5K0JA

Crystal structure of comt in complex with 5-[5-[1-(4-methoxyphenyl)cyclopropyl]-1h-pyrazol-3-yl]-2,4-dimethyl-1,3-thiazole
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
220
structure length
220
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 79
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k0jA00
3ER9A 5LQJA 3PFGA 2HR1A 1RJDA 3GRZA 3NVMB 4AUKA 3PLAE 3KPVA 3TOSA 4BP3A 1G38A 4MQ4A 3UZUA 1D2GA 4QDJA 5EZSA 5FA5A 2OYRA 3JWHA 3THRA 2BZGA 4DA4A 4U7PB 5F2KA 5GOZA 3DMHA 3DUWA 3NWBA 3OFKA 3PVCA 3IYLW 1TW3A 2P7IA 2P3LA 5DM0A 5EQJB 3E05A 5CVUA 5CVJA 3K6RA 5DRYA 3E23A 3D2LA 2Y1WA 5DPMA 3R9XB 8MHTA 3RODA 5HIIA 4FR0A 1MJFA 1XDSA 2FK7A 3MGGA 1B42A 3OU6A 3UFBA 5DWQA 3TM5A 4YV0A 4RTSA 1JG3A 5E9JA 3JWIA 1DL5A 2UYCA 4CWAA 1WS6A 3KQSA 1YZHA 1P1BA 2ZBPA 2ZZKA 4E33A 2FHPA 3CVOA 2NXJA 5E2BA 5EMLA 2IFTA 3LDGA 2G1PA 3FYCA 2E5WA 2IDJA 4CKEA 4OA8A 5LQRA 1DUSA 5M5BA 1EG2A 5GWXA 5K0NA 1P1CA 2NP7A 1ZKDA 5DTMA 3O31A 4DMGA 4CKCA 5H02A 4Y2HA 2ZSUA 3EMDA 2G71A 3G5LA 4DF3A 3MB5A 3P2KA 4KDRA 2AZTA 3V8VA 4DCMA 2ADMA 3F4KA 4RTRA 1U2ZA 2PX4A 2P3OA 4GBED 5F2OA 1ZQ9A 1V39A 3BUSA 4CXMA 5E1MA 3E8SA 2V7EA 1I1NA 1X1CA 3ELWA 3QOWA 4CTJA 1HMYA 3LDFA 4P7KA 4GOND 3G2MA 2OY0A 1RI4A 1XCLA 2CWWA 2P1DA 3LBFA 3ORHA 1JSZA 3DR5A 2OZVA 3VC2A 1R00A 1G60A 1QANA 4U7TB 1N7IA 1NT2A 4ATNA 5KQSA 2C7PA 2I62A 2VDWA 3R6TA 3IV6A 1SKMA 3UJ8A 1NW8A 2OB1A 2OXTA 4CKBA 3NDIA 4PYJA 1QYRA 1XJ5A 3B3FA 3DLCA 2YVLA 3KQOA 3CBGA 3B3JA 3NW9A 5E2AA 2B9EA 4YUXA 4B17A 2PT6A 4YV1A 2QY6A 4FT4A 2G72A 4YUWA 3EEYA 2YR0A 3EGVA 2Z6AA 3ANXA 2UYHA 5B1SA 3P2EA 4RV9A 3M4XA 2OBFA 3I5UA 4GOLD 5DLYA 4E70A 1L9KA 2P41A 2H11A 3AWIA 1QAMA 2PXCA 1NE2A 3ELDA 3P71T 3DXYA 3HTXA 5HIKA 1WZNA 2BR3A 4X63A 1JQEA 3LCCA 4LG1A 4ER6A 5K0JA 2AVDA 1KR5A 5JR3A 1WXXA 2VZ9A 5ICCA 4RTPA 3GNLA 5E9WA 5EMMA 5DSTA 1F3LA 3HVIA 4AZVA 3LHDA 5HILA 5K05A 5LQUA 3KQWA 3C6KA 3Q87B 1KPGA 5FTWA 4PYIA 5ICFA 1RJFA 1AQJA 2P35A 3GWZA 3NJRA 3GXOA 3UA3A 3MQ2A 4C03A 3GJYA 3EVAA 3KQPA 1KYWA 1UIRA 3PB3A 4P7FA 5EHIA 3EPPA 4YMGA 4QVKA 4F85A 1PJZA 5E8JA 2HTEA 2GH1A 2XVMA 3BWCA 3FPGA 1QAQA 3KQMA 3KQYA 5DM4A 1EIZA 3I64A 5CD1A 3G2OA 2JG3A 1ORIA 2CMHA 1SUSA 1RI2A 1EJ6A 4Z2YA 3G5TA 4EQZA 2N47A 2G70A 2PXAA 2G8NA 2ZLBA 1N7JA 2YXDA 2YXLA 3LBYA 3HA5A 1R8YA 2GAFA 4PCLA 4RVFA 4QPPA 4RX1A 3UJBA 2ZZNA 2NXCA 3QV2A 1SG9A 5FCDA 3HVHA 5HZMA 5KVAA 4ER0A 4FSDA 1ZG3A 4E2XA 2GS9A 1SVUA 2VS1A 3LSTA 1AF7A 2ZBRA 2PXXA 1ZHFA 5CVDA 3P97A 2NP6A 3MAGA 3VC1A 4F84A 2GPYA 3CC8A 4IKPA 3I53A 4PYOA 4WVLA 4DKJA 4QQNA 1P39A 1G8SA 2OB2A 3B7PA 2YXEA 3GCZA 2FYTA 3BWMA 5EMKA 5FA8A 3UJ9A 5GP1A 3PX2A 3KQTA 2PWYA 3OU2A 4RWZA 4AX8A 4YUZA 1O9HA 4PYLA 4C08A 4M36A 5EC8A 3KQQA 2AN4A 1X1DA 3EVDA 5DM1A 5DTRA 2QYOA 2ONZA 4OX9Y 3X0DA 4K6MA 5EEHA 3UJ6A 3L8DA 2IDKA 5D1HA 3HCEA 3R0QA 5EVJA 4V0RA 4ER5A 3BGDA 5BXYA 5K09A 4C04A 1YFJA 2IH2A 2QM3A 2YTZA 3M6WA 4FSXA 3UJCA 4A6EA 5K8VA 2IH5A 3KR9A 3C3PA 3G2PA 3G2QA 4X60A 4OBXA 2ERCA 5EEGA 4IV0A 1JTFA 2PX8A 2R6ZA 3MERA 4HSGA 2K4MA 1JTEA 4GUAA 4PCAA 4V0QA 3MTEA 4DQ0A 2KW5A 3ID6C 1VE3A 2P7HA 3O7WA 3HCCA 5HOQA 3HCAA 3C3YA 3H2BA 3CGGA 3DULA 3EVBA 4MHTA 3FTFA 5ICEA 3FTDA 1EJ0A 3A7DA 3RW9A 2VDVE 4XUEA 2BR5A 2R3SA 3GRVA 3TM4A 1BC5A 1WG8A 1BHJA 5CCBA 10MHA 2NYUA 2ZIGA 3SGLA 1F38A 3UBTA 3TKAA 3LGAA 3A25A 3EVGA 3G89A 4FGZA 2UZ4A 2BM8A 2FCAA 3R3HA 3A7EA 5DX1A 1X19A 9MHTA 4GOOD 3QOXA 1EAMA 4EMSA 3FPHA 3KPYA 3P8ZA 5K0EA 5EIFA 2UYOA 5DT2A 5K0BA 3TFWA 2JHPA 3IHTA 2XYQA 3FTCA 3TPZA 5FQOA 4PIMA 3U81A 1JQ3A 5GIOE 4RVDA 4QPNA 1NW3A 4KIFA 4EKGA 1JG1A 1YUBA 4HTFB 4PWYA 4HG2A 3GU3A 2CMGA 4WXHA 1YF3A 5K0CA 3EMBA 4EKIA 1L1EA 4XUCA 3Q7EA 2QRVA 1IM8A 2NNWB 1RI1A 1O54A 1JSXA 2UYQA 3CJRA 1L3CA 4KWCA 5DM2A 2ZW9A 2XVAA 5LQKA 2YUIA 3UJ7A 5LR6A 2PGXA 3HA3A 3OPNA 1SQGA 5C9ZA 1H1DA 3EVZA 1I9GA 3GRUA 4RTLA 2O0LA 1XDZA 4M7RA 3NMUF 5EZQA 2BH2A 5EKXA 1T43A 4EK9A 5KS2A 5GM1A 4YUYA 5JUWA 3O4FA 4X61A 4C4AA 1RJEA 3HCDA 4LWOA 1MHTA 4RTOA 5E8RA 3KPUA 2VP3A 4POOA 1VIDA 2XYVA 3B3GA 5CCXA 3FUWA 4ISCA 3VYWA 2EG5A 5K01A 1SUIA 2AN5A 3SXJA 3T0IA 1FP2A 3M6UA 2FPOA 5CM2Z 1HNNA 5DSXA 2NXEA 3KR2A 1ZGJA 5DTQA 2O07A 2PLWA 3G8AA 4KRGA 3P9KA 4GQBA 7MHTA 3OZTA 3HP7A 2CL5A 1VPTA 3B89A 2PBFA 4YV2A 1L3BA 4R6XA 1N2XA 2BM9A 4RYLA 3GGDA 5IH3A 3R24A 1TW2A 1XTPA 3SX0A 3BZBA 3UJDA 4KDCA 3FUXA 4DZRA 3T7SA 2QRVB 4PIPA 2AN3A 3KR0A 3KPWA 2C7RA 5HEKA 3UA4A 4PGGA 1Y8CA 2AOTA 3B5IA 3GRRA 4KW7A 2PT9A 3T7RA 3WSTA 1FBNA 3HVKA 4DM3A 3PTAA 3AY0A 2LD4A 2PX5A 4M37A 3HM2A 2PVCA 2EFJA 4E2WA 4GC5A 4BLUA 3KPJA 3AJDA 4HC4A 4IWNA 2XYRA 3SSMA 1UFKA 2ZTHA 4A6DA 1R74A 2WK1A 4X41A 4M38A 3OZRA 4GOMD 3BWBA 5EKUA 2HNKA 2JHCA 5GM2A 3TKYA 4RTNA 1KYZA 5FQNA 3SR4A 3DTNA 3HNRA 4QVGA 4YMHA 2PKWA 3ELYA 5EG5A 4L7VA 3P2IA 4NECA 2P40A 1D2HA 2ONYA 2I6GA 3DOUA 4QTTB 2B3TA 3SSOA 4AZTA 5LQCA 3G7UA 1VLMA 3BWYA 4MTLA 3LKDA 1P91A 3CCFA 4AZSA 5U4XA 4G56A 2H1RA 2FK8A 5K0LA 5KYGA 2H00A 3K0BA 1NW6A 5CIYA 2ZFUA 2F8LA 3GDHA 2AOTB 4QQKA 2O57A 4OBWA 5EPEA 5HIJA 4BLWA 2NXNA 1XDUA 2O06A 3LPMA 4HH4A 3KU1A 2YX1A 2XBMA 1Q0SA 1YB2A 4H0NA 2DPMA 5GIPE 5LSAA 