5JYIA

Trypsin bound with succinic acid at 1.9a
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
219
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
molecule tags Hydrolase
publication title Trypsin bound with succinic acid at 1.9A
rcsb
total genus 53
structure length 219
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5jyiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5jyiA02
2ZFRH 4OS6A 5LPRA 1KXEA 1GI8B 2ZU3A 2GGVB 3GCHC 5JBCS 1P2NA 1T32A 2JKHA 2GMTB 2O8UA 3BTQE 5JPMH 4TYDA 3TU7H 4ISOA 1BTZA 3V3MA 2VU8E 1BA8B 3P8GA 4I8LA 1ZTKA 1TBQH 1O2UA 3A7VA 3ODFA 1GHWH 1C4U2 1Z8RA 3GDVA 3P8NA 1HJ9A 3A7TA 1S5SA 3DA9B 4FUDA 1SGEE 1QR3E 2XRCA 3NKKA 1KXDA 1TX6A 4E05H 4U30A 1YC0A 1SFQB 1FNIA 2BQ7B 3QLPH 1L1GA 3MH7A 3BSQA 1TNIA 3EGKH 2BDGA 2BX4A 4JYVH 3A89A 2VH0A 1K1LA 5EQQA 1O5AB 1CT4E 4JZIA 1HAXB 1AKSB 1AWFH 1C1QA 7GCHG 1TYNA 3SJKA 4WMEA 1KDQA 5DG6A 2A4OA 1HAYB 1ZRKA 4ZMAH 4K8BA 4NIYA 4DCDA 2XC5A 2OTVA 2OC0A 1EUFA 1GJ8B 1O2ZA 2ZTYA 2F9VA 3M7TA 1EASA 3VGCC 1O32A 1L0ZA 2D8WA 1IQLA 5LPFA 3QTOH 2ZGBH 1TBZH 1LHCH 5JBTA 2UUFB 4UD9H 4RKJB 5AVDA 2BLVA 1G36A 3K6YA 1L2EA 3AW0A 5EW1H 4X1SU 2BD2A 5FPTA 8ESTE 5JB9S 3P95A 5DO4H 1T8OA 4X2WA 2AEIH 3IWMA 1ZJKA 3U8TH 3I29A 2FI5E 3LC5A 3NCLA 1WQSA 4KELA 2J34A 1HAOH 2WPMS 3Q77A 2ZFFH 2O8LA 1GBTA 2BD5A 1S83A 4OS4A 1EZUC 4AFSA 3RXAA 1C1MA 3KHVA 1O0DH 1D6WA 4A1VA 3SZNA 1FY1A 2Y6TA 1WBGB 1QL9A 1BT7A 1YCPH 4D76A 1PYTD 1FMGA 1MTNC 3VXEH 5HM9A 1ARBA 3PROA 1AB9C 5A0CA 5EXLA 1XVOA 1UVOA 3MH4A 1D9IA 3UR6A 4Q7YA 5GPIB 2H5CA 1DY8A 4HI3A 1RFNA 1XXDA 1CGHA 2Q6DA 1QA0A 3BTME 1GJBB 1O3MA 1QIXB 2FYRA 3HPTB 5EOKA 4IC5A 2BQWB 2R2WU 4CRAA 7LPRA 2AYWA 2ZI2H 1EPTC 2TPIZ 4DIIH 4DGJA 4IBLH 2Y82A 5C5NA 1C4Y2 1EATA 4FU8A 2G5VA 3RC4A 3ATLA 1CT0E 4CBOA 1H4WA 1NU7B 1PPEE 2BDHA 1ANDA 1C5OH 1BTHH 1BIOA 4ABDA 1S82A 2R0KA 1N6XA 1C5UA 1OP8A 1FAXA 3UQOA 3MI4A 1QRZA 3QZRA 5DP7A 3UPEA 3MU8A 1AVXA 1ZMNA 3DD2H 1P57B 1Y5AT 3SGAE 4JCNA 2QIQA 1PPGE 3ELAH 3QUMP 8GCHG 1TGNA 2GCHF 4X2YA 1NPMA 1A0JA 3P17H 8LPRA 2C93B 4U32A 1QURH 3S9BA 4OGXA 1W8BH 2FP7B 3SV9A 3PTNA 1BITA 2KAIB 3SNCA 4FU7A 1C2LA 4B2CA 1O3DA 1GMCF 1CU1A 1C5MD 2FOBA 1K1NA 3S0NA 4BAOB 3E3TA 6CHAC 3S7HB 5EGMA 3BTHE 2BD9A 5J4QA 3VB4A 2XXLA 2I6QA 4Y76A 2AMQA 1V2PT 2Y5FA 2ZPQA 1WTGH 1YPHC 4H6TA 1MTVA 4K1EA 2F9NA 1C9PA 2UUYA 2ZDAH 3T27A 1HGTH 3PB1E 2WUBA 2M5TA 1FI8A 2NU2E 4D7GA 1LQEA 4FUBA 1U6QA 4HTCH 5DP5A 1C2HA 1C5YB 4PROA 2FS9A 5DPAA 1OXGA 3ODDA 2BDCA 2FOEA 2SGFE 2ZHDA 4ABJA 4R8TB 1LPZB 2B5TB 2GDDA 1NRSH 4Y6DA 1MAYA 1PFXC 3RMLH 1JIRA 1GI9B 1Q3XA 1GMDG 5HGGA 3M5NA 1SOTA 1NRQH 4X2XA 2TGPZ 2XWAA 5EXNA 3RLYH 3TJUA 1GMCG 2FOCA 2QY0B 2HNTE 2STAE 4I8JA 1D6RA 1O3JA 1IOEA 1N1LA 4M7GA 3MNCA 4I7YH 2F9PA 5HXFA 3ZZ7A 2W7SA 1ZGIA 3VXFH 1VJAU 1C1NA 1MAXA 2EI8A 1PPBH 5GCHG 3ZVFA 1IQEA 1FIZA 4CRGA 5A2MH 1QFKH 4NZQA 5JBAS 1BRBE 3ZZ9A 2A2QH 4ABIA 1GJAB 1AZZA 2AIQA 3Q3YA 1VITF 1KLTA 1CA0C 1F0RA 2QXGA 1AGJA 1PPZA 1VCQA 3TK6A 1O33A 1P11E 2A0QB 1SFIA 2ZWLH 1EPTB 2QC2A 5EQRA 2ZCHP 5EXMA 2LNCA 1ZTJA 2Z9GA 3SJ8A 1AKSA 1FLEE 2WUCA 2F9OA 3VB7A 1P9UA 2VWNA 1SVPA 2A4QA 1EJNA 4ABFA 3ESTA 2AERH 1MTSA 3RU4E 4MQAA 1ESTA 1A1RA 3LJOA 2Z3EA 1G3DA 2TRMA 1Y59T 4U2WA 5GJ4B 3RXQA 1O3CA 4DW2U 2FXRA 1FQ3A 3AASA 3LPRA 4JK6A 4ZKSU 2QYIA 3E6PH 3RDZA 1TX7A 2EC9H 2ZHFH 1Y3XA 1GHAF 4Y79A 1AU8A 1RD3B 4ZXYH 2BY9X 3M36A 3GY3A 1B0FA 4ABAA 4XFQA 2G52A 1O2MA 1P2KA 3RXEA 3KIDU 2BD4A 1C2DA 1DWEH 3GCNA 5C20A 1O2QA 1NC6A 5C67A 6GCHG 3BEUA 2PV9B 4NIVA 1TNHA 5EW2H 1MZDA 1QA7A 2UWPA 2ZDKA 3RP2A 3GCTG 3PMJA 4BTIB 4JZFH 1BJUA 2VINA 3SUDA 2VNTA 3D23A 1ANCA 4NSYA 1BTUA 1P03A 1HYLA 2BZ6H 2VB0A 1TMUH 3ZZ4A 6ESTA 1XMNB 2A7HA 3MNXA 1HBTH 1BDAA 2H5DA 5DP3A 1BTWA 1XUHA 3B8JA 1NT1A 4INKA 3ITIA 1A7SA 3M61U 3LDXH 4DURA 3ZVDA 3A7YA 4GSOA 1O3EA 1GI2A 2J95A 4VGCC 3ZZ8A 1GI0A 2F91A 3MU0A 5PTPA 4MNVA 1SGFA 2SGAA 2FLRH 4NWKA 4ZAEA 2GDEH 3SV2H 2BD7A 2NWNA 4CRBA 4X0WU 3U1IB 2QV1A 1E0FD 1QNJA 5DKMA 1DFPA 1FXYA 1RIWB 1N6YA 1W13U 4AB8A 1P04A 2F9BH 2J2UA 5K0HA 1GI3A 3A8DA 1FIWA 1BHXB 1DX5M 5DP4A 5LPEA 3STJA 1W3CA 2BQ6B 1K22H 4YOIA 1BRUP 1C4V2 4ZKNU 2QXIA 1GHZA 1C2GA 1TNJA 2VIQA 2ZFPH 1TNLA 1GDUA 2J38A 1PQAA 5FBIA 4NWLA 2XC0A 3GCHB 1FY8E 3F9HA 1XUGA 1X7AC 1YPHE 5L6NH 1DSUA 3P92A 3A83A 1J14A 2AGGX 2Y5GA 2ZCLP 1J15A 5F8TA 1Y3YA 1O3GA 1ZGVA 1C5VA 3RLWH 2Y5HA 1ORFA 2A5KA 1TONA 2XBYA 3EA7A 3CP7A 3MYWA 3SORA 1EQ9A 1NRPH 1P0SH 4KTCA 2WPLS 3FFGA 1F0TA 3S7KB 2BVRH 2F9UA 2P3TB 2Y7XA 2LPRA 3O8CA 5E0GA 1QRWA 1CT2E 2EI7A 4INLA 2AGIX 3K2UA 4K69A 3GYLB 2PSYA 1LTOA 1GBLA 1GCDA 4MPUA 1YPJH 1O36A 1O5CB 1A3BH 1IHSH 1GBCA 1WQVH 3SJ9A 5EODA 1K1OA 2R3UA 2A7JA 3AAVA 3RM2H 3UQVA 4X1NU 1G37A 2OQUA 1O2VA 4K2YA 5C1UA 5DK1A 1O2HA 2WYJA 1F5LA 2BD3A 4LK4A 3PTBA 2FZZA 3SJOA 2B7DH 3UOUA 1LPGB 2AS9A 2FIRH 1K9OE 4B76A 1UTKA 2STBE 1EOJA 2WINI 2CXVA 4NCYA 1GBJA 2KAIA 4LOYH 1WU1A 1K21H 3A84A 1TPSA 1BJVA 4X6OA 2AMDA 2P3UB 4BXWA 4KGAA 5K7RA 3N7OA 1ZJDA 1B7XB 3DFLA 4J2YB 1SLXB 3QN7A 3VB6A 1BUIA 2TGDA 1H8IH 5TCAA 1CO7E 2OC7A 2VJ1A 3SU2A 3GY8A 2BHGA 3FZDA 1IQMA 3RMNH 1DXPA 2XBXA 2OXSA 1SGRE 