5K05A

Crystal structure of comt in complex with 4-methyl-2-(4-methylphenyl)-5-(1h-pyrazol-5-yl)-1,3-thiazole
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
214
structure length
214
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 72
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k05A00
2Q41A 4YUZA 5JR3A 4KRGA 5FQOA 3LDGA 4HTFB 2YXDA 5CCXA 4GOLD 4YMHA 5DM4A 5EIWA 1G8AA 3ER8A 4DKJA 3UA4A 3ANXA 3FRHA 1L3BA 4YUVA 2H00A 2XYRA 5HIJA 4X61A 1TW2A 2PX5A 1AV6A 2UYCA 1KHHA 1RI4A 3KPUA 4PWYA 3ELYA 4PYIA 2IDJA 4M36A 1WZNA 2DULA 3C6KA 5BW5A 2NNWB 2XYQA 3BKWA 3LDFA 4RTOA 3NWBA 2GPYA 1R74A 5HFJA 5HIKA 2ZSUA 3WSTA 3AXTA 1YFJA 1O9GA 1SQFA 3DXYA 3ELUA 3KQWA 3LKDA 3LSTA 1D2CA 4CTKA 3T0IA 4X41A 4DM3A 4QQKA 3BGIA 3GIWA 5DWQA 1KIAA 3SM3A 4KIFA 2OO3A 4A6DA 4MTLA 3KQSA 1DL5A 3VC1A 1RJGA 5K03A 1EQAA 4AX8A 3I58A 2ZWVA 3EVFA 4X63A 3LCVB 4LG1A 3DMFA 3TLJA 4RTNA 1ZG3A 4RVDA 4IV0A 5DXAA 3SSMA 5D1HA 2PX2A 2PXAA 3I53A 3OU7A 5HZMA 3KPWA 3IV6A 3FZGA 2PY6A 5K01A 1EG2A 4HGYA 2IH5A 3TOSA 3G89A 3HVJA 2Z6AA 2XYVA 1H1DA 3B7PA 4PGHA 2AOTA 4ZTBA 4R8RA 4CKBA 4OX9Y 1VIDA 2KW5A 2QYOA 2AOWA 2Z6UA 1NKVA 2AOVA 5H02A 3HCCA 2NXJA 2GB4A 2PX8A 2H11A 2Y1WA 3EMDA 3FTDA 3PB3A 4HGZA 5DPMA 4PIPA 2ZZNA 4YV0A 9MHTA 3M70A 1JG2A 1X1AA 2B2CA 2JHAA 5T6BA 5EHGA 4BP3A 2IGTA 2P40A 5U4XA 5DLYA 5GM2A 3OPNA 3P9NA 3BWBA 3NDJA 3UJBA 5LR6A 2OY0A 3BUSA 5EEGA 5GIPE 4PYLA 3THRA 2O0LA 5EKUA 2ERCA 1G38A 3EEOA 3CJTA 2G8NA 1JG3A 2CL5A 2ZULA 2EX4A 3NDIA 2YR0A 4GOOD 3R0QA 1QAMA 2PJDA 4R6WA 2C7RA 3BGVA 1QANA 3CBGA 3B89A 2O05A 5E1OA 5BW4A 3PLAE 1G60A 3OU2A 3TMAA 1Z3CA 5DT2A 1XDZA 2PT9A 5EMJA 1TPYA 4E2XA 2FHPA 4RTMA 3U81A 3M6VA 1ORHA 3DLIA 2OXTA 2C7PA 3SR4A 3I64A 4ISCA 5E1BA 2P1DA 3VSEA 4C04A 5KQSA 5E9JA 2O57A 3TM5A 3GWZA 4GOMD 2CMGA 5DTRA 1N2XA 3I5UA 1BHJA 3FPGA 2GA9A 4P7KA 5M5BA 7MHTA 4DZRA 3GCZA 4R05A 1G55A 5HOQA 2OKCA 3TQSA 2OYRA 2PKWA 1JG4A 5F2KA 3JWIA 3SGLA 5LQUA 3K0BA 2C7QA 3MCTA 3R9XB 3LDUA 4BLVA 1RJFA 5JUWA 2BR4A 2YXLA 4RX1A 5IKMA 3G2QA 5LQJA 2ZZKA 3GU3A 5GINE 3G8AA 1I1NA 2WK1A 4FSDA 3V97A 1I9GA 4U7PB 2AVNA 1P1CA 1R18A 1EJ0A 3EGIA 4GEKA 4NECA 1WS6A 5CM2Z 5DRTA 5LQAA 1MHTA 2ONYA 2NP7A 3A7EA 4POOA 2BR5A 5FWAA 3TM4A 4A6EA 3ER9A 2YX1A 3HM2A 4HG2A 4MIKA 5CVVA 2GLUA 1R6AA 4LECA 2Z6QA 3EGVA 4XCXA 2YTZA 3MB5A 4GC5A 3G88A 1BC5A 3BWYA 4DF3A 4KDCA 4PYKA 3PFHA 3MTIA 2BM9A 3H2BA 3OFKA 3Q87B 3Q7EA 2VZ9A 3P97A 4BLUA 2IH2A 5FULA 3KPVA 1UWVA 3EVGA 3REOA 1WXWA 3GXOA 1EIZA 4E2WA 3FTEA 2E5WA 2OZVA 5T67A 3HCAA 4KIGA 3HVIA 2UYOA 3I9FA 3PX2A 3S68A 4E70A 5T64A 1JR4A 4YV1A 1XCJA 3P9KA 2CWWA 4HRAA 3HA5A 1VP9A 4WXHA 5K0GA 5GIOE 1VLMA 2FRXA 2ZWAA 3AWIA 4EKGA 1NW6A 2G71A 3EVEA 3FYDA 3PX3A 2I9KA 1R00A 3JWHA 2FK8A 3MGGA 2P3OA 4RYLA 3KR9A 4DCMA 1L1EA 3G2MA 1EJ6A 4FGZA 4PCAA 1XJ5A 4BP1A 2ONZA 3SX0A 4DCGA 1VL5A 4CXMA 1XTPA 4C03A 3TKYA 5E1DA 2QY6A 5P8WA 3DULA 5B1SA 2IIPA 3P9CA 1WG8A 4CKCA 4PYOA 5ICFA 3HTXA 2YXEA 3E7PA 2OBFA 3M33A 5E9WA 4EK9A 3KQMA 2AOUA 4IWNA 3UJ6A 4FSXA 4DMGA 2V74B 1FJXA 4IV8A 5DSTA 2PWPA 3AJDA 3P2EA 5DX0A 4YUWA 5F2NA 2I62A 2P3QA 4CWAA 2I7CA 3KQPA 4KVZA 4OQEA 3EPPA 3HP7A 5MHTA 4RTLA 3O4FA 1BOOA 4QTTB 3G8BA 1FP2A 4OA5A 3A4TA 3M6XA 1YF3A 5FA8A 1OR8A 5HILA 2EJUA 4PYNA 1L3IA 3KR1A 1R8XA 1X1CA 2AN4A 3B3GA 3GJYA 3P2KA 1D2GA 1YB2A 5D1NA 4ER7A 3P9IA 5EQJB 2FPOA 4RTKA 2AZTA 1NW8A 2JHCA 3FYCA 3KR2A 4AZVA 4EVIA 2HMYB 4C05A 1SG9A 5K0BA 1RJEA 1RJDA 1P39A 2ZFUA 2ZLBA 3UJ9A 1PRYA 3FUWA 2NXCA 4GUAA 4AZTA 2I6GA 1JQEA 3EEYA 1G8SA 2R6ZA 2ZIGA 3FUUA 5DX1A 2ORED 3KR0A 4M7RA 5HEKA 2IH4A 2UYHA 1INLA 1VE3A 3NW9A 5CVUA 4X60A 5CVDA 2PV0A 2ZVJA 2B25A 4O29A 4RVFA 1ZQ9A 3SMQA 3BZBA 4PNEA 4R8SA 3FPFA 5LQRA 1M0EA 2YUIA 5CVJA 1JQ3A 1M6YA 1N7IA 1Y8CA 3DUWA 3GRYA 3CC8A 5FHQA 4RTQA 2XVAA 3FTCA 5EG5A 3C6MA 3PTAA 5KQRA 3NJRA 2P7HA 4PYQA 5K0LA 4CKEA 2AOXA 3C0KA 3NVMB 4EMSA 3G7UA 2PBFA 3X0DA 1NT2A 5E9QA 1NV8A 5FA5A 1T43A 2PLWA 2PWYA 1F3LA 1JSZA 3ELDA 3G5TA 2R3SA 1JG1A 3LHDA 5EMLA 2IDKA 3A25A 3NTVA 2PSSA 3TFWA 2AOUB 5C1IA 2IBSA 3EMBA 1KPIA 2N47A 1D2HA 2QRVB 2ESRA 3BWMA 2AR0A 3CCFA 2GAFA 3ME5A 3TKAA 3OU6A 5ICEA 1YFLA 2ZBRA 5C0OE 4EKIA 3BT7A 1NW5A 4QPPA 1QAOA 1UIRA 1VPTA 2WA1A 3B3FA 2OB2A 2ZIFA 3M6WA 4FT4A 4P7GA 5EPEA 2HTEA 4XUEA 5EZQA 3VYWA 1N7JA 1F38A 1XDSA 3HCFA 3T7TA 3FUVA 2P7IA 1XVAA 1KPGA 4RTJA 2UZ4A 4PGGA 2AN3A 5HIIA 4ER6A 5EHIA 3LBFA 5LSAA 1UFKA 2ZW9A 1IXKA 5DRYA 3SSNA 1NBHA 3R3HA 2HR1A 3OCJA 3PVCA 5GOZA 3G2OA 1AQJA 2BZGA 5C9ZA 5K09A 5LQCA 2XBMA 1JTFA 3UJ8A 3V8VA 5EMMA 1BKYA 2VS1A 3HNRA 1IY9A 5EOVA 3KU1A 1L9KA 4MQ4A 5FQNA 3P8ZA 4RTPA 3HEMA 1HMYA 2V7EA 3OE4A 4GQBA 5EKXA 5EVJA 3P71T 4QVGA 1NW7A 3SSOA 3TRKA 2P35A 2ZZMA 3QOWA 2PXXA 3QV2A 3KPJA 3SXJA 5CIYA 3JWGA 3IYLW 1Q0SA 3EVZA 3GO4A 1P91A 3NMUF 1SUSA 4PIMA 1KR5A 3HCEA 3PT9A 5DXJA 3RW9A 1TW3A 4RV9A 3LECA 5FUBA 3NVKI 2IP2A 3KKZA 5FWDA 3EVDA 1JSXA 4LWOA 3HA7A 4RWZA 5E2AA 1FPQA 2AVDA 5CVEA 3RIEA 3JWJA 4E30A 3A26A 1XCLA 1AQIA 4QVKA 2GS9A 4HC4A 2G70A 3DMGA 5FHRA 3THSA 2FCAA 5GM1A 1XDUA 1KYWA 1M6EX 3EVCA 4BY9E 5G02A 3A27A 3UFBA 5K0EA 1L3CA 3DTNA 4PINA 1VP3A 5F2OA 