1KXZA 4GC9A 2HMYB 3HCFA 3OE5A 1G6Q1 2ZVJA 5BW5A 5DX8A 1VBFA 4FS8A 1ORHA 1JG2A 3LKZA 2P3QA 1BOOA 4P58A 4HTFA 3BXOA 3OZSA 2HV9A 5EHGA 4E32A 2JJQA 4RTMA 3LECA 4Y30A 3MCZA 4OA5A 5D1NA 4BY9E 3A4TA 3I9FA 3NDJA 1NW7A 2ZWVA 5FWDA 3EVEA 3MTIA 4R8SA 4DCGA 5FWAA 3KR1A 3FRIA 3MHTA 1FP1D 2AOXA 5CUQA 3DH0A 1I4WA 2I7CA 3FZGA 2ZWAA 3MCTA 4ZTBA 2ZIEA 5GINE 5T64A 4HGYA 4PONA 4MIKA 3CKKA 3M6VA 1SQFA 2WA2A 3CJQA 2EJUA 1X1AA 2PSSA 3OFJA 5LQNA 5MHTA 2ORED 3ELUA 4QTUB 5FADA 2ZCJA 1IY9A 1KPIA 1X1BA 2ZIFA 3M6XA 3OE4A 3SM3A 1KIAA 1NBIA 4C06A 2PX2A 3G8BA 1IXKA 3HCBA 3P9NA 4OQDA 3ME5A 5K0FA 4GEKA 4HGZA 5T67A 2IIPA 3KQVA 2ZBQA 2BR4A 4P7JA 4AZWA 4PNEA 3KHKA 3FRHA 1Q0TA 2AVNA 4X1OA 4F86A 3GIWA 1R8XA 5FUBA 4RTJA 1KP9A 4P7GA 4RVHA 3JWJA 1PRYA 2IBTA 3OCJA 3PT9A 3SVZA 3THSA 4BP1A 3LDUA 2AOWA 3PFHA 3UJAA 5E1OA 2Y1XA 5LQAA 1QZZA 3NVKI 2P8JA 1NKVA 4RSRA 5HFJA 1G8AA 4E31A 2B78A 5EMJA 4FZVA 1G55A 3FPFA 3GRYA 3P9CA 4IV8A 1ZGAA 2B2CA 4JXJA 1M0EA 1NV9A 1RI3A 3EEOA 2I9KA 2JH8A 2V74B 3HVJA 3V97A 1L3IA 2PJDA 3EGIA 4KIGA 2B25A 2AOUA 5KQRA 3ER8A 2PV0A 3C6MA 3FUTA 4OQEA 4C07A 2AOVA 5IKMA 2WA1A 2VDUE 3A27A 5DRTA 3PX3A 5E9QA 5EGSA 3GO4A 2JHAA 2GB4A 4QDKA 4R6WA 5ERGB 1NV8A 4C05A 5E1BA 3BKWA 3BKXA 1JQDA 1FPQA 5FHRA 1VP9A 3IEIA 4LECA 2YQZA 3G88A 3NWEA 3LCUA 3FPEA 4UOEA 1QAOA 3DMFA 4MWZA 3EVFA 1RJGA 2EX4A 2Q41A 3LL7A 3RIEA 2O05A 4E2YA 2OO3A 3UWPA 3HEMA 2OKCA 1JG4A 4E2ZA 1AV6A 3SSNA 4RTKA 2ESRA 3TMAA 5DXJA 3FUVA 5P8WA 5C0OE 2AR0A 4YUVA 1RI5A 3FPJA 5K03A 1UWVA 2ZULA 3TLJA 2FRXA 2IH4A 5DXAA 2AS0A 4PGHA 5ICGA 2HWKA 2EJTA 3LCVB 3ERCA 1D2CA 4FT2A 1AQIA 4PYNA 1WXWA 1VL5A 1TPYA 3P9IA 3SMQA 5K0GA 2Z6UA 3PS9A 2AOUB 3TQSA 1DCTA 4HRAA 1EQAA 5C1IA 1WY7A 4CTKA 3DXZA 2GA9A 3AXTA 3FTEA 1VQ1A 3TRKA 1KPHA 1O9GA 3TR6A 3BGVA 1XVAA 3EVCA 3LX6A 3E7PA 3M33A 2IBSA 4XUDA 4LWPA 1NW5A 2CKDA 1M6EX 1FJXA 4KVZA 3DXXA 2PWPA 3KKZA 4FP9A 4GF5A 5EIWA 4E30A 3S68A 2A14A 3HA7A 4PYKA 1BKYA 2IP2A 4RVGA 3DLIA 1YZ3A 5CVEA 5FHQA 4RTQA 5BW4A 5DX0A 2IGTA 3FYDA 1INLA 3DP7A 5T6BA 3REOA 2JH9A 1Z3CA 4PYQA 4R05A 4R8RA 3T7TA 4BLVA 4ER7A 5FULA 4XCXA 4EVIA 2Z6QA 3M70A 3BT7A 1OR8A 3BGIA 2C7OA 5E1DA 1R18A 1NBHA 3EGEA 5F2NA 1M6YA 2DULA 2QE6A 3VSEA 2IPXA 2OPBA 5HIMA 3JWGA 3A26A 3DMGA 1JR4A 3FUUA 5BP7A 4O29A 2ZZMA 1XCJA 4PINA 3CJTA 5G02A 3AXSA 4PYMA 1R6AA 1VP3A 3I58A 5CVVA 2C7QA 2PY6A 3C0KA 3OU7A 2GLUA 5EOVA 1YFLA 1XXLA 4ER3A 1KHHA 3NTVA
chains in the Genus database with same CATH superfamily
2HR1A 3GRZA 1GL7A 1ODJA 3PLAE 5E6SA 1XBTA 1IRIA 1D2GA 1C2TA 4M1TA 4TZKA 4AMYA 1ZNZA 2HBQA 2ZJ4A 4KAAA 3T41A 1JG6A 2D1TA 3IE0A 3NWBA 1DJNA 3WDMA 3IP1A 4XXHA 1ZESA 5JFOA 1KMCA 2CY0A 4BFVA 5CVJA 2HW8A 1NIJA 1C9DB 3DVAB 3Q1LA 4UM7A 2H1SA 2X6QA 4KEAA 4FHEA 5BQFA 4J6EA 1IUKA 2XDAA 2CZGA 1ZC3A 1VOTA 3LRXA 4JJ6A 3LXRA 3VNRA 4F21A 1WP4A 4YV0A 5CYFA 3RABA 2R0QC 2RJOA 1F2UB 1W2HA 1E2BA 4J7CA 4ND6A 3M89A 4TKVB 5AVRA 2QRQA 3KS9A 1PQUA 1H2YA 1RXCA 2YWJA 4L6CA 1DFIA 2DBRA 3ZGLA 4HDSB 3O31A 1XZKA 1T3TA 3VC3A 2HK6A 1WLYA 1E8DA 2R62A 4UFPA 5BORA 5FJIA 3DHEA 5IM4F 3K8YA 2WWYA 2Y0CA 3LGSA 1P4SA 1FRNA 5EESA 1HE4A 3H0EA 4R40A 2BFDB 4YJKA 2V59A 1OXMA 1KZYC 2D7CA 2P3OA 4JLWA 1ZQ9A 4L2IB 5F2OA 5TEWA 4A92A 1XTUA 3LWZA 4PGAA 3UANA 3O3NB 1R5BA 5KHOC 3DE6X 1DQYA 1W0CA 1N25A 4RH0A 4ENSA 3KB8A 3DZ8A 3GLHB 2Q0SA 2XDWA 4PYRA 3SQDA 2I76A 2B0JA 1NT2A 4M3NA 3GUZA 2CNWA 1B00A 2BLLA 3ND5A 4HQNA 4TV8F 3B6ZA 2HDNB 4WXPA 3O8CA 2EBUA 3IX7A 4PYJA 4DDVA 3ZU3A 3RAEC 4JJKA 4MR7A 4Z49A 3CBGA 3C45A 1WPQA 3OTWA 3B3JA 2JLXA 3KU4A 2HIHA 3HJUA 2D7JA 1VPLA 4PPGA 5DNCA 1YR3A 2BBOA 3L7YA 4C0JA 1E6KA 4LZNA 4J0GA 4B7CA 3EGVA 3EFOA 4DLWA 5KVCA 4IQ8A 1ABEA 3IXQA 3EF3A 3O2QB 4ZOAA 4PHTA 3MXOA 1LSSA 4LK2A 1IN8A 1L9KA 2Q7XA 1KJZA 1CF4A 1JFRA 3Q7QA 4L5IA 3IAM1 3IERA 3AHFA 2OFFA 1UJ2A 3FSJX 3LLSA 1LRKA 3INNA 2B8TA 2VZ9A 4D6XA 1DBQA 1ZK0A 1DFGA 1AH2A 4LMAA 1R8QA 4KUEA 4ON9A 1JEAA 2CYAA 2AMVA 1KDTA 1ZCZA 3OQPA 4Z5XA 3PITA 5AI8A 5ICFA 1RJFA 2E87A 4IDQA 2IPMA 1W76A 1GILA 1RYFA 1GUAA 1OLOA 1D6MA 5JPIA 3A3KA 2WJAA 5FPHA 5LC1A 5C5DA 9LDBA 1J7KA 1PJZA 1FU8A 1X7DA 2G9UA 2JANA 2WSYB 4FILA 5FYQA 3TVDA 1SU4A 3GVPA 2GCPA 3R3ZA 1PJ3A 2D3WA 2PA0A 4WCFA 2CMDA 1SUSA 2XPCA 5KAPA 3DLTA 3G5TA 1Q17A 2ZRNA 1LDBA 2ZLBA 2ZRHA 3O9VA 3TSOA 5CFQA 3K0KA 3CNOA 1N7JA 1OFIA 3LBYA 1SCUB 3HA5A 3LFTA 3G79A 4OL0A 3TN7A 4JLKA 1UZNA 3K30A 5FFNA 5FPQA 5ICMA 3SY8A 2FSIA 4QOSA 3UUGA 5K2OA 4RHEA 2XUHA 1O6ZA 1W9HA 1H22A 5DIZA 1APBA 2BGJA 5JDCA 4RK7A 4RH1A 4JI7B 1ZHFA 4R7ZA 4EGQA 1JWBB 1A88A 4DQVA 2HPVA 4Q9AA 3ZGNA 2B37A 3E1KA 2IXDA 2R47A 1UKYA 3C24A 4X8HA 2NUTA 4DKJA 3H1TA 5IMSA 4B7AA 1G8SA 1QO0D 4EPVA 1FDWA 2WZBA 3BWMA 2FMIA 5TGZA 1YONA 2QX4A 1QWOA 2X1LA 4ARZB 3KQTA 3SC3A 3UQYS 4J76A 3IP8A 5C1BA 4DFDA 1NVFA 1FK8A 1PJLA 4BFWA 5LZ8A 1YJ8A 3EW7A 2HBYA 3EA5A 4HZUA 1QHEA 3TQCA 1VG9B 2BBSA 4LRUA 5DTRA 5DM1A 5JU6A 3UMYA 1IQ0A 4L27A 4MVJE 4QOGA 2VWHA 4RIGA 1AHNA 3W90A 2IDKA 3ASZA 3RSHA 5AW0A 4TLDA 1JJVA 5ALEA 2WEKA 2IPNA 2B1JA 2SECE 1XMPA 2OV6A 5LOVB 1U3VA 5AUQA 5J3JA 2WSBA 3IUBA 4OVKA 1ZL0A 5CMLA 4CLEA 3BGOS 3Q9LA 3VZPA 1FNMA 