5JZGC

Cryoem structure of the native empty particle of a human rhinovirus c
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
331
structure length
303
Chain Sequence
GAQVSSVIKYFNINYYKDSASSGLSRQDFSQDPSTLTNPALMSPSVEACGYSDRQITIGNSTITTSLHTVLAYGEWPTYLSDIDATSVDKPTHPETSADRFYTLDSVEWQVGSHGWWWKLPDALKDMGVFGQNMYYHSMGRSGFIIHTQCNATKFHSGALIVAVIPEHQLAYVGGVKVNVGYDHTHPGQSGHQIRGPSQSNDRSGGKPDEDPLFNCNGTLLGNITIFPHQIINLRTNNSSTIVVPYINCVPMDNMLKHNNLSLVIIPLVPLRPGSSGINSVPITVTIAPYKSEFSGAMEAQRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Atomic structure of a rhinovirus C, a virus species linked to severe childhood asthma.
pubmed doi rcsb
source organism Rhinovirus c
molecule tags Virus
total genus 40
structure length 303
sequence length 331
ec nomenclature
pdb deposition date 2016-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
C PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jzgC02
3J8F3 1EAH2 4JGYA 5K0UC 1TMF3 1AR83 2HWE1 4CDUB 3J8F2 2RS31 5C9AC 1VBB3 5BNOA 1QJU2 5ABJA 4JGYC 1VBA1 1PIV3 1K5MC 1VBC1 5BNNA 1PIV2 3ZFFA 1Z7S1 1QJX1 5BNOC 2WLPA 2RM22 2WFF2 4Q4Y1 2HWE3 2WWSA 3NAPB 4GB32 4CDQB 5BNNC 2BPA2 5A32A 5ABJB 1RVF1 2HWB3 4CEWB 4YVWA 1RUI1 1VRH1 4RR3A 1ND2A 2R061 4QPGC 1RUE3 3VBFC 4RS5A 3JD73 5BNPA 2ZZQA 1AR91 1NOVA 1RUE2 3VBRC 1CD3G 1ZBE2 5A32B 1RUF1 1BEV2 2RS53 2GSYA 4AEDC 4JGZA 1R1A1 1A6CA 4PDWA 3CJIC 1OHFA 4RR3B 1ND2B 1BBT1 3VDDB 4RS5B 1ASJ3 1VB2A 2FZ1A 2FZ2A 3ZFGB 4Q4V1 1ASJ2 2RR11 4JGZB 4PDWB 4Q4X2 1FMD3 1V9U1 1F8VA 2GH8A 1FOD3 5C8CA 3DPRC 2RMU2 1FMD2 1HXS1 5LK7B 1B35A 1FOD2 3VBOC 4CDXC 2PLV1 3S6PA 1MEC3 1D4M1 1OPOA 2HWD1 1PGL1 2RS11 1AYM3 1E57A 1NY71 1MEC2 4BCUA 1MQTA 5DDJ3 1BMV1 1QJY3 2HWF3 2HWC1 3VBUC 4RHV3 1AYN3 1R091 1QJY2 1ZBA3 1W39A 2HWF2 2X5IA 1MQTC 4RHV2 1AYN2 1OOPB 1RUD1 5AC91 4GMP3 1PVC1 1AR63 1FPN1 4GH4A 1RUH2 1COV1 1ZBA2 3JBG1 4GMP0 1R083 1ND3A 5D8AC 2XBO1 4CEYA 1EAH1 3TN93 4YVSA 1AR62 1RUG3 1NCRA 1C8M1 1R082 1X33A 3J8F1 3TN92 2WS93 1ND3C 1RUG2 1TMF1 2X5IB 1AR81 2R043 1CJDA 4GH4B 1AL22 1VBB1 2R042 4RQPC 1PIV1 4CEYB 4YVSB 4CDUC 1PGW2 5J96B 4Y5Z0 5CFCC 2R072 1VBD3 1QJU3 5JZGB 3NAPA 5L7OC 1PO13 4CDQA 1VBD2 2HWB1 5GKAC 4CEWA 5C4WB 3JB8A 1AR72 1PO12 2RM23 2WFF3 2WZR2 1H8TA 4WM7B 1RUE1 5FMOS 4GB33 1EV13 5ABJC 1VBE3 4CEWC 3JD71 4WM8B 1EV12 2RS51 1VBE2 3ZFFC 5FMOL 4N43A 4FTEA 1VAKA 1H8TB 1ASJ1 3VDDA 3VBHA 1ZBE3 4YVWC 1BEV3 4Q4X1 2DF7A 4IV3A 4RR3C 1ND2C 3ZFGA 1K5MB 1HRV3 4N43B 4RS5C 2BFUS 5BNPC 1HRV2 1FMD1 1RHI3 3ZFGC 1FOD1 4QPIA 2QQPA 4CDWA 3VBHB 1RMU3 4JGZC 5ACA3 4PDWC 4Z92B 1RHI2 1RUJ3 4IV3B 1HX6A 3HAGA 2BFUL 4Q4X3 1RMU2 1SMVA 1NA1A 1MEC1 5ACA2 1RUJ2 1AYM1 4Q4W3 3VBFB 2RMU3 5DDJ1 4QPIB 1QJY1 4CDWB 2HWF1 3M8LA 1X36A 4Q4W2 1AYN1 4RHV1 3VBRB 1RUC3 3ZXAC 4SBVA 1IHMA 1ZBA1 3ZFEA 3FBMA 3CJIB 1VRH2 1GFF2 1NA1B 4GMP1 1RUC2 1AR61 2R062 1OOPA 5C8CC 1AUYA 1QJZA 1R081 4N53A 1B35C 3TN91 1AR92 1RUG1 1HRI3 2MEV3 2WS91 3ZFEB 1RUH3 2R041 5CFDA 2Y26A 1HRI2 2MEV2 1TME3 1PGW1 1WCDJ 4N53B 1QQP3 1NCQB 2X5IC 1TME2 3VBOB 4GH4C 1QQP2 1RB8G 5J98B 1AL23 1VBD1 5CFDB 1QJU1 1PO23 4CEYC 4YVSC 1NCRC 5JZGA 1PO11 1AL0G 4NWVA 1PO22 1HXS2 2RM21 2R073 2WFF1 5C4WA 4Y4YA 3VBSA 5JZGC 1POV3 4WM7A 4GB31 1EV11 1VBE1 1PGL2 1POV0 4IV1B 5C4WC 4WM8A 2HWC2 1AR73 3IDEA 2WZR3 4NWWA 5A33A 3VBSB 5K0UA 3NAPC 4CDQC 1ZBE1 1COV2 1BEV1 5C9AA 2BUKA 1H8TC 1HRV1 1K5MA 1C8M2 1HQNA 5A33B 1TMF2 5CFCB 1AR82 4FTSA 4FTBA 1RHI1 5K0UB 4FSJA 1RMU1 1VBB2 4N43C 5ACA1 5L7OB 1RUJ1 5C9AB 4JGYB 3VDDC 3VBHC 1C8NA 4Q4W1 4QPGA 5BNOB 2RMU1 2RS33 4IV3C 3VBFA 2HWE2 2ZAHA 1VBA3 1VBC3 1RUC1 2HWB2 3VBRA 2RS32 5BNNB 3ZFFB 4AEDA 1VBA2 1Z7S3 1QJX3 3CJIA 1VBC2 4QPIC 4CDWC 4Q4Y3 4QPGB 1Z7S2 1QJX2 3JD72 4YVWB 1RVF3 4Q4Y2 1NA1C 1RUI3 2RS52 1VRH3 1HRI1 2MEV1 4AEDB 2R063 1RVF2 1RUH1 4LLFA 1RUI2 5BNPB 1NG0A 1AR93 1TME1 1QQP1 1RUF3 3ZFEC 3DPRA 1NCQA 1R1A3 3VBOA 1OOPC 4CDXA 1BBT3 2BBVA 1RUF2 1AL21 4N53C 1R1A2 1PO21 1NCQC 1BBT2 4RFT0 4Q4V3 3DPRB 3VBUA 2RR13 2R071 5CFDC 4Q4V2 4CDXB 1POV1 4EJRA 5C8CB 1V9U3 2RR12 1AYM2 2XPJA 1DDLA 4IV1A 1B35B 5D8AA 1V9U2 1HXS3 5DDJ2 1AR71 3JB4C 2WZR1 5FOJB 2PLV3 3VBUB 1D4M3 2HWD3 2RS13 4IV1C 2PLV2 1MQTB 1D4M2 2HWD2 2RS12 3LOBA 2HWC3 2VQ0A 5D8AB 1NY72 4RQPA 1F2NA 1R093 3VBSC 1BMV2 4WM7C 1VB4A 2TBVA 4CDUA 5AC93 1RUD3 2WS92 1PVC3 1FPN3 1R092 1COV3 1ND3B 4WM8C 5CFCA 3JBG3 2ZTNA 2XBO3 1RUD2 5AC92 1M06G 1NCRB 1EAH3 1FPN2 1PVC2 3JBG2 5L7OA 1C8M3 2IZWA 2XBO2 4RQPB
chains in the Genus database with same CATH superfamily