5DTMA 3GRZA 5EC8A 3LL7A 3CJQA 3FTFA 8MHTA 1QZZA 2CMHA 1SKMA 2NXNA 2UYQA 4GF5A 4QPNA 5K05A 2H1RA 3E05A 4HH4A 3FUTA 2O07A 3O31A 3P2IA 2HWKA 4GC9A 4RSRA 4V0QA 5CCBA 2VP3A 2ZTHA 3GRRA 4HTFA 3DMHA 5GP1A 2OB1A 1U2ZA 2K4MA 2P8JA 3DXZA 3QOXA 4F86A 1KPHA 4K6MA 1O9HA 4JXJA 4Z2YA 3MTEA 1X1BA 4WVLA 1P1BA 2Y1XA 4V0RA 4PONA 3UZUA 3FUXA 3AY0A 3RODA 1HNNA 5E1MA 1NW3A 4GBED 5ERGB 4LWPA 2IFTA 3A7DA 3FPJA 3PS9A 4P58A 5DX8A 3MERA 2VDWA 5EMKA 5HIMA 3TR6A 1RI2A 1AF7A 3BWCA 3LPMA 3DOUA 1V39A 4OA8A 1VBFA 4BLWA 1ZGAA 4ER0A 4OQDA 4M37A 2P41A 4E33A 2A14A 5K8VA 3MHTA 2YVLA 3C3PA 3UWPA 3CVOA 3MQ2A 4YV2A 4F85A 1QAQA 1IM8A 2BR3A 2JG3A 3BGDA 1X19A 5LQKA 2HV9A 3PFGA 2XVMA 4Y30A 2B78A 3ID6C 4XUCA 3BKXA 3DLCA 1NV9A 5EZSA 3KQOA 1X1DA 2ZCJA 2DPMA 3KQYA 5FADA 2PXCA 1NBIA 5KS2A 2B9EA 3KQTA 3NWEA 2BM8A 4PYMA 3LCUA 1I4WA 2ZBPA 4G56A 3UJ7A 1ZHFA 4QTUB 2GH1A 2EFJA 3EVAA 5GWXA 1SQGA 5ICGA 5E8RA 1VQ1A 3M6UA 4EQZA 3KHKA 2CKDA 3D2LA 3C3YA 3OFJA 1B42A 2YQZA 3T7RA 2AOTB 3ELWA 1JQDA 3GNLA 5DTQA 4C08A 4ATNA 5FTWA 4L7VA 1KXZA 5BXYA 3CJRA 1Q0TA 4GOND 3UBTA 3G5LA 1O54A 5EGSA 4XUDA 4Y2HA 1KYZA 1XXLA 3KPYA 2IPXA 4C07A 1ZKDA 3F4KA 5K0CA 2G72A 1R8YA 4RVHA 1G6Q1 1KP9A 1FP1D 3FPHA 3KQQA 10MHA 5ICCA 2JH9A 4FP9A 4E2YA 3MAGA 3R24A 4F84A 5EIFA 4E2ZA 3L8DA 4C4AA 1YZ3A 5BP7A 2JJQA 4RVGA 1ZGJA 1WXXA 3O7WA 4R6XA 3UA3A 3FPEA 4FR0A 4DQ0A 2PT6A 2ZIEA 4YMGA 3IEIA 3M4XA 4KDRA 3TPZA 3UJCA 3HCBA 2QRVA 4KW7A 1FBNA 4OBXA 1MJFA 3OZSA 4ER5A 5KVAA 4YUXA 5K0NA 2VDUE 1DUSA 3B3JA 4YUYA 1JTEA 2FYTA 3KQVA 1RI5A 4OBWA 2JH8A 3G2PA 1RI3A 2ADMA 3LGAA 3DXXA 4QDKA 4P7FA 3GRVA 5K0FA 2NYUA 3OZTA 4FZVA 4RTRA 4AZSA 2AS0A 4MHTA 2BH2A 3FRIA 4C06A 3B5IA 2PGXA 2PX4A 3GDHA 2O06A 5KYGA 1EAMA 5K0JA 5EEHA 4HSGA 3E8SA 3HCDA 2QM3A 3HA3A 1WY7A 3UJDA 3CKKA 4IKPA 1ORIA 4CTJA 4DA4A 3R6TA 4E31A 4B17A 3GRUA 3AXSA 3ORHA 3HVKA 4E32A 4MWZA 2OPBA 2ZBQA 3LCCA 3SVZA 3HVHA 1QYRA 2EJTA 5DM1A 1SUIA 5IH3A 4UOEA 3IHTA 5CUQA 2JHPA 3CGGA 4KWCA 3LBYA 2AN5A 3OZRA 2G1PA 4RTSA 1DCTA 1NE2A 2VDVE 3LKZA 5E2BA 2FK7A 3E23A 4PYJA 4ER3A 1YUBA 1SVUA 2P3LA 2B3TA 4FT2A 4QQNA 4U7TB 4AZWA 5E8JA 1YZHA 3GGDA 4P7JA 4PCLA 2WA2A 5DM2A 3DH0A 3DP7A 2HNKA 2NP6A 5CD1A 4M38A 2PVCA 4X1OA 2QE6A 3T7SA 1PJZA 3VC2A 4QDJA 2F8LA 3BXOA 3LX6A 3UJAA 1RI1A 3EGEA 2NXEA 3EVBA 3OE5A 2IBTA 3MCZA 3ERCA 2EG5A 3DR5A 2LD4A 5DM0A 5FCDA 3K6RA 5LQNA 4AUKA 4FS8A 2C7OA 5DSXA 4H0NA
chains in the Genus database with same CATH superfamily
4JUCA 1ONOA 4M0UA 1UXJA 3DAOA 1FLDA 1G41A 2A84A 3OEWA 1KBOA 4RA9A 5C52B 1LBSA 4NKRA 4XDYA 5L4LA 4HYQA 3EMVA 2JBAB 3MZ0A 4CMBA 1PZHA 3HACA 3MXTA 4WFQA 4YXFA 3JVIA 3G8YA 5BY2A 4PPFA 4XTRA 7MDHA 1NNUA 1JE0A 4MIEA 1DRKA 1AC5A 4Y0VA 3WKAA 1H2RS 2D74A 3R1IA 2HA7A 5EE1A 1KI9A 2HPVA 2WP8J 3EW7A 3F2IA 3WP0A 2DKFA 4YB8A 3FFTA 2X5OA 4ZTZB 1FXWA 3W2TA 2PKQP 1SEPA 3VVLA 2QXUA 2UDPA 4G89A 4X45A 3SIXA 4LC1A 5EMNA 2MIIA 1QH8B 2NNWB 1U8EA 3SZUA 1EDEA 4IMIB 4GP6A 1UM8A 1ONBA 2VXYA 5HFJA 1XMQB 5ADUS 4V02A 4Y3UA 4AMUA 3KLNA 4M1TA 1UK7A 5H3CA 4GKAA 5C7OO 3HCRA 3ND8A 1MV8A 3A1VA 4GO1A 5DWQA 1G18A 4YRIA 1EJ2A 2FZLA 4PS0A 5F64A 1U4SA 1FQWA 3QPUA 4QICA 3K0FB 5TARA 1PWXA 3VHRA 2PSDA 4LW8A 4FLMA 4AWXA 2F43A 4ILEA 5LUBA 1BDBA 3PNQA 3BK1A 5KTPA 3H8JA 1OKKA 4H3HB 4NBUA 4O4JA 3S27A 1CY8A 2XD9A 2FZGA 3KYCB 1WCWA 3OTWA 3SQMA 3OU7A 4FDVA 2XUKA 4Q7QA 4FC7A 3WGNA 4MWDA 3FZGA 2GJ8A 2D2VA 4LQ4A 3MGBA 1KDRA 2OAQ1 4ZI3A 2XXAA 1QVZA 4TS9A 5EJ9A 1PNQA 5BSGA 1E9CA 4PGHA 4OD0A 2QZSA 5L6MB 2Z6UA 4B9EA 3RAGA 3A1WA 5SZJA 2VN8A 1M2KA 1OIWA 1P2GA 3G0CA 4G24A 4EKYA 2PZMA 4MHOA 4PXYA 3RVOA 5EZYB 1H23A 3QLJA 1Y1QA 1Z2PX 3OESA 2CHQA 1J21A 5T6BA 5C7IO 1C50A 5DLYA 2X1MA 4F3RA 2PM8A 1NP3A 1W30A 4AB1A 3HYNA 1XIVA 1DINA 4PSUA 1GG8A 1RWWA 2V65A 1MTZA 3ZCSA 1S4QA 2I2DA 2EWMA 3AKDA 3DDNA 2I7DA 1POXA 3NBXX 1MJGM 2B61A 4M6WB 1ZA2A 1YMVA 1QAMA 4JMPA 2J59A 1WVIA 1UANA 4XJVA 1Q44A 2IE8A 1B0ZA 1YRYE 1KDZA 4DADA 1MA3A 4JR2A 4BUJA 2BEVA 4QUAA 5BW4A 1AMOA 3TLAA 4GZMA 3LYUA 3GZ4A 1R4MB 2CE2X 1VE9A 3LA6A 2ZG6A 1XTIA 2DQKA 1JH8A 4Q9AA 3U81A 2NZVG 2KPOA 4J1QA 5ENVA 3JQPA 3O1JC 1EX9A 1Z2CA 2CBZA 2GF0A 3EXHA 3VR2A 3IE0A 5THKA 4N8SA 1IYZA 4MWGA 2VYQA 3S44A 2BFEA 2P2DA 1T3SA 3LLMA 3QVSA 4I4TF 2ZBGA 1JSCA 4L6AA 3IPLA 3PQFA 3C74A 4ZALA 1VLLA 1C7QA 1K4MA 1G8YA 3FMIA 1OWPA 3MCTA 3WYNA 3AI7A 3MG9A 1RDFA 9LDTA 3WGOA 5HRUA 5AJXA 5IKMA 4G5HA 1Z6PA 3DE7X 4D3FA 3DVLA 1E9FA 3DWEX 1U0TA 3GDWA 4NK4A 4DBLC 2ZB7A 3PDHA 1ZCAA 1VSTA 3V97A 1VTKA 2Q9BA 3L1IA 4RZHA 1WS6A 1V9CA 2QT0A 1CIJA 1A9RA 3VH1A 5CLJA 1AUQA 5FWAA 1X7YA 1XZMA 3TM4A 1V0JA 5FUVA 2D54A 1SFRA 2WTXA 2IEZA 4L28A 5DLEA 3NGMA 1U2RA 4KUHA 3QY0A 3KCQA 1W0JD 2O2ZA 1HT1E 2WSMA 1A9ZA 5CYPA 1P74A 2XKJE 4L8GA 4EEKA 2IU6A 4X54A 5BWOA 2PXHA 3K4QA 1GQRA 3PJFA 1H05A 2H16A 3G82C 4PHFA 3EVGA 2YICA 4LXUA 1TAGA 1LRJA 1QYWA 1GA4A 3H5LA 2H5JA 2C5FA 5TGTA 3KBBA 2JLCA 2Z56A 3WK4A 1U3GA 4EUFA 3S8YA 5BN5B 1MW8X 2QVGA 4JNKA 3LP5A 2ZRIA 4TMTA 1FVHA 3FSGD 4J0IA 4ARUA 4HRAA 2VHEA 4BCDA 1JECA 1C3EA 1DG3A 3CZRA 3NC0C 2IEIA 2PD6A 2ZROA 3G2IA 2NYAA 3CNHA 4BFVA 1R00A 4U2KA 4XW2A 2KLBA 2QTZA 4GT1A 