1TLTA 3WFZA 3F7NA 1FLNA 4IP0A 4MVXA 4DDTA 3EARA 3UK0A 3BSFA 3PF9A 5FORA 3P0FA 1MO4A 1ZIYA 2Q9AA 3IAXA 2J3EA 3QM1A 2OG1A 2OZPA 1P5RA 3GBSA 1YR6A 4LOJA 3HO1A 3PEUA 2ZRQA 4LNUB 1N5MA 1TF5A 1SFRA 1EJ0A 1ZINA 2RAVA 5DCYA 3KEMA 1BKDR 1CQJB 4Q9LA 1VHDA 3NVDA 4K0KB 3FCOA 1OYWA 5JJ5A 2H9IA 2ZIGA 1HSOA 3HBLA 4M9CA 3Q4GA 5JMPA 5DO9A 4BZPA 2UZ4A 1VLJA 3RFTA 4A6PA 3IH5A 3FYUC 5BOSA 5J2UB 1PQ4A 1FFXA 3PLNA 2GZAA 3QA3E 1ZM9A 4UMFA 5EIFA 4XX1A 2BP7B 2WMOB 5I7EA 1N7GA 2VF8A 3LHKA 3JD4A 5ITSA 2OA0A 3RHTA 3R8FA 3EA0A 4KO4S 4Z99A 3GZNB 1QF9A 4CQJA 1C9NA 4NZMA 2ZT8A 3HR7A 4AO8A 1TQHA 2JZCA 2OAQ1 4X1YA 1E2DA 4ZHSA 2QRVA 3ED5A 1XZPA 3RFXA 3HRHA 1HY3A 2QRNA 2X7XA 2XWPA 2FDCA 4KNWA 3K53A 2Y4OA 3H17A 2J31A 4UARA 3UJ7A 4RF4A 3V8BA 1GU7A 4TYNA 3A3OA 1WSBA 1SU8A 4H1UA 4K5QA 1IEWA 5L7TA 4TV8A 3VV2A 3ZU5A 1PSZA 1WD7A 4RPJA 4GOJA 1U7OA 1YOBA 2YQ4A 4YP7A 2QVBA 4TTIA 4DWWA 4FE4A 4HXYA 4ZJUA 2GD2A 2R44A 1ZNWA 2VP3A 3E61A 4EKDA 7MDHA 1YRAA 1P7PA 3CX7A 1K8XB 4RPKA 3AIOA 4XWAA 2WU0A 4CEJB 3LT1A 4N7BA 3W34A 2A0WA 3KQLA 3OJFA 1LFAA 1L5QA 4AKTA 3HKEA 3WZLA 4CCWA 2GWRA 4A16A 3P7MA 4W7HA 2EKPA 2ATEA 1EXWA 2FLKA 3H1FA 4PZCA 4R83A 1JKMA 5AJYA 5EMHA 1VPTA 2I55A 2OWDA 1CNFA 2IEAA 5EE3A 1D4OA 2NUBA 4KKVA 1X7YA 1E3TA 5IH3A 2Q6IA 1YGYA 2IE0A 4DM4A 1PBTA 1MEOA 3RNOA 3ZLTA 4YB8A 3TLBA 3E03A 4QO7A 1ZM4A 4H6XA 2C7RA 1Y8CA 4RL6A 3Q6IA 4LEIA 1J70A 3C15C 3PTAA 1TYBE 2Z1DA 2C0PA 3L79A 5BPHA 5KO2A 1G5TA 1PEAA 3AEUB 5COQA 3RU2A 4D46A 4PAOA 4N3NA 5EIBC 4WEQA 4QOJA 3UTDA 5KYYB 4LF7B 4W9NA 3S1AB 2XOEA 1WCXA 4TWZA 1X87A 2JFQA 3SSMA 4B83A 3PD7A 4ESVA 3U13A 5CEJA 2UAGA 5KNBH 4HR7A 1QO0A 1R6BX 4PW0A 2WIFA 2RC5A 5LMZA 3N2ZB 1YKFA 3AHEA 3DHWC 4PLTA 5GM2A 4XJSA 1A76A 1XKXA 2LUOA 4BCBA 3H1EA 1CDZA 1R4MA 1R88A 4QVGA 4ND8B 2XJ4A 5B2ZA 4BXOB 1U2QA 4KUGA 4CG2A 1FSZA 1G1AA 2EP5A 1NW4A 4B34A 1DVRA 1X3LA 4GGMX 2NM0A 1UP4A 2BEKA 5KIAA 1GGJA 4LDZA 4YAIA 2VQ6A 5BQOA 5K6RA 4AJ9A 3ZCVA 2EFHB 3RYTC 4MW1A 3HXMA 1ENOA 1DDOA 3D4BA 3R0XA 3V8RA 4A8JA 3IRUA 4LZOA 3AEYA 1KERA 2XNKA 5ENZA 3FZQA 3IBFA 3RIGA 3H87A 1PNRA 4P4GA 1SULA 1XDUA 3CZAA 1MAHA 3KVNA 5AJWA 3NCHA 3L8ZA 2BISA 3OY7A 4LY9A 3FOFC 5F9HA 2DPMA 1QH1A 3ZBUA 1HWYA 3PFKA 4HK4A 3T5MA 4CEJA 2AH5A 1YTLA 4KE6A 2NU9A 1CU1A 1J42A 2GGSA 2QTCA 1SC6A 4NOKA 2YYZA 1UFQA 4RSHA 1GM5A 2BLNA 3N75A 1V5GA 4EMBA 1IN7A 3GLFA 4GRDA 3SF8A 4C7JA 4Z3KA 1NLYA 5JAPA 4ZGGA 2RHTA 1CUUA 2R4TA 2EJVA 3A4TA 4QDTA 1TZCA 5G1PA 1T5OA 1PV4A 2QYHA 4RVUA 3TZHA 1J8VA 1C1DB 1QSGA 5JZBA 1EHCA 1Y6FA 2P65A 2C3UA 4JJZA 4RAQA 3VDMA 3ZE0B 1JEOA 1W8IA 1RBZA 4LQLA 4RA9A 5CDSA 2B61A 5ARBA 3TUZC 4XGIA 1SH7A 2UVPA 2H1LA 2HRCA 1IY8A 1UZAA 1ZM7A 3JR3A 4FMCB 4UJ5A 3VU8A 4C2TA 1VYVA 4K6CA 4BQPA 4YACA 2EKZA 4UPVA 4LJRA 1YJXA 1LJUA 4N8EA 4R1UA 4EY7A 5DNDA 3HCWA 2R6R1 3E5MA 1PG2A 1C3LA 1QIIA 3H9GA 3O21A 3K31A 4B2IA 3FFWA 1D5CA 2OCIA 1JUDA 3SEFA 3ABIA 4AY3A 5MFZA 2YMQA 3ZY4A 4B8WA 4IOMA 4JU8A 4LKRA 2JASA 3TDKA 4TTRA 2IBTA 3KOWA 1EFVB 3HKCB 3ISJA 4KFUA 5E1OA 1RMQA 3QA9A 1MAUA 1P18A 1O87A 2P8JA 4K9MA 4XDZA 1UBMS 1C9EA 5CDGA 1XA4A 2O6HA 3T3IA 1E2LA 3DDHA 3MCAA 3RVJA 1ULBA 3F49S 5DDIP 3T7AA 1Z25A 3DJFA 3E3MA 4BBPA 3A4VA 3MF4A 4TTQA 1VC2A 1M0EA 1RI3A 5JNTA 2RHRA 2VPYA 1XTQA 3GYBA 4MPPA 3EGXB 2AFHB 5T5QA 4BE4A 1QE3A 5FLYA 2XW6A 1T6YA 1T6BY 1VLHA 3GBVA 3P0EA 1GGVA 4X62B 3GY0A 3U7GA 5AO9A 4G0VA 3RB8A 2A9RA 2HU7A 1B0ZA 1Z8DA 3LX5A 4GM4A 1Z7WA 4CQLB 4EHJA 2PUCA 1LY1A 2C8VA 1KU6A 1NF2A 1YE3A 3IUYA 3PX3A 2FPXA 3GO4A 3TTVA 4EECA 3CNBA 3BKXA 4AJ2A 2QMZA 1FP7A 4R9SA 4K9RA 4CF4A 1ODKA 4X64B 3UCXA 3F7MA 1GRRA 1QTNA 2IZOA 5FTNA 3LCUA 6NULA 2R1ZA 2WABA 2GN8A 4OMFG 1KBQA 1NI5A 4ZVNA 4LHEA 3KBOA 3AHIA 1SHLA 4QEKA 4REOA 4O1MA 3EZ9A 3WKAA 5B6PA 1VMEA 5F98A 2Q8NA 2ESRA 3CPEA 2VP9A 3ZQJA 1Q7CA 4E0BA 3ISTA 3I4CA 4OXNA 3UF0A 1SD1A 3DV0B 5HS6A 2RHGB 3ZWAA 1G8GA 3OJWA 4BNVA 3M6FA 3ASYA 1L4LA 4D5GA 5IT4A 3ERCA 3VI3B 2CCGA 3QMMA 1LBQA 2GK6A 4ETWA 5LIPA 5IMBA 2G36A 1EVKA 1CF9A 1E18A 4P98A 4C7VA 5TF4A 2W4IA 1QCDA 1Z08A 4G1UC 3SKXA 4TUYF 3WLMA 2GBLA 2GA9A 4L5AA 4UHBA 4LXTA 3IO3A 3N70A 4BC0A 4EG1A 1E66A 4UAJA 2JLVA 1E6MA 1WSWA 1FQWA 2QM0A 2CLOB 1TUBB 1RHRA 1E1RD 4Q9KA 4C22A 3V8QA 2HU8A 2ZCUA 3H4TA 4C4TA 2QLLA 4ZEXA 5AI0A 1YVDA 2D62A 3N7AA 4UUQA 1NMZA 3KP1A 4JODA 1TCBA 4JK3A 5CVEA 1QFJA 1ZK4A 3BBPA 3W5CA 3D1LA 5HWSA 1ESZA 3VO2A 3LUBA 4F9TA 4IXNA 3K3PA 3MRSA 3WDKA 1OAOC 1U0OC 2JAPA 4AT1A 5BURA 1TCAA 4QREA 2JGEA 2IPXA 4P3OA 4G4JA 1F2UA 1BN7A 2VP0A 4PHCA 3HJNA 5TMDA 1E2MA 2VQ3A 4ANFA 1DT5A 3GJ0A 5AK0A 4TKVA 1Q77A 3VKGA 3DQPA 1P0PA 1P2SA 3MJSA 4DT1B 1A69A 1Y3FE 4UHFA 4M87A 1XWFA 2YINC 3C8MA 1HRKA 1K97A 4PFJA 3V9AA 3ZZNA 4JOQA 3KPVA 3LVFO 4YLGA 2G3YA 2IEGA 4NYJR 2OFOA 4ZT3A 2BFDA 2YS7A 4L2IA 1FTGA 3G2LA 1W96A 5IAKA 3OPVA 1Y7HA 3N0RA 4A3SA 1KVRA 1E32A 1L7EA 4MP3A 3WRYC 2QN7A 2C42A 1T2EA 2EW1A 2Q6TA 4QPZA 5JSUA 1VB5A 3N2YA 4S1OA 3L8EA 5CBPB 3S7ZA 1PFWA 1HRDA 1N0IA 2DSTA 1PLLA 2CZQA 1IZZA 5C53B 5DWQA 2JD0A 2J5KA 3D6HA 4MV1A 4CMEA 1EZ4A 4JJFA 3VDRA 1WS6A 1LDYA 1I3OA 2W2KA 4RS3A 3OURA 4MS1A 2JIQA 1KY4A 1TM7E 3GLSA 4XTCS 5FR2A 1DSSG 1I7SB 