5K0JA

Crystal structure of comt in complex with 5-[5-[1-(4-methoxyphenyl)cyclopropyl]-1h-pyrazol-3-yl]-2,4-dimethyl-1,3-thiazole
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
220
structure length
220
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 79
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k0jA00
4RTOA 2GLUA 3EMBA 2O06A 2PWPA 3E05A 1ZGJA 3OPNA 1AQIA 1YB2A 1VL5A 2GH1A 1NW5A 5HOQA 3HA5A 4GC9A 2G1PA 4KVZA 5C1IA 2OXTA 4C03A 1D2CA 5LQAA 3EVGA 1I1NA 1TW2A 4KRGA 4RTSA 3B7PA 4BY9E 3GRVA 2C7RA 4EKGA 5LQUA 2P8JA 5E1DA 4CKCA 2P35A 4MQ4A 3UJ9A 3PVCA 5CVEA 3DUWA 3KQOA 2CKDA 1G60A 2JH9A 4AX8A 5KVAA 1Y8CA 4PCLA 2BR3A 3AJDA 3FPJA 3EGEA 5EZQA 1SQGA 4QDJA 1DCTA 2XVAA 3KU1A 2IFTA 3C3PA 2R6ZA 5GWXA 2PT9A 3VSEA 3I64A 4ER7A 9MHTA 4RX1A 2ZZMA 3QOWA 3SGLA 4DM3A 3P2IA 2AVNA 2UYQA 4OA5A 4IV8A 2P7HA 5DTMA 3KPVA 3B3GA 4RVHA 2HNKA 5BP7A 1P1CA 1RI3A 1QANA 4BP3A 2UYOA 3CJRA 3NMUF 1RJEA 4RV9A 3FTDA 3VYWA 4YUYA 5LQJA 3KKZA 1UFKA 4E33A 2B25A 3HEMA 4MWZA 4YMGA 4Y2HA 5HEKA 5CUQA 2PX8A 4GUAA 3BWCA 3DXXA 3K6RA 2VDUE 3P9IA 1XCLA 1NKVA 5EHGA 1XVAA 1G6Q1 2B3TA 5CVVA 5EIWA 5ICFA 5FWAA 4DCGA 4CKBA 1AF7A 3HM2A 4RTPA 4HH4A 1QAMA 4ATNA 2ZFUA 4DCMA 2OY0A 2QE6A 3UJ7A 3G8AA 1L9KA 3OE5A 4RVDA 3MCZA 4C05A 4RTMA 3DMFA 1YFLA 2DPMA 2GB4A 2PT6A 3HVIA 3C0KA 4GF5A 4C07A 4GQBA 5BW5A 1MHTA 2ZVJA 3MHTA 5HIMA 3CKKA 3KQVA 4R8RA 3CC8A 3TRKA 5E1MA 3HVJA 3PX2A 3X0DA 4C08A 4RTKA 2AR0A 2NYUA 3HP7A 4RVFA 5FQNA 4XUDA 3AWIA 2AOVA 3O7WA 1X1AA 2CWWA 3KR1A 3P9KA 4HG2A 4YUXA 3EEYA 2P1DA 2VP3A 1R8YA 3THRA 5C9ZA 3DOUA 4E2XA 1EAMA 1SG9A 3M6XA 4M7RA 1Z3CA 4KIGA 3OFJA 3HCEA 2UZ4A 7MHTA 3GRRA 3L8DA 2XYVA 1YZ3A 3CVOA 1WXWA 3T0IA 1XXLA 3OE4A 3GXOA 3FTCA 3LBFA 2FK7A 5DPMA 2GS9A 5P8WA 5K03A 2GPYA 2VS1A 4EMSA 3R24A 4HRAA 1VBFA 2AOUA 3EGVA 3M6WA 3UJAA 1XDSA 4DZRA 1HNNA 1P39A 2IGTA 1IM8A 1JG1A 2WA2A 3BGVA 3LKZA 1XDZA 3AY0A 1V39A 2H1RA 2QM3A 1I4WA 2Z6QA 1SQFA 3PLAE 1RI5A 3ID6C 2O07A 1X1CA 2P41A 3T7TA 2N47A 3I53A 3PS9A 3G89A 3TPZA 4DMGA 4YMHA 3ER9A 2K4MA 2C7OA 3LPMA 1EJ0A 1O9GA 5ERGB 3BKXA 4R6WA 1ZQ9A 2Y1WA 