4HPXB 5KIAA 4ZN6A 1L1EA 3DMRA 3G7SA 4DCGA 1P5FA 3W8FA 4CL3A 1UKCA 3LGXA 5D85A 5LBIA 3VX3A 1NKSA 2XA1A 5IJXA 3IMCA 4GYWA 3LD9A 1ZNYA 4V38A 4MH0R 3SR0A 1NC3A 2C5HA 1VSBA 4OHZA 1QM5A 4PYOA 3FAKA 2JFZA 4ZQEA 4DNQA 4OREX 1L4YA 2PKQO 3C6BA 3WSVA 1DMRA 2C57A 2Z30A 3EGCA 1PR5A 4AJ4A 1D7OA 3IQIX 4UUBA 2PZJA 4QFMA 2F62A 3OCZA 1T4CB 2KHZA 2QOEA 1LZLA 2FF5A 4O08A 4D6PA 5F2NA 1SD5A 2VA9A 3IDSA 4J75A 3CUEF 1EGHA 2CK3D 2P9GA 3QPDA 2OA0A 1DXQA 1BXRA 1KY2A 5FBKA 2GKSA 1A1VA 4JXZA 2IDZA 3TX6A 2KLHA 4HRYA 1M10A 4S12A 1JI0A 3YASA 2B8EA 1YF3A 5ADHA 4MVJM 1ZRMA 2XGMA 3FDFA 1XQXA 3FOCA 1R8XA 3OOSA 4XGKA 2CJWB 1QZUA 1U99A 3FOWA 1YB2A 4N7JA 2NYVA 5BSRA 4CMEA 4R1UA 4XWKA 8LDHA 3T9FA 2P30A 5EQJB 3Q3IA 5K4GA 4RTKA 3U7IA 4REMA 1OF1A 3AIIA 5K7SA 3B85A 4JC8A 4C05A 1VLZA 1SXIA 4II2A 1QMGA 5CB4B 4JQOA 1R5JA 2QEQA 3MA0A 2ID9A 2WHPA 4D79A 3A11A 2RAUA 3KB6A 3T38A 1T1IA 3UHAA 5HCIA 4WZAB 5HEKA 2X0RA 1AKEA 2H1WA 5TPZD 2IH4A 5H16A 4E4YA 1SU4A 4B75A 5JAMA 2PV0A 2GO7A 2PEZA 4JB3A 4FR2A 3IQZA 3ZTWA 4BMYA 2EL7A 1DO2A 2EBWA 4KGVA 4R8SA 5IG2A 4BKPA 1JBEA 1PEYA 1DEKA 1C29B 1M67A 1WL8A 3HUFA 3LPAA 5FHQA 5IX8A 3ZNOA 3LSYA 5HP4A 4DS3A 1P0PA 4FPXA 1QGED 3RFXA 2O2GA 1ZM9A 1S2IA 3D6JA 4B46A 3TM5A 1P8AA 3K35A 5E9QA 8ATCA 2OBNA 2DZDA 2YH2A 4NIMA 2VUSA 3ROKA 5HFAA 4D8WA 3A25A 5BSHA 1DX4A 4AT1A 3DYVA 1DEAA 2JIMA 2YZGA 2N3ZA 3EMBA 3IPXA 1SULA 2ANCA 1VPLA 2I3GA 1AD2A 4H1TA 1BHSA 4OQMA 3V4LA 4W99A 2ZBRA 5AW5A 2AC4A 1W85B 3CUWA 1VPTA 2BT4A 1Y3DE 2QQFA 4M0EA 4RELA 2HSWA 4O1MA 4KOEC 1W34A 3P9PA 1N7JA 1M8GA 2Y3IA 4L15A 4LBWA 4NY1A 1XPOA 5TS3A 4AMGA 5SY6A 3TZBA 2GT1A 2OP1A 3K4PA 2C8LA 2VZ0A 3OZGA 3SK0A 2HRQA 4ER6A 5BQ3A 1AGYA 2OESA 5DK6A 3RYIA 3NZEA 4YNBA 4I1UA 3R3HA 4CLHA 3PNBA 1AQJA 3SZLA 5LQCA 3QVXA 3AHCA 2C59A 2FFHA 3N8KA 1LX7A 4ZCPA 1AUOA 2VDPB 5K4AA 1RC1A 1C3OB 3AGQA 4D44A 4D42A 1UMBA 2HHHB 1TE2A 1MJHA 4B2PA 2RH8A 2AG5A 1XZGA 2PO5A 5MFZA 3H4VA 1GKLA 4K7JA 4L0CA 4ZANA 3TW6A 2RGAA 2RJOA 3ZGZA 3R7LA 1LRLA 1WCIA 3GO4A 4QUHA 4QYTA 2PZAA 1WUYA 3CN9A 2YW9A 2ZPTX 4WZAE 1W581 5L3SA 3L8ZA 3KRTA 5CVEA 3K7EA 4HB2A 1V7CA 5AJWA 1GNPA 5JD3A 4ZYLA 2FSIA 1O95A 4KYUA 3CR7A 4Y2GA 3VH2A 2OOSA 2BTOA 2XV1A 3BFKA 3SICE 1FDTA 13PKA 1L7VC 5C8YB 1WABA 4NPCA 4EL5A 5KNCA 2NSLA 4X94A 3TLYA 3HMQA 1QZZA 3K5PA 4GF5A 3OJEA 4S1WA 1HLFA 3E05A 2O7QA 3ZKWB 4PPGA 2A9OA 2HMSA 3Q9SA 4MNTA 4LBYA 4CLXA 4LWQA 3U6BA 4BVAA 2FOXA 2BGKA 2NQ2C 4EJ0A 1X13A 2X5JO 1Z3IX 4FNOA 4HTFA 1U3UA 3R8XA 1O96A 3LQRA 3FDIA 3V9AA 1CJTC 5KTYA 2YHAA 3TCXB 3L0IB 2BZ0A 3N70A 3VTFA 4DDTA 1WXFA 3GGCA 1A2QA 4ZOLA 4B3MB 4NS1A 2OBLA 1ADYA 1EE9A 2EJBA 1SC1A 2W2QA 4WCDA 3S1LA 4GBED 1DB3A 3V4FA 4OQPA 3OH8A 4A73A 4PFSA 4TN5A 1GFSA 3B1JA 4RD4A 3RS0A 4YQYA 3UAYA 2B5OA 3W77A 1U2DA 2ZCUA 2Q6LA 2XHEA 3PHIA 4RKWA 3FMVA 3IELA 3KKQA 1BROA 1ISMA 2WU8A 1KTIA 3GJSA 4LCJA 1NC1A 5C2JB 4KN5A 2IX3A 4UDYX 3H75A 4X6UA 2RAFA 3QV1A 5CTJA 2IKQA 1BEEA 2F4NA 2XVMA 4MWOA 3HU1A 3BKXA 1YVRA 5LP6C 4BVGA 4QGFA 3OZ7A 4IJMA 4AF6A 3O93A 2QJTA 4RZ3A 3H3XA 5EJ4A 3NHFA 3L6EA 3GA0A 4JLVA 4CIBA 2R8OA 4OB8A 3O5AA 1MBZA 2JFWA 3EG5A 4CL0A 2GH1A 3NM5A 5ICGA 3DZ8A 3TVYA 1L8LA 1WDKA 1HDIA 2EJVA 5JNSA 3P45A 1H6CA 1SBIA 2P2NA 4B7AA 2HSDA 3VO2A 1ABEA 2QL9A 1XMJA 3M6LA 4E4TA 2VK8A 3C3YA 3KCNA 3MWJA 4UUPA 5IWCA 2VQSA 4XGQA 4BMZA 2ZT8A 3JQFA 2C2MA 2JFQA 4HKTA 1ZZGA 3OTHA 3VC7A 4LNUA 5AM3A 3CJRA 4X00A 1QTQA 2O5EA 2ZPAA 1E0JA 4JZKA 4NRDA 5FOUA 2D1TA 1R8YA 4EB8A 3A28A 4PX5A 3KQQA 2RD2A 4DUZB 2FSVA 4RPCA 2ROQA 3DW1X 2A0WA 1Z68A 2Q0QA 4XD7A 3R23A 1ODTC 3S70A 3N53A 1U1IA 2GPJA 4F21A 1IATA 2A0YA 1PNRA 4D6XA 2VDOB 1GPYA 1ZY2A 2HHLA 4MYUA 1OXBB 4AS3A 2I54A 3QHQA 3RNOA 2BC9A 2XB8A 5J9FA 1W4ZA 5DCLA 1E66A 3HSKA 4HNQA 2YRWA 2O1SA 2VKQA 3HCBA 2D7JA 5LOVF 2IF2A 1BYIA 3SN6A 1N6LA 4DKXA 1B4DA 2PUEA 1P33A 4F5YA 1P7PA 2VDUE 1RP1A 2RGNC 2J87A 2Y1GA 5FTMA 4BFXA 4IDBA 4P35A 1DTWB 5JBIA 1FFEA 3KFXA 2I1LA 1R64A 1Z56C 1DMSA 2QWXA 3LV8A 3QOFA 4QDKA 2DPHA 4Q9KA 4HNTA 1ZFNA 3EWSA 3DGFC 4QYMA 1MC5A 5LZ8A 3OEED 3UK2A 3GFGA 4F4UA 4HLNA 3DBLB 1C0IA 1EX1A 1Y7IA 4DV2B 1CEYA 2PVPA 4GI2A 3WLJA 5JPIA 4CQJA 1YA8A 3EQ8A 3JYNA 4PFKA 1TA0A 2BEWB 2VJPA 2DR0A 4P6VF 1RWXA 2W37A 5BYBA 2HJHA 4IXMA 4PBSA 4V3CA 4CTJA 1KH1A 1V71A 1XUOA 2DSTA 2FWNA 2HH9A 4G8DA 1QH1B 3AXSA 3W9YA 3A4LA 1K92A 2W9XA 2HA3A 1ODFA 4R2KA 2V7TA 1PGQA 3DFUA 1XJCA 3QP9A 4H3SA 4HS4A 4KXXA 4O02B 1K6IA 2XVZA 3C48A 2EFDB 5CUQA 3VKVA 1AY0A 4RTSA 3H97A 1KC3A 4I19A 2JI7A 2B3TA 3N9IA 2F1HA 3STUA 1V6SA 3I30X 3P4YA 2HCJB 5KNCH 4FIZA 3ZJUA 1FJHA 2QD1A 2V55B 3MWLA 1CK4A 5DM2A 3DH0A 3ZWCA 4B6EA 4CF6A 3WRWA 1TAQA 2H4WA 4P4LA 1PJ4A 4QYIB 1QHGA 3TW8B 2GKOA 1THTA 2G83A 3U56A 3JV7A 2QNIA 3D6VA 2EG5A 3EPRA 3TJZA 4M89A 4OHOA 4MWEA 2AQ8A 4Q34A 3WAGA 1CQWA 3F6YA 1SU7A 1GWNA 1XFDA 2QPLA 3KKMA 4ZMBA 1TK2A 2FPGB 1UEJA 1IHPA 1OX4A 2Q2WA 1FX1A 1QLHA 3P0JA 4WCFA 1I3MA 2ZI3A 3L9XA 1ZN8A 1ECFA 3L2OB 3UUGA 1T26A 1X8KA 1H9CA 3JQ9A 2RKBA 3QPWA 1RXEA 4U2CA 1NVVR 2ZIWB 4G4SO 3NHPA 3CE9A 3WC4A 3SSAA 1JBKA 2XCQA 1PZMA 3GRAA 4NE2A 5EJMA 3PXDA 1W25A 3UH0A 2IV3A 4CHGA 4PAGA 3C4QA 3JYPA 3S3TA 