2FHPA 1K92A 3GA7A 3KIPA 5F4BA 1DCMA 2O3SA 4V1CI 4W9MC 3T4PA 1KR2A 3AFOA 3ZD6A 4UEKA 5M5BA 1YGPA 1DHTA 4LJ6A 5IN5A 2OEPA 5HGXA 5JTUA 1H2XA 1X1SA 3H2JA 2MHCA 4M89A 3TZEA 2Y1CA 1QOPB 5JI3E 2RGWA 1RAAA 1M8GA 2ZGVA 3W0LB 2QY9A 2R1VB 3FOCA 4JQYA 5F1OA 5KOHB 2I2DA 3EAGA 1U2ZA 1Z34A 1KRXA 4UE6A 3BUSA 3R7DA 4IXWA 4D4IA 4FLFA 5B30A 2Y8EA 4B6SA 5FDFA 5AW2A 4JBYA 2FQ1A 4ND2A 1D4ZA 1Z0JA 3C1OA 3M81A 4OHPA 3ZWYA 1AZWA 2UUCB 2RGBA 1F8XA 2YWDA 5CXXA 4AJ4A 2QTGA 3LBFA 5AI4A 3MSCA 3WGKA 3CR8A 5AJZA 1XLWA 1DKPA 1JDBC 4LS3A 3GROA 1O94C 2GF0A 4PY2A 3R6TA 4XI9A 2AJDA 1XF1A 2A9QA 1US8B 2WAYA 3UCEA 3ZHXA 1IFXA 3HYNA 3EPRA 5LB4A 5I7OA 1QRRA 1PJSA 4EG5A 3K6SB 2PN1A 4ZI5A 3FMIA 4X9XA 5TMEA 4E7PA 1DKOA 5E2AA 4Z7OB 4QXMA 2Q5IA 4TMXA 5ALPA 4GPZA 2GARA 5I8WA 4HAXA 1ZD4A 2IVFA 3WAKA 2BVNA 4DR6B 2YOFA 1RZUA 2PXCA 3A1EA 4J16C 2ATCA 4R16A 4XR9A 3IT1A 3O4GA 1T8SA 2AYXA 4YJ2B 1RYZA 3CX6A 2WP0A 3JRXA 4IWXA 4C7BA 3V4PB 1E3QA 3VAYA 1NW9B 2E18A 1E1RA 2MTBA 5DSTA 3WVNA 4Q1VA 5HILA 3TJRA 2GJAA 1MB0A 3MHPA 3WNZA 1XMOB 4J1QA 2FP4B 2IU6A 5DHFA 2K6GA 2AMJA 3EPJA 1I7DA 3T5PA 1CJKC 4CM6A 2COKA 3LLMA 4FD3A 2C5LA 3EAQA 3SD7A 1RRPA 2P35A 3GWZA 3AOEC 4FI3C 4ARZA 4IM7A 2WY2D 4KGXA 5CHYA 1SCBA 2XQKA 3MT7A 4QVKA 1JVSA 1SURA 2I7TA 2PLNA 3DF7A 1E3LA 4ZARA 1QUEA 4ZCQA 4WNAA 3WSVA 1URPA 5CLLA 3NOXA 5DM4A 3F5FA 5DGXA 3G6KA 1RI2A 5K0SA 1XDWA 5DNEA 1NXTA 3SJBA 4EQZA 4TUYA 5JH7B 4CM8B 1JFFB 4S35A 4FFLA 1W4LA 3EZXA 1DINA 1JH8A 1I3CA 1ZXBA 1WLSA 5AUNB 4KXUA 4PG8A 2RAUA 1F20A 5B4VA 2OORA 3HVHA 2ZE5A 4OEHA 4DC0A 1XFAA 3L6DA 1QX4A 4E2XA 1D0SA 3EXIA 4JX9A 2VS1A 5B37A 5IN4A 4M1WA 2YOGA 1AU9A 4L78A 1BMTA 1LLDA 4PX9A 1EB9A 3S4YA 1ARZA 1REQB 4LZWA 1QVZA 2D2EA 5GONB 1DJQA 2PQ0A 1AGRA 1RS0A 2R85A 4M2LA 1DC3A 4QQNA 2FWJA 4F9FA 1RJ9B 2V3CC 1EQUA 4MVJF 1YASA 3MSXA 5LNK6 3KO8A 2RGYA 2J0VA 4FYKA 3RUFA 1M1ZA 3QF4B 4R2WA 5G4KB 4UASA 4D6PA 1T9CA 2HA3A 2Z56A 1U7ZA 1UL1X 2ROQA 1TF2A 3A6JA 2F4NA 1QFYA 1LVUA 1UPBA 4U2EA 1XVIA 2OHGA 2UZ1B 3EHDA 4BBAA 5HQ3B 1E7QA 3H0KA 1N1EA 4D8VA 5C3MA 5KTSA 1D2MA 2EQAA 5DE3A 2O4CA 3L6EA 4EA6A 4URVR 1QZTA 3QXHA 4X8MA 1TGYA 1X13A 2JK1A 3D5QA 1Z17A 3GZNA 3DOHA 5T6MA 1GPLA 3K2IA 1K6EA 1VIAA 3OESA 5TPWB 4AICA 2PIDA 5JALA 2GM5A 5JS6A 4EL0A 2C7BA 2EFGA 2DUUA 1CSEE 1B15A 5AKKA 2JFXA 2YZGA 3LDAA 5K3CA 1Z8NA 4FQ8A 4L85A 1KL7A 2AE1A 2GUWA 3DULA 3RVQA 2CDAA 4MVJD 4BN5A 1NJ2A 1GN9A 3AETB 1SAYA 3BFXA 1NR5A 4L28A 2WTBA 1LEHA 4LRXA 4HNHA 5EJIA 2NVUB 4U8HA 5IDYA 2Y71A 3WQBA 1BHJA 2NTNA 2RHLA 4L75A 3L6OO 4RM2A 3C4JA 4AX4A 1LCIA 4RZ3A 3G89A 4I36A 1RWKA 2NIPA 3HI4A 2A0XA 3KQHA 3EXG1 3MJDA 1VSQA 3EIEA 9MHTA 5ALSA 1D6JA 1V9CA 1PNQA 2GYVA 3ZDCA 2Q3LA 4KMRA 2K5UA 4E4TA 5LJLA 5LWHA 4OHYA 2UYOA 1Y5MA 2QX6A 4DA6A 1LWNA 5DMHA 2XSZD 3AT1A 5I9MA 1N32B 4LVOA 4WOPA 3GQBB 1X1QA 5FI1B 1IEVA 2O8NA 4YRJA 1JDZA 1O58A 1BFDA 1VHJA 1YRYE 4EW6A 2C4NA 2ZJ8A 3VSCA 1YIOA 4RJTA 1Z4LA 1Z74A 3OZIA 1B23P 4LYGA 1GZ4A 4R2MA 1ISPA 3PYMA 4WIAA 1V6AA 4BDSA 1K2VN 1RI1A 3OWHA 1EDZA 4I4NA 4F06A 4RS4A 4QT4A 2ZUEA 2YUIA 2FUG1 3VU1A 1I6KA 3OPNA 2EZ4A 1A5TA 3AEUA 4JT2A 4OQPA 4YIKA 2N1MA 5KYYA 1A71A 3GCXA 4MLPA 4XCQA 2IEBA 3PXEA 2V9CA 2VK2A 3T9BA 2OBBA 4OY3A 4ZOLB 3ESCA 2I8CA 4EY8A 4DCSA 3RUAA 1VE5A 2DFNA 2RK6A 4FEEA 4PO8A 4RGBA 2VSOA 3VVBA 2JAXA 2VPZA 2XCQA 2J7PD 2YDYA 2VHEA 1I2CA 2GZ2A 1ZMOA 3H42B 4MV6A 3SHOA 4KDFA 4KQGA 3QWIA 3ZE1B 4ND8A 1TK9A 4M9XA 1QM5A 1Y8RB 3A1NA 4OJQA 1U3UA 3VFDA 1IK4A 3FN4A 5AW3A 4ONEA 2RJNA 4IVRA 4LCEA 3ZZ0A 5JY6A 3D4OA 3B52X 1I1OA 2B7BA 1WAMA 4XQ9A 2NU6B 7MHTA 1GU0A 1BCSB 1Q0RA 1OILA 1T9GR 3PI6A 3GBPA 3TDMA 3F9CA 2VBCA 2JA2A 4GQIA 1LZKA 5E3JA 1XTPA 2Z30A 1LRLA 3DWGA 1FZTA 1VIVA 1TK3A 2DR2A 4J7AA 4ES6A 2QPOA 1N5KA 1KAHA 4HQOA 4BX8A 4LDPA 8LDHA 1P2BA 2PLRA 3N87A 2QYSA 2HK9A 3HVKA 1QIGA 4OI2A 5HGJA 3OIVA 2QRZA 2EFJA 4IFEA 5CFRA 4G4SP 3K0EA 1Z4IA 1CUDA 2BM1A 3LP5A 2KB0A 4AKEA 1UFKA 1QOZA 3LUFA 3VZRA 4H7HA 1E1KA 4JI0B 1ZWLA 4FNGA 2FW0A 1A4UA 1LPAB 4RTMA 3BH7A 3QX9A 3RC7A 1SHTX 1U3CA 5HX7A 3AR9A 4QBTA 1H0HA 1J2RA 5ERXA 1ZVJA 2V7QD 4PZUA 3FWHA 4ZAXA 3N2NA 1JSCA 1T8RA 3COPA 1K9VF 1XRSB 4MB6A 4EGCB 3DKPA 4V0NA 4ZQFA 3WLRA 4A0FA 4BLQA 4QPCA 1C1DA 3H1BA 2WTAA 3BIFA 5DIFA 3UUFA 2ID9A 3GIDA 3O3OB 1AHHA 1T3SA 4M0PA 4AB1A 5GGXA 5LD2C 4HADA 5AWFC 1CX9B 2BHNA 3GHHA 3HH8A 4X93A 2Q7DA 3MWYW 5IXJA 1NW6A 5BXQC 2YMPA 2QTNA 4G65A 3GDHA 5HHTA 4LW8A 2W6OA 4BN4A 4NZNA 5DBIA 1YFKA 2HA2A 3BL8A 1G0NA 3V4ZA 3TX2A 1IHPA 1Q3KA 3UAWA 4Y1EA 3NHJA 2G5PA 2XBMA 1Y3AA 3P19A 4L4RA 1ETHA 4XYLA 1DAFA 3R2JA 3DHNA 4KQCA 1XEWY 2I7DA 1J06A 2WU3A 4MKZA 5B2EA 5LBUA 1QMGA 3ADPA 2VXYA 4FEYA 4MVJA 3HDYA 1RSZA 2BMFA 4C5CA 2H5IA 4ITRC 1UAYA 4EA7A 1T2UA 3UW3A 4JYZA 1BYIA 2Q9UA 2R97A 1AQUA 3FJ1A 5EXXA 3TIFA 4BRZA 4E32A 2QQGA 1FNBA 3D54D 2PZLA 4QUIA 5H59A 2EDAA 2BTQB 2ZEJA 2ZTSA 1EFVA 2Z1NA 3O93A 1S89A 3HKCA 4K9LA 5DKFA 4BY9E 5J63A 2HRBA 3EVEA 4NPAA 1JA0A 4XWKA 4UTNA 2SKCA 4AUMA 4Q3CA 4KK3A 4PIVA 2X2OA 4QO8A 1TVCA 2XSZA 5B64A 3VBEA 1I4OA 1I4WA 4KSBA 5I9TA 2PL5A 1LH0A 2VAXA 3IA2A 4UFNA 2NSYA 2X3YA 3K9LA 4XWOA 1R50A 1SM4A 3R76A 1WB6A 4UMVA 