4DJZB 3V12A 1IQKA 5T6DA 4NFFA 1Z8JB 3TITA 4NFEA 2BLWA 2D2DA 4TPIZ 5JDUB 3O8RA 1TPPA 1YYY1 4FUHA 2Z94A 3ATKA 1WSSH 1QQ4A 3GY2A 3EE0B 1CA8B 4A92A 1O2XA 4NIWA 1RTFB 1O5FH 3SI4H 3M5MA 3SNAA 1OOKB 2A4RA 2PKSB 4I33A 2ZFTA 3UUZA 1DS2E 3SNBA 1PPCE 1GHVH 1NFUA 1TQ7B 1O2WA 5E2PA 2ZDVH 5BPEA 1V2OT 2Z9JA 3PYHA 3BTDE 2B9LA 4BOHA 2ZFSA 4Q80A 3RXVA 4Y11E 1EPTA 1UTJA 1SGDE 2C90B 1V2UT 3TVJB 3BG4B 3OTJE 2OCVB 4Y8XA 1HXFH 4Y8YA 1SGPE 2AGEX 2ZTZA 1FY4A 1TOMH 2SGPE 2SFAA 3SBKA 1J16A 5AFZH 2A2XH 3ZZAA 1LKBA 2ZGCA 1ELAA 1LHEH 2QXJA 2RG3A 1HB0B 4DG4A 2HGTH 3SU6A 4Q7XA 1ZHMA 1RXPA 1ID5H 3GICB 1GBIA 5GWZA 4WWYA 1IQFA 4ISIH 3TH2H 1O3LA 1GI5A 1ZZZA 1EAUA 2GTBA 2VGCC 1KLJH 1Z7KA 3D62A 2G8TA 3TK5A 3E0PB 3GOVB 4TY6A 1DDJA 1LVBA 1V2TT 1T8NA 1AVGH 1S6HA 4RN6A 3FP7E 2D1JA 1P06A 2VVVA 2CF9H 3R3GB 1FJSA 1AHTH 2ASUB 2OQ5A 5FHTA 4UONA 1UVSH 4NG9H 1E38B 3A7WA 1SB1H 2OBQA 4OGYA 2FODA 3NUMA 3TK9A 4MLFB 1A2CH 3M3SA 4FUJA 2OBOA 2Z7FE 2ZKSA 1YPLH 3LC3A 2HNTF 3UNRA 1UTMA 1QQUA 5LGOA 1XKAC 2ZCKP 1QB9A 2BZAA 1SBWA 3A8CA 1MTUA 3MH5A 1NTPA 1KXBA 1MQ5A 5DP8A 5JYIA 5ABWA 1RS0A 3LGUA 2GT7A 1ZYOA 2ZP0H 4XOJA 5T6GA 5FAHA 1BTYA 1MD7A 3Q76A 4AG2A 2CHAB 4BTUB 2GZ9A 4NIXA 1OP2A 3UTUH 1AB9B 1ELBA 2WPIS 3FP8E 3SGBE 4YT6H 4K60A 3SJIA 4KP0A 1BTXA 1GJ9B 1PQ7A 1FAKH 3LKWA 3U1JB 3M3VA 3H7OA 3B9FH 1L1JA 3A80A 1AVWA 2V35A 1IQIA 1OWHA 1H9IE 3SU0A 4AB9A 2WYGA 1ANBA 1OP0A 1SOZA 1W10U 2D26C 2GZ8A 3NK8A 3RMOH 1YPEH 3T25A 3L6PA 3MNSA 4YOGA 4X1RU 2OP9A 2DE8A 1P02A 1SQTA 4WF8A 1EKBB 2Q6FA 1L4DA 1IQGA 1JXPA 3ATWA 1TLDA 1V2QT 4ZKOU 1VITH 5TCCA 2P8OB 1MZAA 7ESTE 1P3CA 1GHAG 2C8WB 3F6UH 4O3UA 2FWWA 2OINA 1O2IA 1OX1A 2VVCA 1KYNA 4B1TA 2BM2A 1H9LB 1GBMA 3DUXH 2J4IA 1P01A 1OPHB 2P95A 3SHCH 4HZHA 2VVUA 2Z9LA 1OKXA 5E0HA 1SR5C 2H9HA 1ETRH 2W5EA 5JB8S 5T6FA 1D4PB 4AYVB 1EB1H 1DY9A 1KTSB 1LPKB 1JIMA 2HWLB 5EQSA 1EXFA 1SHHB 1HAVA 1DVAH 2P16A 1SPJA 1NFYA 3ZZ3A 3NPSA 2P59A 5IDKA 3HK3B 4FU9A 2VIDA 1GI1A 1QBNA 1V3XA 4Q2KA 3W94A 1C5ZB 5FXLA 1CSOE 3PV4A 1UO6A 1K1MA 4AFZA 5CHAC 2ZDLA 3QTVH 2VIVA 4SGAE 1SL3A 5ETXA 2ZA5A 1OS8A 7GCHF 3HGPA 1T4VH 1GBBA 1LHDH 5B6OA 5SGAE 1YKTA 1A4WH 4LZ1H 2FEQH 3UREA 4ABBA 2CJIA 4B71A 1ZTLA 4VGCB 3PWBA 4I8HA 3UWIA 3EYDA 1SLUB 4WJG2 2YOLA 1O3BA 3E91A 4YESB 1G3CA 1YPMH 1ZPZA 2Y80A 4TPYA 2PTNA 2R9PA 1TGTA 1AFQB 5AHGH 2CN0H 4DIHH 3LGVA 1OWDA 2C8YB 1AY6H 3CENA 1Y3UA 1HLTH 1T8MA 1FONA 4ZH8A 2G51A 1GJDB 3SU3A 2IN2A 4WXVA 3M7QA 1TBRH 1QJ7B 2ZO3H 2FLBH 3OX7U 4XDEA 2OC1A 1S6FA 4F49A 1QCPA 1KY9A 3BTKE 1OWJA 3ZZBA 1V2ST 2BX3A 2FDAA 2BDYA 1BMMH 2HOBA 1YLCA 4H4FA 4R0IA 4MPWA 1AMHA 2ODQA 2PKAA 3PO1C 1LDTT 1HAIH 1Z6JH 4IC6A 1EJMA 1C9TA 4QT8C 1O39A 4YOJA 3BTFE 4WXIA 1EAXA 2VH6A 1QBOA 1O5DH 4CHAB 1E36B 3I77A 2IOTA 1CGJE 1C2MA 1T31A 1V2RT 4FXGH 3U8OH 1G2LA 1EZQA 1C2JA 1SI5H 2F83A 5FPYA 7KMEH 2BY6X 2O8MA 1ZR0A 2G5NA 2XBVA 1ZRBA 1AUTC 2BYAX 4NGAH 1F5RA 2CGAA 2AFQB 3KQDA 3MU4A 2ZF0H 4ASHA 2XNIA 3MWIU 1MCVA 5BRRE 2GT8A 1W11U 4JYUH 4B2BA 1MU8B 2C3SA 2Z3CA 1G30B 3P6ZB 1KIGH 3S9AA 1GBDA 3KQEA 1TGSZ 3A88A 4XBDA 1GMDF 3M3TA 1UTNA 3OSYA 1VGCC 4MPXA 4IS5A 4CRCA 1KSNA 5C2ZA 4YM9A 1SGQE 1TNKA 1AIXH 2WPJS 3LIWA 1CVWH 1C5SA 3ZZ6A 2ZIQH 3RXRA 2FX4A 2GX4A 3EDXB 1P9SA 1HJAC 2YNBA 4B75A 4GLYA 1O35A 1GHBG 4X2VA 1HAZB 1QRXA 5FPSA 1DT2A 3URDA 1CBWC 1DWDH 5DP6A 3UFAA 3QK1A 1FZZA 3S69A 1DM4B 1IAUA 3W95A 1FN8A 4YTAA 1MD8A 4JK5A 3SGQE 2G55A 2FI3E 1TRYA 3RXHA 3BTTE 1ZSLA 4I32A 1WTHD 3MMGA 5C5OA 3LGWA 4UE7H 1E35B 1BMAA 2CHAC 5I25A 1W2KH 2ALPA 2BDIA 5GXPA 3TPIZ 1GBHA 1P05A 2PUXB 1HAGE 2ZC9H 4D9RA 4UFDH 2HRVA 2A7CA 3KGPA 5L2ZH 1EP5A 3PMBB 1GBKA 3TNSA 1GI6A 3Q3XA 2B0FA 3KF2A 4CH2B 3AAUA 2JETC 1HAPH 2Z6BD 1KDQB 1O3IA 1O2LA 1GGDC 1O5BB 1V2VT 5FX6A 1UTPA 4GCHF 3LT3A 1GVKB 1MQ6A 2G81E 1G3EA 1DICA 1F0SA 2ZZUH 1C1PA 1O2SA 5F8XA 3T29A 3JZ1B 1GCTC 3EQ0H 3SUEA 1Y3VA 1EZSC 3PLKA 2BMGB 4GHQA 1EX3A 2Q6GA 2V6NA 3FZZA 3P8OA 1MCTA 4FUGA 1ETSH 2ZPSA 1C1UH 5ESBA 2H1UA 3VEQB 1CHGA 1AD8H 1QB1A 1J17T 1OYQA 3DHKH 2ZU2A 1EOLA 1BOQA 4JZ1A 4NZLA 5EU8A 4Y71A 2H9TH 3T5FH 4A5TS 1V2WT 3RXMA 3QDZB 3F1SB 1DOJA 2J92A 1T8LA 5FCRA 4CR5A 1HAVB 1SGYE 1M9UA 1A3EH 3MO6A 1XUFA 6CHAB 2C4FH 2WPHS 3SO3A 2V3OH 3SNDA 1O3AA 1DXWA 4IN2A 2PSXA 4KTSA 1UK2A 1O2JA 1YCPK 3RXTA 1NRNH 1TPAE 1Z1JA 1GMHF 2R0LA 3SV8A 4X1PU 1TALA 2PGQB 4K3JA 1GJ7B 5J4SA 3KL6A 2B8OH 2RA0A 3OYPA 1N8OB 3MO9A 1O34A 4IMZA 1ELEE 1PQ8A 1Q2WA 3A7ZA 1ZHRA 3FP6E 1GG6C 1K28D 3PM3A 1PPHE 1QBVH 1TGCA 1YGCH 3Q3KA 2ZHQH 1PYTC 2P94A 1EAWA 4XBCA 4UEHH 1YCPM 1O5EH 4GPGA 1QJ6B 1NO9H 2ANKH 1H8DH 3SU1A 3OY5U 1A0LA 3ENSB 1BB0B 3E16B 4X8SH 1LHGH 2H6MA 4ZROA 3ZVBA 4Y7AA 3MO3A 3AW1A 4J1YA 2GZ7A 1BBRK 1T4UH 3G01A 1RTKA 1VITG 2BB4A 3RXUA 1BQYA 3K65B 3H5CB 4AGKA 2O9QA 3MU1A 1ZOMA 2G4TA 4JZDH 3L33A 5JBBS 1E37B 2P93A 1XX9A 2W3IA 1GCTB 3PMAB 4XSKU 2ZDNA 3HKIB 5L2YH 3QZQA 1UCYH 3RXKA 2JETB 5CE1A 1C2EA 1KTTB 8KME2 4B2AA 1LO6A 1GGDB 1CHOG 1C1RA 5DP9A 1GHBF 2V0BA 2WV5A 1B0EA 1IHTH 1ESAA 1P2OA 5C3NA 1S85A 2C8XB 1ZMLA 2BXUH 2FOHA 3RXFA 1S81A 4X6NA 1SQOA 1P8VC 2AIPA 3IITA 4X8VH 3D65E 4O9VA 4K1SA 1INCA 1UK3A 4RSPA 3IG6B 1YPKH 2EI6A 1LCYA 3M37A 