4ZXEA 3N9QA 5F6KA 1TMF3 5FPXA 3B3QE 4DPNA 1AR83 2RG4A 3M3CA 4Y33A 2HWE1 4IEZA 4CDUB 1J3QA 2IXLA 1Y4WA 4LE4A 4FPCA 2YBSA 3IAQA 2OUHA 1VMHA 1VBB3 4L8QA 4JGYC 3AZVA 2KD7A 3OD0A 3WEZA 1A34A 5FZ8A 5FY1A 4DUXA 3D3AA 2B9UA 4R52A 1BZWA 1QMJA 4BH9A 4META 5G05L 5BNOC 2VOXA 4M3CA 4YSFA 3AYEA 4YGCA 2J22A 1SPPB 3CO2A 5FXXA 2JX9A 5GZFA 1PGSA 3MLKA 4WVMB 5C5TA 2WWSA 1QY4A 4GB32 3MIEA 5FPAA 4CDQB 5BNNC 2DVDA 3L2YA 5CAZA 5A32A 2BPA2 5ABJB 4CEWB 4CVUA 4YVWA 1RITA 5FOBB 1UIKA 2NM1A 5H9QA 3K46A 1H9WA 1RUI1 5FFOC 4D6SA 4PLMA 5A7NA 4AHXA 2P2KA 2R061 3T2QA 4D8MA 3I2IA 1UYZA 1H1AA 1S4CA 5FYTA 3UL2A 5AVAA 2Y33A 3HN1A 1HB4A 3NQHA 4QDQA 4OFGA 1P8JA 3I2DA 4CP0A 2ZZQA 1XE7A 4OZOA 1G9CA 1QDCA 1H2NA 4UFMA 1ZRRA 2OW4A 1CD3G 1ZBE2 2P6CA 4CCMA 5L9VA 2IFWA 2VM9A 1D0HA 2W91A 3ZXGA 1VRBA 1H1IA 2K9ZA 4FFFA 1IPSA 1UY0A 4Q0VA 1QOOA 5HCFA 4IEUA 1IZ3A 3SCFA 5CKQA 1ASJ3 1O4TA 3AB0A 1QKQA 5FJKA 2CL2A 1DG6A 1VAVA 2Y6JA 3LFIA 3ZR5A 4DXTA 1US2A 3LB9A 3S5AA 2W5FA 1ASJ2 3J7NA 5I91A 1SG3A 3PIJA 4Y22A 1ENXA 2ZGLA 2H0BA 3C3VA 1RXGA 5JUVA 4XURA 1ULGA 2VR4A 5DZGA 2BVVA 1XXNA 3OEBA 4QHBA 3N36A 4CCCA 1FMD3 1V9U1 5CBLA 2GH8A 3O0XA 4JDNA 5C8CA 1HIXA 4IERA 4M3CE 4P9LA 2OPWA 4G9SB 5JOZA 3B9IA 3M3QA 1FXZA 2JG8B 1LGBA 1FMD2 4FBFA 1HXS1 3Q9OA 3WG2A 3WDYA 5C5UA 4CDXC 2QQKA 5FPZA 2Z2SB 4HKWA 2KA3A 5K8SA 5LB6A 1QJEA 1EUTA 4COVA 1YXWA 1D4M1 2ZGMA 4AVTA 2LRPA 5A3LA 4DRRA 3HNBM 4COUA 2V73A 2J1EA 2VZSA 4GWNA 2B39A 5A7SA 3RZLA 3IPVA 2CGOA 2SLIA 3IIAA 4OI1A 1MQTA 5FR3A 2AUYA 2HWC1 2HWF3 4WVVA 3LGRA 1AYN3 2O1QA 3WG4A 4QX8A 2VMDA 2WINB 3JQXA 3OB8A 2HYXA 5LBFA 3WHTA 4JHTA 3EXUA 1ZBA3 2HWF2 2WC2A 3OPTA 3Q8BA 4RGGA 4OHYA 1AYN2 1RUD1 2ET1A 4IGPA 5JLVA 1C28A 1AR63 1WBLA 1W9SA 2TUNA 4XJWA 3U75A 1COV1 4XILA 1ACCA 1Q8OA 1ZBA2 2XVLA 1ND3A 5IVYA 4MZUA 4W6WA 3WR0A 1H2MA 4Y1VA 4AWDA 1PMJX 1UYPA 4Q0SA 1HN1A 1AR62 1NLRA 3SITA 3R0RA 1CAWA 4LHKA 1C8M1 3LKJA 1X33A 2LROA 2WNEA 4IEOA 3EMRA 2R043 1ULFA 2WO1A 4XF9A 4XJAA 3FWEA 3IDAA 3QD6A 4XFCA 4FAHA 3DN7A 4YG3A 2W0XA 2PHTA 1H6XA 1LOBA 3RYKA 3TEWA 2AC1A 2R042 1AVBA 2W68A 4H14A 1ZRCA 5FZOB 4NHXA 4RQPC 5AFEA 2Y6LA 4M0NA 2ATFA 4E2QA 2D93A 1WW6A 3W20A 1GP4A 3WG1A 2D98A 3T0AA 5C3OA 4Y3OA 2WIIB 3R6SA 1OA3A 3V0BB 3NRUA 3AYCA 4QU2A 1R64A 5FPBA 5IFTA 1IQAA 1QJU3 2EVXA 1O3QA 3RYPA 1C1LA 1F35A 4Y5TA 2VMGA 4IE7A 2HWB1 5JI9A 1BK1A 4NAOA 2R6QA 3VKOA 1UOFA 3NKTA 4JKKA 2BQPA 1LOFA 3JB8A 3HVDA 4NE9A 3AP6A 2QJVA 5K4LA 1H8TA 5A7PA 4D7YA 3O0VA 4FPKA 3BODA 4A7YA 3PVEA 4A7KA 4DEQA 4EV0A 1N3PA 3P3PA 4ZZ8A 2ZX0A 2VUCA 3JD71 3USUA 3A4UA 4A45A 1GOFA 4CE8A 2VW0A 3B93A 3FHIB 5GLUA 3LZZA 2BW8A 1YQ2A 2YXSA 2YC4A 4S2HA 1LB2A 5FMOL 4N43A 4FTEA 1LODA 3RRDA 3UETA 3I2HA 3ASIA 4K20A 1MS9A 3ZMOA 4XUQA 3ZVXA 1QXRA 5I0TA 1Q5OA 1QHDA 2JDMA 3KCYA 1I5ZA 3AXEA 3VDDA 3IT8A 4NIGA 2WNUB 1GWMA 3VBHA 4YVWC 2Z69A 2PHFA 1W8FA 2OIIA 4QD2A 1HLCA 2WT2A 1GZTA 1K5MB 4MXWA 2CSGA 5FY5A 2VVFA 3I59A 4BQXA 1N1YA 2VUJA 5APAA 4Y1XA 1WGPA 5GLZA 1JZ3A 3RYRA 2XQRA 1LESA 4E4ZA 2X09A 2C24A 1RMU3 2E32A 2VNOA 3HIFA 1LOAA 2OVUA 3OTFA 4WBBA 2WYSA 1DHKB 3HAGA 2ZGTA 4Q4X3 3VKNA 2VQAA 1RMU2 4UW3A 4MO3M 2BNNA 1LOEA 1MEC1 1QWRA 2W1SA 1GNHA 3O1VA 1YIPA 1AYM1 1OQDA 1V70A 2BOJA 3AFGA 2PHUA 3SKVA 4Q4W3 2YROA 3GZEA 4A7ZA 2W1WA 4DXSA 3LWCA 2RMU3 3CEWA 5LY2A 2VTFA 5DDJ1 4BXFA 4Y20B 1X36A 3ZN5A 2WWUA 1GZWA 4Q4W2 5EV7A 3CQOA 5F32A 4LKEA 5IJRA 3LDKA 1WKYA 3S7IA 2E26A 3WQ1A 3ZXAC 3DXUA 2J1TA 1JHNA 1VRH2 4A41A 1NA1B 2XKPA 2A3YA 5C8CC 1AUYA 2F4PA 5FMCA 4AF9A 2FCTA 4XF4A 1R081 4N53A 1S0IA 1CAUA 3AZYA 5FTTC 4C0BA 3TN91 1S2BA 2VZOA 4GKYA 1AR92 1RUG1 3SEEA 3V65A 1O4ZA 4XAAA 2P3JA 4DRVA 4UFHA 2D5FA 4LHNA 1HRI3 4MHUA 2WS91 5BNQA 5JSOA 2ZCWA 1WMXA 3K75B 1RUH3 3TYJA 1MS3A 5CFDA 4PLOA 1S0JA 2GC3A 2Y26A 4XQ4A 4QQ2A 1HRI2 3KM5A 1WD3A 4UYBA 3VKLA 2VOVA 5A1AA 3EYPA 3H3ZA 3BIWE 2NMOA 2YBPA 3KT4A 3VBOB 5L36A 3WVJA 1OFSA 3DYOA 3I97A 3LQCA 4DO0A 4V2WA 4YFZA 1PK6B 1UX7A 2E7QA 4OULA 1VBD1 2VCBA 4S2DA 4A3XA 5T50A 4F8AA 2X53S 2DURA 4XZPA 4YYOA 2B5HA 2WAOA 4DIQA 1XNAA 2VBPA 3FHAA 2YGLA 4K1YA 2ZGNA 5A6ZA 3SKJE 2J1AA 2JKXA 3LF7A 3M2MA 4OMCA 3BGAA 4Q0PA 4QB6A 2JG9B 3KVAA 4BJ0A 3V0AB 1Q3EA 3VGIA 1X82A 2HBTA 5FYVA 3RPQA 4YM1A 5C7GA 5JI7A 1U0AA 5C3SA 4S2GA 1CR7A 3ES1A 5JZGC 3MDPA 2P6HA 4GB31 2ZOEB 5A3PA 5EXOA 3ZDVA 1FAYA 3WW4A 2R0FA 5C4WC 2C5DA 2GNBA 3MF9A 2QQWA 5ANQA 1DLLA 1ODNA 1W6PB 5LA9A 1JZ7A 3WLUA 4QQPA 2A73B 4P9XA 3VD4A 4AVBA 3TEYA 3JUUA 4QQHA 4Y4RA 3KGLA 3NV4A 4WZCA 4KGQA 2VGDA 5I8YA 1CIYA 2EIDA 3VBSB 2SBAA 4HMZA 1UOJA 3O1TA 4LJHA 3GBFA 1ZBE1 1GZ9A 1OFNA 4H7MA 3BTAA 1U5IA 1I5PA 2JENA 3OYWB 4LPLA 5C9AA 1LOFC 1ULCA 1MR5A 1UY1A 4IEXA 4MGYE 3THCA 4E4SA 2XONA 2BUKA 4CCEA 1H8TC 4KBBA 1KFUL 1XJAA 2IXIA 3AXDA 4GAZA 5CG9A 1H2KA 2O0OA 2Z42A 5AVPA 3OUIA 4BE3A 1HQNA 5EWSA 1J1TA 3L2HA 3IM0A 2QZ3A 3NNFA 4AHZA 1AZDA 5A33B 4HT1T 4NIDA 4COWA 1SFNA 3WINE 3C8XA 1C4RA 2B45X 3FZ3A 3ZSKA 5FUNA 4RL7A 4XJ9A 5L7OB 4N43C 5CKNA 4XUNA 1UYYA 1GU3A 1YFUA 1RUJ1 4URAA 1S2EA 1BQPA 5CEHA 1FI2A 5JOWA 1DQ6A 2WO2A 3T08A 2WSVA 4E2SA 2CU5A 2ZGQA 3VDDC 3OBTA 1ULPA 2ADDA 4KG0A 3VBHC 1H6YA 4QPGA 1XNCA 4QX1A 3N7JA 3VBFA 1XRUA 1Y9GA 2HWE2 3ELNA 4GIQA 3K4AA 3U14A 5A80A 1ENRA 1AX0A 5FREA 1SQ4A 3PVNA 4Z07A 2QUOA 4I09A 4AEDA 5D21A 4E27A 4Q8KA 3J4UH 3H42B 5FYCA 4COZA 3ATGA 4N90A 3B7MA 4UW5A 1O3RA 5HCBA 2EF6A 4O65A 3ZYBA 4C8DA 4EN0A 1W6NB 5FXVA 2C4XA 2WO7A 1W8UA 2CY6A 5FY9A 1S55A 1TZOA 1RUI3 2JJ6A 2NLRA 5CB7A 1DZTA 2E63A 3CJXA 3LA2A 4QB1A 2R063 2BGOA 2O8QA 2ZZJA 3NO8A 1O4YA 2QQOA 2BJSA 4G3YC 1UL9A 4HANA 1RUI2 2VH9A 1N3OA 3HBKA 5FBJA 5BNPB 2UY9A 1JS9A 1RXFA 4XIKA 1TME1 4QAWA 5FBZA 3PJYA 2GC2A 3IAPA 4UFKA 1FNYA 3ACIA 1OH3A 3ZSJA 3DPRA 2WNOA 1NCQA 3K4DA 5FP9A 1J3RA 5HV4A 3PMEA 3RZKA 2B4KA 3FE5A 5E1RA 4KWKA 2PHDA 3ZYRA 1W9YA 3WT3A 3POBA 4MGZE 4N53C 1KD7A 1HQLA 3KV5A 3MHZA 5DUVA 4YW6A 4KI5M 2X29A 