2B1IA 4NATA 3GZJA 2J9GA 1V16B 3EGXA 1AS3A 3M6XA 4QPDA 1KIAA 1YNSA 1GLVA 1WXQA 2IHZA 2IOFA 2O8FB 5KVQA 4IICA 4WPGA 1Z6PA 1F9EA 2P6RA 5F21A 3AVQA 4LDRA 3WGIA 4K6KA 4LBZA 2R11A 4A2WA 3G0OA 4G9GA 1KI7A 3I1IA 1G5PA 1T13A 4CQLA 2ECFA 2FFQA 4U0KA 5JWHA 3DCNA 2LGJA 5A6VA 3EVNA 4F72A 2QI9F 5CT5A 4B6JA 4D4MA 1HDXA 2YN0A 1PRYA 4GNKA 4G2TA 3SHVA 2J7PA 4AF8A 1L8QA 1ZVKA 4G86A 4QVIA 1Z5ZA 5A3QA 1GTG1 2GYUA 1O03A 1MC1A 4MGEA 2XAUA 1PQWA 3D4NA 3SSAA 1P7ZA 1UK6A 3T7EA 1ZNQO 3BCSA 5BR8B 1V7CA 4AIIA 4UEOA 1N2SA 2BBTA 2XY4A 2EOAA 2Z3WA 3DHYA 3BMCB 4NMLA 4EG7A 3KKKA 4IV8A 3U4CA 1V7QA 4Q37A 2GEVA 3HACA 3DTTA 4NENB 1GGKA 7AT1A 4P5EA 3DV0A 1GKKA 3IEMA 2JFGA 2JH8A 3OD5A 4Y1FA 3BXHA 1LDNA 1OPRA 1XNJA 3BD6A 2P5SA 1VI6A 2P9QA 3DAGA 1AG9A 3PDWA 2DKFA 2YV2A 1LLFA 2CXSA 3CUKA 1CUXA 4FYYA 1J2UA 4FYIA 1PU2A 3RAGA 4F3TA 5SZJA 1UDBA 3A27A 3EXFB 4BNLA 4YRNA 2JFHA 5E9QA 4ZO9A 3DM5A 2O8BB 5AVOA 1TUBA 2GB4A 1E20A 5A5DA 1XF9A 4EUNA 2WPDD 4DIUA 4LTMA 4ARBA 1ZK3A 3QY9A 4FJ0A 1LPOA 2V7QA 3AB8A 1N9ZA 3AP1A 2ZAGA 5AKGA 3V8PA 2BKVA 2DLNA 3E15A 2E4YA 4Z0HO 2G1AA 3DDOA 3HEMA 4KFTA 2G9VA 4YNBA 1ONNA 1BN6A 1XN1A 5GONF 3FUVA 3AR3A 3D7NA 2BOVA 3SK0A 4XLTA 2RH8A 3KUUA 2ZITA 2O1XA 1SZCA 1B6RA 5K03A 1V3TA 5AYVA 1DRWA 3VR3D 4NCXA 2GM9A 1RP1A 2HYIC 2IZ5A 2FSPA 3AKDA 4XX0B 4CMGA 4DT1A 4BP8A 2E6KA 1NXWA 5FOWA 3B1VA 1CEQA 1EQAA 3DFZA 3ECSA 4UU8A 1C4KA 3ESRA 1AQ6A 3BXZA 3E9QA 2QXUA 4Q15A 4O8CA 1OVMA 2CLKB 3AHHA 4A0HA 5LUBA 2XWQA 4B45A 4JR0A 7ADHA 1SHKA 2RHWA 3CTMA 4H35A 3V2UA 3U0BA 2WNHA 3UAXA 2O1WA 3D3QA 1OFTA 4HD8A 4DG8A 4FHGA 4KL8S 2PYDA 3W8FA 2IP2A 2JGNA 2MMGA 2Y4NA 1YZ3A 3I6QA 3CUYA 5HRCA 4YAJA 2Q46A 1KDRA 4R05A 2Q2WA 6REQB 3UWMA 5CBPA 3L0DA 1EUQA 4MRVA 2Z0MA 1VCNA 3I9V1 3OZWA 1ZIDA 2IJGX 1DAEA 1WTAA 2A0UA 5HIMA 1V0JA 5KTYA 4X66B 3TS1A 1RWNA 3EQ2A 3UUWA 4B3MB 2MSEB 2CL7X 3C3KA 1Z38A 3I6IA 3OLWA 3JZIA 3CH5A 3MPOA 3T5DA 4I55F 3WLIA 4DR3B 4NCHA 3KJHA 3PQ8A 3EWNA 1UJ5A 2CHVA 1ZFNA 3P2JA 2I3AA 1J22A 1KHHA 3AY0A 2YIVX 1CIPA 3RTDA 1FLVA 1J2YA 4J2OA 5TXGA 5KCMA 3T61A 5KOHA 5CA1F 2MOKA 1BVYF 3KL2A 1I30A 3OIYA 4MQ4A 1SIUA 3BH0A 1AQYA 1KEUA 3I9NA 3NKFA 3ITEA 3JWHA 3R5XA 1Z6TA 4FD2A 3W5UA 1TO2E 1YZLA 3OZFA 2XODA 3CWQA 5F2KA 5GOZA 5H80A 2DJIA 1JYFA 3BL6A 3SCZA 4E4YA 5HOEA 4OH1A 5I4CA 2P3LA 4MV4A 1GNPA 1T3HA 3EDMA 5HR5A 5JROA 4RD6A 1E6UA 1PZFA 1SKYE 3C1TA 3EG5A 4L57A 1ZN8A 5A4AA 5CBKA 2W2MA 3HNOA 3MUOA 5C51B 5GQSA 5IEBA 3V4SA 3RODA 3ZGVA 4BYMA 1B42A 3N0WA 4QBKA 4ZOLF 5KKCA 4WNIA 3D7RA 4N5HX 5TQ0B 1X77A 4LI3X 4U2CA 1US8A 4QM6A 1UC8A 3QIVA 1YU6A 3B36A 1VPVA 3C5WP 3H4VA 2C4UA 2FVYA 3K6SA 3PBKA 1RAIA 4IEFB 1KBOA 5M29A 3DEJA 4BLTA 3PC4A 1GQOA 5SZKB 2ZIUB 2FSSA 2OQRA 3OOJA 4Y2HA 1F1BA 2WDPA 3PEWA 3QFRA 1HFEL 4CMKA 1QG2A 3BICA 2Q8PA 4NCNA 4TV9B 3WNVA 1A82A 1IZ0A 5J5CA 4V38A 5HZGA 4YJ2A 2E85A 4RY8A 3KT6A 3VI4B 3AEXA 3PC3A 2XMDA 4XSVA 5M3BA 1LSJA 4NX2A 1XTJA 1ADJA 4MVJH 4NHOA 2NTJA 2WPDA 1G7CA 5FBRB 1AD2A 3VU9A 1VE1A 1JAZA 3FNQA 3D9QX 1K98A 4I4TF 2FP4A 1U5BA 3NYQA 4GX2A 2I2CA 2Q0XA 4QJIA 3SLKA 3WNQA 4CIWA 4DB4A 3U3DA 1KAGA 1G60A 1DE0A 4A5OA 1TM1E 2EF0A 2Q5JA 5FFMA 2RE8A 2HPHA 1Q7TA 3TTTA 1JIUA 3AR5A 2QM7A 2Y99A 4Q12A 2C1XA 1R9JA 3MUEA 1EK5A 1RZVA 1PBNA 4IDHA 4LGMA 1OXBB 1WBBA 2PKEA 3KTFA 1ZM2A 3IIIA 1J23A 4C7KA 1MAAA 4S2UA 3U40A 4CKEB 3IVCA 1X8KA 3AFGA 1DEAA 3AJEA 4BVLA 4E6EA 5JARA 4O4HB 1W1UA 3VR3A 1AMUA 4GAEA 3NNNA 5JH7A 2HHHB 2WWXA 3PFBA 2Y3IA 4CM8A 3DPSA 5SY9A 4E70A 3IJ5A 2ZSKA 2I4IA 4BWYA 3EF0A 4AULA 3HTXA 3H5WA 1PFVA 3MOGA 3PZRA 3ZTTA 1T9DA 5K0JA 1P4AA 1KR5A 4Q34A 3V7YA 2LP4Y 3ZHUA 5IG2A 1Z2AA 5ADWA 1I6MA 1M6HA 3LQKA 2WHQA 1RM3A 3G9XA 4L15A 3R77A 2GPSA 2F64A 1Y7IA 1HO3A 2QIPA 1AXRA 1VJGA 1REQA 3DE0X 3K9QO 1W581 1Y7LA 2JFPA 2DOKA 3LQQA 1GAWA 3ZBPA 1PR9A 5GONA 4CRWB 2VSYA 4U8GA 4Y2YA 4E5MA 1U8EA 1RJ9A 4B80A 1AS0A 1TRHA 2A1UA 3C85A 2QAGC 3UAGA 3B6KA 3QF4A 2ACVA 4CN8A 5G4KA 1KYWA 1XDBA 4IGIA 3LRPA 4F60A 2OR3A 3E7DA 1LPPA 4PU0A 2XVMA 2UZ1A 3A4NA 5FTKA 5JYDA 2G76A 1EUDB 3FLEA 4GHWA 1UXGA 1KBZA 4H1TA 4OQXA 1NC1A 5AKIA 3S5JA 3HYRA 3SC6A 3STTA 4E1AA 4CDMA 5CYOA 1WO8A 2CJPA 4L0CA 4KMMA 1U3TA 4LBYA 3SYRA 2VPPA 2FSHA 4KV9A 4R71A 2WF5A 3FAKA 1L4FA 4GOKA 1A9SA 1L4BA 1U0BB 3KUKA 3PDUA 1OXXK 3DLBA 3HQ4O 4TMTA 4C3UA 1SG9A 4OX9B 3GFPA 1XQWA 1YBVA 1EM8B 5FBQB 2RCNA 4WXYB 3MTGA 1H94A 4KXXA 4LFBB 2ZBRA 3FSRA 3VSDA 1U7HA 5CVDA 1ZWKA 4D25A 3S2ZA 2JJYA 3VC7A 1G64A 4CL2A 1TF7A 1BS2A 4RHCA 4EQ6B 2KQUA 3AETA 4DN6A 2NVUA 3N76A 3PZBA 1OI4A 3GCZA 5BVHB 4L08A 3ANYB 2QQFA 3IT0A 4DC1A 4D8WA 3V8NA 1KETA 4EO9A 2PWYA 3L43A 1NRIA 1G2IA 3AF4A 4GLOA 4LXYA 4NPCA 5F7ZA 2A67A 3FXAA 5IBRA 1LQ2A 4ALKA 5GADl 4JVLA 4KH1A 4PLWA 3FYUB 1DOZA 4FOTA 1OZAA 1NGSA 3X0DA 2OK7A 1CUAA 2SCUB 1OUMA 2VFAA 3UJ6A 1MW8X 2I7XA 3GLUA 1Z7BA 3GQBA 3IQZA 4PBRA 4K3UA 1FQKA 4PG7A 3ZEAA 3CRVA 5CA1A 4RJLA 3KR9A 2PV7A 1N75A 2OBLA 3REQB 4OFBA 4BB0A 1QH0A 1U9CA 1VJ5A 3JSAA 2PX8A 3K1AB 1X7XB 1NSFA 4GUAA 1J0EA 1YZVA 4UUBA 3OECA 3WGOA 2P2CA 2J41A 3DCIA 3E7FA 1NVMB 2XA2A 1L7XA 5A5EA 3K09C 4UTXA 4M0MA 2H2GA 1DOAA 4ZOLA 3ZKAA 2FPKA 2R48A 1PWEA 4G85A 