4H42U 1XUIA 3RMMH 2EEKA 3RXCA 1D3DB 2ANWA 4GVUA 1HUTH 1V6DA 4CRDA 4ISNA 2FX6A 1AO5A 1GDNA 1DANH 1AI8H 1GWAA 3HGNA 1LHFH 3GDUA 3UR9A 4Q7ZA 1AZ8A 1HJ8A 4ZHLU 3PO1B 1CGIE 1P2JA 1P2IA 4JZEH 4BAKB 2QA9E 3M35A 3SQEE 5C1YA 2ZEBA 1VJ9U 1HRTH 1ZHPA 3A7XA 4Z0KA 1ELCA 1OYTH 4Z6AH 1CHOF 1TA6A 1V2JT 1YM0A 1ELFA 4LXBH 1NN6A 2OUAA 4MNWA 5FX5A 2ALVA 1HJAB 3E8LA 2P8OC 1SLVB 3PLBA 4D7FA 1XUJA 2SGQE 2A45B 3GYMA 2BLQA 1GBFA 1SHYA 1K1JA 4ZXXH 1TB6H 2A5IA 3TJVA 1LVOA 1S0RA 4CH8B 3UNSA 2XBWA 1ELGA 2YNAA 5A8YA 2ZU1A 4IW4E 1L1NA 1GMHG 2VGCB 1QGFA 5IYTA 1GG6B 1GVZA 4SGBE 2ILNA 4YT7H 3F68H 2FOFA 4H6SB 1TX8A 2NU1E 3SN8A 9ESTA 1EZXC 1O37A 4ISLA 1THPB 2JH5D 1Y5UT 1UVUH 3EAJA 4ZHMU 3BN9A 1MMJN 3A8AA 3V0XA 1JMOH 4ZKRU 1ZLRA 1UTOA 1QY6A 3V7TA 2QCYA 3DFJA 3ZZDA 3H7TA 4DOQA 1SLWB 1P2MA 1GL0E 2ZU5A 1SC8U 2DUCA 1F2SE 4A7IB 1TGBA 4F4OC 2FO9A 3O8DA 1FPHH 4THNH 5EPYA 4B74A 1TABE 4HFPB 5F6MA 4DVAU 2HVXA 2BY8X 2BLOA 1MKXK 4BAMB 2UWOA 2QXHA 2PR3A 1SGNE 1C2FA 3JZ2B 1JWTA 1C5RA 1DUAA 2SGEE 3VB5A 3A85A 4MNYA 1KXCA 2ZDMA 5LH8A 1IQHA 4Y0ZE 3SI3H 3TH4H 3MH6A 1CQQA 2FM2A 5CMXH 4AX9H 2SNVA 3OU0A 1JOUB 1FY3A 2A4GA 2IPHA 5A09A 3UNQA 4GAWA 3GY4A 4ESTE 5HM2A 2G00A 1WV7H 1DLKB 3LOXA 3QO6A 2JH0D 3T62A 4AN7A 2QF0A 2HNTC 1RIWC 1ABJH 1A5HA 1JBUH 2GV7A 2W26A 3RXOA 2WPKS 1HV7A 8GCHF 1SGTA 4MNXA 5ESTE 1BTPA 1E34B 5A8ZA 4WH8A 4FUIA 1PPFE 4BTTB 2OD3B 4GHTA 1OSSA 3GY7A 2BY5X 1ZPCA 2K1QA 1G3BA 4U01A 5F03A 6GCHF 1YP9A 1TWXB 1IQJA 3TGKE 1C5PA 2HPPH 3A87A 2XC4A 1O2KA 3VFEA 1JRTA 3V13A 4OS1A 2HALA 1P2QA 1VGCB 1GI7B 2ZFQH 3KQCA 3LU9B 1C1WH 1O3OA 3UWJH 3E0NB 1WCZA 4AG1A 1A46H 1XUKA 2DE9A 1C5NH 2ZNKH 1UTQA 1HDTH 3MOCA 2QN5T 4MDSA 3P8FA 1Y5BT 1HIAB 1QL8A 1TNGA 1O2RA 4Y7BA 5E0JA 1TOCB 2Z3DA 4E7RG 4JMYA 3KNXA 3RXGA 1BRAA 2TIOA 1Z1IA 1F0UA 1THSH 3M7UA 1HFDA 4YZUA 1DWCH 1Y3WA 3EA9A 2WV4A 4TY7A 1F5KU 1C5WB 3E90B 2Z9KA 1V2LT 1TRNA 2ULLA 4K1TA 2FMJA 2GKVE 2ODPA 1WOFA 2PTCE 5HMAA 1GDQA 1NFXA 1TE0A 5A0AE 3RU4D 4BNRA 1GBEA 5GCHF 4ABGA 4BAQB 5DGJA 1MU6B 1F7ZA 2GCTC 1PQ5A 3HK6B 4CBNA 1C1VH 4YLQH 4O03A 1H9HE 2GMTC 1O2OA 2UUJB 5L30H 3ZZCA 4K5ZA 2XTTB 5E2OA 1B5GH 4ABHA 4MG3A 4AZ2B 2JH6D 1KXFA 3T2NA 1TMTH 3RM0H 1HAHH 1RGQA 4FVDA 3GCOA 5FCKA 1TPOA 3F9EA 1FUJA 3BG8A 1GHXH 1S0QA 5EPNA 3UIRA 2I6SA 1P10A 3M5LA 2OLGA 2PHBA 1LMWB 1XXFA 1C2KA 2BOKA 2ZQ2A 1DITH 3CS7A 1NM6A 1DLEA 4IGDA 1O38A 1WYKA 4Y8ZA 1GPZA 4O97A 1KXAA 1FY5A 4RKOB 1O31A 1LVYA 3LGYA 2RCEA 4WMFA 1Z6EA 3MFJA 4X6MA 6LPRA 3ZV8A 2SGDE 5DJ7A 2FTMA 1DSTA 3LJJA 3BEIB 1K2I1 2Y7ZA 1O5GH 3GY6A 3RXJA 4CHAC 2THFB 3QGJA 3LGTA 4ZUHA 3A82A 3ZV9A 1O3PB 5TJXA 1NY22 4UFGH 4A1XA 1SGIB 4FUCA 3ATMA 1QHRB 2CV3A 3RXLA 3UY9A 4IN1A 1O2PA 4O3TA 1AE8H 2BOHB 1ELTA 3TGJE 1XKBC 1FV9A 2FOGA 3KEEA 3AVZA 1MKWH 3URCA 1W12U 2H9EH 4ZHAA 4IMQA 2ZGHA 4X1QU 3BG4C 2PGBB 2BDBA 4WVPE 3I78A 3U69H 2OC8A 1J8AA 4MVNA 4KKDA 3E1XB 9LPRA 4I31A 1DPOA 1NS3A 3M5OA 4X8TH 3BF6H 1ESBA 4E06H 1AFEH 1O3KA 1S84A 3D49H 2Q1JA 3KCGH 4GUXA 2J94A 3B23B 2FOMB 3MU5A 4OS7A 4B73A 5C1XA 3ZVEA 1EJAA 3ZYEA 1P09A 1TMBH 2ZGXH 3STIA 2FTLE 1N8OC 3SNEA 1SSXA 3NZIA 1BZXE 1LQDB 1DWBH 4XBBA 2RA3A 1C1SA 4JYTA 2NU0E 1KLIH 1BRCE 1V2MT 2G4UA 1V2KT 5G4BA 1LKAA 2R2MB 1C2IA 3KQBA 2A31A 2R3YA 1AUJA 1G32B 2Z9IA 2FESH 4AORA 1O2TA 1HXEH 1C5QA 1AN1E 4UDWH 2GV6A 5EG4A 4Y10E 3U8RH 4Y0YE 1W0ZU 1MKWK 2PKSC 3SQHE 3BTGE 3GCTF 1NRRH 2Y81A 3NXPA 1MTNB 2BVSH 2XYAA 4FUFA 3C1KA 1ELVA 3S9CA 2ESTE 4WMDA 2FOAA 1AQ7A 1QTFA 1TAWA 3ZZ5A 3LONA 1ABIH 1MTWA 1GJ6A 3O8BA 4D8NA 3SU4A 3RXSA 3UOPA 4UFEH 1P12E 5HYOA 1V2NT 4KTUA 5AF9H 2ZQ1A 1HNEE 4E7NA 1O3NA 4AFQA 2IJOB 5E8EH 2W7UA 1YPGH 1FN6A 2UUKB 3U98H 4CR9A 4I8GA 1EAIA 1NFWA 2NU4E 3F9GA 1P3EA 2VIWA 4NSVA 4X8UH 1YBWA 1Z8GA 2J9NA 4AFUA 5H4IB 2ZTXA 1EP6A 2A1DB 2AMPA 2PUQH 1HPGA 1YF4A 1O3FA 3TJNA 1NU9A 1D3TB 2CF8H 3LH3A 3A8BA 1A0HB 1QL7A 1MUEB 1NROH 3EA8A 3CS0A 2GVFA 1ELDE 1Z8IB 4I8KA 1TQ0B 2VWLA 2QAAA 1MH0A 2NU3E 2PW8H 3TLOA 3BEFB 1GJCB 1G2MA 1YLDA 1ZSKA 2V3HH 1A61H 2H2ZA 3L3TA 4TWWA 5FBEA 4AGJA 3RU4T 4YLUA 1RRKA 5GDSH 1MBMA 1CE5A 1BMNH 2UWLA 3PMHB 1GI4A 4NA7A 4ABEA 3SHAH 3BTEE 3WY8A 1O30A 3LGIA 2A5AA 2O8WA 3SV7A 3MHWU 3LH1A 1DUEA 2TGTA 1H1BA 2FI4E 3HKJB 3GDSA 1TRMA 3VGCB 1UCYK 1TA2A 2ZHEH 2ZG0H 1C5TA 1NZQH 1RJXB 3FAOA 2ZU4A 1O3HA 1THRH 1EB2A 2ZECA 1UHBB 1K1PA 1Q31A 2GCTB 4OS5A 3ZVAA 3RC6A 1BBRH 5A0BA 1L4ZA 1UMAH 2BVXH 2A32A 1HIAA 1C1TA 3Q00A 2XWBI 1GVLA 2BD8A 4A1TA 1UVPA 2HPQH 1VCWA 1XVMA 2BY7X 3DT0H 3GY5A 1WAYB 1GHYH 2ANMH 4NA8A 3TGIE 2ZPRA 4K8YA 2EA3A 3ZVCA 1ETTH 1LVMA 4MPVA 1D3QB 2F3CE 1SGCA 1UHBA 1J9CH 1ACBE 4LZ4B 2RDLA 1FPCH 1UK4A 1T7CA 1AWHB 3A81A 3F9FA 3MNBA 1ZPBA 2W3KA 3QWCH 4HGCA 2PFEA 1OWIA 1O2NA 1XM1A 2VIPA 1JRSA 1TFXA 2PWXA 3TNTA 3R0FA 1GL1A 2BXTH 4DY7B 4INHA 3TJOA 2ZGJA 3SU5A 3OY6U 1VZQH 1ARCA 1FDPA 4BANB 5F8ZA 2P3FH 5AFYH 2QF3A 3RUOA 4WY3A 3SUFA 4DT7B 3RXBA 3VPKA 3BTWE 4ISHH 1C1OA 1G9IE 1OWEA 1A5GH 2FS8A 3FVFB 2XCFA 5GIBA 1VCPA 1Z71A 3BIUH 3NWUA 4XE4A 5T3HA 1A5IA 3BV9B 2BDAA 2C8ZB 1W0YH 4BAHB 1MKXH 3BIVH 1ZSJA 1NESE 3MTYA 1PJPA 4GCHG 4D9QA 1Y8TA 1QJ1B 2GD4B 3QGNB 1W7GH 3RC5A 4FUEA 3T26A 4MTBA 3GISB 1BBRE 3K6ZA 1OWKA 1BCUH 1SQAA 1UTLM 2FPZA 1DE7H 1W14U 1TIOA 2FYQA 3KN2A 3RXIA 1AE5A 3RXPA 3TIUA 2O8TA 1HCGA 1K1IA 2ZHWH 2ODYB 1MBQA 1WUNH 1GJ5H 3ZVGA 3A86A 4X6PA 2PLXA 4YO9A 1AFQC 3SV6A 1C5LH 2VIOA 1O2YA 2VWMA 4CRFA 1UJ1A 1W7XH 1UCYE 1O2GH 1BMLA 3K9XB 5I46H 2SNWA 3P70B 4TWYA 2TBSA 1QB6A 4CREA 3RXDA 2AH4X 4WH6A 4AOQA 1BHXF 1GJ4H 3QX5H 1ZMJA 1CBWB 5A8XA 1UVTH 1D3PB 2CMYA 2XW9A 3FANA 3ZYDA 2VWOA 3PLPA 1SGFG 1IQNA 1C5XB 3HATH 1RTLA 5CHAB 3VB3A 3C27B 1SMFE 2HLCA 3SOSA 2BTCE 2GP9B 3PWCA 4BXSA 2ANYA 1ANEA 3ATIA 3T28A 1VR1H 2PKAB 2TGAA 4A6LA 1CA0B 4AYYB 3U9AH 4OS2A 2XCNA 4NA9H 3SW2B 1GBAA 1F92A 2GCHG 3SUGA 3TH3H 4UFFH 2QGRA 4FVBA 1SG8B