4H18A 2YJNA 1ID1A 1XNGA 2IW1A 2TSYB 2JAHA 5JQGF 3JZFA 1MX1A 6REQB 1G8JA 2CXNA 5HGXA 4DV4B 4S05A 3E1KA 4DA8A 1PV4A 1X7DA 2G67A 3AB3A 3FHCB 3TDKA 2MDTA 3V4VB 1Z5OA 3N2KB 4ESEA 3D4LA 4YYZA 4JSTA 4Q7JB 4U7JA 3ESBA 2GBFA 5DNVA 1F3OA 1VKZA 3JU3A 5TV2A 3RS8A 1Y89A 1E1MA 5FXMA 4GR4A 2Q1SA 1A96A 4YRTA 4Y6LA 1RYFA 4BU0A 1TUEA 1F20A 1KIAA 5EP2A 3E0XA 3P9QA 2AXPA 1ZBQA 5LQSA 3T9DA 4S35A 3GUZA 4X65B 5JANA 1ZIXA 2KJQA 3WHPA 3X2FA 3BFJA 3PCTA 4G67A 1XEXB 4RJJA 3BSWA 2ZB3A 3EQ7A 1X7HA 1TVKB 4RTNA 4MS1A 4P93A 1ETUA 5IKOA 2B6HA 1U28C 1G5IA 3L92A 5D1HA 3K3PA 3ZY6A 4R1PA 5ED4A 2C3YA 1RM0A 1E2IA 4DIUA 4CKZA 3P9ZA 1YAHA 3ORSA 1DBWA 2PMCA 1W5EA 3AFNA 3IP9A 4MIOA 5I4IA 1A7AA 1YVPA 2WI8A 3T95A 4TKVA 3R2JA 2PUCA 2KW5A 5DHUA 2EKZA 2QPOA 3HCCA 3AW9A 2XCRB 1XVUA 4P5PA 3NASA 3RUEA 3LU1A 1KFBB 1PZNA 4D57A 3P0EA 1GIAA 3DPSA 4OQLA 4X3CA 1DS6A 3JAKA 3U7GA 3K70D 3CCCA 1G5HA 2PUJA 4KO4S 1EUCA 3PGA1 1T4BA 1UC9A 1PZEA 2GCEA 2Q62A 2QMUA 2B83A 3ESAA 3HJUA 3C1OA 1WB5A 4XDGA 3CSSA 2D5CA 3DPIA 1VRCA 5I9MA 5AHKA 5TJHA 3AZPA 2GGSA 1MA0A 4X92A 1MPXA 2YYZA 3KQKA 1LI5A 1SRQA 2EX4A 3FKSA 1GGJA 3B13B 3P26A 2ISQA 5D3QA 4ZI7B 3DZDA 2DFPA 2OO5C 2WC1A 3A6KA 2PR7A 1PJBA 3HSYA 3B89A 5A2QA 2GQ0A 2WPNA 4QIHA 2NZYA 3H9JA 3PU6A 4IIJA 1J6UA 3ZNNA 4CM1A 3FIJA 4QTZA 3KX2A 1G5TA 2AJ8A 2SKEA 2O8DB 2X14A 4XQ9A 5JDCA 1ZK3A 3DLIA 3LUDA 3HLKA 3Q3EA 5CLGA 3U7RA 4BGVA 3TL6A 4TUYF 4G1MB 3TZQA 1EQ2A 3N2IA 3UQZA 2GBIA 4I1SA 3RYFB 2J46A 4KV7A 4J3JA 1BHJA 2NOAA 5CM9C 4DR2B 2B3DA 1B3BA 2GLTA 1C0KA 3FG9A 4KPFC 5CNMA 4MCAA 1GQSA 1M2HA 1WP9A 3B36A 5HOQA 3BIXA 2B1RA 1OTHA 3HB7A 3E9RA 5CB4F 4HWTA 1IXYA 3M81A 4LE0A 3IAUA 1ESCA 5DK4A 1JAXA 5C8ZA 4YJFA 4M9QA 4Q4DA 4ALMA 4KR0A 2FPWA 2QMHA 1H0KA 1SMKA 5A5FA 3HXPA 3SFZA 1EJ0A 4IDHA 4EKDA 3Q6IA 1PT6A 3AG6A 5LZ5A 3SQWA 1JALA 1Q21A 3A31A 3LWNA 4CMEC 5CB6A 1CBUA 1E1LA 2VOJA 1GTG1 2IXEA 2KMLA 3PWSA 2GCOA 3E5RA 3N2GA 1HE5A 5DNUA 3EGVA 2QTBA 2V4ZA 5I45A 1C9DB 1SIWA 1RZUA 3ZCTA 2CLOB 4D9JA 3ODGA 1FVXA 2HREA 2Y9PB 1C4OA 4NOLA 2HU8A 2VF2A 2VJYA 3MUNA 4LBZA 1SUDA 4AG6A 1TQDA 2NT4A 2PS9A 4JZYA 2ACEA 4LSGA 4J7UA 5A62A 3ETJA 3QE3A 2P6RA 1KFEB 2FN9A 4HLUA 4LHSA 4YMSA 2I4LA 3KZNA 1RRCA 2P8SA 3PUVA 4HAVA 3KJIA 1ZJYA 1SOMA 1V11A 5BYAA 2CN1A 2CVOA 2ODEA 3I42A 3HA5A 4Z4EA 3O9MA 4NTZA 2GD2A 1PL7A 2QX8A 4IP0A 4WZBE 4G97A 2UUOA 3LUBA 3QFRA 1WV1A 2W90A 3LWDA 3PI7A 3G23A 2RI0A 3R5FA 1WEHA 3ZU6A 1ESEA 2H0QA 1P6UA 3EGXB 4DT1A 3WYCA 4OFWA 2FG6C 4CBVA 1EEHA 2RG7A 4G4JA 3QLUA 3O0TA 2PZKA 3ZU5A 4XWWA 2VLIA 5P8WA 1GAJA 1WG8A 3B12A 4JT8A 4N40A 2QBYB 3C8DA 3EVNA 3ZU3A 3LT1A 3ROZA 3SS9X 1GKKA 1Z4NA 4E0BA 2YYYA 3WMGA 1H1LB 1TTHA 1KY4A 2WTMA 3WYDA 2GNOA 4EDFA 1J5PA 3BFPA 2OSBA 3OLQA 2P3QA 4CWAA 4W5RA 1U4OA 4O4JB 4B3BA 4QT4A 1IY8A 1CWUA 1S02A 4HATA 1M2NA 1Z7BA 4QREA 2FX3A 4J3FA 5DBIA 5H0IA 4F2HA 1TCUA 1XX6A 2ZWMA 1LPBB 4KPUB 3VR5H 3GCGA 4RVUA 3PFBA 1LV7A 1KO8A 2GSWA 2H8KA 3INRA 5AI5A 5E95A 3E5MA 4BNTA 2HRDA 3VZDA 1Z37A 2VVTA 4CGZA 3H05A 5IJ9B 5JAIA 3QKWA 4K9PA 1OSNA 2H3EA 1G20A 1TJYA 2C99A 1Q3TA 2FJUA 1RJDA 3B20A 3HDYA 4EPWA 4MWCA 4DCTA 1UQUA 3FUWA 1EQUA 3WKDA 2E5LB 4XVCA 1DRJA 1G8SA 2VA8A 3D0KA 5DN6A 1N3YA 4WLVA 5KC9A 2DECA 1EFKA 1JQLB 1ZONA 3AR7A 4L27A 4DIFA 1NF3A 1S01A 2X13A 3KJQA 3WMEA 4B81A 3BZBA 5CVJA 1U02A 4M6WA 4HL6A 3T3DA 2J9FA 4RTQA 5J2TB 3CC8A 3MM4A 2XVAA 3FTCA 3PTAA 3PQ7A 1CY7A 1MX3A 5K0LA 1AVTA 2EFHB 3K9QO 3N0VA 4FMDF 5K1ZA 1F12A 2WJVA 1EHCA 4C0HA 5CFNA 5MFPA 1EWTA 1LBTA 1XQ6A 1YI0A 2Q9CA 2PLWA 4N6GA 3L8HA 4H7DA 2BJWA 1GG2A 1EINA 4I7EA 4NCNA 1N6IA 5KSZA 4W5TA 2PGAA 1PFKA 1ZIYA 1DQPA 2EBUA 2PUWA 1QYXA 2QRVB 4DUPA 3CCFA 1Z45A 3HK2A 3HU2A 3E2IA 4V24A 1QGUB 1L4KA 4NABA 3EXEB 3RBZA 4BKQA 1NMZA 2DFNA 1RZRD 4BQSA 1JMYA 4IJUA 4ZI7F 1UXGA 2BW0A 3IQFA 2ZRFA 1U5BB 4C4AA 1I3OA 2JFGA 1YKGA 3LUAA 2FW1A 3DB2A 1JJAA 4RY0A 1YMQA 3PQ2A 2C4HA 2DJIA 4Y6OA 2VHWA 3T06B 1GZDA 1U5AA 5GOZA 4BE9A 3LHIA 5EYPB 3T15A 1LW7A 4HAYA 3QPCA 5KU1A 2VS1A 4X3OA 1OXUA 4NNPA 3NNNA 2IXFA 4PV7A 5E0OA 5FQNA 4DIOA 1DXHA 4QEZA 2VQ6A 4BN5A 1UDXA 1X1RA 3D8RA 3PHCA 2PA3A 4NPHA 4GOJA 4BFZA 4QVGA 4CV1A 1DWQA 2HOQA 3EDMA 4BRUA 4UE6A 2PXXA 4NJMB 2G1KA 2ZSBA 4YWHA 1USUA 5DIZA 4EGQA 4PIMA 4HXFB 1LC0A 1JFFA 1TW3A 1EVQA 1XZDA 2ZB8A 3SIRA 4G0NA 5HJ7A 4LWOA 4BNIA 2Y1LA 3CLUD 2CFTA 2AVDA 1K7FB 3E22A 4L0MA 3DBHB 5DEOA 4C1NA 4BQEA 1KKUA 3GOQA 2WILA 4PHHA 4C4RA 2A33A 2L2QA 1BW9B 3HB1A 4LMRA 3T4EA 4YAIA 3W5BA 1PG2A 1KYWA 1QZTA 1PW7A 4R51A 1UBSB 5K0EA 3MTDA 2V1XA 1R4NA 2GHTA 3IHWA 2M98A 3TSCA 2VOEA 1NASA 1U0FA 3QE0A 1QMPA 3B6MA 4MVJA 4DCNA 4Z54A 1EFTA 5DI3B 4IIBA 4ZKEA 3DGEC 3K5WA 1G5RA 4GC9A 5HA5A 1T15A 1R27A 4WKCA 4DLZA 1E6MA 1E9VA 5K0TA 2CDNA 1MG0A 3ZE7A 3EB9A 3FZEA 3O2QB 4QU0A 3UY4A 1X0VA 3Q8WA 1KPHA 1YDFA 2QJRA 3DVRX 1Y33E 1HURA 1U2SA 4O4IF 4OATA 5IXJA 4QOHA 1NULA 2AI2A 3FUXA 4V2IA 4WSOA 1F2DA 3UMFA 4CMJA 4OK3A 2V0NA 4RL4A 3R5HA 4TV9F 1TZKA 4TVKA 3RH0A 3PS9A 4RQUA 1IJEA 3HB9A 3TR6A 3TN7A 1NMEA 1W0KA 3W05A 1ZEMA 2FEMA 3BWEA 4BMXA 4PO9A 5AT1A 5KEIA 1EK5A 4HTAA 3VDQA 3VO9A 1ENPA 5K3CA 4CQNA 3ZBUA 1PNOA 4DYVA 1N2OA 