4RFSB 5T8KC 2HJGA 3MS2A 1WW8A 1QDUA 3U9TA 3ZJVA 3MMPA 1F38A 2YRXA 2R6JA 3M2TA 1UEIA 1XRQA 1TC2A 1Q1BA 1NL3A 2AG1A 3KTAB 4UBKA 5TGTA 4PC6A 4QT0A 4H0CA 2VEDA 1XT6A 4MDFA 1KJJA 1ODSA 2B5VA 2V0CA 3WA6A 1SVKA 1Y8RA 2LCIA 3TXYA 2DLDA 3DKKA 4N1AA 4NTZA 3DEIA 1Y4DE 2I2XB 1VRWA 2R7MA 1FFBA 2AFVA 3MAJA 3TX6A 3I3SR 4ND1A 3SS9X 4B7XA 3KX2A 4WFIA 4CYMA 4HTFB 4XJTA 3JYQA 4QFMA 4EUFA 4HEA1 3HMQA 2Z9CA 3EMBA 4WZBB 1ZSNA 1L7NA 2ATVA 2WVGA 3IR7A 4NICA 4Q1BA 2VUUA 2IYOA 1VFPA 5CT8A 5EMNA 2WF7A 4KWCA 2E48A 2KPOA 3BB1A 1VMAA 2LWIA 1RQLA 5DM2A 5IHXA 1G21E 2HYDA 3G0BA 3WLOA 3R7BA 3VR5D 4K81B 2VXBA 2XMCA 2W6NA 4KGZA 1FFEA 4LPKA 4RXMA 3OPQA 1DIOB 4A03A 5AQ1A 1LLCA 1OJLA 2P2SA 2PWZA 2KWIA 1UBHS 1UAGA 4M8KA 4E5NA 3L0ZA 1MV8A 1BHQ1 3JQEA 1ZUHA 1JB1A 5A06A 3FIJA 3BX1A 1MX5A 1RJEA 2WNSA 3KDPA 1UFOA 3WLQA 3EHEA 1KRHA 3GGCA 1C9YA 4QJ5A 4QSMA 2NQ2C 2WAAA 5K01A 1HQDA 1A9RA 2QJRA 1Q3HA 1S3SA 1NYQA 1UWLA 3M6UA 1UZLA 4JX8A 2FZEA 4JB0A 3LCMA 2GMWA 4YCAA 4YAEA 4ZQIA 5DSXA 4CL0A 2IA5A 2P9CA 2PMDA 3BCHA 2PLWA 2HQ1A 1OZGA 2JGFA 1E7RA 2BFFB 3B89A 2P5YA 4YRBA 1JQLB 3GGDA 5JRZA 3NGXA 2MSDB 1H2BA 1R66A 4ZREA 2NZJA 1MB9A 3CTPA 3IJRA 3IAM6 2RB5A 5HEKA 4KPEC 3WRWA 4UVDA 3KHUA 1RRGA 1YOVB 2JC3A 4NABA 5LYJF 1H2AS 2X8AA 2V6JA 4LF4B 2JIBA 2JL1A 1RYYA 4NPHA 5AVXA 2PD3A 4IDBA 1JTVA 4CV3A 3AJDA 4X91A 3IEVA 3QX3A 4GECA 5KWIA 1U8UA 1PF7E 2DAPA 3NX4A 3QVTA 4B3IA 1LBHA 1CUEA 1T91A 5HA5A 4DUZB 4NJEB 1GYQA 4HWKA 4J90A 4MHOA 8AT1A 2Y0PA 4D4HA 4ND4A 3WHIA 2X6TA 4Q4JB 4G9EA 5J5AA 2BTQA 1NYLA 2ISSD 1FYWA 1N2ZA 1MQ8B 2QX9A 1XZMA 3K0CC 2QL7A 4IR7A 3R23A 4JJEA 4W9RA 1ZRNA 3L4EA 3HY6A 3I2JA 4MKXA 5CYGA 1AKVA 1T26A 3HKDB 2ZXUA 1B2RA 3RC8A 2LIVA 3CE9A 1COZA 3AI7A 5I51A 3BVPA 3ONVA 3RRFA 3WOHA 1T1SA 3VU3A 4WY5A 1NJGA 2G63A 4BO8A 2IITA 3B5EA 2R6AA 1XXHB 4OMCA 2BFEB 3EQ9A 2D6FA 3TB6A 2ZJBA 3QLVA 1QP4A 2Q5EA 2BHSA 3P0IA 1V16A 1W88B 2H2IA 2AF4C 3FF1A 4NAVA 4UXIA 4YJHB 3RUCA 2JIZD 3PNLA 2GAOA 6Q21A 2C58A 4CL8A 4CW7A 2O8FA 1FS4A 1TQ4A 2FPGB 4H0NA 1Z6QA 3CSSA 1DDGA 3LX8A 4KNVA 4C0SA 2RHHA 4AXXA 1G6Q1 2EJBA 3PQ3A 2J48A 4IGFA 4UUNA 5K8UA 3F8SA 4MUJA 1ORHA 3HXLA 2FUKA 1KARA 4AN4A 1BOOA 3BXOA 2IC5A 1QGUB 2QR3A 4XJXA 5DNWA 2AJ8A 2H92A 3F1LA 3RD5A 3VNUA 1EJ2A 1NUUA 2OFPA 3FF4A 4OA5A 1NJ5A 5JAOA 4Y6GB 1ZO8A 4B2PA 3P1JA 1P9RA 1RBMA 3QUBA 4NBNA 3LAWA 4DCGA 5JPDA 2BD0A 2WUVA 1T2DA 1JHOA 2XUFA 3H65A 5FWAA 4KFCA 4DCUA 2I6UA 1L5FA 1J2TA 1JH9A 5CUQA 3F7OA 2HCTA 2WMYA 1T2VA 4TPKA 1HXHA 4R41A 2BI4A 1NNSA 4FGWA 4GH5A 1C8BA 2LBPA 2WUEA 5NULA 1U2GC 4J6FA 2QPAA 1U2SA 1HT0A 1NZJA 3V2GA 2NAFA 3KLMX 3WB1A 1S6YA 3EQ7A 3BIOA 4BGVA 1RYDA 4DLPA 5EJEA 3D6JA 2DR3A 2ZDQA 4BQOA 1M67A 1D1TA 2PX2A 3R7WA 5JI2E 1KMMA 4UULA 1DAOA 3EIUA 2PNFA 2Q3EA 3VR5A 3HN6A 2V5AA 2EXXA 3R3JA 2WJ3A 3RAJA 3I4LA 3EZ7A 4DLNA 3P4YA 1TB4A 3FKQA 4OL9A 1USUA 2AVNA 1Z2DA 3EXFA 4P08A 2O8BA 4AY5A 4RTJA 1DAKA 1YSCA 8ADHA 5EJ6A 2ZUFA 1F60A 1NOJA 3AJRA 3GT3A 4GICA 5AOAA 4RLSA 4EYKA 3SVLA 4G4IA 1THTA 1UMCB 4MA5A 4N18A 4ZRMA 1LS1A 4MW7A 5DTJA 3KQNA 2I99A 2VJAA 5T4FA 1CY4A 4Q3LA 4WE3A 5ALZA 3INGA 2PA3A 1V3QE 3D6VA 4Y6RA 1IAVA 2XKKA 3D7KA 2GERA 3P9CA 4YJ3B 1XVTA 1NONA 3QKIA 1IG0A 4JXJA 4U3JB 4EI8A 4IMJB 1C30B 1IHDA 1TD9A 1ZCJA 1PT5A 4I5IA 1YACA 4PC3A 4CQMD 1CZOA 1GOTA 2I22A 3GJSA 4Y0VA 4YLEA 1Y0BA 3IO5A 3RT7A 3K4PA 2RFLA 1J6UA 2PKQP 2WWWA 3CWZA 1O89A 5LIRA 2IPAB 5KVVA 1YDMA 1CWUA 2P91A 1VYHA 2WIBA 3BD7A 3CM0A 4HNAB 5A0FA 4PQYA 1UXKA 2GFQA 3WBKA 2W42A 1OFGA 3ZU2A 2ANCA 4BTVA 1ID8A 2YVQA 2E3JA 2QLNA 2P9YA 3H8VA 2O2XA 2QZZA 4ZYUA 4R6WA 4GVPA 1Q2UA 1DKNA 3TOZA 2CLFB 3GAMA 1YS9A 5E4YA 2APJA 4LRQA 2EWWA 5EPUA 5B1YA 1CP3A 2FVXA 5TC4A 1NQAO 621PA 2CUTA 3ZKWB 3FPEA 1CJTC 5FI5A 3C6ZA 3MBKA 3RIEA 3RHSA 6REQA 1Q74A 4LRTB 1JG4A 1MUUA 4NWIA 4DLBA 4QARA 1MG0A 2TRSB 4WQMA 1CZLA 2R60A 3SHTA 3PC2A 1ZD2P 3RU7A 4HNUA 3HLYA 2A78A 2AJCA 4XVCA 3EMKA 3FPJA 2Q2OA 4FOOA 1P9NA 3PJRA 4NE7A 3VPFA 2AS0A 3C8UA 4OH7A 5ICGA 3BRQA 3BM5A 4Z0NA 4PRLA 1SB8A 2TMGA 1Z4PX 2GBIA 2TMYA 4LRYA 3RI3A 1DCTA 2W7TA 2JIZA 4C2BA 4AQ7A 4NYIR 2G8LA 4ZT5A 3TRKA 2HKIA 5KNCD 1NUPA 1KPHA 3C5HA 3FTEA 1IJEA 3OA2A 2GM4A 5DEOA 4ZO7A 2OILA 2GF2A 3A58B 3DXXA 1W5AA 2OHOA 3L04A 4GGOA 5AOBA 1Y8AA 2RBKA 1MNQA 4BMXA 2A14A 4CLXA 3ESBA 5ALFA 4AURA 4L22A 1C5KA 2HREA 3VO8A 1IZ8A 1WSDA 1DWPA 1Z3CA 1R0SA 1UINA 4JGIA 3UMSA 2ECOA 3H19A 2E4VA 4B84A 4V1CB 2AF3C 1YCGA 4YDSA 1MVNA 3WE7A 3PGMA 4QFBA 4QIHA 4EF5A 2NO6A 4Q4AB 4CE6A 3W79A 2HHAA 1BG6A 1OSNA 1JR4A 4FCTA 4LYFA 2FV8A 3CW2A 3LY9A 4YDHB 5IVPA 3CJTA 3JY6A 2OWEA 3EOBI 4WMLA 3EVTA 1WDKA 3D59A 2PY6A 1CT9A 4UKDA 3UHOA 2Z5LA 3VPDA 3BJEA 3IS3A 5EOVA 2PQ2A 3KALA 4HFNA 2FHSA 2VZEA 3DB2A 2J87A 5B3AA 2PMEA 1XXLA 4GKJB 4H18A 3ER9A 2B30A 3UMRA 1B2LA 3Q3CA 3D8BA 5AM3A 4UM9B 3EY4A 1G38A 4N6NA 1ML3A 1NVUQ 2J9FB 4R98A 2GFIA 5EZSA 3NWOA 3C98A 2BZGA 1RWPA 2QRKA 2IF0A 4URUR 4QRDA 1MOQA 1C14A 3OICA 2KHZA 3PHHA 1OWPA 4MX8A 3RYHB 1V41E 2G83A 1HI9A 1U0LA 4GD3Q 3VJLA 4CIYA 2NZ8A 1T0UA 2WD8A 1A4IA 3R9XB 3DYBA 4Q03A 2P6PA 4CIAA 1NVVR 4NQRA 4X20B 4OQQA 3ENKA 4B4UA 1YRWA 1JDBB 3TM5A 1M2VB 1M1YE 