5HZMA 3NW9A 5EC8A 2NXCA 4BLWA 1NW3A 5EZSA 4QTUB 1VE3A 5LQCA 5FWDA 1NBIA 3IEIA 2QYOA 4MTLA 8MHTA 3LL7A 2I7CA 1HMYA 3BGIA 1NT2A 4WXHA 5EMMA 4PNEA 2YXLA 3G2MA 4K6MA 2PLWA 3M33A 2IH4A 5HFJA 5MHTA 2PJDA 1NV8A 2PKWA 3A7EA 1UIRA 3EMDA 2O57A 2YX1A 3GWZA 5E9QA 4YUZA 3GIWA 4NECA 5H02A 4QQKA 5ICEA 1VQ1A 3A7DA 4X63A 4IKPA 4L7VA 4FT4A 5E2BA 3TFWA 3V97A 2NP7A 2OO3A 5U4XA 2AOWA 5GM2A 2FCAA 2BR4A 3P8ZA 2GA9A 1JG3A 2ONYA 2PY6A 2OPBA 3E8SA 4X60A 4AZTA 5E1OA 2PSSA 5LQKA 1BKYA 2NXEA 4B17A 2C7QA 3A4TA 1KPGA 4ER5A 1KPIA 4HGYA 4ER6A 2IIPA 4FSXA 5CVUA 1U2ZA 4HSGA 3KR9A 2QRVB 4RTJA 1WXXA 5DM1A 2ZBPA 5DSXA 4KWCA 4YUWA 1AV6A 3KQTA 2V7EA 3UBTA 3A25A 3CCFA 2JG3A 4HC4A 1R74A 4X41A 5K0JA 4C04A 5DLYA 1IXKA 3I58A 4QQNA 4RTRA 3CJQA 2NP6A 3LX6A 4P7GA 4QTTB 1B42A 1AQJA 3SXJA 4QVGA 3Q7EA 4GBED 4O29A 4CTKA 2Z6UA 1WS6A 2BM8A 3RIEA 5GM1A 4AZSA 5GINE 5K01A 2IPXA 2OYRA 3OCJA 5DX1A 2PXAA 4RSRA 2AS0A 3HCFA 3KPWA 3G8BA 3AXTA 4EVIA 2PXXA 1DUSA 5EKXA 3SSOA 2ORED 3HCDA 3LKDA 3OU6A 2WK1A 1WG8A 1P91A 2IP2A 2ZSUA 5EIFA 5K0NA 4PIPA 2P3QA 1ORIA 2NXNA 3JWIA 4LWPA 1JTFA 4CWAA 3EGIA 2EG5A 3GDHA 4PYKA 2ZBQA 4FGZA 5EEHA 3TKYA 5K0GA 5EMLA 4GEKA 3FTFA 1RI4A 2OB2A 3MERA 3LECA 5DXJA 3HTXA 4OQEA 3TR6A 5FA5A 3REOA 2HTEA 3UA3A 2ERCA 1X1DA 5M5BA 5HIIA 1FJXA 4PINA 1JTEA 2AVDA 3MAGA 3DP7A 3FPEA 2UYCA 3BKWA 3KQWA 4R8SA 1QAQA 2JHPA 5CD1A 2IBSA 1R8XA 3GJYA 3R6TA 2JHCA 3M6UA 1O9HA 3EEOA 3KPYA 1TPYA 3MCTA 4PGHA 5KQSA 2XYRA 4CXMA 4AUKA 4DF3A 5DWQA 4U7PB 3LSTA 2FPOA 4FR0A 4WVLA 2VDVE 4PYMA 2B2CA 3EVZA 3FRIA 1Q0TA 1WY7A 5ICGA 2H00A 4POOA 3ERCA 2AN3A 4KIFA 4PIMA 1L1EA 4E2YA 3UJBA 3DXZA 5K0FA 1D2GA 4PYQA 1G8SA 1FPQA 2PX5A 5T64A 5EMKA 4QDKA 5G02A 4CKEA 2FK8A 3NVMB 5JR3A 2WA1A 3GRYA 3SSMA 3LDUA 3UJ8A 4RYLA 3C6KA 3T7SA 5E2AA 2BR5A 2CMHA 5FTWA 2JJQA 2ZZKA 3HA3A 3T7RA 3LCUA 3I9FA 3B5IA 3BGDA 4FSDA 3G88A 5EHIA 4YV2A 4LECA 1RI2A 2F8LA 4LG1A 1SKMA 3HCBA 4XUEA 3UJDA 5LQRA 4XUCA 1VIDA 1D2HA 4PYLA 5FA8A 5T6BA 1G38A 5DM2A 2FHPA 3Q87B 3NDJA 3NWBA 3PT9A 3UA4A 4OBXA 4IV0A 3GRZA 5DRYA 5FQOA 4Y30A 1KXZA 1N2XA 3R0QA 3LGAA 3EVFA 5K0CA 3MQ2A 2XVMA 