SFQB 4YOGA 1C1WH 1DLEA 2FOHA 3ZZ4A 4YOJA 2GCTB 1G3CA 1MCVA 1YGCH 2P3FH 2V35A 3E6PH 3QTVH 1LKAA 1VITG 1C2IA 1K1LA 2XC5A 4X8SH 1QQUA 5DP5A 4HZHA 1ELDE 1FY5A 2BZ6H 2ZU4A 2HPQH 1SGYE 3ENSB 5H4IB 4OS6A 1SB1H 4X1PU 1YPLH 3PWCA 1C5YB 1TABE 1JIRA 3AAVA 2EC9H 2ZFSA 4IMZA 2AGGX 2A1DB 3BF6H 2Y5FA 1W0ZU 1O2IA 3GY8A 3MI4A 1C2LA 2QXGA 1VJAU 4Y7AA 1P11E 1ZPBA 1WOFA 1FZZA 3LDXH 1GHXH 4OS4A 3RXDA 4OGXA 3ZZ8A 1ELTA 1RIWC 2AIQA 3LGWA 1TBRH 1HAOH 2SGQE 4ABAA 1LHFH 2OC0A 1T32A 1SGRE 2WV5A 4FUIA 1IQHA 5JPMH 4X6PA 3VB5A 1ETRH 3SNAA 6LPRA 1HAZB 1UVPA 1T8NA 2SGAA 1O31A 4OS7A 3SBKA 1BJVA 2VB0A 1NM6A 1ZPCA 2BDCA 2A2XH 2ILNA 4H6TA 4R0IA 1C2GA 1TB6H 1SSXA 1C1PA 5GDSH 4R8TB 1TNKA 1Z8RA 3Q3XA 1GGDB 1G3EA 1C2DA 3F9FA 4NA8A 1Y59T 6CHAC 4NIWA 2Q6GA 1QB6A 5DP7A 5TCCA 4F4OC 3AVZA 1LVOA 2FWWA 4CRAA 1O34A 1SI5H 2JH6D 3GCHC 3TJVA 2BY8X 2EI7A 4THNH 4WH8A 2NU4E 1GI3A 3BEUA 3RC4A 1HAXB 2AERH 3F68H 1KY9A 2FXRA 4D9QA 1FQ3A 1D3DB 2OQUA 1KSNA 3Q77A 1SGNE 5DJ7A 5EW2H 3KGPA 1CVWH 3M61U 1YLDA 3RXMA 2FO9A 1BDAA 1GHVH 1FY4A 3ZYDA 2FTMA 3D62A 3SJKA 4A6LA 1O5GH 3R0FA 2C3SA 1DSTA 1IAUA 3RM2H 3PO1B 1TGNA 4K2YA 2ZDNA 3VB7A 3U1IB 1ANCA 1PYTC 3V7TA 2A4RA 3VB6A 3BG8A 4Z6AH 2HWLB 1TNLA 1MU6B 1ETSH 1GL1A 2G8TA 1L4DA 4NSYA 5T3HA 1PPBH 1OXGA 3KQCA 1EJNA 2H6MA 3SV2H 3A7ZA 1QBOA 1FUJA 1O37A 2ZI2H 1DT2A 1ZOMA 1GDNA 3KIDU 3GICB 5E2OA 3SU4A 1MQ5A 2GZ9A 3SQHE 1EAIA 5TJXA 1O3FA 1NO9H 2XWAA 1HAHH 1QA0A 1HAVB 1N6YA 2ZFPH 1AUJA 2A5AA 5EPNA 2XC4A 1EZXC 1M9UA 1N1LA 2BD2A 5JYIA 1UTLM 3T27A 3EA9A 2CGAA 1KTSB 2AGEX 2PUXB 1KLTA 3SJOA 5DK1A 3QX5H 5C2ZA 4IW4E 1AE5A 1TGTA 3UQVA 1A1RA 4MG3A 5I25A 1Y3VA 1HUTH 3M36A 1O0DH 3VFEA 2D8WA 2VU8E 4MQAA 5A0AE 1H8IH 2VIWA 5L2ZH 1TE0A 3F9HA 1P04A 5ABWA 2BLOA 4DIIH 3U1JB 2HLCA 1O2LA 4TY6A 1C1QA 1NC6A 3RM0H 3M7QA 1F0UA 1C5OH 2WPKS 3SI4H 2A31A 1Y5AT 1GMCG 1FDPA 4FVDA 1IQMA 1GDUA 4Y6DA 1HNEE 2Y81A 1P2OA 2XBWA 5FX5A 4CHAB 3SV6A 1D6RA 2FI5E 3EQ0H 2FM2A 4NIXA 4JCNA 1C5VA 1C5PA 4MDSA 4KKDA 3SU1A 1NFUA 1NTPA 1XUFA 2SNVA 1AFQC 4TY7A 2UUYA 1ZMJA 1O2TA 2HPPH 2I6SA 1UCYH 1KXFA 4K5ZA 3SJ9A 5C1UA 4UE7H 1MH0A 1ELEE 3LU9B 1E36B 2PKSB 2ZWLH 1RJXB 1B0EA 1QBNA 6GCHG 2ZCKP 2PTNA 2BDHA 4I8HA 1CGJE 1ZTKA 2ZGBH 2IOTA 1KXCA 3F9EA 3ATMA 1OKXA 4DUR