1P3DA 4FYXA 1IY2A 1FTNA 5KYVA 3TLGB 4F4FA 5I5EA 3A4IA 1YZHA 3OC0A 1MR3F 2ZXEA 3GMTA 3QOYA 2ZZKA 4RZIA 2WKWA 2ZJFA 3TSCA 2IEYA 2CFIA 3WGZA 4BIMA 3Q3HA 1G59A 4MPRA 2BIFA 3LX4A 3LNCA 4CKEA 2VQDA 4WW0A 1FNSA 4HN2A 4AQDA 4CQMA 1OZFA 4LZJA 1SOUA 2YIJA 3ILSA 4JASB 3B6JA 4O4HA 5H02A 5KX5B 1MA0A 3EMDA 3JYLA 5JSYA 2I71A 2AJBA 4J4HA 4OHXA 2OP0A 4JC4A 4YRTA 4RTRA 2F8TA 4RKQA 2D1YA 4RCYA 2WB2A 3R6LA 1ZOOA 1Q44A 2I2WA 1GKYA 3DV9A 3R7LA 4AMUA 1J39A 4C0BA 5KWVA 2IX9A 4PSCA 3EGDB 4Q3EA 2OD7A 4YO7A 4EZBA 4J0HA 3F4BA 3QOWA 1LK7A 3QYPA 2LPMA 2RG7A 4LISA 1DV2A 5EIBD 1Z0UA 4KMOA 1VM6A 1JGTA 3GJTA 4K9SA 4O4JB 1RWQA 2IPLA 1YQ9A 4A2PA 4GW3A 2VT3A 2OZVA 4XVRA 4YJHA 5FPSA 1U7DA 2RHDA 4QECA 4P1ZA 4YCMA 3ZU6A 5DCLA 1N7IA 3OO1A 4GZ3A 4IDFA 1KQNA 1UH5A 2XUDA 1OC2A 1RWMA 1I4DD 1Y1QA 3LM8A 2W70A 1VSBA 3O4VA 3ZQ4A 4CMAA 3EWSA 4X8OA 4DRYA 1I7NA 2PE5A 1EVZA 4Q9HA 2X8BA 2ZI4A 3JD0A 2QZPA 1UBJS 1J09A 4G23A 3SIPA 4E5UA 2VT2A 2A86A 1I3LA 2VF7A 2ZYAA 4F0JA 4YV1A 5L6LB 2HT1A 1EUDA 2DFKB 1EVYA 3WB9A 3CGWA 3CEPB 1DCFA 2UYHA 2QZSA 3AR7A 1CVIA 4G1BA 1T0IA 1NF9A 2OYCA 4PPQA 1KTVA 2OBFA 1A95A 3MLBA 3GV0A 3AWIA 1XP5A 5REQB 4LYDA 2CB0A 3DXYA 1KKMA 2ICAA 4DCPA 4FB4A 4R1PA 1CW2B 1GTL1 2EV9A 3JAWB 5HF9A 5C3UA 5KNCA 2HWYA 4L73A 1EM8A 2AWNA 1UOOA 4XE5A 2Q1XA 3GNLA 3T06B 3H9QA 3EASA 3VR5H 3WWOA 3IOYA 1O95C 3VXKA 4WKNA 4BNJA 1Q2XA 3AKZA 1XKQA 5JJIA 2DJ5A 3QWAA 3KQWA 4I99A 4HGNA 1X14A 1NFQA 1VI5A 1JE1A 4EQ6A 1X39A 4BO5A 4IZOA 4Q4CA 5BVHA 1P80A 3LOPA 1M10A 2F1KA 3GAFA 3I1FA 1QP7A 1ND6A 1WUKS 1YJBA 3EVAA 4BMYA 1A3CA 1ISFA 3L7KA 3I42A 4D9IA 5AKLA 4YMGA 2OV1A 4FOSA 2NACA 1V43A 3FM9A 2PX6A 4C1NA 4C5AA 4Q7LA 3VHRA 2CMHA 2F3SA 2SCUA 5C80A 5DISB 2BCGY 2QJOA 3IBSA 3NHAA 4C3OB 1I3KA 4UMEA 2PXAA 5CPFA 2MYUA 5LLSA 4A6XA 5COAA 5K8LA 3UJNA 2YXLA 5ARCA 2HO5A 1W85B 4QPPA 4COOA 4BZQA 3REQA 4XM0A 4JXKA 2CGEA 2WJZB 1CUBA 1IJFA 3ZWVA 3K1AA 1CY0A 2F1OA 1X7XA 2QSYA 2YJ5A 1PGOA 3GF4A 1IOVA 3STYA 1GGEA 3ZH9B 4F4DA 4RBNA 2WSSD 4MVJG 3MD0A 1GKLA 2YUTA 4Y2PA 3CIOA 2NP6A 1CUZA 1YULA 2GPYA 4R1TA 4YT4A 1NVKA 1P1FA 1XI2A 4HDRA 1RTTA 5DOVA 5L8VA 5B57C 2OG2A 4O0LA 2X8WA 3H97A 4RFSA 1GQ2A 4D5EA 4IJ5A 2VRNA 2D5IA 3F3MA 3PX2A 1I2ZA 3TRDA 3M1AA 5I4BA 2P2DA 1ZI9A 4RFVA 3U3OA 1D2RA 3U1BA 1UZUA 2I54A 4QBIA 3V6LA 5JW6A 5C8ZA 3T3HA 2DCUA 2IYQA 8GPBA 3K0AA 2DPGA 4R2IA 1GPAA 2REXB 3GVXA 4QEDA 3OKCA 4MIYA 4BRWA 3R0QA 5EVJA 1BDBA 1HKHA 3EZFA 4QOFA 1JKJB 3H5LA 3KRTA 4X1IB 3R4VA 3OZDA 2XIQA 2HJ9A 2Q3JA 2VJNA 3DZFA 1A8QA 1X9GA 1BXZA 221PA 3KUCA 2G04A 3QUQA 4BB5A 2C97A 3LXXA 2K4MA 3D3WB 3DR3A 2GPWA 2O8EB 1NMXA 1JA1A 2QQ0A 3GPLA 1IBMB 4OJTA 1JDTA 4DJDC 3VPXA 3H5OA 2CXHA 1KI8A 3ZC3A 5HM6A 3M83A 4EABA 4HYEA 3ZWWA 5MN4A 3PGVA 2AUMA 1J25A 4PN3A 3I4FA 2V58A 4M9SA 2ZOSA 1ADGA 4GLJA 1XU4A 2RGNA 2Z04A 1U81A 1WEKA 2J3MA 2WSLA 1VE7A 3DG9A 1U6KA 3QVVA 4UQPA 5B1DA 2AUNA 4IFTA 2NLOA 2OCYC 2WG2A 4B6PA 3RR2A 3C8HA 1PFYA 4Y6PA 1PUJA 2JCSA 1RJWA 3L4KA 5F7OA 2HJVA 4G24A 1S8OA 5F2EA 4RLFA 1E7YA 4QPNA 3TCXB 3JQFC 2BFFA 4TVBA 3ZJ5A 1YZYA 3AIKA 3A32A 3GPCA 2G08A 4TWJA 1Y82A 3SNHA 1PW5A 1P9LA 3SFVA 1N0UA 4G5XA 4N82A 3GWGA 4UNRA 4RYDA 5H82A 3O4RA 5LQKA 1HT2E 1Q1NA 4MVCA 4CKZA 4L50A 4M86A 1II9A 1YOVA 4CI9A 6GPBA 1D03A 4OHFA 2P0EA 5F51A 1D07A 1M34E 4YCDA 1HDGO 3L0BA 1LJ8A 1NPYA 2GQ0A 3O4HA 2H5JA 2P3SA 1L7DA 3P94A 1PIWA 4Q9NA 3T6KA 1UJ6A 1GCOA 3DOOA 4OD0A 4NEQA 3FG9A 2RHBA 3KPUA 4TXHA 4DQUA 1D1SA 3QOFA 3QPAA 3TXXA 1G3QA 3B3GA 3L7IA 1VPEA 2O54A 2WT9A 1Y9DA 4JENA 3BE8A 3FDZB 2A94A 2HDWA 3CSUA 4URWR 1A9QA 2VA8A 2HWXA 5GAJA 4IW3B 2O2GA 3WWPA 1Q22A 3MS4A 1P74A 3FBWA 1D9XA 5BQ3A 4NF2A 4B3HA 1FC0A 1ODIA 5FRDA 1SD2A 3WL3A 2Q29A 4UHCA 5FUWA 4NDAA 4B4KA 5LD2B 1YK1A 3CZ5A 5JHHB 3UJPA 1TAUA 1ULHA 1VCOA 2CMKA 3GEIA 4KDCA 3ILYA 3FUXA 4I1VA 4DJAA 1J9EA 1I0LA 3EULA 2WAOA 4EKEA 1W9MA 3TCKA 4D41A 1W88A 1KI6B 2JRLA 2WSSA 2F3QA 9GPBA 2B4AA 1X92A 2OGSA 4NFSA 3RYCB 2XKJE 3AG5A 4GC5A 4Z9XA 1GIAA 2YCLA 2FPGA 3H5TA 4J1SA 4M1EA 4P92A 4WADA 2OV3A 3UGTA 4YJGB 3TSWA 1Y5IA 2VTDA 2O0MA 4MW4A 1SU6A 4PVCA 4XDYA 1MEEA 3BIWA 2WHXA 2D74A 1UOPA 3MJ4A 4X84A 2YV3A 1E6WA 1SCQA 2ISQA 2ZUBA 4GWLA 3S40A 3ZG6A 3RROA 3SR4A 4DANA 1QGUA 1XD9A 2P4UA 4BBZA 1PDOA 4XYBA 2JCYA 4WH0A 4IMPA 4M8SA 5EG5A 5SZHB 4GIBA 1VGRA 1N2JA 2IXBA 2A9VA 2F1RA 3IALA 2M6KA 1JZTA 1R7RA 4B3JA 1W93A 5A2GA 4GE3A 3GL9A 3LKDA 4BTLA 3KJZA 4Q7MB 1QYDA 2IW3A 4DJJA 3BILA 4RMJA 3F5QA 1Z0AA 2X5XA 4F2DA 3K0BA 4U63A 4U9UA 4LYAA 1LX6A 3DPIA 3UGKA 5IRCD 2A9KA 2O57A 1PJBA 4EUKA 1RD4A 1AURA 1P81A 4HWOA 4YP9A 5EJFA 4J3JA 3UGQA 2R8XA 3ZBQA 3UOWA 3U1VA 1YB2A 4UM9D 1OU4A 4GR9A 5LCXA 4BKPA 1KDPA 2GD0A 4H1VA 1MX3A 1UBGA 2X4GA 2ZJ6A 1LK5A 4EJ0A 2GZHA 2H6EA 3AO0B 4LJ9A 1XAGA 4WRRA 4Z0PA 3W8NA 1RBYA 5IS2A 4J1TA 1V47A 1OJ7A 3PUVA 4YI5A 1Q1EA 2XCIA 4WXEA 1PHRA 4IOKA 1J8DA 3RVNA 3VKUA 1ABBA 1MABB 2ZWVA 5DT9A 1YL6A 1FQJA 1UMCA 1EGHA 1GUBA 1DIRA 1KEVA 2D5BA 1CR4A 2I4LA 2HDHA 1TCUA 1YHYA 2PPVA 1RRKA 3HB5X 1QRTA 4PG4A 5C4IA 4DA8A 3NV9A 3PPVA 1XRJA 2GLXA 3AY3A 3O3CA 4H7EA 4YJ3A 2QXYA 4JB3A 4U3JA 2HGSA 5LQMA 2C9YA 4MIKA 3VHQA 1NU8A 1C30A 