1VRVA 1VZ2A 2RCNA 1T4CA 1PN3A 1XZBA 3OT1B 3PKIA 4IJVA 1YDEA 4LJ4A 2Q1YA 4OGFA 1DC4A 3C3JA 5KTSA 3BMOA 1AU9A 5G0UA 1IM8A 1F0NA 2J4CA 5NLLA 3BGDA 4QJIA 1GPLA 4IIFA 3B6EA 4GS5A 4RK4A 3IUJA 3VNRA 1DKQA 2I34A 4HQOA 3L5OA 4RIEA 2DHDA 1RLIA 3ESZA 4H4DA 4YASA 5F7ZA 5IT0A 1A5SB 4TYNA 5ALNA 3GBVA 1Q1GA 5BUQA 4MKRA 1B23P 1NBAA 3HU3A 4YJHA 5DH9A 1EXNA 1JDTA 1VYVA 3IAFA 2HIHA 4CNQA 4CN8A 3E8MA 3O03A 5C8YA 4ZV9A 4LYFA 4EQZA 4XYLA 1JEQA 4K5QA 4RD6A 4J91A 4DC1A 2CKDA 4DBZA 1EXVA 1ESZA 3OFJA 2OGTA 4BNZA 3HKEA 3ELWA 3L6CA 4MV5A 4WERA 5E7QA 3ZWNA 5JS7A 3INYA 2RBKA 1TRHA 1J5XA 1KXZA 1XF9A 3BTSA 3UBTA 2BELA 4H1WA 3MILA 2Y99A 4LZAA 4QXMA 3QQPA 5JISA 1T8WA 4AMZA 1ZK4A 3GLHB 4GD3Q 5DGHA 3AEXA 3MHPA 4F2PA 3BVPA 3HBAA 3MAGA 4DMCA 4K9RA 1LNQA 4XSGA 4WCFC 4WXPA 4A0SA 2B69A 3ZW8A 2FFBA 2JJ8A 1YR9A 4TPKA 4E7OA 4DQDA 3FFBA 4YJ3F 2C95A 3CONA 1CRQA 1QIIA 1JL3A 4M22A 1UK9A 5HVNA 3QUTA 1ODIA 5FRDA 1A50B 2NUPB 2SNIE 1LSOA 3P2MA 2BGUA 3UOAB 2NU9B 5A0TA 2NVWA 3STYA 1P5JA 3IS3A 4X0EA 4LXQA 4Y2PA 3SJ7A 5B37A 3S40A 4R01A 3TCNA 1KU6A 2C88A 2AS0A 1PTJA 1UJ6A 2PGXA 1S1CA 1Z6ZA 3SXUB 5B1EA 2DUNA 3CX4A 1RKQA 2JLXA 1E3LA 2BCGY 3K70C 1GPDG 3DCIA 3ENVA 4FE3A 4YP1A 3RJ9A 1YOBA 5A5EA 3AFOA 1T8PA 5L6LB 1F8FA 4RMIA 5I7VA 2GM4A 4GL2A 3G02A 1ORIA 2P78A 3O4IA 5DBEX 1JIKA 1PWYE 3GRUA 2Y6UA 5AVYA 4K3VA 4ICIA 3BB3A 3HVHA 4UEQA 3W78A 2X9LA 1SUIA 1ZK0A 1Z4QA 1XZHA 2R8EA 2DTXA 3EZGA 4MV4A 4BJ6A 3C5WP 4MINA 4KQ2A 3T1HB 7YASA 1XN4A 2GZAA 3E23A 5EZ5A 3SEZA 4TSFA 5GONB 3K15A 4BMOB 5FL7D 2B9VA 1NJ2A 3UWKA 2CL6X 2P9QA 4LSZA 2ZAGA 1ZR2A 4YJGB 1U3FA 1P2BA 3A9VA 3A2NA 1CUJA 5JQWA 3NIWA 5DMXA 4DR1B 2HLDD 4YBZA 4YYEA 2QE6A 1NNEA 3ZJ5A 4P4GA 4IJ6A 1YACA 5EPOA 3M2TA 2GFIA 3S2FA 3WOVA 4EWLA 4GDFA 4ARIA 3R5JA 3WRYC 1BN6A 2W93A 4Q12A 1XO1A 2B2XA 4E11A 4YRKA 3ERCA 4HXGA 2Y8EA 2Z9BA 3LCRA 4TXLA 4WNYA 4UTPA 5EUBA 4ALKA 4C7VA 2YJ4A 4EG5A 2ZR9A 1E3DA 5DSXA 2V9CA 3WB1A 3BB4A 4O2BF 4RLSA 5CFZA 4LCEA 3AG5A 2V7WA 3SC4A 5EHNA 1YZTA 3GJ8A 3C3BA 2TECE 1FU8A 5D6NA 3DL7A 1IPFA 1IONA 2QJFA 2ONKA 3L07A 3VNAA 2QQ5A 2DPXA 2FWRA 4B84A 5A02A 5BQFA 3GHYA 3BEOA 3O3NB 2GPAA 3UA4A 4MV6A 3HKCB 1ZLYA 1A9YA 2ZE6A 4TTQA 1DIAA 1KEEB 4KREA 4RGQA 4N5IX 3L9WA 5ICSA 2HRCA 5IJZA 2RH4A 2CLEB 2OK7A 3MBKA 4CCYB 1I3LA 3IQHX 5FUWA 3RCBA 2HXGA 5LD2B 1J56A 1TA9A 4BAGA 3IDZA 1N1MA 1PR6A 4KQ6A 1ELOA 1ZMBA 2BSAA 4YJKA 2WF8A 4E09A 2AE2A 4DG5A 1RWNA 3PT5A 3R6GA 3IEKA 4ZMRA 2X1VA 1OXTA 2QVCA 3FFXA 3LLCA 1ZMXA 3VR3D 3H9BA 3OQNA 1M2OA 1E6EA 3LKDA 1Z63A 3SLRA 5EIEA 4Y2XA 2WAMA 4DC9A 3I01A 2C2BA 3D6HA 1SKUA 3B82A 1UMDA 3LXUX 3NH9A 5CJPA 5A0FA 4WLFA 4DM3A 2WZBA 3PDJA 1FTQA 4DLPA 3U7FB 3OQMA 2Q2OA 3TXAA 5J5AA 5KCZA 1ZUHA 2JLVA 2CXSA 5ABPA 3NRBA 2FMTA 1V5GA 1XZEA 1ZD8A 2W2PA 4KMRA 3N05A 3EZ7A 1BKSB 1ZNZA 2VDRB 4LG1A 5ESDA 1YDHA 3UM9A 3ZWWA 5IVPA 1NP7A 1TYDE 4G23A 2ST1A 4GKVA 4PQEA 3QVOA 4G9GA 3RU2A 1E94E 4D4JA 1BJTA 4BLSA 2XZTA 4JXKA 3DB1A 4L2IA 2R5FA 4UEKA 3WP1B 2IEGA 1A95A 2IYXA 3AKZA 1B15A 4ZJPA 3B9PA 4BX8A 2RJNA 5IFKA 4MYCA 3OAAA 1DFGA 1M34E 5AK3A 2OHOA 3THOA 2IIBA 2YV2A 3ASZA 3GLGE 1YR7A 1AS0A 4BLPA 3E3OA 4F6RB 3CNEA 3DOJA 1V1JA 2P6PA 9MHTA 3GV0A 3KEOA 1TYZA 3U9LA 4EF6A 1LLUA 2EGUA 2JHAA 1DE0A 1S9HA 4UMDA 4DIBA 1QIGA 1F8XA 3V1NA 4WFKA 3P9NA 4U3JA 1E2NA 3SX4A 5AW3A 2IS1A 3LVFO 4URYR 4AMYA 2YY7A 3FUCA 3R7WA 3HXKA 3BM5A 4H4EA 4M1WA 1PYGA 3ZVRA 3SWWA 4OJNA 1WHTB 3CRNA 2HBYA 4YR7A 4QG7A 3QE2A 1F6WA 4TXHA 5EHQA 3DE0X 1IJFA 1AT1A 2VC2B 4Z6KA 1EA5A 1HFJA 3VDXA 4E3WA 3L05A 4XR9A 5DNEA 4O4JF 3KTAA 5CDSA 3I1FA 1TYAE 3P2JA 1VKRA 1U2GC 2XB2A 5E4JA 2PT9A 1X7GA 5HSGA 2YMQA 3QLUC 3TIVA 5IK2D 1ZI6A 2C7PA 1T5TA 2HF7A 2XOEA 2FJ0A 2P1DA 3BFVA 1WSAA 4AD8A 4DZZA 1UBOS 2JAPA 4EJ6A 2BEWA 3HE3A 5JBQA 3I5UA 2P9HA 4XTCS 3NNSA 4HAIA 1V1RA 2AW3A 1OZ0A 2V6BA 4Q9LA 5LDDC 2OKCA 1KU0A 5EJIA 5JDIA 1JG4A 2MYTA 1E7RA 4DLNA 4KN6A 3N28A 5KYYB 3R9XB 1AXGA 2IT1A 3L7DA 3JYLA 1IIBA 3QXGA 3NHZA 4BCCA 4YXWD 4JEIA 1MUUA 4WUVA 3KOXA 1YK0A 3KZ1E 2HD4A 1FYXA 4FSDA 2FPIB 4PQYA 2O23A 4GSYA 3A9CA 1USVA 2AVNA 2LKDA 3E4CA 3ITNA 3OMWA 4K26A 5K3BA 5TC4A 3WQBA 5HX7A 1ZGGA 3IAAA 1OJ7A 1WB6A 2YWDA 4HAUA 2XNDD 4NOMA 2BR5A 2Q5IA 1ZX1A 4QL3A 4Y2YA 1J0XO 1YZUA 3LK7A 5CM8B 1WB4A 4HX5A 4CDRA 3Q7QA 2E37A 5LNK6 2HM7A 4UMEA 4GEGA 3HSSA 3RVMA 1UDCA 4C76A 1IBLB 3CMCO 4Q1FA 4XX0A 3I6ZA 1DV2A 4F2WA 5J43A 3IT1A 1I24A 3COWA 3I1YA 1ANKA 4D8XA 3I6YA 5A1TA 3IOYA 2FPGA 2XMBA 3FCOA 1SXJC 1WXWA 3K1JA 4UTRA 3GXOA 4N4AA 3VX4A 1L6IA 3L4KA 3LP6A 2PX3A 4FYHA 2E5WA 4BWYA 2C2XA 5JS8A 1NBMD 1GVNB 1Z7EA 2RFLA 1TGYA 4NZPA 1BE0A 2I7TA 1CSEE 4CT5A 1P44A 2FVYA 1FQJA 5FNVB 2JC3A 4B7ZA 3N58A 3MGCA 3HBFA 1RPJA 5CX1A 1RPTA 3RAPR 2PIAA 3PC6A 3QUQA 4LPSA 4PG4A 2PS1A 3QU2A 4FU0A 4Y6SA 5IAAA 5LXTB 1OH5A 4L6CA 1MO6A 1U9IA 4FDAA 1W4AA 1YR2A 4MMZB 4X93A 2DHQA 1UBLS 2RB4A 4W8GA 3Q88A 1W4RA 4FFVA 4RWEA 1R5OA 3GZNA 1PJ2A 5CLQA 2CBXA 1G64A 1DX6A 4K28A 3G1UA 2OG2A 1UWKA 3KLPX 1CR6A 1QR6A 2ZSEA 3VI3B 4Z1MA 3NRJA 3N7TA 4LF4B 1NJ1A 5AOVA 2WJPA 1Y1RA 1Y1LA 3HFSA 1XWIA 2IS6A 1C3LA 3DJFA 2CW5A 1ACJA 1NFFA 4FQ5A 4UAUA 1ZOIA 2QM8A 2GPTA 