3KF5A 4MGKE 4QWNA 2NN8A 5I0UA 1OA4A 3MI8A 4EN7B 5IWFA 3LIHA 4YG6A 1D2QA 1FX5A 4J1XA 4FPFA 5FZCA 4BK5A 4IUGA 3ZSLA 4E8CA 4AXOA 3N35A 4LKDA 4P5YA 4UW6A 5CFDC 4YW2A 2BV4A 1POV1 1V6OA 1W6OB 3ST7A 5F5AA 4IE6A 4EJRA 1V9U3 4HPKB 4R9DA 2XPJA 4A4AA 2R0HA 1W90A 4B4PA 2JICA 5F3IA 1NE4A 1I3HA 4IV1A 4PHZA 1B35B 5D8AA 2VULA 1CPNA 1V9U2 1HXS3 4W50A 4EWAA 2ET7A 3JB4C 4QMAA 1O91A 1SLIA 4GXLA 1BKZA 2TNFA 2WRAA 5DAXA 1D4M3 4BDVB 3ITQA 4KWLA 2XJSA 3R4DB 4PIXA 3RJRA 4AFAA 4L92A 1WCQA 4YZ2A 3TNQA 2XLAA 4YZ5A 4CRQA 5IK5A 3NL1A 3ECQA 4NIIA 5ISLA 1D4M2 3H8UA 3QACA 5DZEA 1PZ9A 2HWC3 2VC9A 4JV4A 1XU2A 1UU5A 5JXJA 3U4SA 3NJZA 2R1BA 5L9RA 4LNVA 4IDZA 4RSUA 1NT0A 4CDUA 1RUD3 4DXRA 2D6MA 4A6OA 1COV3 2QQUA 1E5IA 1RUD2 4XCBA 4PT6A 4XVHA 2HH9A 1RUNA 2XUMA 1XYPA 4MYEA 2ERFA 4Q1PA 3E6CC 3WQ7A 5FZHA 2XVGA 1C8M3 2E9QA 2IZWA 4BPZA 5IW0A 4JGYA 3PVBB 2JDNA 4LBQD 1SPPA 2CDPA 2E33A 3I54A 2NZ9A 2F17A 1LJ7A 3USSA 2DVFA 2G1MA 2G9FA 1O3SA 3N7KA 3VZOA 2VCAA 2GH2A 5C9AC 5BNOA 5ABJA 2R30A 4MADA 4BQ5A 5F9TA 3PUSA 4QKBA 4ASLA 5BXXA 3WD5A 5BNNA 2LW8A 3Q8CA 1NXD1 4QX7A 3GBGA 2KM2A 4ET7A 3ZYIB 5J3UA 1HB3A 2GP3A 3H50A 3S0MA 4QPWA 3NAPB 4HKLA 3OBRA 1S0CA 4YW4A 2EAAA 2VJXA 3LFMA 1HW5A 3FHQA 2HWB3 5LWBA 1V6MA 1Q8QA 4CCNA 5HXVA 1VRH1 2VZUA 2A75A 2WWJA 5FLHA 4HXCA 4QPGC 4ITCA 3HT2A 5FZ7A 4HL0A 3VBFC 2PHWA 2QQMA 5FDBA 2NMNA 5A1FA 4A6SA 5BUVA 3JD73 3N4MA 1AR91 2DTWA 1Q8VA 1ZREA 2GMPA 3WP6A 1O5UA 2HBUA 5IK8A 4AEDC 1RUF1 1BEV2 4NOTA 2GSYA 4HFSA 3AP9A 4U36A 2E53A 1BYHA 1R1A1 1UU6A 1OHFA 4RR3B 4BK4A 3ZFGB 1F4AA 1BBT1 2VMCA 3H0OA 4L0PA 4LUKA 1UO9A 3ZIWA 3OGGA 3O1OA 4HVQA 3UJQA 4JQRA 4RS5B 3E5UA 3BPSA 1V6NA 2GN7A 4QKNA 2FZ2A 3VHNA 3LE0A 2ZHLA 3I2GA 2Q8OA 3GDBA 2G4IA 3PUHA 1Y9QA 3M1HA 1CZVA 3G7DA 4Q4V1 3T1LA 4BQ1A 1LNSA 3E5QA 3KB5A 5FZBA 3A0KA 4JGZB 4PDWB 1PHMA 1QIQA 2O8OA 4ZS2A 1DYPA 2A5ZA 4QXHA 5EJ1B 5A6YA 4XZUG 2DUPA 4EN6B 5J37A 5FV3A 3SNMA 1JU4A 3ETQA 3H7YA 3LCPA 4UF0B 2VBDA 3ILRA 3POFA 3DPRC 4D0QA 5C3QA 2F4LA 1UU4A 5KC6A 2GAUA 1UF2C 3MV01 4KH9A 2ZGUA 4OLLA 1MEC3 1V6JA 2ZS6B 5LA2A 3ROUA 1UKGA 1AYM3 3EJKA 3E6DA 5FK7A 1RJ7A 1E57A 1X9PA 2WSUA 1NY71 5F5IA 4P08A 1MEC2 1F15A 2E7TA 4ZS3A 1W2NA 5DDJ3 4XC9A 3VZLA 1SFYA 1BMV1 4EYUA 1HV0A 4PQQA 1QH7A 1MS4A 4XJZA 4CU7A 3T09A 4LBLA 3HPNA 2LS6A 1W39A 1FV2A 1L7LA 3K2OA 3CLPA 4OI4A 2KR2A 3RJ2X 3JBG1 1UAIA 1R083 5D8AC 4Q27A 3OUHA 3TN93 4QHZA 1RUG3 4QU1A 5F3GA 1C57A 1NCRA 2DFBA 4XACA 3RNSA 3AC0A 1WMEA 3BB6A 4O9GA 1R082 4K6BA 5A3UA 1AHSA 4JHZA 5DUUA 3WCSA 2GU9A 1CAVB 1FNZA 3J8F1 2WS93 3TN92 5FQ0A 3VN4A 1RUG2 5IYYA 3V0BA 4MHRA 4UFLA 2E7AA 4E4DX 2BNMA 3LOIA 1ENSA 2BZDA 2VUAA 4GH4B 4JRLA 3WF1A 1AL22 2Y64A 1UKRA 1Q8SA 3OY8B 1NX9A 4IESA 5B4NA 5KHKA 2DUQA 3U37A 3KGZA 4P9JA 2YZ4A 4YVSB 1G9DA 2D3PA 2X8KA 1BHGA 1ZNPA 4CDUC 2DUOA 5DAVA 3I3BA 3AKSA 4B7KA 3HBZA 1K12A 2D40A 3I8TA 4XTPA 1VBD3 3CU7A 3FUQA 4NHMA 4XMIA 2FDGA 4BIOA 2XKOA 4V2VA 4EN9B 3ZPOA 1EYBA 2VXRA 4M3CF 3H8RA 2XLFA 5IK4A 1VBD2 2D6NA 1WLCA 5E89A 2ZKLA 2BERA 1PX3A 5A7WB 5FZ9A 1YYNA 5LW9A 3UGHA 1U12A 4K1ZA 4QT6A 3QBQA 2WZR2 1NLQA 3I7DA 5FMOS 4YZ4A 2FCUA 3I2OA 4GB33 2W92A 4K7JA 5ABJC 2WNUA 5BV6A 3TOJA 4CEWC 4WM8B 3J9SA 4NMIA 1DFQA 3GJAA 3VKFC 3AL6A 3X29B 1YJKA 3GNEA 1UMZA 3O1MA 1UXXX 1RGSA 1GBGA 3BTYA 5F39A 2Z5WA 3RWNA 3N3HA 1GP6A 1N3QA 4Q2FA 2NYYA 2FBEA 3KHBA 1WWYA 4LBJA 4HBNA 4Q0UA 1O7FA 4XIOA 4NHYA 3SLIA 4FQZA 4LO6B 2GDFA 3N9PA 4BZ4A 2WNVB 4I3GA 1OXCA 1WA6X 1O8SA 3OD4A 5IVCA 1ZBE3 2BWCA 3DKQA 2JDPA 4YW7A 5M0TA 2XHKA 3IMNA 5DUWA 3WSOA 1L3JA 3ZYHA 3AKPA 3WOGA 2VMEA 5FLIA 1JUHA 5KXDA 4M00A 5A1LA 2WDBA 3FBYA 4ZPIA 4AI8A 3EHKA 1YJLA 2PYTA 4OHWA 1FOD1 2WFPA 1IS5A 4BQ3A 4Y20A 1IS6A 2QQVA 1JOJA 4I3PA 4XFHA 4BM8A 1W6MB 4Z92B 1ZZ6A 4MGTA 1UWWA 3KV9A 3FMGA 1RUJ3 4IV3B 4MGQA 4XFIA 1MPXA 1G6NA 1ST8A 1IG3A 1NA1A 2ZPXA 2JDUA 4AGRA 2LUWA 2XXZA 1RUJ2 3AZZA 2Q30A 4G4FA 2XWBB 3N9OA 1QF3A 2VVEA 3VV1A 2GALA 5CU1A 4HK9A 1SDDB 1TVGA 1F5JA 1QJY1 1CX4A 3U11A 3UKNA 4CDWB 3JZVA 4HLTA 3K4ZA 1KITA 1CPMA 2GMMA 1E5HA 2VOWA 3KSCA 4EZ4A 1UY3A 1OUSA 2A1XA 3AFKA 4MV2A 1OMIA 4SBVA 3TRSB 4AI1A 4DFSA 4YM2A 4JRAA 3W9AA 1UYXA 3MW2A 1UD1A 1J3PA 4M4PA 3WUDA 3N9NA 3PUAA 4GMP1 1EPWA 4N9HA 1CJPA 1OOPA 1YHFA 1RUOA 4B4RA 1QJZA 1EPZA 2Y6FA 2HJIA 3SH3A 2PA7A 3WV6A 3N7LA 1NQJA 1UPIA 4AAPA 2WQZC 1JYWA 2D43A 2JDZA 1KDMA 2V4AA 2UYBA 5EIYB 1PK6A 1W04A 3O1RA 5FUPA 2VTXJ 1DP0A 3LEKA 4KU7A 3ZFEB 3DGTA 4QX2A 4GJZA 2VCMA 2DCYA 1PNGA 1TME3 1PGW1 5T52A 2PAEA 2XL7A 4AL9A 1UCXA 3GXUA 4Q26A 1PNFA 1TME2 3PTYA 3ZXEA 2FHRA 4OUMA 3ZN6A 5C3PA 1XSQA 4FFGA 4WZFA 2FD8A 3FL7A 4O61A 1UW8A 5JPMB 5CIRA 1UMIA 4N7UA 1JZ8A 3AMPA 1UIJA 4QX0A 5F8PA 4FPLA 3J7LA 1DIWA 3VHOA 3GZTB 1NCRC 2G9ZA 3H7JA 5KC5A 5JZGA 4NWVA 3E6BA 3WZ1A 3MO4A 5I93A 4LA3A 4QGMA 2BWAA 3HQXA 5C4WA 3VHPA 3HR9A 1SLCA 4BMBA 5SV5A 3BIEA 4KQ7A 2GP5A 3VBSA 1JYCA 1POV3 3OSDA 4WM7A 3WQ0A 1EV11 5FO7B 1VBE1 5KXBA 5JR7B 1POV0 1W6QB 3JU9A 1YNAA 3TEXA 2ZX1A 4ISQA 2WN2A 1Q43A 3KWVA 4I0WB 3W5MA 2VTXA 4TZDA 2Q1MA 2OX0A 5FXWA 3OGJA 4LKFA 3ETPA 3O1SA 3CNAA 4QX5A 3S7EA 4IEWA 5A33A 2D6KA 3ME2A 1HDKA 4I2OA 5FPVA 3PDQA 1LHNA 2AYHA 2PAMA 2JDKA 4LBNA 4KGGA 5FZ6A 1K45A 4XYXA 3RQ0A 4FP2A 3PL0A 4PCRA 