chains in the Genus database with same CATH superfamily
2ZFRH 4OS6A 5LPRA 1KXEA 1GI8B 3F0OA 2ZU3A 2GGVB 4B6EA 3GCHC 5JBCS 1P2NA 1T32A 2JKHA 2GMTB 2O8UA 3BTQE 5JPMH 4TYDA 3TU7H 4ISOA 1BTZA 3V3MA 2VU8E 1BA8B 3P8GA 4I8LA 1ZTKA 1TBQH 1O2UA 3A7VA 3ODFA 1GHWH 1C4U2 1Z8RA 3GDVA 3P8NA 1HJ9A 3A7TA 1S5SA 3DA9B 4FUDA 1SGEE 4ZCNA 1QR3E 2XRCA 3NKKA 1KXDA 1TX6A 4E05H 4U30A 1YC0A 1SFQB 1FNIA 2BQ7B 3QLPH 1L1GA 3MH7A 3BSQA 1TNIA 3EGKH 2BDGA 2BX4A 4JYVH 3A89A 2VH0A 2JJ2D 1K1LA 5EQQA 1O5AB 1CT4E 4JZIA 1HAXB 1AKSB 1AWFH 1C1QA 7GCHG 1TYNA 3SJKA 4WMEA 4Z1MD 1KDQA 5DG6A 2A4OA 4YXWD 1HAYB 1YY3A 1ZRKA 4ZMAH 4K8BA 4NIYA 4DCDA 2XC5A 2OTVA 2OC0A 1EUFA 1GJ8B 1O2ZA 2ZTYA 2F9VA 3M7TA 1EASA 4B6FA 4Q63A 3VGCC 1O32A 1L0ZA 2D8WA 1IQLA 5LPFA 3QTOH 2ZGBH 1TBZH 1LHCH 5JBTA 2UUFB 4UD9H 4RKJB 5AVDA 2BLVA 1YLNA 1G36A 3K6YA 1KMHB 1L2EA 3AW0A 5EW1H 4X1SU 3SZEA 2BD2A 5FPTA 8ESTE 5JB9S 1SKYE 3P95A 5DO4H 1T8OA 2K0QA 4X2WA 2AEIH 3IWMA 1ZJKA 3U8TH 3I29A 2YMSC 2FI5E 3LC5A 3NCLA 1WQSA 4KELA 2J34A 1HAOH 2WPMS 3Q77A 2ZFFH 2O8LA 1GBTA 2BD5A 1S83A 4OS4A 1EZUC 4AFSA 3RXAA 1C1MA 3KHVA 1O0DH 1D6WA 2VBCA 4A1VA 3SZNA 1FY1A 3WWFA 2Y6TA 1WBGB 1QL9A 1BT7A 1YCPH 4D76A 1PYTD 1FMGA 1MTNC 3VXEH 5HM9A 1ARBA 3PROA 1AB9C 5A0CA 5EXLA 1XVOA 1UVOA 3MH4A 1D9IA 3UR6A 4Q7YA 5GPIB 2H5CA 1DY8A 4HI3A 1RFNA 1XXDA 1CGHA 2Q6DA 1QA0A 3BTME 5HIYA 1GJBB 1O3MA 1QIXB 2FYRA 3HPTB 5EOKA 4IC5A 3KYFA 2BQWB 2R2WU 4CRAA 7LPRA 2AYWA 2ZI2H 1EPTC 2TPIZ 4DIIH 4DGJA 4IBLH 2Y82A 5EJZA 5C5NA 1C4Y2 1EATA 4FU8A 2G5VA 3RC4A 3ATLA 1CT0E 4CBOA 1H4WA 1NU7B 1PPEE 2BDHA 1ANDA 1C5OH 1BTHH 1BIOA 4ABDA 1S82A 2R0KA 1N6XA 1C5UA 1OP8A 1FAXA 3UQOA 3MI4A 1QRZA 3QZRA 5DP7A 3UPEA 5HIZA 3MU8A 1AVXA 1ZMNA 3DD2H 1P57B 1Y5AT 3SGAE 4JCNA 2QIQA 1PPGE 3ELAH 3QUMP 8GCHG 1TGNA 2GCHF 4X2YA 1NPMA 5DSFA 1A0JA 3P17H 8LPRA 2C93B 3KQ5A 4U32A 1QURH 3S9BA 4OGXA 1W8BH 2FP7B 3SV9A 3PTNA 1BITA 2KAIB 3SNCA 4FU7A 1C2LA 4B2CA 1O3DA 1GMCF 1CU1A 1C5MD 2FOBA 1K1NA 3S0NA 4BAOB 3E3TA 1WXRA 6CHAC 3S7HB 5EGMA 3BTHE 2BD9A 5J4QA 3VB4A 2XXLA 2I6QA 4Y76A 2AMQA 1V2PT 2Y5FA 2ZPQA 1WTGH 1YPHC 4H6TA 1MTVA 4K1EA 2F9NA 1C9PA 2UUYA 2ZDAH 3F2GA 3T27A 1HGTH 3PB1E 2WUBA 2M5TA 1FI8A 2NU2E 4D7GA 1LQEA 4FUBA 1U6QA 4HTCH 5DP5A 1C2HA 1C5YB 4PROA 2FS9A 5DPAA 1OXGA 3ODDA 2BDCA 2FOEA 2SGFE 2ZHDA 4ABJA 4R8TB 1LPZB 2B5TB 2GDDA 1YWUA 1NRSH 4Y6DA 1MAYA 1PFXC 3RMLH 1JIRA 1GI9B 1Q3XA 3PRDA 1GMDG 5HGGA 3M5NA 1SOTA 1NRQH 4X2XA 2TGPZ 2XWAA 5EXNA 3RLYH 3TJUA 1GMCG 2FOCA 2QY0B 2HNTE 2STAE 4I8JA 1D6RA 1O3JA 1IOEA 1N1LA 4M7GA 3MNCA 4I7YH 2F9PA 5HXFA 3ZZ7A 2W7SA 1ZGIA 3VXFH 1VJAU 1C1NA 1MAXA 2EI8A 1PPBH 5GCHG 3ZVFA 2EQNA 1IQEA 1FIZA 4CRGA 5A2MH 1QFKH 4NZQA 5JBAS 1BRBE 3ZZ9A 2A2QH 4ABIA 1GJAB 1AZZA 2AIQA 3Q3YA 1VITF 1KLTA 1CA0C 1F0RA 2QXGA 1AGJA 1PPZA 4F55A 1VCQA 3TK6A 1O33A 1P11E 2A0QB 1SFIA 2ZWLH 1EPTB 2QC2A 5EQRA 2ZCHP 2OK5A 2LP6A 5EXMA 2LNCA 1ZTJA 2Z9GA 3SJ8A 1AKSA 1FLEE 2WUCA 2F9OA 3VB7A 1P9UA 2VWNA 1SVPA 2A4QA 1EJNA 4ABFA 3ESTA 2AERH 1MTSA 3RU4E 4MQAA 1ESTA 1A1RA 3LJOA 3VG8A 2Z3EA 1G3DA 2TRMA 1Y59T 4U2WA 5GJ4B 3RXQA 1O3CA 4DW2U 2FXRA 2HLDD 1FQ3A 3AASA 3LPRA 4JK6A 4ZKSU 2QYIA 3E6PH 3RDZA 1TX7A 2EC9H 1COWD 2L74A 2ZHFH 1Y3XA 1GHAF 4Y79A 1AU8A 1RD3B 4ZXYH 2BY9X 3M36A 3GY3A 1B0FA 4ABAA 4XFQA 2G52A 1O2MA 1P2KA 3RXEA 3KIDU 2BD4A 1C2DA 1DWEH 3GCNA 2F4LA 5C20A 1O2QA 1NC6A 5C67A 6GCHG 3BEUA 2PV9B 4NIVA 1TNHA 5EW2H 1MZDA 1QA7A 2UWPA 2ZDKA 3RP2A 3GCTG 3PMJA 4BTIB 4JZFH 1BJUA 2VINA 3SUDA 2VNTA 3D23A 3PV2A 1ANCA 4NSYA 1BTUA 2WPDD 1P03A 1HYLA 2BZ6H 2VB0A 1TMUH 3ZZ4A 5C94A 6ESTA 1XMNB 2A7HA 3MNXA 1HBTH 1BDAA 2H5DA 5DP3A 1BTWA 1XUHA 3B8JA 4OM9A 1NT1A 4INKA 3ITIA 2WZQA 1A7SA 3M61U 4TT3D 3LDXH 4DURA 3ZVDA 3A7YA 4GSOA 4TSFD 1O3EA 1GI2A 2J95A 4VGCC 3ZZ8A 1GI0A 2QF4A 2F91A 3MU0A 5PTPA 4MNVA 3OTPA 1SGFA 2SGAA 2FLRH 4NWKA 4ZAEA 2GDEH 3SV2H 2BD7A 2NWNA 1E79D 4CRBA 4X0WU 3U1IB 2QV1A 1E0FD 1QNJA 5DKMA 1DFPA 1FXYA 1RIWB 1N6YA 1W13U 4AB8A 1P04A 2F9BH 2J2UA 5K0HA 1GI3A 3A8DA 1FIWA 1BHXB 1DX5M 5DP4A 5LPEA 3STJA 2HVYB 1W3CA 2BQ6B 1K22H 4YOIA 1BRUP 1C4V2 4ZKNU 2QXIA 1GHZA 1C2GA 1TNJA 2VIQA 2ZFPH 1TNLA 1GDUA 2J38A 1PQAA 5FBIA 4NWLA 2XC0A 3GCHB 1FY8E 3F9HA 1XUGA 1X7AC 1YPHE 5L6NH 1DSUA 3P92A 3A83A 1J14A 2AGGX 2Y5GA 2ZCLP 1J15A 5F8TA 1Y3YA 1O3GA 1ZGVA 1C5VA 3RLWH 2Y5HA 1ORFA 2A5KA 1TONA 2XBYA 3EA7A 3CP7A 3MYWA 3SORA 1EQ9A 1NRPH 1P0SH 4KTCA 2WPLS 3FFGA 1F0TA 3H09A 3S7KB 2BVRH 2F9UA 2P3TB 2Y7XA 2LPRA 3O8CA 