2QLMA 1JNYA 4M0CA 2PBRA 4EQ6A 5LYJB 1VCMA 2BEJA 5ITWA 3SYNA 3T5TA 5K3OA 2HU2A 3IMEA 4UOQA 4MS1B 4OV6B 1GZ4A 1XA4A 1K2WA 2M32A 1RPZA 4C0LA 3OJ0A 1EA7A 1EM6A 4FE4A 5AXBA 5JT1A 3TQTA 2HMTA 2DQ4A 1ZW1A 1OWNA 1IM5A 1I5RA 2QAIA 2RHTA 3IHLA 4ZTUB 1CY4A 5C32A 4PR3A 3GJYA 1GYQA 4LC9A 4NBLA 4P84A 4PHTA 1IN4A 1ZH6A 1Y5LA 4QNNA 2BGLA 2GZ2A 3CWZA 4BNXA 1ZN2A 4BJ1A 1R9NA 2OBXA 3C3EA 2DE0X 4LRUA 4LKOA 5JXJA 1SM4A 1VBMA 1GT6A 4HLQB 3I2JA 4Y1FA 1IVSA 4B1FA 3KLBA 4TTSA 2R6JA 4BNLA 2F64A 4O4IB 1LSSA 5JAQA 2QG4A 4UKDA 1ORRA 3RYTC 3IKJA 1P17A 3MWEB 5ECDA 1VE3A 1QE3A 5ANRB 4O4LF 2D0OB 2EG9A 2MMGA 1PS0A 2OLJA 4HUQA 5DI9A 5DYNA 4DQUA 1O0CA 3SMQA 3NJ4A 3DVQX 3DD5A 5JECA 2Y71A 1NG1A 4PXSA 2YUIA 4ZI7A 4FOOA 4H9GA 1OYYA 2O59A 4NMWA 1RRFA 2VP4A 1EFLA 3PUHA 4TWZA 5ALSA 5K5EA 1XYGA 2XITA 3CGWA 1BMQA 4CKEA 3OTGA 2C00A 2PBFA 4IIJB 1U0EA 2BSQA 3GG2A 3S7TA 2Y0PA 4QXAA 4RORA 4OVKA 2AEMA 1JG1A 3ND5A 2OCIA 1D2NA 2PSSA 1GKYA 4RD3A 4M9RA 3MOIA 2YWXA 1H1LA 3CLTC 4N0QA 1ENOA 2X0KA 1MB4A 1O1YA 2EQBA 2HHJA 2NZ2A 2P5YA 3JW8A 4K9SA 1JAHA 2J3HA 4WECA 2R86A 5E6SA 1KL7A 4XASA 3M2PA 5EZQA 5IM4A 5IW8A 2HTEA 2LCIA 3GFPA 1QHNA 2I66A 1XDSA 3HXTA 3PV0A 4IVNA 4MQ5A 5HF9A 3KYJB 4EOGA 5C8DA 2QXYA 1KPGA 5BVHB 3AHFA 3LUCA 4PRZA 2PRIA 1XKTA 2JVIA 2ZEJA 5BRNA 3D5TA 2QX6A 3GLIE 3EIWA 4LGYA 4IDAA 2HR1A 1RJ9B 4XWGA 3CF0A 3C5VA 3LAWA 3FOZA 5BN4A 1VJRA 4EECA 3J80A 1G20B 3IUYA 4I2NA 4ND7A 1PI3A 4YT5A 4Y7CA 4IFTA 4DQKA 3C70A 2I8CA 3HRIA 3M1IA 4G36A 5EXTA 3UBMA 3P71T 4CT4B 4JT9A 2GXUA 2IOFK 1W35A 2YJ5A 1ZITA 2GCOB 4XIYA 4CI0B 2JANA 3I6MA 4L74A 3CMMA 2FUG1 2HLDA 1EB8A 4ZCMA 1LPSA 5CIYA 1YL5A 4QQRA 3PDIA 2C2KA 4CFSA 4L16A 5G3ZA 3UAWA 1KR5A 4QOJA 2DUUA 3U7QB 2IP2A 2ZUWA 3FBGA 4Z51A 1JSXA 3HA7A 4UMFA 2JRLA 2H4XA 5EXSA 1MVNA 3IAHA 3PKZA 3LRPA 4I55A 2C7VA 3Q12A 3DNPA 4JBHA 4KU4A 3BH6A 4PZ9A 1K8ZB 1Z7WA 4IIYA 4FZJA 3PBKA 1KQPA 2XQVA 3D1LA 1C7IA 4D2IA 2BJHA 2E21A 3A9SA 3KQNA 1KMHA 1TM4E 3FNEA 1UBGA 3DFIA 2WSSD 4JEHA 4YT2A 5BWCA 3MOGA 1S8AA 2H1RA 4X7PA 1T5HX 3LF1A 4JUIA 5COQA 2VPWA 1H22A 2GDZA 2WG1A 4MAAA 2GD1O 4P34A 3E7FA 2OUIA 1RR6A 4GL4A 4KIJA 1YQEA 1IRIA 1VLJA 4ZU3A 4YAWA 5G0WA 3VSBA 2HIMA 4P1ZA 3EAFA 1U5BA 3LM8A 1ZRNA 3ZK7A 1X42A 2GEFA 2R25B 4JL8A 1DQRA 2QSUA 3TQQA 1TQHA 4HDAA 2ZYTX 2FPMA 3KDPA 2H9YA 3ETNA 1KNQA 2I29A 3O8OB 1TVCA 2BH9A 2CF5A 4O2LA 3G0OA 3RWOA 1JHUA 3H1FA 2YWHA 3IQGX 5DX8A 3KS9A 3STTA 1E9RA 3HBMA 3ZE8A 3UHJA 4A0RA 5GONF 2AT1A 3MWDB 1ZNWA 4YREA 3FPSA 4FEEA 2IEYA 1D6NA 1PGPA 3ET4A 2ZYUX 1I1QB 1O7JA 1JHMA 2QR3A 4MRRA 3TOCA 1ZQ1A 5H9VA 5IT5A 2EF1A 4IDPA 3PGXA 3H6GA 3TS1A 4ISBA 2FZ4A 1NF8A 1F1BA 2ATEA 2CF6A 3V33A 2OZLB 1JEOA 2A88A 3AJRA 1JKXA 3O8CA 2PKXA 2D1YA 2ZAYA 5KQPA 5BSKA 2YV4A 1NBIA 2UYGA 2WJIA 4U8GA 5IKXA 3X3HA 5B6JA 1ZH4A 1GCUA 2J4FA 2M6SA 2PBZA 3I05A 3OI7A 4IO0A 4F04A 1KWGA 1SQGA 4FYWA 4E5SA 3K9LA 1XB2A 2QM7A 4KGDA 2Z2IA 1JLLB 3CR8A 1SU8A 2IX9A 4AKHA 4C3UA 1UK8A 3PL1A 1N6PA 2B4YA 2RK4A 3EEFA 5U9CA 2XXAB 1L4FA 3PQ5A 3V7YA 3RT9A 5IT4A 1O4VA 5HF5A 5LVAA 3INGA 1JQDA 4KKXB 4REQB 3R5KA 4MB6A 4XVUA 2HFJA 3DSRA 1Q0TA 3IVRA 2OORA 3RC7A 1O54A 3RPEA 3ZWOA 4NATA 2REQB 3N2ZB 2WJWA 3KU4A 4K9MA 1B8UA 5B7QA 1WF3A 1Z29A 3H4IA 1LUAA 1U8UA 10MHA 1KO5A 1RPAA 2NSHA 1SNYA 4EKEA 1N2ZA 4GQIA 1DI0A 4QT0A 3E9EA 2JIZD 3PLRA 3NORA 5G41A 5CA1A 3K20A 4FMBB 4MS4B 1VMKA 3L8DA 3QZUA 3QJGA 4IDFA 4WUTA 4O2AF 1VXRA 4RVGA 3RYHB 3V3KA 3R9WA 1DBVO 8ABPA 4DV6B 1K7XB 1ZMTA 3K4HA 3LOQA 3ABSB 3OZVA 1P5ZB 3UMCA 4G5OA 2ZIEA 1JDBB 2BMEA 2IY9A 2QRUA 3AR2A 4KDRA 2VPTA 2LZ0A 4MCHA 2QRVA 5KX5F 1PFVA 5ULLA 2GK7A 1GD1O 4QKQA 4KUEA 5LZ9A 4FGSA 2F00A 3GLFB 5JXHA 1XNRB 5KVAA 1X3LA 4K0KB 2O1EA 5HZKA 1A7UA 3AGPA 3WICA 1JTEA 2JZNA 3BMOB 1S0UA 1NR1A 2WMNB 4JBGA 4NPAA 5KHAA 4BDTA 4JWTA 4B73A 1IOZA 3A32A 2O8CB 4X44A 1UOEA 2PO7A 3R20A 3X1KA 2GEDA 3UH1A 1LC3A 4MO9A 2YC4C 3ZWKA 3G9XA 2XWQA 4N7RA 5I7UA 3AV0B 1MOQA 4K6KA 1VM6A 2BHRA 2F3UA 2EZ8A 1PJ8A 2DFKB 2I9PA 4AL4A 4U2EA 5BUCA 1Q7TA 5EYPA 4NCJA 5BNZA 3DYIA 2F1OA 1NG9A 3VMMA 4S0ZA 1SGWA 1CF9A 1DBQA 3QBEA 4OXNA 3W2IA 4O6VA 2IJGX 3IBGA 3K0CA 2JJ2A 1FZTA 3ZE0B 3GN2A 2R8ZA 3KZVA 4MWZA 5HUHA 1M74A 2YYAA 5JWRA 3EX7C 2FZWA 1KYQA 3OOJA 3G17A 4UAGA 3ZDXB 2C4UA 2QS9A 3TB4A 5AESA 3C1UA 4URXR 1RHQA 5IYZF 3B1XA 3C7AA 3BBPA 4P4SB 4YHBA 1LF0A 1YU9A 2CLKB 1SQSA 1BO6A 1NR7A 2GFQA 2ID8A 2P1RA 2CLIB 3FRJA 2OQ2A 1U1EA 4L5CA 4UMVA 4BBJA 1ZKMA 1I7SB 3GEIA 3PUZA 2AMLA 1QHXA 4RKEA 2MSEB 4BLRA 5JUWA 4NS4A 1EBBA 1EM8B 2ZT6A 4P33A 4RQBA 3T5CA 5I7RA 5CD1A 3U6KA 1U04A 3LX6A 1YAJA 4EARA 3L7YA 2GZSA 3O83A 1ISGA 3FWHA 4ZQFA 2YRFA 1NQUA 3ZDFA 4OSPA 4N7BA 1N9GA 1MAVA 1G7CA 1MB3A 3E03A 2YUTA 2BIFA 3MEQA 4BNYA 1M34B 4M8IA 4O2AA 2AEJA 3VBEA 4BTEA 3DT6A 3V7WA 3ZWPA 2XSZA 3ZNQA 2JA1A 3ITKA 3KAKA 4I9FA 1F51E 4IG9A 3ZEAA 4G26A 1BCRB 2VAVA 2NU9A 4G1UC 1FW8A 2FSHA 1MG5A 4GI3A 2EZ4A 1KYXA 2JI6A 3N7UA 4BEVA 3JR7A 1GHTA 2NUAA 4XFKA 5A4IS 2HMWA 4C22A 5J1TB 2FXIA 2ZI9A 1JKJA 3ADDA 1MX5A 3U9TA 5HIJA 5FUYA 1VA4A 1TD9A 4GP9A 4ALNA 3QE9Y 3NTLA 1BVRA 2R11A 2REBA 1KHHA 5TMDA 2Z4RA 3PXAA 5DBGA 1SOVA 4GX0A 1MEJA 4B80A 