4LIUA 1BEV1 1WUVA 4XABA 4JTOA 3THDA 4KNCA 3SC7X 2WN3A 1HRV1 3DKWA 1DCSA 4H3WA 4P9IA 3WDVA 2ENRA 4K3UA 3ZO0B 4AEJA 2WNUC 4R4ZA 3FLRA 1KGYA 4YGDA 5DPNA 1RHI1 1UPSA 1BVP1 3SH4A 1VR3A 5K0UB 3D5OA 1WCSA 3BVCA 3KCCA 4K21A 1JYNA 1Q56A 5JR2A 1LENA 3KQRA 3T30A 3S30A 2AZ5A 2XJPA 2EXHA 3RFRA 3DL3A 4GD4A 4Z82A 4D6RA 4JX0A 2YBKA 4AVSA 2ZGSA 3KQ4B 3EQEA 5C3RA 1LHVA 3C7HA 4DUVA 2D44A 1YC61 3HN3A 1W6NA 5BY5A 3LSEA 3AJYA 4AFMA 1UY2A 3OPWA 2ZAHA 5FK8A 4C90A 4XBLA 4E4HA 1DZRA 3WNLA 1RUC1 4BLIA 3VBRA 2ETEA 5GALA 5FXZA 3BTZA 2RV9A 4LEJA 1EY2A 3BU0A 1O3TA 4IEPA 3CJIA 3VZKA 1AX2A 1JMUB 3NJVA 5FYUA 4B29A 1G8WA 1QNWA 4ZONA 4AZZA 2ZX2A 4JCKA 2GZWA 4YVWB 2V4VA 1VPHA 2WA4A 3LEIA 4XJUA 3RG0A 1NA1C 1REDA 3NV2A 2RS52 1VRH3 2WYFA 2YC0A 1JW6A 2YYOA 1HJGA 1H4HA 2XUEA 2JIGA 2D5HA 3NNJA 1YQ6A 4AFBA 2LALA 3OEAA 1AR93 1F9KA 5JDBA 4R9AA 4GWMA 5JOYA 4GZ9A 4LO7A 4TN7A 1QQP1 3RS6A 2ZGRA 1RUF3 2JDYA 3L9JT 1W9WA 2J7MA 5BYNA 2UU8A 2DDUA 1R1A3 4WVZA 4R8HA 4CP9A 1OOPC 4NIHA 1BBT3 3FN9A 4XBQA 1RUF2 3WW1A 3UNPA 2XHNA 3DUIA 1AL21 4HPKA 4XAEA 3GALA 1R1A2 2B8MA 1OI6A 4OVEA 1BBT2 4RFT0 5FMBA 3I3MA 2NPIA 4HONA 4Q4V3 3ZDSA 1PK6C 1WLDA 1DGLA 1SLTA 2W94A 4TSVA 2QTWB 2V72A 2W1QA 3NV3A 3U4XA 5FZAA 3E1F1 1QXJA 4DUWA 1SFPA 4Q4V2 1XU1A 1IKQA 2VZ1A 4V1PA 4XFBA 5KHHA 2ZGKA 3ILNA 3GZAA 3NNGA 5C8CB 2ZXQA 2D3RA 2YHJA 2ZACA 4IEVA 4QQLA 4KU8A 3AP5A 3HNMA 4N8MA 5FO8B 1DDLA 2WZ8A 4L9BA 4UT5A 2DCTA 4QHOA 5LATA 4XDQA 5JMCA 4BQYA 3MW3A 3MIHA 1YRZA 5EZWA 3D0JA 2WZR1 2NP0A 4PJYA 1SBFA 3TWIA 5FPLA 3U10A 3VBUB 4BWOA 5JSRA 4AVAA 4C1WA 1G9AA 1SACA 4AHYA 1JH5A 3ORJA 1JUIA 1W05A 1MQTB 5FZLA 1F31A 1MS1A 2P34A 4UFJA 3INAA 5DMYA 1W8HA 2ZHKA 3HJRA 1GR3A 3N7MA 5L19A 1VJ2A 3LOBA 2E31A 4QKDA 4U2AA 3BPZA 1IS3A 5FIXA 2YPDA 1LGCA 2CWSA 1NY72 1B09A 4LOTA 4NPRA 3VBSC 1BMV2 5LA1A 3ZXDA 4WM7C 1LCLA 3LAGA 5HI0A 2TBVA 3KT7A 1HB1A 4ATFA 1REEA 1ND3B 1LKNA 1V00A 2XGXA 4LXLA 3JBG3 5DUXA 3RMXA 3SXWA 5CFCA 2GMEA 1PX4A 4ZKTB 2GNMA 4ZZ5A 2QDRA 1KXGA 2P5BA 3GZUC 3JBG2 4D3WA 4XF3A 4YRDA 1A8MA 3J8F3 4XJ8A 3WF4A 4A3ZA 3OG2A 1GZCA 1KFXL 4FPEA 1KEXA 3DF0A 2HEYF 2VO5A 1GANA 3IBMA 3J8F2 1C5IA 2DU1A 2FMYA 2RS31 2IXKA 4KL1A 4MLOA 3MLLA 4LO8A 3MBWA 3T4VA 2YB7A 2YGMA 5DG2A 2K46A 3TNPB 1W8WA 1VBC1 4IEYA 5LCWL 5FP4A 3SCGA 1NUKA 3AZXA 3MF6A 2ZMKA 3ZFFA 1S2KA 1UOBA 1QJX1 2HEVF 2WLPA 2G19A 2RM22 2W1UA 2WFF2 2XDVA 4ZU4A 4DY3A 3F2ZA 4LA2A 4ASMB 5JXGA 1G86A 3T0DA 2D3SA 2HWE3 1VP6A 4YG0A 3IIIA 4YPJA 5IATA 1RVF1 2PN5A 2VXJA 3W5NA 4MUVA 4JKLA 5TSWA 1SDWA 2EIEA 4RR3A 4BQ4A 4PLNA 4YNIA 2WJSA 4BXSV 4FAGA 1Z78A 3NVCA 4EZHA 4RS5A 3USUB 3I3EA 5FZDA 3ZYJB 5LA0A 1PZ7A 1C5HA 2IVIB 5FYIA 1NOVA 1OSGA 1W03A 1M4WA 3VBRC 4TXWA 3BKZA 3ZN4A 3POGA 3LPGA 4LBQB 3ZLIA 3JCIA 4JGZA 1A6CA 4PDWA 3CJIC 2A6ZA 5FZMA 5A3MA 1ZX5A 1ND2B 3AYAA 5FAXA 4PI0A 5IHRA 3PIGA 4LOSA 1VMFA 2VPVA 2XWJB 3AP7A 3VDDB 2CTVA 1LEMA 2OUJA 1XQNA 3B01A 1Z0HA 4W65A 1GV9A 2FZ1A 3MFCA 1WCUA 2VZTA 1XNTA 1QNYA 1AXZA 2EA7A 1T6GC 1SBDA 1TNFA 3OJBA 2YPJA 4MXWB 3T1MA 1GQPA 3MLJA 3WNXA 2DBIA 3CMGA 1KS4A 2VNVA 2QCSB 4K9SA 5KHIA 5I0DA 1XC6A 4MX3A 1GQGA 3AYDA 2QBXA 4AI0A 1FOD3 1LTEA 1KJLA 2YFUA 5FMDA 3UGGA 3VL9A 3H8XA 4TLGA 3P3NA 4FQ4A 4JQTA 2Q5TA 4Q1RA 3M7AA 3PNAA 4IXLA 1FOD2 4ISRA 3K3OA 5FYBA 2ARBA 3I3DA 5LK7B 3LA3A 2AGSA 4RGAA 4CXXA 2DWRA 2PLV1 4HK8A 3S6PA 4CCOA 1HKDA 1VAMA 5IVBA 2BEOA 2RS11 3WW3A 4H7LA 4H2AA 4LHSA 4B4QA 2YY1A 3MIFA 3V56A 2QVSB 3C7FA 4BCUA 4OMDA 4HOOA 1QJY3 1JYTA 3Q8FA 1ZYBA 2QQLA 2JWPA 4XUTA 4XBNA 4AOCA 2EALA 1CAVA 1R091 3QH7A 3WNKA 1QJY2 5F37A 1WMDA 3QLQA 1W8OA 3RWKX 5AC91 1JYXA 4DZGA 1OBNA 1PVC1 4FOYA 1FPN1 4GH4A 4GMP3 4AI9A 2UWCA 4DB5A 4CXYA 3HNYM 3CL1A 3KV4A 1CAUB 4GMP0 4IEQA 3VKMA 2XBO1 3AMMA 4IE5A 4CU8A 3UESA 5F2WA 3UGFA 1EAH1 3GYDA 4YVSA 2ZX4A 4YW3A 2B42B 1ULEA 3ACFA 3FUOA 1DYKA 2VZ3A 4EROA 1ONAA 4CPBD 4PBPA 5JXHA 2PQQA 4IGQA 4FPJA 2VU9A 5FLJA 2D6OX 2VY0A 2X5IB 1UN1A 4I01A 5A3WA 4AFDA 3ZMNA 4COYA 2EXKA 1Q8PA 2VD7A 5F1RA 2A6WA 3RZMA 3B5LB 2W47A 3HWJA 2W08A 4FPOB 4L2NA 2Y38A 5IAVA 5T5PA 1OA2A 2JDAA 1H30A 1PIV1 1XNKA 1Y43B 1YI7A 2DVBA 4CEYB 4CUCA 5CADA 5IAXA 5A7WA 1OURA 4CU6A 5FUIA 1IGOA 1KRIA 2WKKA 1PGW2 2OZJA 1ZZ9A 2A7AA 5J96B 2Q0AA 2Q1ZB 4Y5Z0 2H0VA 5C8WA 3VD9A 1W0OA 3I2KA 5CFCC 1OH4A 2R072 4B3NA 5FRAA 4AAXA 1SZBA 1D0GA 2JB8A 2RJKA 3I49A 1LRHA 4FO9A 5A3TA 4XFFA 5L9BA 5DN2A 4WVMA 3R05A 1WZXA 1BK0A 3GCXA 4FXKB 1S0FA 4CDQA 2BGPA 4PQ9A 3ABZA 5IUQA 2PXJA 4CEWA 1MACA 2R1DA 3ES4A 4UW4A 4X6QB 3T2OA 3VD7A 5JCTA 1AR72 3AK0A 4H55A 3TAYA 3WNPA 2RE9A 3MPPG 2XOMA 3H1YA 1RUE1 2JD9A 1L7RA 1EV13 2WNVA 1VBE3 5KXEA 1X50A 4ZU7A 4BISA 1H0BA 4LULA 5JWPA 3H8OA 2I07B 1EV12 2RS51 2DV9A 1U5YA 1VBE2 4XMAA 4R9BA 3ZXFA 3ZFFC 3A0NA 4LBOA 4TYSA 3S5QA 4WV8A 1D4VB 4XDOA 5GZDA 3HT1A 3H3UA 3POEA 2V5YA 4CZSA 1H1MA 4TLFA 1OPMA 2WQ4A 1HN0A 1PVXA 3F95A 1RJ8A 4OI0A 1BEV3 3PVOA 4I02A 3KVBA 4Q4X1 1ZVFA 2ZMLA 4IV3A 4RR3C 2VOKA 4LBMA 5D2AA 1CZSA 1HRV3 1OLQA 3RZJA 4YZ3A 1LULA 4LORA 4RS5C 2PELA 3CF6E 1J83A 2XMLA 1HRV2 1I6XA 1MS8A 1RHI3 1T2XA 3ZFGC 2OA2A 1FT9A 1H8VA 2ARAA 3TBDA 3WF0A 3VZNA 4CDWA 4DS0A 5LZ6A 2QQPA 5FPUA 5T5JA 5I0SA 3KD4A 1GQHA 4JGZC 4PDWC 1RHI2 1RTVA 4K8RB 1K5JA 2JG8A 