5E0GA 4RT1A 5C17A 1QRWA 1CT2E 2EI7A 4INLA 2AGIX 3K2UA 4K69A 3GYLB 2PSYA 1LTOA 1GBLA 1GCDA 4MPUA 1YPJH 1O36A 4XD7D 1O5CB 1A3BH 1IHSH 1GBCA 1WQVH 3SJ9A 5EODA 2KFWA 1K1OA 2R3UA 2A7JA 3AAVA 3RM2H 3UQVA 4X1NU 1G37A 2OQUA 1O2VA 4K2YA 5C1UA 5DK1A 1O2HA 2WYJA 1F5LA 2BD3A 4LK4A 3PTBA 2FZZA 3SJOA 5F53A 2B7DH 3UOUA 1LPGB 2AS9A 2FIRH 5GNDA 1K9OE 4RT0A 4B76A 1UTKA 2STBE 1EOJA 2WINI 2CXVA 2YMSB 4NCYA 1GBJA 2KAIA 4LOYH 1WU1A 1K21H 3A84A 1TPSA 1BJVA 4X6OA 2AMDA 2P3UB 4ASUD 4BXWA 4KGAA 4ACBA 5K7RA 3N7OA 1ZJDA 1B7XB 3DFLA 4J2YB 1SLXB 3QN7A 3VB6A 2KCOA 1BUIA 2TGDA 1H8IH 5TCAA 1CO7E 2OC7A 2VJ1A 3SU2A 3GY8A 2BHGA 3FZDA 1IQMA 3RMNH 1DXPA 2XBXA 2OXSA 1SGRE 4DJZB 3V12A 1IQKA 5T6DA 4NFFA 5EIYA 1Z8JB 3TITA 4NFEA 2BLWA 2D2DA 3WW7A 4TPIZ 5JDUB 3O8RA 1TPPA 1YYY1 4FUHA 2Z94A 3ATKA 1WSSH 1QQ4A 3GY2A 3EE0B 1CA8B 4A92A 1O2XA 4NIWA 1RTFB 4M9FA 1O5FH 3SI4H 3M5MA 3SNAA 1OOKB 2A4RA 2PKSB 4I33A 2ZFTA 3UUZA 1DS2E 3SNBA 3N99A 1PPCE 1GHVH 1NFUA 1TQ7B 1O2WA 5E2PA 2ZDVH 5BPEA 1V2OT 2Z9JA 3PYHA 3BTDE 3OEHD 2B9LA 4BOHA 2ZFSA 4Q80A 3RXVA 4Y11E 1EPTA 1UTJA 2AHME 1SGDE 2C90B 1V2UT 3TVJB 3BG4B 3W1EA 3OTJE 2OCVB 4Y8XA 3MQKC 1HXFH 4Y8YA 1SGPE 2AGEX 2ZTZA 1FY4A 1TOMH 2SGPE 2SFAA 3SBKA 1J16A 5AFZH 2A2XH 3ZZAA 1LKBA 2ZGCA 1K0HA 1ELAA 1LHEH 2QXJA 2RG3A 1HB0B 2XOKD 4DG4A 2HGTH 3SU6A 4Q7XA 1ZHMA 1RXPA 1ID5H 3GICB 1GBIA 5GWZA 4WWYA 1IQFA 4ISIH 3TH2H 1O3LA 1GI5A 1ZZZA 1EAUA 2GTBA 2K8IA 2VGCC 1KLJH 1Z7KA 3D62A 2G8TA 3TK5A 3E0PB 3GOVB 4TY6A 1DDJA 1LVBA 1V2TT 1T8NA 1AVGH 1S6HA 4RN6A 3FP7E 2F43B 2D1JA 1P06A 2VVVA 2CF9H 3R3GB 1FJSA 1AHTH 2ASUB 2OQ5A 4HG6A 5FHTA 1UVSH 4UONA 4NG9H 2KCPA 1E38B 1SB1H 2OBQA 3A7WA 4OGYA 2FODA 3NUMA 3TK9A 4MLFB 1A2CH 3M3SA 4FUJA 2OBOA 2Z7FE 2ZKSA 1YPLH 3LC3A 2HNTF 3UNRA 1UTMA 1QQUA 5LGOA 1XKAC 2ZCKP 1QB9A 2BZAA 1SBWA 3A8CA 1MTUA 3MH5A 1NTPA 1KXBA 1MQ5A 5DP8A 5JYIA 5ABWA 1RS0A 3LGUA 2GT7A 1ZYOA 2ZP0H 4XOJA 5T6GA 5FAHA 1BTYA 1MD7A 3Q76A 4AG2A 2CHAB 4BTUB 2GZ9A 4NIXA 1OP2A 3UTUH 1AB9B 1ELBA 2WPIS 3FP8E 3SGBE 4YT6H 4K60A 4ACAA 3SJIA 4KP0A 1BTXA 1GJ9B 1PQ7A 1FAKH 3LKWA 3U1JB 5FL7D 3M3VA 3H7OA 3B9FH 3SYJA 3F3BA 1L1JA 3A80A 1AVWA 2V35A 1IQIA 1OWHA 1H9IE 3SU0A 4AB9A 3WWBA 2WYGA 1ANBA 1OP0A 1SOZA 1W10U 2D26C 2GZ8A 3NK8A 3RMOH 1YPEH 3T25A 3L6PA 3MNSA 4YOGA 4X1RU 2OP9A 2DE8A 1P02A 1SQTA 4WF8A 1EKBB 2Q6FA 1L4DA 4Q4LA 1IQGA 1JXPA 3ATWA 1TLDA 1V2QT 4ZKOU 1VITH 5TCCA 2P8OB 1MZAA 7ESTE 1P3CA 1GHAG 2C8WB 3F6UH 4O3UA 2FWWA 2OINA 1EFRD 1O2IA 1OX1A 2VVCA 1KYNA 4B1TA 2BM2A 1H9LB 1GBMA 3DUXH 2J4IA 1P01A 1OPHB 2P95A 3SHCH 4HZHA 2VVUA 2Z9LA 1OKXA 5E0HA 1SR5C 2H9HA 1ETRH 5T1VA 2W5EA 5JB8S 5T6FA 1D4PB 4AYVB 1EB1H 2WV9A 1DY9A 1KTSB 1LPKB 1JIMA 2HWLB 5EQSA 1EXFA 2J5UA 1SHHB 1HAVA 1DVAH 2P16A 1SPJA 1NFYA 3ZZ3A 3NPSA 2P59A 5IDKA 3HK3B 4FU9A 2VIDA 1GI1A 1QBNA 1V3XA 4Q2KA 3W94A 1C5ZB 5FXLA 1CSOE 3OAAD 3PV4A 1UO6A 1K1MA 4AFZA 5CHAC 2ZDLA 3QTVH 2VIVA 4SGAE 1SL3A 5ETXA 2ZA5A 2GJGA 1OS8A 7GCHF 3HGPA 1T4VH 1GBBA 1LHDH 5B6OA 5SGAE 1YKTA 1A4WH 4LZ1H 5IK2D 2FEQH 3UREA 4ABBA 2CJIA 4B71A 1ZTLA 4VGCB 3PWBA 4I8HA 3UWIA 3EYDA 1SLUB 4WJG2 2YOLA 1O3BA 3E91A 2KZ4A 4YESB 1G3CA 1YPMH 1ZPZA 2Y80A 4TPYA 2PTNA 2R9PA 1TGTA 1AFQB 5AHGH 2CN0H 4DIHH 3LGVA 1OWDA 2C8YB 1AY6H 3CENA 1Y3UA 1HLTH 1T8MA 1FONA 4ZH8A 2G51A 1GJDB 3SU3A 2IN2A 4WXVA 1OHHD 3M7QA 1TBRH 1QJ7B 2ZO3H 2FLBH 3OX7U 4XDEA 2OC1A 1S6FA 4F49A 1QCPA 1KY9A 3BTKE 1OWJA 3ZZBA 1V2ST 2BX3A 2FDAA 2BDYA 1BMMH 2HOBA 3GS9A 1YLCA 4H4FA 4R0IA 4MPWA 1AMHA 2ODQA 2PKAA 3PO1C 1LDTT 1HAIH 1Z6JH 4IC6A 1EJMA 1C9TA 4QT8C 1O39A 4YOJA 5B6LA 3BTFE 4WXIA 1EAXA 2VH6A 1QBOA 1O5DH 4CHAB 1E36B 3I77A 2IOTA 1CGJE 1C2MA 1T31A 1V2RT 4FXGH 3U8OH 1G2LA 1EZQA 1C2JA 1SI5H 2F83A 5FPYA 7KMEH 2BY6X 2O8MA 1ZR0A 2G5NA 1H8ED 1ZRBA 2XBVA 1AUTC 2BYAX 4NGAH 1F5RA 2CGAA 2AFQB 3KQDA 3MU4A 2ZF0H 4ASHA 2XNIA 1NBME 3MWIU 1MCVA 5BRRE 2GT8A 1W11U 4JYUH 4B2BA 1MU8B 2C3SA 2Z3CA 1G30B 3P6ZB 1KIGH 3S9AA 1GBDA 3KQEA 1TGSZ 3A88A 4XBDA 1GMDF 3M3TA 1UTNA 3OSYA 1VGCC 4MPXA 4IS5A 4CRCA 1KSNA 5C2ZA 4YM9A 1SGQE 1TNKA 1AIXH 2WPJS 3LIWA 2QF5A 1CVWH 1C5SA 3ZZ6A 2ZIQH 3RXRA 2FX4A 2GX4A 3EDXB 1P9SA 1HJAC 2YNBA 4B75A 4GLYA 1O35A 1GHBG 4X2VA 1HAZB 1QRXA 5FPSA 1DT2A 2J98B 1CBWC 1DWDH 3URDA 5DP6A 5KECA 2IPQX 3UFAA 3QK1A 1FZZA 3S69A 1DM4B 1IAUA 3W95A 1FN8A 4YTAA 1MD8A 4JK5A 3SGQE 2G55A 2FI3E 1TRYA 3RXHA 3N7DA 3BTTE 1ZSLA 4I32A 1WTHD 3MMGA 5C5OA 3LGWA 4UE7H 1E35B 1BMAA 2CHAC 5I25A 1W2KH 3FKSD 2ALPA 2BDIA 5GXPA 3TPIZ 1GBHA 1P05A 2PUXB 1HAGE 2ZC9H 4D9RA 4UFDH 2HRVA 2A7CA 3KGPA 5L2ZH 5DN6D 1EP5A 3PMBB 1GBKA 3TNSA 1GI6A 3Q3XA 2B0FA 3KF2A 4CH2B 3AAUA 1BMFD 2JETC 1HAPH 2Z6BD 1KDQB 1O3IA 1O2LA 1GGDC 1O5BB 1V2VT 5FX6A 1UTPA 4GCHF 3LT3A 1GVKB 1MQ6A 1E1RD 2G81E 1G3EA 1DICA 1F0SA 2ZZUH 1C1PA 1O2SA 5F8XA 3T29A 3JZ1B 1GCTC 3EQ0H 3SUEA 1Y3VA 1EZSC 3PLKA 2BMGB 4GHQA 1EX3A 2Q6GA 2V6NA 2V7QD 3FZZA 3P8OA 3F2HA 1MCTA 4FUGA 1ETSH 2ZPSA 1C1UH 5ESBA 2H1UA 3VEQB 1CHGA 1AD8H 1QB1A 1J17T 1OYQA 3DHKH 1MABB 2ZU2A 1EOLA 1BOQA 4JZ1A 4NZLA 5EU8A 4Y71A 2H9TH 3T5FH 4A5TS 1V2WT 3RXMA 3QDZB 3F1SB 3U28C 1DOJA 2J92A 1T8LA 5FCRA 4CR5A 4FOUC 1HAVB 1SGYE 1M9UA 1A3EH 