4K6HA 3DAFA 1HNXB 4Q9JA 1IUOA 3UKOA 1QG6A 4F6LA 1Z6AA 3Q9UA 4KR2A 2DULA 3P4UA 3UPTA 1A71A 5GZ6A 5EPUA 2J3EA 4L6IA 3WSTA 4U7HA 3FXAA 3LSTA 3MN1A 3T3EA 4NLLA 2FQQA 1GT91 2D5LA 3AEKA 4X41A 3FNIA 3RO7A 5BWBA 4KIFA 1GN9A 1AKUA 1JMVA 1LBEA 3WHIA 1KZ9A 4MTLA 1DP4A 1OI2A 1QJ4A 3KQSA 3SKXA 2VCHA 3VC1A 4EHFA 1JLRA 5C80A 2H29A 2WPDD 3AV3A 4RF4A 1J8FA 3EVFA 4NICA 3DVSX 3LCVB 4QGSA 3QTTA 4OM7A 3WB9A 3BS4A 2JFFA 3WMWA 4R2WA 3ZOZA 3BSYA 2EP5A 4G5QA 3HJFA 3LKVA 5DU2A 3LKBA 2BFMA 5LFAA 3W4KA 4OQFA 2PXAA 4XDZA 3R09A 4QYSA 2J3IA 1D04A 3GFOA 3KK0A 4YCSA 4XIIA 4DV7B 2G06A 1KZ4A 1YQDA 3DF9A 2VSFA 4IS3A 2PN1A 2QLFA 4C6HA 4EF4A 5BNTA 1RW4A 3H83A 1P4SA 2XUJA 4LOLA 3GT0A 4II7A 4YLGA 3A4IA 2PX8A 4DZTA 2M2IA 2HNAA 5AM5A 3CA8A 4PTZA 1KSHA 1ZCFA 3IVXA 2VP5A 5LWQA 4U9UA 3AVOA 4DLAA 2J0SA 2QSZA 1MCZA 2PGJA 4U7GA 4JJ4A 3EA5A 4COKA 1KEEA 3ZDRA 3MT9A 2JFYA 3NDJA 4AO8A 1A77A 2G1JA 3L43A 3MJRA 1Y5IA 1Q15A 1PWEA 1VJ5A 4WZAA 2PL3A 4OF4A 1MKYA 1DAPA 1PZGA 4WEQA 3N6VA 2MYPA 3G3EA 4HCJA 1KMIY 2B1QA 1KDTA 2XMZA 4JJZA 2ODWA 2B4RO 2OC4A 4ZZ3A 3ABIA 2EKBA 1KS9A 3V8BA 4PICA 3FFWA 2H1CA 1RWOA 4LF8B 3WK6A 1T3TA 2J9RA 1X80A 2ECKA 1L1QA 5EE3A 4ZXPA 4DMLA 4CTOA 1OT3A 2X58A 1V2GA 4KEAA 4HJXA 4F4DA 5AH0A 4MQFB 1YRAA 3AUAA 3OICA 3H5IA 3AB7A 2W7TA 4TL9A 3KSAC 4L75A 1RQRA 4C4ZA 4QXPA 4ARCA 1GY8A 1NYQA 3MSXA 2QQ0A 3Q3JB 4Q39A 2B99A 4INAA 2VTDA 4DANA 4GOMD 1M1NB 1XD2B 5DSZA 1ZUNA 2N1BA 3D81A 3BCRA 1P5HA 4PHGA 1E2JA 3BL6A 1OD6A 3ONNA 2ERYA 2PKWA 3JWIA 5ECGC 3FWKA 1R6XA 2I67A 2DVMA 2Y67A 3R7BA 2JIPA 3RYIB 4UULA 2CNOA 1QQ7A 3DTVB 4JASB 5LKRA 2JZOA 1LX6A 4ZVUA 2XDYA 3G8AA 5GINE 3IDOA 4CEIB 1WBBA 2JJ1D 2YFKA 5IBRA 1NVXQ 2JFUA 4DCJA 3H16A 1ZIDA 4BVLA 1NXWA 5CLHA 2BI7A 5CD9A 2LDXA 2XD4A 2NP7A 3UXYA 3FW1A 3MMZA 4BO1A 3ZLUA 3WL3A 3EGWA 2WUFA 2P2GA 3OWHA 4W8HA 1H8EA 2BFBA 4JVLA 5BSWA 5AM0A 4J7CA 3EZNA 1KOGA 1OGYA 4XM0A 1KJYA 4GQAA 4ZPJA 5JVDB 3OM1A 3PVSA 5G0TA 1PS9A 4YVFA 3WLRA 4IDOA 3Q87B 3OZIA 4TVSA 4WBSA 1UBNA 2FZKA 4ALLA 2E0IA 2J5XA 4EFDA 5JTTA 2J8ZA 4PVDA 2HU5A 2WAAA 2QZPA 4BIMA 1Q1EA 2GRJA 5KWSA 2R44A 1Z6QA 1QUEA 2WJAA 4BNJA 5LU8A 2JZCA 2Z43A 3ZHBA 4BVKA 4CM8B 2Z5LA 3KTAB 4ZO4A 1DV1A 1FFXB 4EGAA 4ES6A 1UWLA 2W2OA 3S8MA 1PR2A 1SVNA 1CHDA 1TLFA 4D0SA 3WGIA 3R7SA 5JAZA 1G3MA 5THXA 4CETA 2H2HA 4MW1A 1QONA 1VP9A 2CLMB 3E0QA 3EF0A 3IKVA 3K31A 4R3NA 3O95A 1NQ5A 1USKA 2CNKA 4IIHA 3VR4A 2YJ6A 1P4AA 2BJVA 3ZGXA 2MINB 3WBKA 2IIQA 4HWGA 2UVPB 4RYLA 2J07A 4S1TA 3IBCA 3VJRA 5HRAA 3U1VA 3I5AA 2C8KA 1XQWA 3DHWC 2VHUA 1W29A 4GBJA 1LLQA 3EUWA 3VOBA 2AQHA 2OFXA 3L7JA 5HJ2A 1KZYC 1V1MB 4KFRA 2RGGA 1ECGA 4KQXA 2P2SA 3THXB 3MFYA 2OBFA 2ZBDA 2OBBA 3W3AA 2IK8A 4FNGA 4BLOA 5HOEA 4A15A 3TECE 3CTMA 2V74B 4R98A 3BWDD 3BK7A 4B31A 3RHTA 4OG2A 3L77A 4RE6A 2A94A 5EESA 1R5NA 1U2GA 2WD8A 1FB5A 4IHJF 1TC1A 3KQPA 4OQEA 5EIOA 4BQFA 2HT6A 3AVTA 2WJGA 3VOAA 2ZRMA 4LZOA 3R0ZA 4DDMA 5EJ5A 1C9YA 2LDBA 3A4TA 4PX2A 4MW5A 3LPCA 1RLOA 4L73A 1X92A 1UBRS 4D9HA 4BQRA 3T9AA 4LVNA 1FFGA 2A9FA 5I01A 1A4IA 4PZZA 5EUCA 4KO1S 3RE1A 5HDBB 3G2KA 3TUZC 1B0AA 3E3NA 4I99A 4QE3A 1MAWA 4M3NA 3KR2A 3HCNA 4X7BA 2WYIA 1GZ3A 1QDUA 2HMYB 4NV0A 3WK5A 1RJEA 5H8WA 4IH1A 3SDZA 3DMTA 2FUKA 4NJEA 2J3JA 4B2IA 2LCFA 3ZHTA 3NAGA 3JQAD 3FSEA 1TD1A 4H7PA 4IH4A 3ED1A 3T8YA 4B0OA 2JIZA 1VHWA 2CJPA 3ZJTA 1V95A 2C9DA 3P1JA 5I8PA 2A0XA 5LXTA 2QF7A 4EJSC 3D4PA 4UD2A 1QORA 3KP1A 3WOHA 5BWLA 4H7EA 1PJAA 1HETA 2Z6AA 1G98A 1Y8CA 3GRYA 3PYLA 3SF0A 3WIUA 3NJRA 3DFMA 4S2UA 3QFTA 3PJRA 3JXEA 2AMFA 4FFBA 4PE5B 1YO6A 1E1QA 4OL0A 1JSZA 1UPAA 4BLVA 5KYXA 4I6GA 2C9OA 2CUZA 5KYUB 1JU3A 3DBIA 2CEAA 1FK8A 2V5UA 2CL0X 5EQTA 1UQTA 1OPXA 1NMYA 1YC2A 3OPQA 1IC6A 4TX1A 2V7GA 1T9CA 3UB2A 3A3NA 1QHHA 5ECWA 1CR0A 1T9GR 5ARDA 3VYWA 1DC3A 3RT1A 1CDOA 1QIMA 2VDLB 4F5ZA 1RLTA 3T7TA 1VC2A 2W6QA 4Q48A 1RRKA 4MMXB 4DABA 3WGHA 5EHXA 1IDOA 2QGNA 4FGUA 3M9XA 3HHPA 2ORYA 5DM70 1GGVA 1UFKA 5D5HA 1GU0A 1QF6A 1G1MA 2H9AA 4D97A 2K7FA 2RGNA 2UAGA 2Q6VA 3G2OA 2YASA 4Q00A 1MIOB 3IUNA 4JDPA 3VAAA 2NZUG 1P29A 3F3MA 4FJ2A 2J0VA 1N4AA 2JEOA 2KBFA 2QK4A 3LNTA 3MJDA 4G84A 1E32A 2HHCA 2QZ4A 1LDBA 3KU1A 1PNTA 4KGXA 5KBYA 2AFIA 3SY8A 2O3SA 5KTTA 4RTPA 1UBCA 4D1YA 4HNRA 1OLXB 4XYMA 3ROFA 4IIXA 4D8YA 1NW7A 2NLOA 1OC2A 1EFUA 2WU4A 1CZNA 1XTJA 3WLNA 3GJ4A 3RADC 1BH6A 5BXQC 4V0MA 3WNVA 5C8VA 1M1ZA 3RTGA 2HA2A 1LNSA 3OMLA 3GB9A 5CH5A 5EQDA 1T5SA 4DMMA 5HBGA 2QTVB 3GUCA 4Q3DA 1TIKA 4L0DA 3WLOA 4BIIA 3JVDA 4E30A 1SCAA 2BM1A 4XLZA 5TQ0B 3NT4A 3IAM1 4I50F 1S7GA 4GYYA 2WMOB 3N2LA 3S29A 1DKPA 4MUBA 1XDUA 1FOEB 4NL4H 2PH5A 5AKGA 3WLSA 2J08A 4EX6A 5FOQA 2W42A 3UFXB 3VBCA 3DTNA 3VUEA 1JG6A 1XKQA 3UCFA 4PSVA 3FCXA 2A0UA 3F49S 3NG1A 3R6DA 5EMHA 3TSOA 1SKMA 1V3VA 3T3HA 2V3WA 3UV3A 3V1LA 2Y92A 3UVEA 2J0QA 4V0QA 4WNAB 3AHIA 3MRTA 4YAFA 1JIUA 2V6IA 4PU0A 2O7RA 3PUYA 1PX0A 3FB4A 3GFSA 3QOXA 4H0FA 4H17A 3ZGNA 4MDYA 3CB2A 2QDXA 1ZR4A 3LDHA 4MXDA 4YCJA 5DBOA 4NV3A 421PA 1EUDA 1PLKA 2FY8A 2V5VA 3E53A 3TMKA 3UZUA 1V3UA 3WR5A 4YP0A 5C5CA 5BOSA 1OASA 3LPNA 5JXGA 5LL6P 1LJ8A 1P73A 1N6RA 3P96A 2W6MA 3KDAA 3A4VA 3M1AA 