2X1HA 1SBQA 3ET5A 1VKRA 2C4WA 1TUGA 2JARA 2ORED 5JISA 2BMDA 2CBGA 2ZSAA 1KPIA 2DP4E 2BWJA 4EM6A 4MZDA 5ICSA 4GT1A 4MR8A 2EQ5A 2VJPA 3ME5A 1LUAA 1FP4B 2A4MA 4TKLA 1EDEA 3BGWA 4LUCA 4HNAA 5JS7A 3HO6A 1BJKA 2GXAA 4AMBA 3ELBA 1WF6A 2G9RA 1T10A 3DBOB 2GJSA 5AOVA 2QP3A 1P1RA 3CBQA 3Q3IA 3WYBA 4ZAWA 1RWWA 5IXYA 1YVEI 5HDBB 1RMYA 2E1RA 4BO9A 1T0BA 3R8XA 3HGMA 2G09A 3F67A 5ECDA 3RT9A 3D4LA 3IUJA 2ANBA 3Q9UA 1OWNA 2Y1XA 4ZQCB 5EWLB 3ZKWA 4RSRA 3WWDA 5K0ZA 1TM2A 1G21A 2ZSHA 2IL1A 1MIOB 3BK7A 3G2IA 4HEHA 2QN9A 4JKOA 3WJ7A 2DQKA 4LA4A 4PZAA 1HC7A 4EYGA 4KFRA 2ILTA 2QTRA 1UKZA 3UGJA 5I9SA 3HSYA 4KQEA 1YQUA 3PPYA 3N2KB 2YN4A 1L8XA 3DTYA 1RCUA 3PIRA 2IZ0A 5LXTF 3DONA 1L5WA 2ZWIA 1F4PA 4DPKA 4EI7A 5BRNA 1G0OA 2RARA 4RANA 2O20A 4KIGA 2DWUA 3LK6A 1UPXA 3DEYX 3SQWA 4C20A 3C6MA 1FSSA 1O6FA 2I0FA 3H8JA 4FONA 4YP0A 1N0HA 3W3AH 4G8JA 1QK3A 4RHYA 5ALHA 1UXHA 1ZJYA 4RK6A 4AN1A 5T7BA 1T2CA 3CLSC 3MM4A 1HETA 3Q0IA 4QLBA 3K15A 1H42A 1W5TA 4PC7A 1GQRA 1JE0A 1H6BA 4EJSC 1J5XA 1Q91A 4D02A 1AX9A 2TMKA 2VUHB 2OUIA 3WRYA 4LAFA 4NAHA 1FCJA 2XKBA 4MRSA 2OMEA 2Q41A 5JJKA 4M0KA 4GM1A 4A15A 3UWPA 1Y6RA 3UATA 4BGIA 4BL5A 4QELA 1U80A 1CQXA 2Q27A 1GP2A 4Z6KA 4Q4AA 3QVKA 1SG0A 4TWRA 1U7UA 2FP3A 3AVOA 2EWVA 1OYYA 2BFMA 1ICEA 1TM3E 4IQ4A 3SQOA 4UVIA 2D5CA 1UC9A 1AS2A 4U2FA 2Z6UA 4O5OA 5DHTA 1M0TA 1WB5A 5DXFA 3RK0A 4EG8A 4PM4A 3DXZA 1L5GB 4CKWB 4F5WA 3EGWA 4ZEVA 2JIOA 2J9FA 4P32A 4JGBA 3LWDA 3EVCA 2C2YA 1IL0A 4BKRA 1YQTA 4XUDA 2NUAB 2CKDA 2WWVD 2IWRA 3ER6A 3PJEA 1N5RA 1MORA 4FE7A 4HN4B 2C92A 3TXAA 4E30A 1DQPA 4FM9A 3O8NA 4B7UA 5BW4A 3AUAA 4ZMRA 3PF8A 3PDJA 1O6BA 1INLA 1BVUA 1CVLA 4R1OA 4Y6SA 1N8SA 1H6DA 3W7BA 3WR5A 5I4KA 2OQVA 3BT7A 1U3GA 5FJJA 5FULA 3VOAA 1FFYA 1MQAA 1M6VA 2H65A 3KJIA 3TLGA 1YZTA 3QPVA 1AF4A 1E2PA 1JHZA 3G7NA 4ODIA 4BNUA 3FR7A 4AG6A 3W6UA 5HUJA 4RF5A 4IRMA 1E89A 5JECA 2J6IA 5DU2A 1E9EA 3LPAA 5D3KA 3ST7A 4TT3D 2HLNA 2QVZX 3SJUA 2IYFA 5HFNA 3ROKA 3REFA 1RM4A 1HH4A 3C14C 1JZSA 4ZEOA 4Y67A 2P2LA 2F67A 2LZ0A 2P1ZA 4P4LA 5LN1A 3QUSA 4OYLA 4PEVA 2GVNA 2X5OA 4HUQB 4B6EA 2XA9A 4L9SA 4RLHA 3BA1A 1U2EA 3CN9A 4J16A 3JARB 3HDHA 4OYRA 5K8JB 3GLTA 3PWSA 5HCUA 1B6GA 2XHEA 3WWCA 3EGDA 4L51A 1CDEA 1A2BA 1T3GA 1TW3A 1U5CA 5D3MB 3CLRC 1G5FA 2J46A 4L76A 4O0MA 3T1OA 4O3MA 4TL8A 2IZ7A 2OECA 2QYTA 3NBZC 4WWHA 3FHCB 3X2SA 1ADFA 5DPMA 5F33A 8MHTA 2OTCA 3KE9A 4PSAA 4PWZA 1W36C 2OGWA 5HIIA 4QGGA 5CB0A 1DKMA 1S5PA 1Z2CA 3P0HA 4IIVA 4ZVQA 5K8CA 2DPLA 4PTYA 1G8MA 3BHMA 4F71A 3PXAA 4FPXA 3AOEA 4BASA 4HAIA 4R31A 4FSHA 3KSBC 1QVWA 1JNYA 4PCUA 4ZC1A 5AXBA 1SUAA 5DK4A 3IV7A 4D42A 2JFUA 2P77A 2YCBA 3MTJA 4RV5A 3F7TA 4WINA 4R2HA 1Z9BA 3FLBA 2VHUA 3GEGA 4N3CA 4OPMA 2ZSUA 2B9VA 4WD3A 3PE6A 1J24A 2I4RA 2PANA 3MZ0A 3P2KA 3L8MA 4DCMA 4F7DA 3F4KA 4CNBA 3U6BA 1DAGA 5REQA 3AEKB 2CLDX 2XQGA 5IPFA 5CW2A 3VJKA 4LF8B 4HX2A 4HXGA 4Y2RA 3RO7A 1O5IA 3I8XA 5AIAA 1BFKA 5EHQA 4DYDA 4G37A 4CTJA 1HMYA 4WKGA 2Z8YM 4MO9A 4MW9A 3IT2A 4OCZA 1EX7A 2V45A 2A8YA 1YJ5A 5LMNB 4WNCA 3GDWA 3DR5A 3VKVA 4CF7A 5JQGB 1YQQA 1QANA 4YFVA 2ZJ1A 1VJDA 2GKGA 2ZR8A 4LDJA 3EISA 4INJA 4NCKA 1ZD9A 5C52B 2ZIAA 2I62A 2C96A 4IXDA 1FNCA 4J0EA 5ALRA 2YWRA 4G3XA 1VLZA 1SKMA 2QAGB 3NR2A 1U9ZA 2NSJA 1O57A 4C30A 1J8YF 3U9LA 4LVNA 2CXTA 4BX0A 4YLYA 1IMJA 1A5BB 3MMSA 4MV5A 3CVVA 4CL3A 1HDZA 3SZ3A 3R3UA 4HO1X 4AYTA 3V34A 4TN5A 2X15A 3O8QB 1ZY2A 4KPGA 4OXYA 3RE1A 4ZZ1A 1YVRA 2ES4A 4KYIB 3WK8A 4LDQA 4FYVA 3ESZA 4HAUA 3T9FA 2QB5A 1UBRS 3E9RA 5LBTA 5CA0F 3ITDA 1JQEA 1KNQA 1UIMA 4QHTA 2IHTA 3B20A 1K4MA 3CR3C 1GPJA 1Q0ZA 3PFCA 1WXXA 2PEYA 2B4QA 1A8UA 2BI7A 5IABA 3HN2A 5JVDF 3UAYA 1CE8B 4HDAA 5AHRA 5EZ5A 3RANA 2QRPA 3AUKA 4JNKA 5EGNA 5ECGC 3SEAA 1Y3IA 1NRJB 2ZVPX 4BMNA 4MQUA 2AXQA 3Q87B 1YB4A 1KPGA 2HA5A 4PYIA 4FVTA 1Q5PA 2H29A 4DY6A 3NJRA 2FZLA 4IDAA 1CZKA 1DTWB 1BXKA 4C4SA 4FZRA 1RQ2A 4M1SA 4EVSA 1X7ZB 2QX8A 2VNJA 2R84A 5JOQA 4WK4B 1EIZA 3LC2O 4HZIA 2FZ4A 4TT3A 3TQOA 1XRRA 1E9CA 3PJGA 4O4IF 4UJ3A 3OJLA 3OCVA 3R20A 4NYMR 4Q48A 3RS0A 3W8RA 4DW8A 2EL7A 1JKJA 1H3NA 4ZXPA 1C4OA 2NXCA 5F9MA 2AL7A 4MKHA 5H9VA 5EP1A 3Q0EA 1EFUA 4FSDA 2XQFA 3LT4A 4B8YA 3D3WA 4IIFA 2IYEA 2O8EA 1W0JD 2NXWA 1BWQA 3L7JA 4BVFA 1EX9A 4KODA 4WACA 2OK8A 1BH2A 1LXCA 1OHHD 3QU5A 3VC1A 3MINB 1YA6A 4N8SA 1OTXA 2F59A 5M7EA 1ONPA 3K92A 3NEYA 4PO1A 1GUDA 3JPYA 3RS7A 2DEUA 1L7BA 2GOYA 1OZ0A 5EUCA 3JQCA 2VIIA 5FP0A 2O3TA 4EGSA 1WDTA 4DWVA 1QQ5A 5A0TA 4P4NA 3NG1A 1BO6A 4OO3A 4Z4EA 3B6MA 3EDCA 2QAIA 3U60B 3F5DA 2DB3A 5BPFA 3OUTA 4GBMA 5HMLA 2LTAA 4QULA 4ZCMA 6LDHA 3NGLA 4NBTA 5DJ5A 5JS2A 3UT0A 5EL0A 5K8VA 2NU7B 2QG9A 2R86A 2C3PA 4X60A 1XMXA 3ZZTA 3ESXA 4ZDJA 2QLMA 5FUQA 2CV0A 3FVRA 4PCAA 2E21A 3QZUA 3ZDEA 2KW5A 1VE3A 1GQSA 4NV0A 5E0KB 2IP4A 3OQOA 3LDHA 5DHSA 1HT3A 1YH3A 3HCAA 3S2EA 2PMBA 2D2IA 3NHLA 4DXDA 3EVBA 4DCOA 4D8XA 1UR5A 5TJHA 1CHDA 5DASA 3Q7IA 3FTFA 3DW1X 1DS6A 3IAS6 3F97A 1KAQA 2GLTA 4HAOA 2YZNA 3SM9A 3W1WA 5A71A 4ZV4A 2BR5A 3VR6H 1RPZA 3FOZA 1BC5A 1WG8A 4MI1A 1E2FA 1RVV1 1P1HA 2J1LA 3NH6A 4JJ7A 4YA6A 5CCBA 3PUXA 3WRXA 2H2AA 2AZXA 2JJ2D 4Y2VA 3DAHA 1B76A 4FYHA