3MO6A 2J97A 1XUFA 6CHAB 2C4FH 2WPHS 3SO3A 2V3OH 3SNDA 1O3AA 1DXWA 4IN2A 2PSXA 4KTSA 1UK2A 1O2JA 1YCPK 3RXTA 2W6JD 1NRNH 1TPAE 1Z1JA 1GMHF 2R0LA 3SV8A 4X1PU 1TALA 2PGQB 4K3JA 1GJ7B 5J4SA 3KL6A 2B8OH 2RA0A 3OYPA 1N8OB 3MO9A 1O34A 4IMZA 1ELEE 1PQ8A 1Q2WA 3A7ZA 1ZHRA 3FP6E 1GG6C 1K28D 5KEDA 3PM3A 1PPHE 1QBVH 1TGCA 1YGCH 3Q3KA 2ZHQH 1PYTC 2P94A 1EAWA 2JDID 4XBCA 4UEHH 1YCPM 1O5EH 4GPGA 1QJ6B 1NO9H 2ANKH 1H8HD 1H8DH 3SU1A 3OY5U 1A0LA 3ENSB 1BB0B 3E16B 4X8SH 1LHGH 2H6MA 4ZROA 3ZVBA 4Y7AA 3MO3A 3AW1A 4J1YA 2GZ7A 1BBRK 1T4UH 3G01A 1RTKA 1VITG 2BB4A 3N7EA 3RXUA 1BQYA 2YMSD 3K65B 3H5CB 4AGKA 2O9QA 1WDIA 3MU1A 1ZOMA 2G4TA 4JZDH 3L33A 5JBBS 1E37B 2P93A 1XX9A 2W3IA 1GCTB 3PMAB 4XSKU 5C0UA 2ZDNA 3HKIB 5L2YH 3QZQA 1UCYH 3RXKA 2JETB 5CE1A 1C2EA 1KTTB 8KME2 4B2AA 1LO6A 1GGDB 1CHOG 1C1RA 5DP9A 1GHBF 2V0BA 2WV5A 1B0EA 1IHTH 4AC9A 5HKKD 1ESAA 1P2OA 5C3NA 1S85A 2C8XB 1ZMLA 2BXUH 2FOHA 3RXFA 1S81A 4X6NA 1SQOA 1P8VC 2AIPA 3IITA 4X8VH 3D65E 4O9VA 4K1SA 1INCA 1UK3A 4RSPA 3IG6B 1YPKH 2EI6A 1LCYA 3M37A 4H42U 1XUIA 3RMMH 2EEKA 3RXCA 1D3DB 2ANWA 4GVUA 1HUTH 1V6DA 3UB0A 4CRDA 4ISNA 2FX6A 1AO5A 1GDNA 1DANH 1AI8H 1GWAA 3HGNA 1LHFH 3GDUA 3UR9A 4Q7ZA 1AZ8A 1HJ8A 4ZHLU 3PO1B 1CGIE 1P2JA 1P2IA 4JZEH 4BAKB 2QA9E 3M35A 3SQEE 5C1YA 3OEED 2RDEA 2LELA 2ZEBA 1VJ9U 1HRTH 1ZHPA 3A7XA 4Z0KA 1ELCA 1OYTH 2XNDD 4Z6AH 1CHOF 1TA6A 1V2JT 1YM0A 1ELFA 4LXBH 1NN6A 3DSGA 2OUAA 4MNWA 5FX5A 2ALVA 1HJAB 3E8LA 2P8OC 1SLVB 3F0PA 3PLBA 4D7FA 3DCLA 1XUJA 2SGQE 2A45B 3GYMA 2BLQA 1GBFA 1SHYA 1K1JA 4ZXXH 1TB6H 2A5IA 3TJVA 1LVOA 1S0RA 4CH8B 3UNSA 2XBWA 1ELGA 3PRBA 2YNAA 5A8YA 2ZU1A 4IW4E 1L1NA 1GMHG 2VGCB 1QGFA 5IYTA 1GG6B 1GVZA 3OFND 2QE7D 4SGBE 2ILNA 4YT7H 3F68H 2FOFA 4H6SB 1TX8A 2NU1E 3SN8A 9ESTA 1EZXC 2KCAA 1O37A 3OE7D 4ISLA 1THPB 2JH5D 1Y5UT 1UVUH 3EAJA 4ZHMU 3BN9A 1MMJN 3A8AA 3V0XA 1JMOH 4ZKRU 1ZLRA 1UTOA 1QY6A 3V7TA 4I86A 2QCYA 3DFJA 3ZZDA 3H7TA 4DOQA 1SLWB 1P2MA 1GL0E 2ZU5A 1SC8U 2DUCA 1F2SE 3ZIAD 4A7IB 1TGBA 4F4OC 2J98A 2FO9A 3O8DA 1FPHH 2KR7A 4THNH 3FO8D 3DSPA 5EPYA 4B74A 1TABE 4HFPB 5F6MA 4DVAU 2HVXA 2BY8X 2BLOA 1MKXK 4BAMB 2UWOA 2QXHA 2PR3A 1SGNE 1C2FA 3JZ2B 1JWTA 1C5RA 1DUAA 2SGEE 3VB5A 3A85A 4MNYA 1KXCA 2ZDMA 5LH8A 1IQHA 4Y0ZE 3SI3H 3TH4H 3MH6A 1CQQA 2FM2A 5CMXH 4AX9H 2M2AA 2SNVA 3OU0A 1JOUB 1FY3A 1W0JD 2A4GA 2IPHA 5A09A 3UNQA 4GAWA 3GY4A 4ESTE 5HM2A 2G00A 5EJ1A 1WV7H 2KM0A 1DLKB 3LOXA 3QO6A 2JH0D 3T62A 4AN7A 2QF0A 2HNTC 1RIWC 1ABJH 1A5HA 1JBUH 2GV7A 2W26A 3RXOA 2WPKS 1HV7A 8GCHF 1SGTA 4MNXA 5ESTE 1BTPA 1E34B 5A8ZA 3UAIC 4WH8A 4FUIA 1PPFE 4BTTB 2OD3B 4GHTA 1OSSA 3GY7A 2BY5X 1ZPCA 3FN8A 2K1QA 1G3BA 4U01A 5F03A 6GCHF 1YP9A 1TWXB 1IQJA 3TGKE 1C5PA 2HPPH 3A87A 2XC4A 1O2KA 3VFEA 1JRTA 4RI0A 3V13A 4OS1A 2HALA 1P2QA 1VGCB 1GI7B 2ZFQH 3KQCA 3LU9B 1C1WH 1O3OA 3UWJH 3E0NB 4F48B 1WCZA 4AG1A 5CHBA 1A46H 1XUKA 2DE9A 1C5NH 2ZNKH 1UTQA 1HDTH 1VKYA 3MOCA 2QN5T 4MDSA 3P8FA 1Y5BT 1HIAB 1QL8A 3NRLA 1TNGA 1O2RA 4Y7BA 5E0JA 1TOCB 2Z3DA 4E7RG 4JMYA 3KNXA 3RXGA 1BRAA 2TIOA 1Z1IA 1F0UA 1THSH 3M7UA 1HFDA 4YZUA 1DWCH 1Y3WA 3EA9A 2WV4A 3FOAA 4TY7A 1F5KU 1W0KD 1C5WB 1E1QD 3E90B 2Z9KA 1V2LT 1TRNA 2ULLA 4K1TA 2FMJA 2GKVE 2ODPA 1WOFA 2PTCE 5HMAA 1GDQA 1NFXA 1TE0A 5A0AE 3RU4D 4BNRA 1GBEA 5GCHF 4ABGA 4BAQB 5DGJA 1MU6B 1F7ZA 2GCTC 1PQ5A 3HK6B 4CBNA 1C1VH 2PP6A 4YLQH 4O03A 1H9HE 2GMTC 1O2OA 2UUJB 5L30H 3ZZCA 4K5ZA 2XTTB 1SQRA 5E2OA 1B5GH 4ABHA 4MG3A 4AZ2B 2JH6D 1KXFA 3T2NA 1TMTH 3RM0H 1HAHH 1RGQA 4FVDA 2RFKC 3GCOA 5FCKA 1TPOA 3F9EA 1FUJA 3BG8A 1GHXH 1S0QA 5EPNA 3UIRA 2I6SA 1P10A 3CNRA 3M5LA 2PHBA 2OLGA 1LMWB 1XXFA 1C2KA 2BOKA 2JIZD 2ZQ2A 1DITH 3CS7A 1NM6A 1DLEA 4IGDA 1O38A 1WYKA 4Y8ZA 1GPZA 4O97A 1KXAA 1FY5A 4RKOB 1O31A 1LVYA 3LGYA 2RCEA 4WMFA 1Z6EA 3MFJA 4X6MA 6LPRA 3ZV8A 2SGDE 5DJ7A 2FTMA 1DSTA 3LJJA 3BEIB 1K2I1 2Y7ZA 1O5GH 3GY6A 3RXJA 4CHAC 2THFB 3QGJA 2KCYA 3LGTA 4ZUHA 3A82A 3ZV9A 1O3PB 5TJXA 1NY22 4UFGH 5C0TA 4A1XA 1SGIB 4FUCA 3ATMA 1QHRB 2CV3A 3RXLA 3UY9A 4IN1A 1O2PA 4O3TA 1AE8H 2BOHB 1ELTA 3TGJE 1XKBC 1FV9A 2FOGA 3KEEA 3AVZA 1MKWH 3DSOA 3URCA 1W12U 3KYGA 2H9EH 4ZHAA 4IMQA 2ZGHA 4X1QU 3BG4C 2PGBB 2BDBA 4WVPE 3I78A 3U69H 2OC8A 1J8AA 4MVNA 4KKDA 3E1XB 9LPRA 4I31A 1DPOA 1NS3A 3M5OA 4X8TH 3BF6H 1ESBA 4E06H 1AFEH 1O3KA 1S84A 3D49H 2Q1JA 3KCGH 4GUXA 2J94A 3B23B 2FOMB 3MU5A 5EJLA 4OS7A 4B73A 5C1XA 3ZVEA 1EJAA 3ZYEA 1P09A 1TMBH 3EE7A 2ZGXH 3STIA 2FTLE 1N8OC 3SNEA 1SSXA 3NZIA 1BZXE 1LQDB 1DWBH 4XBBA 2RA3A 1C1SA 4JYTA 2NU0E 1KLIH 1BRCE 1V2MT 2G4UA 1V2KT 5G4BA 1LKAA 2R2MB 1C2IA 3KQBA 2A31A 2R3YA 1AUJA 1G32B 2Z9IA 2FESH 4AORA 1O2TA 1HXEH 1C5QA 1AN1E 4UDWH 2GV6A 5EG4A 4Y10E 2L6OA 3U8RH 4Y0YE 1W0ZU 1MKWK 2PKSC 3SQHE 3BTGE 3GCTF 1NRRH 2Y81A 3NXPA 1MTNB 2BVSH 2XYAA 4FUFA 3C1KA 1ELVA 1S6LA 3S9CA 2ESTE 4WMDA 2FOAA 1AQ7A 1QTFA 1TAWA 3ZZ5A 3LONA 1ABIH 1MTWA 1GJ6A 3O8BA 4D8NA 3SU4A 3RXSA 3UOPA 4UFEH 1P12E 5HYOA 1V2NT 4KTUA 5AF9H 2ZQ1A 1HNEE 4E7NA 1O3NA 4AFQA 2IJOB 5E8EH 2W7UA 1YPGH 1FN6A 2UUKB 3U98H 4CR9A 4I8GA 1EAIA 2CK3D 1NFWA 2NU4E 3F9GA 1P3EA 2VIWA 4NSVA 4X8UH 2JJ1D 1YBWA 1Z8GA 2J9NA 4AFUA 5H4IB 2ZTXA 1EP6A 2A1DB 