5ALPA 4OA8A 1S8FA 3OM8A 2DWUA 1G3IA 3K32A 5LYJA 3NEAA 5KJCA 1YKSA 1NJ8A 4RKFA 3RKSA 3MHTA 5EY5B 5DCWA 3C3PA 5JC1A 1J2JA 4I08A 3OCCA 2WRZA 1RHKA 1DUVG 5LQKA 4AP5A 1FSSA 2HV9A 3WLIA 3GGSA 2NU6B 1LKZA 1RXSA 4Y18A 2QRPA 4JROA 2IW3A 1UJMA 2ZUEA 3L01A 1JYFA 4QAQA 1TF7A 1Z0AA 3VR6A 3PUKA 3NYIA 5TEVA 3RF6A 1LVUA 1Q0PA 1HH4A 1XEFA 2ZAOA 3EUEA 3LCUA 3QYJA 4KACA 4KFTA 4MV3A 4WKPA 3ODPA 5JZOA 4WESA 2FETA 3E1SA 2ZJYA 3RHFA 3L4EA 1Z4MA 3IODA 4COOA 4RKYA 4ZRNA 3OURA 3QKRA 1YS9A 4IXTA 4BU1A 4JIGA 3RAJA 3T41A 4YT4A 1ZMRA 5L3ZA 1KE1A 5EQFA 3BOSA 3FWNA 3PIIA 3ETEA 3DQPA 1DVRA 2GVDC 1UXKA 3KG2A 2Z2KA 3IEVA 5EGSA 2Z4TA 3FH0A 5AYVA 5CMLA 3CG0A 5A6VA 2DH5A 3G1TA 2NTEA 2ANBA 2GAAA 5K6AC 1O58A 5LUAA 2ECOA 3MYRA 4FP9A 3KD3A 1NZDA 4N5DA 4P2GA 5WRFA 1TMKA 2IUUA 1CU1A 1QLWA 1SCUA 5BW8A 5KU7A 5ALFA 3MW8A 2ZXUA 1DAKA 3VPAA 3M5PA 4YN3A 1ODCA 2DHEA 3ORRA 1Y8QA 1JPVA 4JGIA 1CQJA 1UPFA 5L53A 1ADCA 3VKWA 3H2SA 4JD5A 5I3CA 1O57A 4OBXA 2FX5A 5DXFA 1JVSA 1OFIA 4YQZA 4FYJA 3RIYA 4YUXA 2ZE8A 4QA9A 4YCBA 4WK6A 1G0NA 4JWKA 2VBFA 5TGZA 4R7ZA 3IR7A 1U0NA 3KUCA 4IHJA 4BQPA 1TM3E 4NE7A 2Z08A 5FP0A 4B0PA 2YZNA 4PQRA 2P5SA 3COYA 4RJIA 4WLOA 1T6XA 4W6QA 4UTXA 4JY7A 1RHMA 4QRIA 4C0WA 1PP4A 5KYGA 3KZOA 4FYIA 2OO5A 4Q93A 1ZXBA 3ESCA 1IULA 4C01A 4M49A 5IBQA 3RRBA 3VYUB 5INTA 1RIFA 3Q5GA 4DXDA 2ZTSA 4NWIA 3QLVC 1FTGA 5M7EA 4RW0A 3G6WA 4P5EA 1EAYA 4NCHA 3ORHA 3AUTA 5GVRA 5LZ2A 4HF7A 3B1ZA 1M6NA 5DM1A 3MVEA 3SJCA 1QQTA 1QGYA 5F5LA 3BCUA 1QQAA 4FHGA 3K2IA 4FW8A 5C35A 3MRSA 4LZNA 2WYVA 3PF8A 3ZHXA 2A1UB 2GJKA 5ITZA 4HQKA 1EG7A 3CZCA 3SQNA 5ALZA 3U9SA 4HO1X 4RY2A 3QEOA 1XRRA 1Y7LA 3T5BA 2GCPA 3V8MA 4O2RA 4B4OA 4YDRA 5KDDA 4YDHB 1YCFA 3EXIA 2X40A 4KIWA 2G9VA 2K6GA 2G77B 3TAHA 1L7OA 1RI1A 2X9NA 2A3RA 3EVBA 3WRXA 4ZGGA 1TTTA 2IBTA 2VFAA 3H19A 3HXOA 1N7HA 4XPIB 1IM2A 3LBHA 2XB9A 5DM0A 3TFQA 5AKZA 4D74A 5A4FS 1RBMA 4ENWA 1WB9A 1JDPA 5B58T 1C0LA 3EH2A 3HJCA 1Z5NA 2P6OA 2OLKA 4OKIA 1KFJB 2FUEA 3C15C 2Q41A 3H5RA 2PMWB 2C58A 3RHZA 3ADPA 3KDSE 3KUUA 1T34A 1RC0A 3W6ZA 4KB5A 2JIOA 5KMGB 3IP8A 4WK0B 1Z73A 4U1RA 4BRWA 4EG6A 2YOHA 2GRAA 1B6TA 1RMQA 2DWQA 1RAFA 2FUG6 2QV0A 4B7CA 1UAAA 3AFGA 1Q0HA 2R9VA 4URHA 1UT8A 2W4IA 3LVBA 3MJSA 4LY6A 4NCXA 1OY1A 1TFUA 2HV8A 3ZW9A 3PQ8A 4UJ5A 4TYWA 1JQBA 2Q9UA 2Q5QA 2Z58A 3REFA 3QOYA 4HDNB 6PFKA 3OC6A 4LZZA 3WVNA 1RABA 4PC6A 1LV8A 2DTEA 5LP6A 4ZHQB 3PEWA 2ZE7A 1YK1A 3ORFA 2Q7XA 4KQEA 2MSDB 5C5DA 2AJLI 2GPYA 1YNSA 1XQ1A 2JKYA 3K0EA 4B3XA 2DFVA 4CTKA 1THMA 2QIOA 2XLBA 4X6LA 3Q8MA 2FMUA 1E99A 1MXHA 3D4IA 3ZG6A 4AKEA 1UOPA 1A8PA 4JAVC 4L72A 5CJ2A 4PXAA 1R3UA 4Q3LA 3P4XA 1GOTA 1SK9A 3M6IA 1ZEJA 4CDGA 3LBAA 1E3WA 3E82A 5EKTA 3S2IA 4B4DA 2FSPA 1MABA 1E79D 4PQFA 1QH9A 121PA 2PUAA 1VFPA 3PEFA 2X41A 2YN0A 3T1VA 5LOVB 2G9ZA 1KSFX 3HA2A 3OF2A 2B7LA 2H7YA 5I7FA 4QGHA 5TR9A 2IH5A 2R4QA 3CUVA 3GMSA 3W79A 1G7RA 4PIVA 4QOGA 3JQ7A 1ULZA 1DHTA 4YRNA 4IXWA 2ETVA 4Q3BA 2O2YA 2OGUA 3GP5A 4I0WB 2NXJA 1ZC4A 3FTDA 4TYPA 4QU9A 1X7XA 3PB3A 3ZTTA 3GJXC 2C5AA 5CG2A 4PF1A 1Z26A 5F1KA 4WBNA 2HCTA 4YV0A 4ZGBA 1OJLA 4YCAA 1YJBA 3ICCA 1II8A 3K0AB 4N3BA 3G5MA 5FOWA 3K2EA 4WADA 1F17A 3G2NA 3VU8A 4TV8F 1NAIA 2BGJA 5FYQA 3ZGOA 2VJAA 2R8BA 3RJMA 2I65A 1UM9B 1WUJS 3BUSA 4JQZA 3N59A 1H94A 1XJQA 1R8QA 2CXUA 3Q4GA 1CEEA 4PM4A 4H7HA 4LYEA 1RM4A 3C3XA 2Y1CA 2XUAA 4LHEA 4OGLA 4NEHB 1DIOB 2WE8A 1OBCA 3NDIA 3T7IA 3V1MA 3NVDA 4R5MA 4ZT2A 2EFYA 5JH7B 3BAZA 3OIFA 2XEXA 4F9TA 2R2AA 3TR0A 3UMYA 3FM9A 1G60A 1L7EA 2ZK7A 1J39A 2Q45A 3OU2A 1M2WA 5FD8A 3HXQA 3UWSA 2X76A 2G8LA 4QFBA 4HDRA 3DT8A 2W6JD 4ON9A 5ALMA 4P3KA 2VDNB 1OMOA 3N86A 4ZYTA 1TPYA 2C20A 2OC9A 4XEHA 5CH3A 5F77A 3V1YA 2CDAA 2OXTA 3WO1A 5JCOA 3WYFA 1JAYA 2NO1A 5A05A 5KQSA 1ST3A 1QGUA 2O7VA 1F2TA 3H5OA 4A5SA 3A1FA 1GPAA 2OCKA 1XTQA 3P0HA 3SS7X 3FMPB 1G21E 1EFDN 4LGVA 2A1IA 4MQEB 5CPBA 3U7EB 3V1UA 1ID8A 3BQ9A 3TQSA 4IYJA 4QJBA 1Z2EA 2J45A 5HZHA 2Q3LA 3OIYA 1NXTA 2HDNB 2PZBA 3OEHD 1N1DA 1E1YA 3UJHA 2CCKA 4KI7A 2YXLA 3GVCA 4C0AC 3KSUA 1TZJA 1KXJA 1S7CA 2DQSA 4DJEC 2NTNA 1N5IA 1P9RA 4ZODA 3UJNA 4BVFA 1YZGA 1DJLA 2DPGA 4RJ2A 3TIXB 2FWBA 3OAAD 3FLMA 4EY6A 1RWMA 3H2KA 5E0KB 1COWD 4FI3F 4G8BA 3ZDEA 2YX1A 5T8KA 2I6XA 4LOAA 5CXQA 4Q01A 1WUHS 4NFSA 2VPXA 1NOJA 3SS8A 1GUAA 1KP3A 3RFFA 4U7DA 2OV2A 1ULAA 4DF3A 4QBHA 3A06A 2AG6A 1YTLA 3U60B 1AKVA 3FSGA 3FTPA 2C8JA 3RG8A 2HBQA 1JFFB 1L7AA 1T3HA 3F46A 4N3AA 3AR3A 3BE5A 3CBQA 2F8SA 1W73A 3CY6A 3G0HA 3CXRA 2DHRA 2RHWA 1J99A 3Q98A 4OBBA 2AN9A 4E2WA 4DMFA 4LFAB 1G8KA 2ZIUB 1VB5A 3OY7A 3PEEA 4I66A 3A3KA 2Y4OA 3MGKA 4A27A 3KVYA 4AUEA 1MQ9A 1P5RA 4GBMA 4J0KA 5GJCA 1SXJE 1N3BA 1HEIA 1TCBA 4FS3A 3RS9A 2ENUA 5FPSA 5A71A 1OZHA 5AVJA 2HQSA 5JU6A 4KWTA 2Y1KA 2YZ7A 2DFDA 3HQ4O 4EHDA 4OJTA 4CKWB 2V6MA 1RYNA 5DGIA 1CR4A 3ZE2B 4BECA 4QSHA 2D6FA 4WINA 1HOXA 4HQLA 4J0GA 4RH3A 3RVSA 1VJ0A 3A3YA 3IV7A 3PEVA 4J0JA 4TQUS 1CYDA 4P92A 4RA6A 4X62B 3ZXYA 1VL8A 2GI4A 5THQA 3F6CA 5KJ1A 2J6IA 1X39A 1RFGE 1UDRA 2IYEA 3NPAA 1V48A 3HZRA 5E6UB 3HUTA 1A69A 3EFOA 5ICFA 5JSZA 3ICPA 1R6UA 2B5WA 4CEIA 3VPHA 1KDOA 5I3ZA 3CFYA 4IUDS 3FZNA