1HX6A 2P37A 2BFUL 5EYXA 5DQ0A 5K7PA 5FWEA 1SMVA 1KDKA 1V6KA 1KS5A 1W8NA 1F4HA 2I2SA 2VL4A 3MGUA 4FVVA 3T2PA 3VBFB 4O9EA 4IE0A 1US3A 2VZQA 4JTNA 4CCLA 5JMOA 4QPIB 3UV9A 4XPVA 1YQ8A 4P5HA 3IWZA 1E5RA 2F6BA 4RHV1 3HOBA 5CNAA 1RUC3 2C0ZA 5DABA 5FWJA 1WW4A 4JC1A 1QDOA 1FATA 3FBMA 3ZFEA 1GOGA 1TG7A 2GNDA 4SLIA 3VZJA 1RUC2 3ZR6A 2AENA 3BOPA 4NAMA 5FZ1A 1LU2A 1QH6A 5JXIA 3RZGA 2WLQA 1JN2P 3EBRA 4LK7A 4LT5A 2IVJA 2MNGA 4HVRA 5DXDA 2R7EB 1GUIA 4QGNA 3OGVA 1D2SA 1W9FA 5FO9B 2XJVA 4X6RB 4QPYA 3D0SA 2R16A 3AMNA 4I30A 3BTXA 2ARXA 3THPA 1WLWA 2XB6C 5IT6A 5EQUA 5A3OA 4AFCA 5EP9A 1QQP3 2RDSA 3O12A 3HEIA 1NCQB 2BGCA 3LD8A 4QM8A 5FZOA 5DAWA 2YU2A 2VG9A 3LEGA 2BP6A 1YI9A 2ARCA 2O14A 2WZPP 1XYNA 1AJKA 1QQP2 3GJBA 4GH4C 5EYYA 5J98B 3U07A 4AVCA 1I9RA 5JOXA 3POSA 1AL23 5GZGA 5HV0A 1GMMA 2UWBA 3RZHA 1W06A 5ERLA 1W6QA 3EO6A 3BCWA 2DBNA 4YVSC 3WQBA 1LHUA 1PM7A 3THTA 5J7MA 1PO11 3AMQA 3SQOA 5GM0A 1YFYA 1JTZX 5JVVA 3ZYFA 2EXIA 1IKPA 2ZHMA 4C1XA 2RM21 2WFF1 1OLRA 4Y4YA 1LU1A 3NJYA 2W9XA 1E5SA 1ULOA 1DQ5A 5FP7A 4AHWA 2H6CA 1JXNA 1PGL2 1SLAA 2L9LA 2EAKA 1TQ5A 3J26N 4IV1B 4EWEA 3VHRA 2PAKA 3ZXJA 4EE2A 3SCHA 1VALA 5CA6A 2BRTA 5EJ3A 2RVAA 4ARXA 3WDTA 2WZR3 4NWWA 1XE8A 2RDRA 5KR7A 1CESA 4C0HA 5IVJA 1UY4A 5K0UA 2J42A 4HN1A 4CSWA 5EPAA 1W3VA 4CDQC 5IVFA 4GWJA 4MXVA 2XVKA 4GWIA 1ODMA 3Q8AA 2IC1A 1LHOA 3LDBA 3R4SA 3ZSMA 1YFWA 2UYAA 4AYUA 5JSPA 4YARA 2XG3A 1YEWA 1K5MA 3CHXA 4MOAA 1ZZ7A 2DTYA 2MPFA 2WNVC 1GWKA 1S0EA 3AKTA 3PUIA 5C6CA 1TMF2 4AW7A 1AR82 4FTSA 4FTBA 4FSJA 2W46A 5F5CA 5A6XA 3UT0A 4MGSA 4BQ2A 4XXAA 4RD7A 1VBB2 3IB3A 5ACA1 3O1PA 5L73A 3BALA 3HQUA 3OGRA 4JGYB 5FZFA 3NNMA 1A3KA 3WP3A 5A70A 2Y60A 1UMHA 5F7UA 2RDQA 3P5BA 3E5XA 3BYWA 2C6SA 4AQ2A 1H9PA 3TEZA 5BNOB 2FCVA 2RS33 4IV3C 4W6YA 3RZZA 1S0GA 1RC6A 2JDHA 1CWPA 3SEPA 5FJHA 4EN8B 1F5FA 2FDJA 4IQPA 1ZA4A 4GALA 4QXBA 5T55A 1VBC3 4B1LA 3UYJA 4L99A 1W0PA 2RS32 5BNNB 5LEKA 4NN0A 1BJQA 2FDHA 2RHPA 4FPYA 5JPNB 1QJX3 5D1IA 1KQRA 1VBC2 2VQTA 3FLPA 3NSTA 3ZYGA 5LRSA 4CDWC 2WBKA 3RGBA 1LEDA 4PF5A 3RI8A 4XFAA 3S57A 4Q0QA 1O8PA 1QJX2 3HQRA 1JZ5A 3PU8A 2JG8C 2CGNA 2FDKA 1AX1A 1RVF3 1XNBA 2JB4A 4L97A 5JIAA 2GNTA 4EQVA 4E9KA 5HCHA 4O7XA 2V09A 1PZ8A 2MEV1 1RVF2 2VQUA 5AFBA 2ZKNA 4AEMA 1NZIA 2J1SA 4CCDA 4KMQA 2I45A 3U0ZA 1NG0A 2OYZA 3MFAA 3H9AA 3T2TA 4LE3A 1MS5A 1DBNA 2J1VA 2J1UA 1NAEA 2UURA 1G9FA 5H9RA 3WHUA 5A6QA 3PHMA 1DQ0A 2YG0A 1YO8A 3ZFEC 5ANNA 3WNMA 1QOSA 3VBOA 2QQJA 4XQDA 3H1MA 2QFEA 4Z8BA 3FLTA 1J84A 2CWMA 1GSLA 1QU0A 1W9TA 1PO21 1JBCA 4GULA 1DQ4A 3PLQA 5C33A 1MZ5A 3M70A 1TE1B 1PMHX 4XUOA 5I0RA 2IXCA 3OCPA 4N9IA 3WDUA 3CIHA 5F3EA 2YDEA 1OKOA 4UXAA 3SHRA 4NHLA 5A3NA 4LUMA 3VBUA 5B2GB 4D7SA 3V0AA 1TNRA 2JG9A 2QNKA 2R071 3D6EA 4LO5B 1AJOA 5T5LA 4CDXB 5J36A 1A78A 4NPMA 4DEVA 3KLSA 1ALYA 1JU3A 4A42A 5FYZA 1OF4A 1XPWA 2B7YA 2ZBJA 5H9PA 2K0GA 1AR71 1SBEA 3ZKUA 4YM3A 5JAXA 3DXTA 1W6PA 5FOJB 2PLV3 1QJFA 5CZKA 5GZCA 1XSRA 2W39A 2QDNA 3OPZA 2VMIA 2RS13 5B4XA 1CIWA 3GCWA 4B7EA 3ZX7A 1OUXA 2PLV2 4PF1A 2P4EA 2DCZA 3POIA 2RS12 4ARYA 3CZJA 4OCTA 3OYWA 3GHNA 2XJTA 2PFWA 1R093 1N1SA 5E6HA 3NV1A 4AQSA 2WR9A 1VB4A 4FXGB 4Y1UA 4YLZA 4DINB 5AC93 3OBAA 4CP2A 3RSJA 1DQ1A 1PVC3 1FPN3 2AR6A 2QZ2A 3MPBA 4UI9L 1R092 2YFZA 1XOYA 1W8ZA 3I4IA 2Y6GA 2XBO3 5AC92 1NCRB 1CAXB 1EAH3 1FPN2 1PVC2 4AEKA 1HQWA 1WLTA 2UY8A 4FPGA 4LK6A 5L7OA 4IE4A 5FQ0B 1ZZ8A 4INDA 1LECA 4J1WA 5I8TA 2XBO2 4RQPB 2D6PA 1MS0A 1EAH2 3AVRA 5K0UC 3KZ4C 2VAUA 3C7OA 3GBWA 3MIGA 3PUQA 4R4XA 3WF2A 2EXJA 4CPBA 1CQ9A 1G9BA 4NVPA 2DVGA 4PIZA 5JIUA 1QJU2 4F83A 3B02A 2CHHA 1VBA1 2Q8EA 1PIV3 1HV1A 1SLLA 1K5MC 1YLLA 4S2FA 4XETA 4ZXKA 5IFPA 4NRQA 5KWRA 3ALQA 1SCRA 2PMWB 1PIV2 3ZXKA 1Z7S1 3WDWA 2W3JA 2B9VA 2RJLA 4ONUA 2BYVE 4FI9A 4Q4Y1 5FKBA 5K9YA 3OOXA 2DYCA 4LQRA 5E88A 1PMIA 4F7ZA 3AP4A 3CKHA 1TEIA 3PJQA 3U1XA 2QQNA 2RJ2A 4LBQA 5LBEA 3AJZA 4DMIA 3B94A 4JDMA 4AGGA 3QOPA 3VDCA 2RDNA 1ND2A 5CYYA 2BNOA 2TEPA 1VE0A 2VZVA 5F5QA 1RUE3 2OQ6A 1NZCA 1DU3D 1U5XA 2X10A 1IG0A 4M3CB 3A7QA 4DXZA 5KBFA 4XF0A 1UNBA 2NQYA 1XE0A 2ADEA 1X8MA 4M0HA 5BNPA 4NRPA 1R1ZA 3M4FA 1RUE2 2ZGOA 2C9KA 2A70A 4Q8LA 4OHZA 4DY5A 2HEWF 1IPKA 2RS53 5A32B 2JE7A 3IDBB 2GC1A 4Y1YA 2C26A 1BVVA 1OQEA 1UXZA 3NNLA 4Z2WA 3O0WA 2ZEXA 4OHXA 1OVPA 1AXKA 2XJRA 3BU7A 1J59A 1LAJA 5LBCA 3TB0A 5HXMA 2C1FA 3D4KA 2CYFA 3NJXA 4CP1A 3ZOIA 1VB2A 1W3XA 4HSLA 4Y26A 4AGVA 4CXWA 2Y0OA 4D7TA 1CGPA 2P3KA 3FFQA 1JI6A 4NROA 2W87A 3R4UA 2W95A 2W52A 3KMHA 4L11A 4FOVA 4XOGA 2RR11 5FZ0A 3KS7A 4P9YA 4Q4X2 5G04L 1MZ6A 3UKTA 3C7EA 1V6LA 4AI3A 2AREA 3J7MA 5KHJA 2Y6KA 2Q4SA 5FCCA 1QOTA 4BA6A 1F8VA 1Y7BA 1W6OA 1NXMA 2Y8KA 3C2UA 1WA4A 2A6VA 4YGBA 4A44A 3DEMA 2OQ7A 5GLVA 2ORZA 4BQWA 5GZEA 2RMU2 3NW4A 4MH0E 4ES8A 2HYKA 1CVNA 2ORXA 4WVWA 2Q1FA 1B35A 3VBOC 1O6UA 5LY1A 3P6BA 3POYA 1RIRA 5J48A 4Y22B 1QXPA 3MIBA 5FZ3A 4QDSA 3ON7A 2FDFA 1NQDA 1OPOA 2AEYA 2HWD1 5LK5A 4XE9A 3RMYA 3OF1A 1PGL1 2Y6HA 2DCKA 4LIVA 4XTMA 1GYKA 4OUEA 4K8FA 4NRMA 2J1RA 3W58A 1RINA 3K48A 3VBUC 2YMZA 3DYMA 4RHV3 2OT7A 2IFRA 2JG9C 4BYYA 4CUBA 4QGLA 4UWDA 2W2IA 1I1EA 4HSJA 2X5IA 1JOBA 3IDCB 1MQTC 1ZM1A 4RHV2 1OOPB 3ZXLA 2ZGPA 2PQSA 3ACGA 3ACHA 3AX4A 4NJ4A 