2AMPA 2PUQH 2WSSD 1HPGA 1YF4A 1O3FA 3TJNA 1NU9A 1D3TB 2CF8H 3LH3A 3A8BA 1A0HB 1QL7A 1MUEB 1NROH 3EA8A 3CS0A 2GVFA 1ELDE 1Z8IB 4I8KA 2W6ID 1TQ0B 2VWLA 2V3MA 2QAAA 1MH0A 2NU3E 2PW8H 3TLOA 3BEFB 1GJCB 1G2MA 1YLDA 1ZSKA 2V3HH 1A61H 2H2ZA 3L3TA 4TWWA 5FBEA 2IJD1 4AGJA 3RU4T 4YLUA 1RRKA 5GDSH 1MBMA 1CE5A 1BMNH 2UWLA 3PMHB 1GI4A 4NA7A 4ABEA 3SHAH 3BTEE 3WY8A 1O30A 3LGIA 2A5AA 2O8WA 3SV7A 3MHWU 1QZ8A 3LH1A 1DUEA 2TGTA 1H1BA 2FI4E 3HKJB 3GDSA 1TRMA 4P02A 3VGCB 1UCYK 1TA2A 2ZHEH 2ZG0H 1C5TA 1NZQH 1RJXB 3FAOA 2ZU4A 1O3HA 1THRH 1EB2A 2ZECA 1UHBB 3PV5A 1K1PA 1Q31A 2GCTB 4OS5A 3ZVAA 3RC6A 1BBRH 5A0BA 1L4ZA 1UMAH 1NBMD 2BVXH 2A32A 1HIAA 1C1TA 3Q00A 4P00A 2XWBI 1GVLA 2BD8A 4A1TA 1UVPA 2HPQH 1VCWA 1XVMA 2BY7X 3DT0H 3GY5A 1WAYB 4XRNA 1GHYH 2ANMH 4NA8A 3TGIE 2ZPRA 4K8YA 2EA3A 3ZVCA 1ETTH 1LVMA 4MPVA 1D3QB 2F3CE 1SGCA 1UHBA 1J9CH 1ACBE 4LZ4B 2RDLA 1FPCH 1UK4A 1T7CA 1AWHB 3A81A 3F9FA 3MNBA 1ZPBA 2W3KA 3QWCH 4HGCA 2PFEA 1OWIA 1O2NA 1XM1A 2VIPA 2PWXA 1JRSA 1TFXA 3TNTA 3R0FA 1GL1A 2BXTH 4DY7B 4INHA 3TJOA 2ZGJA 3SU5A 3OY6U 1VZQH 1ARCA 1FDPA 4BANB 5F8ZA 2P3FH 5AFYH 2QF3A 3RUOA 4WY3A 3SUFA 4DT7B 4FETA 3RXBA 3VPKA 3BTWE 4ISHH 1C1OA 1G9IE 1OWEA 1A5GH 2FS8A 3FVFB 2XCFA 2EY4C 5GIBA 1VCPA 1Z71A 3BIUH 3NWUA 4XE4A 5T3HA 1A5IA 3BV9B 2BDAA 2C8ZB 1W0YH 4BAHB 1MKXH 3BIVH 1ZSJA 1NESE 3MTYA 1PJPA 4GCHG 4D9QA 1Y8TA 5CDFE 5KGOA 1QJ1B 2GD4B 3QGNB 1W7GH 3RC5A 4FUEA 3T26A 4MTBA 3GISB 1BBRE 3K6ZA 1OWKA 1BCUH 1SQAA 1UTLM 2FPZA 1DE7H 1W14U 1TIOA 2FYQA 3KN2A 3RXIA 1AE5A 3RXPA 3TIUA 2O8TA 1HCGA 1K1IA 2ZHWH 2ODYB 1MBQA 1WUNH 1GJ5H 3ZVGA 3A86A 4X6PA 2WHXA 2PLXA 4YO9A 2KX4A 3AK5A 1AFQC 1FX0B 3SV6A 1C5LH 2VIOA 1O2YA 2VWMA 4CRFA 1UJ1A 1W7XH 1UCYE 4DT4A 1O2GH 1BMLA 3K9XB 5I46H 2SNWA 3P70B 4TWYA 2TBSA 1QB6A 4CREA 3RXDA 2AH4X 4WH6A 4AOQA 1BHXF 1GJ4H 3QX5H 1ZMJA 1CBWB 5A8XA 1UVTH 1D3PB 2CMYA 2XW9A 3FANA 3ZYDA 2VWOA 3PLPA 1SGFG 1IQNA 1C5XB 3HATH 1RTLA 5CHAB 3VB3A 3C27B 1SMFE 2HLCA 3SOSA 2BTCE 2GP9B 3PWCA 4BXSA 2ANYA 1ANEA 3ATIA 3T28A 1VR1H 2PKAB 2TGAA 3F2FA 4A6LA 1CA0B 4AYYB 3U9AH 1UW7A 4OS2A 2XCNA 4NA9H 3SW2B 1GBAA 1F92A 2GCHG 3SUGA 3TH3H 4UFFH 2QGRA 4FVBA 1SG8B
chains in the Genus database with same CATH topology
2ZFRH 4OS6A 5LPRA 1KXEA 1GI8B 2ZU3A 2GGVB 3GCHC 5JBCS 1P2NA 1T32A 2JKHA 2GMTB 2O8UA 3BTQE 5JPMH 4TYDA 3TU7H 4ISOA 1BTZA 3V3MA 2VU8E 1BA8B 3P8GA 4I8LA 1ZTKA 1TBQH 1O2UA 3A7VA 3ODFA 1GHWH 1C4U2 1Z8RA 3GDVA 3P8NA 1HJ9A 3A7TA 1S5SA 3DA9B 4FUDA 1SGEE 1QR3E 2XRCA 3NKKA 1KXDA 1TX6A 4E05H 4U30A 1YC0A 1SFQB 1FNIA 2BQ7B 3QLPH 1L1GA 3MH7A 3BSQA 1TNIA 3EGKH 2BDGA 2BX4A 4JYVH 3A89A 2VH0A 1K1LA 5EQQA 1O5AB 1CT4E 4JZIA 1HAXB 1AKSB 1AWFH 1C1QA 7GCHG 1TYNA 3SJKA 4WMEA 1KDQA 5DG6A 2A4OA 1HAYB 1ZRKA 4ZMAH 4K8BA 4NIYA 4DCDA 2XC5A 2OTVA 2OC0A 1EUFA 1GJ8B 1O2ZA 2ZTYA 2F9VA 3M7TA 1EASA 3VGCC 1O32A 1L0ZA 2D8WA 1IQLA 5LPFA 3QTOH 2ZGBH 1TBZH 1LHCH 5JBTA 2UUFB 4UD9H 4RKJB 5AVDA 2BLVA 1G36A 3K6YA 1L2EA 3AW0A 5EW1H 4X1SU 2BD2A 5FPTA 8ESTE 5JB9S 3P95A 5DO4H 1T8OA 4X2WA 2AEIH 3IWMA 1ZJKA 3U8TH 3I29A 2FI5E 3LC5A 3NCLA 1WQSA 4KELA 2J34A 1HAOH 2WPMS 3Q77A 2ZFFH 2O8LA 1GBTA 2BD5A 1S83A 4OS4A 1EZUC 4AFSA 3RXAA 1C1MA 3KHVA 1O0DH 1D6WA 4A1VA 3SZNA 1FY1A 2Y6TA 1WBGB 1QL9A 1BT7A 1YCPH 4D76A 1PYTD 1FMGA 1MTNC 3VXEH 5HM9A 1ARBA 3PROA 1AB9C 5A0CA 5EXLA 1XVOA 1UVOA 3MH4A 1D9IA 3UR6A 4Q7YA 5GPIB 2H5CA 1DY8A 4HI3A 1RFNA 1XXDA 1CGHA 2Q6DA 1QA0A 3BTME 1GJBB 1O3MA 1QIXB 2FYRA 3HPTB 5EOKA 4IC5A 2BQWB 2R2WU 4CRAA 7LPRA 2AYWA 2ZI2H 1EPTC 2TPIZ 4DIIH 4DGJA 4IBLH 2Y82A 5C5NA 1C4Y2 1EATA 4FU8A 2G5VA 3RC4A 3ATLA 1CT0E 4CBOA 1H4WA 1NU7B 1PPEE 2BDHA 1ANDA 1C5OH 1BTHH 1BIOA 4ABDA 1S82A 2R0KA 1N6XA 1C5UA 1OP8A 1FAXA 3UQOA 3MI4A 1QRZA 3QZRA 5DP7A 3UPEA 3MU8A 1AVXA 1ZMNA 3DD2H 1P57B 1Y5AT 3SGAE 4JCNA 2QIQA 1PPGE 3ELAH 3QUMP 8GCHG 1TGNA 2GCHF 4X2YA 1NPMA 1A0JA 3P17H 8LPRA 2C93B 4U32A 1QURH 3S9BA 4OGXA 1W8BH 2FP7B 3SV9A 3PTNA 1BITA 2KAIB 3SNCA 4FU7A 1C2LA 4B2CA 1O3DA 1GMCF 1CU1A 1C5MD 2FOBA 1K1NA 3S0NA 4BAOB 3E3TA 6CHAC 3S7HB 5EGMA 3BTHE 2BD9A 5J4QA 3VB4A 2XXLA 2I6QA 4Y76A 2AMQA 1V2PT 2Y5FA 2ZPQA 1WTGH 1YPHC 4H6TA 1MTVA 4K1EA 2F9NA 1C9PA 2UUYA 2ZDAH 3T27A 1HGTH 3PB1E 2WUBA 2M5TA 1FI8A 2NU2E 4D7GA 1LQEA 4FUBA 1U6QA 4HTCH 5DP5A 1C2HA 1C5YB 4PROA 2FS9A 5DPAA 1OXGA 3ODDA 2BDCA 2FOEA 2SGFE 2ZHDA 4ABJA 4R8TB 1LPZB 2B5TB 2GDDA 1NRSH 4Y6DA 1MAYA 1PFXC 3RMLH 1JIRA 1GI9B 1Q3XA 1GMDG 5HGGA 3M5NA 1SOTA 1NRQH 4X2XA 2TGPZ 2XWAA 5EXNA 3RLYH 3TJUA 1GMCG 2FOCA 2QY0B 2HNTE 2STAE 4I8JA 1D6RA 1O3JA 1IOEA 1N1LA 4M7GA 3MNCA 4I7YH 2F9PA 5HXFA 3ZZ7A 2W7SA 1ZGIA 3VXFH 1VJAU 1C1NA 1MAXA 2EI8A 1PPBH 5GCHG 3ZVFA 1IQEA 1FIZA 4CRGA 5A2MH 1QFKH 4NZQA 5JBAS 1BRBE 3ZZ9A 2A2QH 4ABIA 1GJAB 1AZZA 2AIQA 3Q3YA 1VITF 1KLTA 1CA0C 1F0RA 2QXGA 1AGJA 1PPZA 1VCQA 3TK6A 1O33A 1P11E 2A0QB 1SFIA 2ZWLH 1EPTB 2QC2A 5EQRA 2ZCHP 5EXMA 2LNCA 1ZTJA 2Z9GA 3SJ8A 1AKSA 1FLEE 2WUCA 2F9OA 3VB7A 1P9UA 2VWNA 1SVPA 2A4QA 1EJNA 4ABFA 3ESTA 2AERH 1MTSA 3RU4E 4MQAA 1ESTA 1A1RA 3LJOA 2Z3EA 1G3DA 2TRMA 1Y59T 4U2WA 5GJ4B 3RXQA 1O3CA 4DW2U 2FXRA 1FQ3A 3AASA 3LPRA 4JK6A 4ZKSU 2QYIA 3E6PH 3RDZA 