1RUH2 5EHDA 1IS4A 1LR5A 2MHFA 3LPFA 5CVRA 5FZIA 3IPVB 3T4HB 4AG4A 4E8DA 4CEYA 2G9GA 2EIBA 3LEMA 4MGIE 5FYSA 1DQ2A 4RN5A 4XUPA 5CISA 4YM0A 4B8EA 3IN9A 1ND3C 4GKXA 1TMF1 3J7HA 3KCXA 1AR81 1CJDA 1ZZCA 2VBBA 5FP8A 3SH5A 1JZ4A 2JE9A 5FZKA 3C7GA 4LHLA 3BUCA 3AVSA 1VBB1 4P02B 5GJ6A 1C1FA 4ZU5A 1DGRN 2DVAA 3LIGA 3CZUA 3PU3A 4W8JA 1N1TA 1SCSA 1JODA 3ZN6B 1GNYA 1CAWB 1UQXA 3DECA 5J1XA 5LRRA 4XHBA 2I74A 5FY7A 3VUOA 5HBAA 3MUZ1 5IVEA 1BXHA 3MUY1 5FYYA 4CCJA 1J1LA 2WL1A 4Y1ZA 1XNDA 4FPHA 5JZGB 2OXBA 3NAPA 2BOIA 4KG8A 1PO13 5L7OC 1MVQA 2FMDA 2YC2A 5GKAC 5C4WB 2OS2A 1CZTA 2RM23 1PO12 2WFF3 1SEFA 4WM7B 4N7IA 4OUSA 4UOJA 1DYOA 3O14A 1W8TA 4M01A 1OD3A 1SLBA 1UZZA 3T3YA 1VLNA 4J6GA 3ENRA 4ORFA 1UX6A 3G6JB 1N1VA 3MYXA 4EWDA 3NWKA 2CDOA 4LMFA 1VAKA 5IVVA 2VE1A 4XQWA 4R9CA 5BPXA 2ILMA 2CAVA 3EB7A 1RYYA 2DCJA 4OI2A 1H8TB 4FOQA 4LLOA 4YW1A 5FP3A 2BU9A 4KWJA 5LBBA 1DZQA 1U5ZA 1ASJ1 2JIJA 4QX3A 5A7QA 4KBZA 1MVEA 2ID4A 4Z1VA 1O5LA 2DF7A 4YWAA 2Y0IA 1ND2C 1NE6A 3ZFGA 2JE8A 4OHVA 3WX5A 1ZA7A 4BHPA 3AKQA 4N43B 5LASA 3A22A 4BOWA 2ZEWA 5A7OA 4OQ8A 2BFUS 1T6BX 1YQCA 4XXPA 5BNPC 4KWUA 2A6XA 1FMD1 1V6IA 1IQDC 1BLZA 4NR1A 4QPIA 1LGNA 1POQA 1Y9MA 3VBHB 4RFRB 4UF0A 3ZPYA 3B9CA 1L7QA 3GM8A 5EJZB 5ACA3 2GN3A 1ZRFA 2BDRA 3I59B 5F3CA 3VL8A 5ACA2 3FJSA 1EP0A 1NLSA 1SHWB 1W2AX 1YCIA 4K40A 3D82A 2XL9A 3IMMA 3APBA 4FP3A 5KHGA 3VDBA 1WW7A 3ZYPA 2CNAA 3NMBA 2EIGA 5EFUA 1A8DA 2VMHA 1GLHA 2XQXA 1EUUA 2HWF1 3M8LA 1STMA 4HKOA 4DQAA 1UZYA 1AYN1 2VZRA 2VCCA 3VBRB 2Y34A 2H6BA 1OQ1A 2EICA 2JD4A 4AE2A 1IHMA 1ZBA1 2C9AA 2XH6A 4FT8A 2R49A 3CJIB 3JQWA 1H2LA 1NKGA 3I3QA 1GFF2 1OD5A 3K3NA 3N9MA 1XB9A 3MV11 4JAAA 2OKXA 2R062 1AR61 4I0BA 3RVHA 5J09A 5FYMA 3BN6A 1GKBA 2OZ6A 2VOTA 3FX3A 3DYPA 3NKGA 3WDXA 3WNOA 4JKMA 2JKBA 4XCAA 1B35C 4QB2A 4MSVA 2WUHA 1GZWB 2VW2A 4M4RA 4IL7A 3WXPA 4ZHNA 4Q29A 2MEV3 1CX1A 1OF3A 2CAUA 2R041 4BU2A 1O59A 3K51A 1APNA 3B69A 2ZA9A 4TTGA 1WD4A 4CU9A 4NPLA 1QEXA 2D6LX 2MEV2 3Q8EA 4YZ1A 1ULDA 1WCDJ 4HZFA 4N53B 3OY8A 2IXJA 3UKVA 2X5IC 5C71A 4MG2A 4OZXA 4CP9B 1S0DA 4NO4A 2BTVC 2IWGB 2D7FA 5T54A 2WQ8A 2DFCA 2QE3A 4W6XA 4X8NA 1RB8G 3WCRA 1W2OA 3AL5A 1YFXA 3HMYA 4OYUA 1BCXA 1HJFA 3LSDA 2YUEA 5CFDB 1PM4A 5FZEA 1QJU1 1PO23 2E51A 4NHKA 1UZWA 1YWKA 5E16A 3RI9A 4CEYC 2LTNA 4W4ZA 3O1UA 4P9GA 2A3XA 2K2SA 5LEJA 1AL0G 2VVDA 1GICA 1PO22 3A23A 4FOWA 3IKWA 1HXS2 1X7NA 2R073 5HPOA 2AH2A 1Y3TA 2ES3A 4X8PA 2PHRA 4F3JA 3ZIXA 3KHCA 4PI2A 3AZWA 2ZHNA 3MIDA 5FYHA 2HLEA 3SISA 1LOCA 4QM9A 4XW3A 5DG1A 4NIAA 2QQIA 1RL3A 4WM8A 3ILFA 4HN0A 3I2JA 3ACLA 4AR2A 2HWC2 1AR73 1ZRIA 3GGLA 1OLMA 3IDEA 3K77A 4GJYA 4UBHA 4XF1A 4YGEA 5GLWA 4QXKA 3LDRA 1XYOA 4CA9A 1YUDA 3HD8B 2A3WA 2IUWA 5E8AA 4AQ6A 1J58A 1X9TA 2PTMA 5KXCA 3NAPC 3U78A 4ZY9A 5T5OA 2B46X 1GP5A 1COV2 3V64A 5DZFA 4CUAA 2VMFA 1QGLA 4GA9A 2DU0A 2YU1A 3PMSA 4FFHA 2XJQA 3FFZA 4Y24A 4IW3A 2VW1A 4AVVA 4HVOA 2D97A 2QKDA 3RDIA 3BI3A 1C8M2 3OBZA 3VB9A 1IPJA 5F2SA 3M3EA 2IXHA 3KT1A 5CFCB 1OVSA 3O5SA 4XDPA 4CCKA 1JHJA 4IETA 4P00B 2PHLA 2WT0A 2ZX3A 1NYWA 4ES9A 1RMU1 1W2TA 1DGWA 4RYDA 4TWTA 4URTA 5DAPA 1UZ0A 1W6MA 1OC1A 1WMFA 2XLGA 3OGSA 5C9AB 1KJRA 1GWLA 4DNYA 2P3IA 4Y5SA 2Q8DA 2V5DA 2KXLA 4ATEA 2Q8CA 2P1BA 2XR4A 1C8NA 2BBAA 4Q4W1 4E2GA 3QH6A 4D94A 5C70A 1ZRDA 2RMU1 4I0AA 1C3HA 1JZ2A 1VBA3 3WW2A 5DAQA 2ZMNA 4A2UA 2HWB2 1G7YA 3CDZB 4LBKA 2HKXA 5FZ4A 4QXCA 1IOAA 2CV6A 2ZABA 3URFA 3ZFFB 1VBA2 2P3YA 2Z79A 2BVBA 1GNZA 3H1WA 1Z7S3 2VZPA 3A21A 4UAPA 5H9SA 5I8SA 1OLME 2VNRA 2ZEYA 4QPIC 3DCQA 1DGRA 1WBFA 3M3IA 4D6QA 3E97A 4Q4Y3 4QPGB 2XJUA 1XBFA 3PTRB 3MEPA 1Z7S2 5CG8A 3AMHA 3GF6A 3JD72 4JDOA 4UBGA 2CGPA 2VECA 3H3LA 1YIFA 3JXSA 4Q4Y2 4LKSA 4D69A 1WCKA 1JOPA 4AQTA 1UZVA 1MZFA 1HRI1 4J25A 2GC0A 4AEDB 3CBNA 1CN1A 1RUH1 2WA3A 2WT1A 4LLFA 2YV8A 3UK9A 3AKRA 2WO3A 5GLTA 4P14A 3SMHA 2JXAA 4C91A 1DLCA 1S1AA 3OUJA 4HG6B 4ASKA 3WG3A 3B00A 4AK3A 3WY6A 4QQOA 5FKCA 1MZEA 1W2UA 5FZGA 2A71A 1LOGA 1WW5A 2UWAA 1V0AA 3FC0A 3T0BA 1H4GA 3WNNA 3IZOA 3VD5A 3W59A 5F6LB 4RA0A 3WP5A 3ZSEA 4CDXA 4CTEA 4Z2AA 2BBVA 4JZRA 3ZKYA 4YFWA 4FFIA 5CKMA 5T3NA 1AXYA 3VLBB 1W28A 1NCQC 1DGWX 4LTAA 4P9WA 3O7OA 4Q5OA 1K3IA 2E6VA 1ZZBA 4LO4B 3KV6A 5HCAA 3GHMA 2FQPA 4PIYA 1VIWB 3DPRB 4NUBA 3W21A 2RR13 3ZM8A 4YW5A 1CONA 3POJA 4B1MA 3P1IA 1REFA 1FV3A 2WABA 4RGKA 2LM3A 2WZEA 4XEZA 4XFGA 2RR12 1GOHA 2OPKA 1LHWA 1AYM2 3D8CA 1JZ6A 1W0NA 1JYIA 5SV8A 2VNGA 4HETA 4BB3A 3I2FA 5DDJ2 2P17A 3VZMA 1HB2A 3N9LA 4UFIA 4DOUA 1JYVA 4IGOA 1URXA 2ZAAA 4BLJA 1N47A 3QCWA 4XHXA 3WUCA 1X8EA 4PBOA 3VD3A 4CUGA 2FDIA 2VUDA 2HWD3 4IV1C 2JECA 1YQ5A 4JVAA 4AI2A 1W99A 3DV8A 2AACA 1DF0A 2ZEZA 1CAXA 2HWD2 2WAAA 3LA7A 2R32A 4FCAA 4QKFA 2VQ0A 1FYUA 5IK7A 1K42A 4OQ9A 4BMEA 5D8AB 3BOWA 2X05A 2AEZA 4RQPA 1F2NA 3VDAA 2JEMA 1OT5A 1ENQA 4LITA 3WF3A 4QDRA 2WS92 1S0BA 3POWA 2A6YA 4WM8C 4CYDA 3MZHA 1VMJA 2ZTNA 2PHXA 3MICA 4GQ7A 1M06G 3UJOA 5FY4A 3PURA 3KF3A 3M3OA 1AF9A 3MW4A 2Z4FA 1D7PM 5FY8A 4BIFA 4MVTA 4LR4A 3WP4A 1UOGA 2ZJCA 2N7GA 1OKQA 3AM2A 5FY0A
chains in the Genus database with same CATH topology
5F6KA 5FPXA 1TMF3 3B3QE 4DPNA 1AR83 3M3CA 2HWE1 4IEZA 4CDUB 1J3QA 2IXLA 4LE4A 4FPCA 2OUHA 1VBB3 4L8QA 4JGYC 3AZVA 3OD0A 2B9UA 4R52A 1BZWA 1QMJA 4BH9A 4META 5BNOC 2VOXA 4M3CA 4YSFA 3AYEA 4YGCA 3CO2A 5GZFA 2JX9A 1PGSA 3MLKA 4WVMB 2WWSA 1QY4A 4GB32 3MIEA 4CDQB 5BNNC 2DVDA 3L2YA 5CAZA 5A32A 2BPA2 5ABJB 4CEWB 4YVWA 1RITA 5FOBB 1UIKA 2NM1A 5H9QA 1H9WA 1RUI1 5FFOC 4PLMA 4AHXA 2P2KA 2R061 1H1AA 3UL2A 5AVAA 3HN1A 4OFGA 3I2DA 4CP0A 2ZZQA 1XE7A 1G9CA 1QDCA 1H2NA 1ZRRA 2OW4A 1CD3G 1ZBE2 2IFWA 1D0HA 3ZXGA 1H1IA 2K9ZA 4Q0VA 1QOOA 5HCFA 4IEUA 1IZ3A 3SCFA 1ASJ3 1O4TA 3AB0A 1QKQA 2CL2A 1DG6A 1VAVA 3LB9A 1ASJ2 5I91A 4Y22A 1ENXA 2ZGLA 2H0BA 3C3VA 1ULGA 5DZGA 2BVVA 1XXNA 4QHBA 3N36A 1FMD3 1V9U1 5CBLA 2GH8A 3O0XA 4JDNA 5C8CA 1HIXA 4IERA 4M3CE 4P9LA 4G9SB 5JOZA 3B9IA 3M3QA 1FXZA 2JG8B 1LGBA 1FMD2 4FBFA 1HXS1 3Q9OA 3WG2A 3WDYA 4CDXC 5FPZA 5K8SA 2Z2SB 4HKWA 2KA3A 4COVA 1YXWA 1D4M1 2ZGMA 4AVTA 5A3LA 4DRRA 4COUA 2V73A 4GWNA 2B39A 3IPVA 2CGOA 2SLIA 3IIAA 4OI1A 1MQTA 2AUYA 2HWC1 2HWF3 4WVVA 3LGRA 1AYN3 2O1QA 3WG4A 2WINB 3JQXA 3WHTA 3EXUA 1ZBA3 2HWF2 2WC2A 4RGGA 4OHYA 1AYN2 1RUD1 2ET1A 5JLVA 1C28A 1AR63 1WBLA 2TUNA 4XJWA 1COV1 4XILA 1Q8OA 1ZBA2 2XVLA 1ND3A 4MZUA 4W6WA 3WR0A 1H2MA 4Y1VA 4AWDA 1AR62 4Q0SA 1NLRA 3SITA 3R0RA 1CAWA 4LHKA 1C8M1 3LKJA 1X33A 2WNEA 4IEOA 2R043 1ULFA 4XF9A 4XJAA 3FWEA 4XFCA 3QD6A 4FAHA 3DN7A 4YG3A 2W0XA 2PHTA 1LOBA 3RYKA 2R042 1AVBA 2W68A 4H14A 1ZRCA 5AFEA 4RQPC 4M0NA 2ATFA 4E2QA 2D93A 1WW6A 3WG1A 2D98A 2WIIB 3R6SA 1OA3A 3V0BB 3AYCA 4QU2A 1IQAA 1QJU3 2EVXA 1O3QA 3RYPA 1C1LA 2VMGA 2HWB1 5JI9A 1BK1A 2R6QA 3VKOA 3NKTA 2BQPA 1LOFA 3JB8A 3AP6A 2QJVA 4D7YA 1H8TA 3O0VA 4FPKA 3BODA 4A7YA 3PVEA 4A7KA 4EV0A 1N3PA 3P3PA 2ZX0A 3USUA 3JD71 3A4UA 2VW0A 3B93A 3FHIB 5GLUA 3LZZA 2BW8A 2YXSA 4S2HA 5FMOL 4N43A 4FTEA 1LODA 3RRDA 3ASIA 4K20A 1MS9A 3ZMOA 3ZVXA 1QXRA 5I0TA 1Q5OA 1QHDA 3KCYA 1I5ZA 3AXEA 3VDDA 3IT8A 2WNUB 3VBHA 4YVWC 2Z69A 2PHFA 2OIIA 4QD2A 1HLCA 2WT2A 1K5MB 4MXWA 2VVFA 3I59A 1N1YA 2VUJA 4Y1XA 1WGPA 5GLZA 3RYRA 1LESA 4E4ZA 3HIFA 1RMU3 2VNOA 1LOAA 2OVUA 3OTFA 4WBBA 1DHKB 3HAGA 2ZGTA 4Q4X3 3VKNA 2VQAA 1RMU2 4UW3A 2BNNA 1LOEA 1MEC1 1QWRA 1GNHA 1YIPA 1AYM1 1OQDA 1V70A 3AFGA 2PHUA 4Q4W3 2YROA 4A7ZA 3LWCA 2RMU3 3CEWA 5DDJ1 4Y20B 1X36A 3ZN5A 1GZWA 4Q4W2 5EV7A 3S7IA 3WQ1A 3ZXAC 1JHNA 1VRH2 1NA1B 2XKPA 2A3YA 5C8CC 1AUYA 2F4PA 4AF9A 4XF4A 1R081 4N53A 1S0IA 1CAUA 3AZYA 5FTTC 4C0BA 3TN91 1S2BA 4GKYA 1AR92 1RUG1 3V65A 1O4ZA 4DRVA 2P3JA 2D5FA 4LHNA 1HRI3 2WS91 5BNQA 2ZCWA 3TYJA 1RUH3 1MS3A 5CFDA 4PLOA 1S0JA 2GC3A 2Y26A 4XQ4A 4QQ2A 1HRI2 3KM5A 1WD3A 3VKLA 2VOVA 3H3ZA 3BIWE 2NMOA 3KT4A 3VBOB 5L36A 3WVJA 1OFSA 4YFZA 1PK6B 2E7QA 4OULA 1VBD1 4S2DA 4A3XA 4F8AA 5T50A 2X53S 2DURA 4XZPA 4YYOA 2B5HA 2YGLA 4K1YA 2ZGNA 4Q0PA 3M2MA 3V0AB 2JG9B 1Q3EA 3VGIA 1X82A 3RPQA 4YM1A 5JI7A 1U0AA 5JZGC 4S2GA 1CR7A 3ES1A 3MDPA 4GB31 2ZOEB 5EXOA 1FAYA 3WW4A 2R0FA 5C4WC 2C5DA 2GNBA 3MF9A 1DLLA 1W6PB 3WLUA 4QQPA 2A73B 4P9XA 4AVBA 3JUUA 4QQHA 3KGLA 3NV4A 4WZCA 4KGQA 2VGDA 5I8YA 3VBSB 2SBAA 4HMZA 3GBFA 1ZBE1 1GZ9A 1OFNA 4H7MA 3BTAA 1U5IA 2JENA 3OYWB 5C9AA 1LOFC 1ULCA 1MR5A 4IEXA 4MGYE 4E4SA 2BUKA 1H8TC 4KBBA 1KFUL 2IXIA 3AXDA 5CG9A 1H2KA 2O0OA 2Z42A 5AVPA 4BE3A 1HQNA 5EWSA 1J1TA 3L2HA 3IM0A 2QZ3A 4AHZA 5A33B 1AZDA 4HT1T 4COWA 1SFNA 3WINE 1C4RA 2B45X 3FZ3A 3ZSKA 4RL7A 4XJ9A 5L7OB 4N43C 1YFUA 1RUJ1 1BQPA 1FI2A 5JOWA 1DQ6A 4E2SA 2WSVA 2ZGQA 3VDDC 3OBTA 4KG0A 3VBHC 4QPGA 1XNCA 3N7JA 3VBFA 1XRUA 2HWE2 3ELNA 4GIQA 1ENRA 1AX0A 5FREA 1SQ4A 3PVNA 4Z07A 2QUOA 4I09A 4AEDA 4E27A 4Q8KA 3J4UH 4COZA 3ATGA 4N90A 3B7MA 4UW5A 1O3RA 5HCBA 2EF6A 4EN0A 1W6NB 2CY6A 1S55A 2JJ6A 1RUI3 2NLRA 5CB7A 1DZTA 2E63A 3CJXA 3LA2A 2R063 2O8QA 2ZZJA 3NO8A 1O4YA 4G3YC 1UL9A 4HANA 1RUI2 2VH9A 1N3OA 5BNPB 2UY9A 4XIKA 1TME1 5FBZA 3PJYA 2GC2A 1FNYA 3ZSJA 3DPRA 1NCQA 1J3RA 3PMEA 3FE5A 5E1RA 4KWKA 2PHDA 3ZYRA 3WT3A 4MGZE 4N53C 1KD7A 1HQLA 5DUVA 2X29A 4MGKE 5C33A 2NN8A 5I0UA 1OA4A 3MI8A 4EN7B 4YG6A 1D2QA 1FX5A 4J1XA 4FPFA 3ZSLA 4AXOA 3N35A 4UW6A 5CFDC 4YW2A 1POV1 1V6OA 1W6OB 3ST7A 4EJRA 1V9U3 4HPKB 4R9DA 2XPJA 2R0HA 4B4PA 2JICA 1NE4A 1I3HA 4IV1A 1B35B 5D8AA 2VULA 1CPNA 1V9U2 1HXS3 4EWAA 2ET7A 3JB4C 4QMAA 1O91A 1SLIA 4GXLA 1BKZA 2TNFA 1D4M3 4KWLA 2XJSA 3R4DB 4PIXA 3RJRA 4AFAA 4L92A 4YZ2A 3TNQA 2XLAA 4YZ5A 4CRQA 5IK5A 3NL1A 3ECQA 1D4M2 3H8UA 3QACA 5DZEA 1PZ9A 2HWC3 4JV4A 1XU2A 1UU5A 3NJZA 2R1BA 4LNVA 4RSUA 4CDUA 1RUD3 2D6MA 1COV3 1RUD2 1RUNA 2XUMA 1XYPA 4MYEA 2ERFA 4Q1PA 3E6CC 3WQ7A 2XVGA 1C8M3 2E9QA 2IZWA 4BPZA 4JGYA 3PVBB 4LBQD 3I54A 2NZ9A 1LJ7A 3USSA 2DVFA 2G9FA 1O3SA 3N7KA 3VZOA 2GH2A 5C9AC 5BNOA 5ABJA 2R30A 5F9TA 4ASLA 5BXXA 3WD5A 5BNNA 1NXD1 3GBGA 2KM2A 3ZYIB 5J3UA 3H50A 3S0MA 3NAPB 4HKLA 3OBRA 1S0CA 4YW4A 2EAAA 1HW5A 2HWB3 1V6MA 1Q8QA 5HXVA 1VRH1 2A75A 5FLHA 4QPGC 4ITCA 3HT2A 3VBFC 4HL0A 2PHWA 5FDBA 2NMNA 5BUVA 3JD73 3N4MA 1AR91 2DTWA 1Q8VA 1ZREA 2GMPA 3WP6A 1O5UA 5IK8A 4AEDC 1RUF1 1BEV2 4NOTA 2GSYA 4HFSA 3AP9A 4U36A 2E53A 1BYHA 1R1A1 1UU6A 1OHFA 4RR3B 1BBT1 3H0OA 4LUKA 3ZIWA 3OGGA 4HVQA 3UJQA 4JQRA 4RS5B 3E5UA 1V6NA 2GN7A 2FZ2A 3VHNA 2ZHLA 2Q8OA 3ZFGB 3T1LA 2G4IA 1Y9QA 3M1HA 3G7DA 4Q4V1 4BQ1A 3E5QA 3KB5A 3A0KA 4JGZB 4PDWB 1PHMA 2O8OA 1DYPA 2A5ZA 5J37A 2DUPA 4EN6B 3SNMA 3ETQA 