1TX7A 2EC9H 2ZHFH 1Y3XA 1GHAF 4Y79A 1AU8A 1RD3B 4ZXYH 2BY9X 3M36A 3GY3A 1B0FA 4ABAA 4XFQA 2G52A 1O2MA 1P2KA 3RXEA 3KIDU 2BD4A 1C2DA 1DWEH 3GCNA 5C20A 1O2QA 1NC6A 5C67A 6GCHG 3BEUA 2PV9B 4NIVA 1TNHA 5EW2H 1MZDA 1QA7A 2UWPA 2ZDKA 3RP2A 3GCTG 3PMJA 4BTIB 4JZFH 1BJUA 2VINA 3SUDA 2VNTA 3D23A 1ANCA 4NSYA 1BTUA 1P03A 1HYLA 2BZ6H 2VB0A 1TMUH 3ZZ4A 6ESTA 1XMNB 2A7HA 3MNXA 1HBTH 1BDAA 2H5DA 5DP3A 1BTWA 1XUHA 3B8JA 1NT1A 4INKA 3ITIA 1A7SA 3M61U 3LDXH 4DURA 3ZVDA 3A7YA 4GSOA 1O3EA 1GI2A 2J95A 4VGCC 3ZZ8A 1GI0A 2F91A 3MU0A 5PTPA 4MNVA 1SGFA 2SGAA 2FLRH 4NWKA 4ZAEA 2GDEH 3SV2H 2BD7A 2NWNA 4CRBA 4X0WU 3U1IB 2QV1A 1E0FD 1QNJA 5DKMA 1DFPA 1FXYA 1RIWB 1N6YA 1W13U 4AB8A 1P04A 2F9BH 2J2UA 5K0HA 1GI3A 3A8DA 1FIWA 1BHXB 1DX5M 5DP4A 5LPEA 3STJA 1W3CA 2BQ6B 1K22H 4YOIA 1BRUP 1C4V2 4ZKNU 2QXIA 1GHZA 1C2GA 1TNJA 2VIQA 2ZFPH 1TNLA 1GDUA 2J38A 1PQAA 5FBIA 4NWLA 2XC0A 3GCHB 1FY8E 3F9HA 1XUGA 1X7AC 1YPHE 5L6NH 1DSUA 3P92A 3A83A 1J14A 2AGGX 2Y5GA 2ZCLP 1J15A 5F8TA 1Y3YA 1O3GA 1ZGVA 1C5VA 3RLWH 2Y5HA 1ORFA 2A5KA 1TONA 2XBYA 3EA7A 3CP7A 3MYWA 3SORA 1EQ9A 1NRPH 1P0SH 4KTCA 2WPLS 3FFGA 1F0TA 3S7KB 2BVRH 2F9UA 2P3TB 2Y7XA 2LPRA 3O8CA 5E0GA 1QRWA 1CT2E 2EI7A 4INLA 2AGIX 3K2UA 4K69A 3GYLB 2PSYA 1LTOA 1GBLA 1GCDA 4MPUA 1YPJH 1O36A 1O5CB 1A3BH 1IHSH 1GBCA 1WQVH 3SJ9A 5EODA 1K1OA 2R3UA 2A7JA 3AAVA 3RM2H 3UQVA 4X1NU 1G37A 2OQUA 1O2VA 4K2YA 5C1UA 5DK1A 1O2HA 2WYJA 1F5LA 2BD3A 4LK4A 3PTBA 2FZZA 3SJOA 2B7DH 3UOUA 1LPGB 2AS9A 2FIRH 1K9OE 4B76A 1UTKA 2STBE 1EOJA 2WINI 2CXVA 4NCYA 1GBJA 2KAIA 4LOYH 1WU1A 1K21H 3A84A 1TPSA 1BJVA 4X6OA 2AMDA 2P3UB 4BXWA 4KGAA 5K7RA 3N7OA 1ZJDA 1B7XB 3DFLA 4J2YB 1SLXB 3QN7A 3VB6A 1BUIA 2TGDA 1H8IH 5TCAA 1CO7E 2OC7A 2VJ1A 3SU2A 3GY8A 2BHGA 3FZDA 1IQMA 3RMNH 1DXPA 2XBXA 2OXSA 1SGRE 4DJZB 3V12A 1IQKA 5T6DA 4NFFA 1Z8JB 3TITA 4NFEA 2BLWA 2D2DA 4TPIZ 5JDUB 3O8RA 1TPPA 1YYY1 4FUHA 2Z94A 3ATKA 1WSSH 1QQ4A 3GY2A 3EE0B 1CA8B 4A92A 1O2XA 4NIWA 1RTFB 1O5FH 3SI4H 3M5MA 3SNAA 1OOKB 2A4RA 2PKSB 4I33A 2ZFTA 3UUZA 1DS2E 3SNBA 1PPCE 1GHVH 1NFUA 1TQ7B 1O2WA 5E2PA 2ZDVH 5BPEA 1V2OT 2Z9JA 3PYHA 3BTDE 2B9LA 4BOHA 2ZFSA 4Q80A 3RXVA 4Y11E 1EPTA 1UTJA 1SGDE 2C90B 1V2UT 3TVJB 3BG4B 3OTJE 2OCVB 4Y8XA 1HXFH 4Y8YA 1SGPE 2AGEX 2ZTZA 1FY4A 1TOMH 2SGPE 2SFAA 3SBKA 1J16A 5AFZH 2A2XH 3ZZAA 1LKBA 2ZGCA 1ELAA 1LHEH 2QXJA 2RG3A 1HB0B 4DG4A 2HGTH 3SU6A 4Q7XA 1ZHMA 1RXPA 1ID5H 3GICB 1GBIA 5GWZA 4WWYA 1IQFA 4ISIH 3TH2H 1O3LA 1GI5A 1ZZZA 1EAUA 2GTBA 2VGCC 1KLJH 1Z7KA 3D62A 2G8TA 3TK5A 3E0PB 3GOVB 4TY6A 1DDJA 1LVBA 1V2TT 1T8NA 1AVGH 1S6HA 4RN6A 3FP7E 2D1JA 1P06A 2VVVA 2CF9H 3R3GB 1FJSA 1AHTH 2ASUB 2OQ5A 5FHTA 4UONA 1UVSH 4NG9H 1E38B 3A7WA 1SB1H 2OBQA 4OGYA 2FODA 3NUMA 3TK9A 4MLFB 1A2CH 3M3SA 4FUJA 2OBOA 2Z7FE 2ZKSA 1YPLH 3LC3A 2HNTF 3UNRA 1UTMA 1QQUA 5LGOA 1XKAC 2ZCKP 1QB9A 2BZAA 1SBWA 3A8CA 1MTUA 3MH5A 1NTPA 1KXBA 1MQ5A 5DP8A 5JYIA 5ABWA 1RS0A 3LGUA 2GT7A 1ZYOA 2ZP0H 4XOJA 5T6GA 5FAHA 1BTYA 1MD7A 3Q76A 4AG2A 2CHAB 4BTUB 2GZ9A 4NIXA 1OP2A 3UTUH 1AB9B 1ELBA 2WPIS 3FP8E 3SGBE 4YT6H 4K60A 3SJIA 4KP0A 1BTXA 1GJ9B 1PQ7A 1FAKH 3LKWA 3U1JB 3M3VA 3H7OA 3B9FH 1L1JA 3A80A 1AVWA 2V35A 1IQIA 1OWHA 1H9IE 3SU0A 4AB9A 2WYGA 1ANBA 1OP0A 1SOZA 1W10U 2D26C 2GZ8A 3NK8A 3RMOH 1YPEH 3T25A 3L6PA 3MNSA 4YOGA 4X1RU 2OP9A 2DE8A 1P02A 1SQTA 4WF8A 1EKBB 2Q6FA 1L4DA 1IQGA 1JXPA 3ATWA 1TLDA 1V2QT 4ZKOU 1VITH 5TCCA 2P8OB 1MZAA 7ESTE 1P3CA 1GHAG 2C8WB 3F6UH 4O3UA 2FWWA 2OINA 1O2IA 1OX1A 2VVCA 1KYNA 4B1TA 2BM2A 1H9LB 1GBMA 3DUXH 2J4IA 1P01A 1OPHB 2P95A 3SHCH 4HZHA 2VVUA 2Z9LA 1OKXA 5E0HA 1SR5C 2H9HA 1ETRH 2W5EA 5JB8S 5T6FA 1D4PB 4AYVB 1EB1H 1DY9A 1KTSB 1LPKB 1JIMA 2HWLB 5EQSA 1EXFA 1SHHB 1HAVA 1DVAH 2P16A 1SPJA 1NFYA 3ZZ3A 3NPSA 2P59A 5IDKA 3HK3B 4FU9A 2VIDA 1GI1A 1QBNA 1V3XA 4Q2KA 3W94A 1C5ZB 5FXLA 1CSOE 3PV4A 1UO6A 1K1MA 4AFZA 5CHAC 2ZDLA 3QTVH 2VIVA 4SGAE 1SL3A 5ETXA 2ZA5A 1OS8A 7GCHF 3HGPA 1T4VH 1GBBA 1LHDH 5B6OA 5SGAE 1YKTA 1A4WH 4LZ1H 2FEQH 3UREA 4ABBA 2CJIA 4B71A 1ZTLA 4VGCB 3PWBA 4I8HA 3UWIA 3EYDA 1SLUB 4WJG2 2YOLA 1O3BA 3E91A 4YESB 1G3CA 1YPMH 1ZPZA 2Y80A 4TPYA 2PTNA 2R9PA 1TGTA 1AFQB 5AHGH 2CN0H 4DIHH 3LGVA 1OWDA 2C8YB 1AY6H 3CENA 1Y3UA 1HLTH 1T8MA 1FONA 4ZH8A 2G51A 1GJDB 3SU3A 2IN2A 4WXVA 3M7QA 1TBRH 1QJ7B 2ZO3H 2FLBH 3OX7U 4XDEA 2OC1A 1S6FA 4F49A 1QCPA 1KY9A 3BTKE 1OWJA 3ZZBA 1V2ST 2BX3A 2FDAA 2BDYA 1BMMH 2HOBA 1YLCA 4H4FA 4R0IA 4MPWA 1AMHA 2ODQA 2PKAA 3PO1C 1LDTT 1HAIH 1Z6JH 4IC6A 1EJMA 1C9TA 4QT8C 1O39A 4YOJA 3BTFE 4WXIA 1EAXA 2VH6A 1QBOA 1O5DH 4CHAB 1E36B 3I77A 2IOTA 1CGJE 1C2MA 1T31A 1V2RT 4FXGH 3U8OH 1G2LA 1EZQA 1C2JA 1SI5H 2F83A 5FPYA 7KMEH 2BY6X 2O8MA 1ZR0A 2G5NA 2XBVA 1ZRBA 1AUTC 2BYAX 4NGAH 1F5RA 2CGAA 2AFQB 3KQDA 3MU4A 2ZF0H 4ASHA 2XNIA 3MWIU 1MCVA 5BRRE 2GT8A 1W11U 4JYUH 4B2BA 1MU8B 2C3SA 2Z3CA 1G30B 3P6ZB 1KIGH 3S9AA 1GBDA 3KQEA 1TGSZ 3A88A 4XBDA 1GMDF 3M3TA 1UTNA 3OSYA 1VGCC 4MPXA 4IS5A 4CRCA 1KSNA 5C2ZA 4YM9A 1SGQE 1TNKA 1AIXH 2WPJS 3LIWA 1CVWH 1C5SA 3ZZ6A 2ZIQH 3RXRA 2FX4A 2GX4A 3EDXB 1P9SA 1HJAC 2YNBA 4B75A 4GLYA 1O35A 1GHBG 4X2VA 1HAZB 1QRXA 5FPSA 1DT2A 3URDA 1CBWC 1DWDH 5DP6A 3UFAA