3H7YA 3LCPA 3ILRA 3DPRC 1UU4A 5KC6A 2GAUA 1UF2C 4KH9A 2ZGUA 4OLLA 1MEC3 1V6JA 2ZS6B 3ROUA 1UKGA 1AYM3 3EJKA 3E6DA 1RJ7A 1E57A 2WSUA 1NY71 1MEC2 2E7TA 5DDJ3 3VZLA 1BMV1 1SFYA 1HV0A 1QH7A 1MS4A 4XJZA 4LBLA 1W39A 1FV2A 3CLPA 4OI4A 3RJ2X 3JBG1 1UAIA 1R083 5D8AC 4Q27A 3TN93 1RUG3 1C57A 1NCRA 2DFBA 3RNSA 1WMEA 3BB6A 4O9GA 1R082 4K6BA 1AHSA 5DUUA 3WCSA 2GU9A 1CAVB 1FNZA 3J8F1 2WS93 3TN92 5FQ0A 3VN4A 1RUG2 3V0BA 4E4DX 2E7AA 2BNMA 3LOIA 1ENSA 2VUAA 4GH4B 4JRLA 1AL22 1UKRA 1Q8SA 3OY8B 4IESA 5KHKA 2DUQA 3KGZA 4P9JA 2YZ4A 4YVSB 1G9DA 2D3PA 2X8KA 1ZNPA 4CDUC 2DUOA 3AKSA 4B7KA 3HBZA 2D40A 3I8TA 4XTPA 1VBD3 3CU7A 3FUQA 4NHMA 4XMIA 4BIOA 2XKOA 4EN9B 1EYBA 2VXRA 4M3CF 2XLFA 5IK4A 1VBD2 2D6NA 1WLCA 5E89A 2ZKLA 1YYNA 1U12A 4K1ZA 4QT6A 3QBQA 2WZR2 3I7DA 5FMOS 4YZ4A 4GB33 4K7JA 5ABJC 2WNUA 5BV6A 3TOJA 4CEWC 4WM8B 3J9SA 1DFQA 3VKFC 3X29B 1YJKA 3GNEA 1UMZA 1RGSA 1GBGA 2Z5WA 3RWNA 3N3HA 1N3QA 4Q2FA 2NYYA 2FBEA 4LBJA 4HBNA 4Q0UA 1O7FA 4XIOA 3SLIA 4FQZA 4LO6B 2GDFA 4BZ4A 2WNVB 4I3GA 3OD4A 1ZBE3 2BWCA 2XHKA 3IMNA 5DUWA 1L3JA 3AKPA 3WOGA 5FLIA 1JUHA 5KXDA 4M00A 3FBYA 4AI8A 3EHKA 1YJLA 2PYTA 4OHWA 1FOD1 2WFPA 1IS5A 4Y20A 1IS6A 1JOJA 4I3PA 4XFHA 4BM8A 1W6MB 4Z92B 1ZZ6A 3FMGA 1RUJ3 4IV3B 4XFIA 1G6NA 1NA1A 2ZPXA 4AGRA 2LUWA 3AZZA 1RUJ2 2Q30A 4G4FA 2XWBB 1QF3A 2VVEA 3VV1A 2GALA 5CU1A 4HK9A 1F5JA 1QJY1 1CX4A 3U11A 3UKNA 4CDWB 3JZVA 4HLTA 1KITA 1CPMA 2GMMA 2VOWA 3KSCA 4DFSA 3AFKA 4MV2A 1OMIA 4SBVA 3TRSB 4AI1A 4YM2A 4JRAA 3W9AA 3MW2A 1UD1A 1J3PA 3WUDA 4GMP1 4N9HA 1EPWA 1CJPA 1OOPA 1YHFA 1RUOA 4B4RA 1QJZA 1EPZA 2HJIA 3SH3A 2PA7A 3WV6A 3N7LA 1NQJA 1UPIA 2WQZC 2D43A 2JDZA 1KDMA 2UYBA 1PK6A 3ZFEB 4KU7A 3DGTA 2DCYA 1PNGA 1TME3 1PGW1 5T52A 2PAEA 2XL7A 1UCXA 4Q26A 1PNFA 1TME2 3PTYA 3ZXEA 2FHRA 4OUMA 3ZN6A 4WZFA 1UW8A 5JPMB 5CIRA 4N7UA 3AMPA 1UIJA 4FPLA 1DIWA 3VHOA 3GZTB 1NCRC 3H7JA 5KC5A 5JZGA 4NWVA 3E6BA 5I93A 4LA3A 4QGMA 2BWAA 3HQXA 5C4WA 3VHPA 3HR9A 1SLCA 4BMBA 5SV5A 4KQ7A 3VBSA 1JYCA 1POV3 4WM7A 3WQ0A 1EV11 5FO7B 1VBE1 5KXBA 5JR7B 1POV0 1W6QB 3JU9A 1YNAA 2ZX1A 4ISQA 4I0WB 1Q43A 4TZDA 2Q1MA 3OGJA 3CNAA 4QX5A 3S7EA 4IEWA 5A33A 2D6KA 3ME2A 1HDKA 4I2OA 1LHNA 2AYHA 2PAMA 4LBNA 4KGGA 4XYXA 3RQ0A 4FP2A 4PCRA 1BEV1 1WUVA 4JTOA 4KNCA 1HRV1 3DKWA 4H3WA 4P9IA 3WDVA 2ENRA 4K3UA 3ZO0B 4AEJA 2WNUC 4R4ZA 3FLRA 4YGDA 1RHI1 1UPSA 1BVP1 3SH4A 1VR3A 5K0UB 3D5OA 1WCSA 3KCCA 4K21A 1Q56A 1LENA 3KQRA 3S30A 2AZ5A 2XJPA 2EXHA 3DL3A 4Z82A 4AVSA 2ZGSA 3EQEA 1LHVA 2D44A 1W6NA 5BY5A 3LSEA 3AJYA 4AFMA 4C90A 2ZAHA 4XBLA 1DZRA 4BLIA 1RUC1 3VBRA 2ETEA 5GALA 4LEJA 1EY2A 1O3TA 4IEPA 3CJIA 3VZKA 1AX2A 4B29A 1G8WA 1QNWA 2ZX2A 4JCKA 2GZWA 4YVWB 2WA4A 4XJUA 3RG0A 1NA1C 1REDA 3NV2A 2RS52 1VRH3 2YC0A 1JW6A 2YYOA 1H4HA 2D5HA 4AFBA 2LALA 5JDBA 1AR93 1F9KA 4R9AA 4GWMA 5JOYA 4LO7A 1QQP1 3RS6A 2ZGRA 1RUF3 3L9JT 5BYNA 2UU8A 1R1A3 4WVZA 4R8HA 1OOPC 1BBT3 4XBQA 1RUF2 3WW1A 3DUIA 1AL21 4HPKA 3GALA 1R1A2 2B8MA 1OI6A 4OVEA 1BBT2 4RFT0 2NPIA 4Q4V3 3ZDSA 1PK6C 1WLDA 1DGLA 1SLTA 4TSVA 3U4XA 3NV3A 1QXJA 4Q4V2 1XU1A 1IKQA 4V1PA 4XFBA 5KHHA 2ZGKA 3ILNA 3GZAA 5C8CB 2D3RA 2YHJA 2ZACA 4IEVA 4QQLA 4KU8A 3AP5A 5FO8B 1DDLA 4L9BA 2DCTA 4XDQA 5JMCA 3MW3A 3MIHA 1YRZA 5EZWA 3D0JA 2WZR1 2NP0A 4PJYA 1SBFA 3TWIA 3U10A 3VBUB 4BWOA 5JSRA 4AVAA 4C1WA 1G9AA 1SACA 4AHYA 1JH5A 1JUIA 1MQTB 1F31A 1MS1A 2P34A 3INAA 2ZHKA 5L19A 1GR3A 3N7MA 3LOBA 1VJ2A 4U2AA 3BPZA 1IS3A 1LGCA 2CWSA 1NY72 1B09A 4NPRA 3VBSC 1BMV2 3ZXDA 4WM7C 1LCLA 3LAGA 5HI0A 2TBVA 3KT7A 4ATFA 1REEA 1ND3B 1LKNA 1V00A 2XGXA 5DUXA 3JBG3 3SXWA 3RMXA 5CFCA 2GMEA 4ZKTB 2GNMA 2QDRA 1KXGA 3GZUC 4D3WA 3JBG2 4XF3A 4YRDA 1A8MA 3J8F3 4XJ8A 1GZCA 1KFXL 4FPEA 3DF0A 2HEYF 1GANA 3IBMA 3J8F2 1C5IA 2DU1A 2FMYA 2RS31 2IXKA 4KL1A 4MLOA 3MLLA 4LO8A 3TNPB 5DG2A 2YGMA 1VBC1 4IEYA 3SCGA 3AZXA 3MF6A 2ZMKA 3ZFFA 1S2KA 2HEVF 1QJX1 4ZU4A 2WLPA 4DY3A 2RM22 2WFF2 4LA2A 4ASMB 1G86A 2D3SA 2HWE3 1VP6A 4YG0A 1RVF1 2PN5A 4MUVA 5TSWA 1SDWA 4RR3A 4PLNA 4YNIA 2WJSA 4FAGA 1Z78A 3NVCA 4RS5A 3USUB 3ZYJB 1PZ7A 1C5HA 1NOVA 1OSGA 1M4WA 3VBRC 3ZN4A 4LBQB 3JCIA 4JGZA 1A6CA 4PDWA 3CJIC 2A6ZA 5A3MA 1ZX5A 1ND2B 3AYAA 5FAXA 3VDDB 2XWJB 2VPVA 3AP7A 2CTVA 1LEMA 2OUJA 1XQNA 3B01A 1Z0HA 4W65A 1GV9A 2FZ1A 3MFCA 1QNYA 1AXZA 2EA7A 1T6GC 1SBDA 1TNFA 3OJBA 2YPJA 4MXWB 3T1MA 3MLJA 3WNXA 1KS4A 2QCSB 4K9SA 5KHIA 4MX3A 1GQGA 3AYDA 4AI0A 1FOD3 1LTEA 1KJLA 3VL9A 3P3NA 4FQ4A 2Q5TA 4Q1RA 3M7AA 3PNAA 4IXLA 1FOD2 4ISRA 5LK7B 2ARBA 3LA3A 2AGSA 4RGAA 2DWRA 2PLV1 4HK8A 3S6PA 1HKDA 1VAMA 2BEOA 2RS11 3WW3A 4H7LA 4B4QA 2YY1A 3MIFA 3V56A 2QVSB 4BCUA 1QJY3 1ZYBA 4XBNA 2EALA 1CAVA 1R091 3QH7A 1QJY2 1WMDA 3QLQA 5AC91 4DZGA 4FOYA 1PVC1 4GMP3 1FPN1 4GH4A 4DB5A 2UWCA 3CL1A 1CAUB 4GMP0 4IEQA 3VKMA 2XBO1 3AMMA 1EAH1 3GYDA 4YVSA 2ZX4A 4YW3A 2B42B 1ULEA 3FUOA 1DYKA 4EROA 1ONAA 4PBPA 2PQQA 4FPJA 2VU9A 5FLJA 2D6OX 2VY0A 2X5IB 1UN1A 4I01A 4AFDA 3ZMNA 4COYA 2EXKA 1Q8PA 5F1RA 2A6WA 3B5LB 3HWJA 2W08A 4FPOB 4L2NA 2Y38A 5T5PA 1OA2A 1H30A 1PIV1 1XNKA 1Y43B 1YI7A 2DVBA 4CEYB 5CADA 5JSOA 1IGOA 1KRIA 2WKKA 1PGW2 2OZJA 1ZZ9A 2A7AA 5J96B 2Q0AA 2Q1ZB 4Y5Z0 2H0VA 5C8WA 1W0OA 5CFCC 2R072 4B3NA 5FRAA 1D0GA 2RJKA 1LRHA 4FO9A 4XFFA