1JSXA 3DMHA 3GU3A 2I6GA 4A6EA 3TKAA 4F84A 2EX4A 3NWEA 5FHQA 5DT2A 1EJ6A 3WSTA 4M36A 3ELWA 3FYDA 3JWJA 2PX2A 1ZKDA 1M0EA 3UWPA 3FUUA 3NVKI 3TM4A 1YFJA 1JQ3A 3GO4A 3HNRA 4GOND 3TOSA 3P9CA 2Z6AA 4X61A 2ONZA 5DM0A 3B3FA 3QV2A 5HIKA 4U7TB 1OR8A 1T43A 1L3CA 3FPHA 5HILA 3O4FA 2G70A 1TW3A 3VC1A 1R00A 2QRVA 3FZGA 5E1BA 1G8AA 5GIPE 4UOEA 4QPNA 3C6MA 5LR6A 3RODA 3IV6A 5CM2Z 1XDUA 1QZZA 5DX8A 4MHTA 4P7FA 4DQ0A 3KQPA 3KQYA 4IWNA 5CIYA 4PCAA 2CL5A 2I9KA 3OU7A 4F86A 1M6EX 2ZWAA 10MHA 5FHRA 5EVJA 5JUWA 1YF3A 3HVHA 4GOLD 3OFKA 2V74B 3D2LA 2PV0A 3KHKA 4P7JA 1L3BA 2JHAA 4E2WA 1F3LA 3MB5A 1ZGAA 3GCZA 2Y1XA 3HCCA 2ZBRA 1XTPA 3DLIA 5CCXA 2KW5A 3SVZA 3BWYA 5IH3A 2VZ9A 1N7IA 3FPFA 4GC5A 3LDGA 1Q0SA 3M6VA 3DXYA 2YQZA 1FP1D 5CVJA 1KYZA 2ZLBA 4CTJA 4DA4A 3NJRA 3P2EA 2NNWB 1EQAA 3MGGA 1M6YA 2YR0A 5CCBA 3ANXA 3OZRA 2LD4A 2FRXA 2B78A 1VP9A 2XYQA 4HTFB 2HR1A 5FULA 3FUXA 3KQSA 1KR5A 4F85A 3FUVA 3CGGA 5D1NA 3OZSA 1NW7A 1L3IA 2EFJA 3I5UA 5DX0A 4RTLA 3FYCA 1JG4A 2AN5A 3MTIA 3THSA 2ZTHA 3UZUA 4E70A 2GAFA 2IBTA 1MJFA 4X1OA 3R9XB 2AN4A 4HGZA 2PX4A 3JWGA 4PGGA 4M38A 4ER0A 5ICCA 1DL5A 1ORHA 4KDRA 1R6AA 3UJ6A 2ESRA 5K05A 4PYNA 2P40A 5FCDA 4GOOD 5EQJB 4EKIA 1PRYA 3P9NA 4FZVA 4XCXA 4QPPA 4ER3A 3FUWA 3BWBA 4OQDA 5E9WA 3SR4A 3DLCA 4BLVA 4DKJA 2XBMA 3G2PA 3QOXA 3E23A 3B3JA 1JSZA 2PWYA 3DTNA 4AZWA 4V0RA 3IHTA 4EK9A 3KR2A 4H0NA 4OA8A 5D1HA 1FP2A 4PYJA 2IH2A 2BM9A 2IDKA 1PJZA 4FP9A 1NE2A 3EVBA 3SSNA 5K0EA 1VP3A 3EVAA 3P71T 3NTVA 5EPEA 5KYGA 1NBHA 3KPUA 1SUSA 4PONA 3K0BA 1SUIA 2ZWVA 3GNLA 3KQQA 4G56A 3PFHA 3LHDA 4FS8A 3EPPA 3V8VA 3PFGA 1KP9A 5DRTA 5GOZA 1KPHA 3JWHA 5DM4A 2DULA 3UFBA 3C3YA 3EVCA 4YV0A 5GIOE 5DTQA 3BT7A 3OU2A 2JH8A 2O0LA 5DTRA 5LSAA 1ZHFA 1RJFA 3HA7A 2R3SA 2OKCA 4A6DA 4V0QA 3EVEA 1RJDA 5DXAA 1WZNA 1NW6A 2ZIEA 3G5TA 2ZW9A 3E7PA 3BWMA 3F4KA 3LBYA 4BLUA 1P1BA 3PTAA 1EIZA 2AOTA 1X19A 3HVKA 3LCCA 2CMGA 2PVCA 1JR4A 3LCVB 5FUBA 2VDWA 2EJUA 2O05A 2NXJA 4RVGA 3UJCA 3O31A 5F2OA 3AXSA 5T67A 1X1BA 1R18A 3FUTA 5HIJA 3A26A 2QY6A 2ZIGA 4GOMD 4P58A 4M37A 5E8JA 2B9EA 3R3HA 3IYLW 5K0BA 4RWZA 4EQZA 3TMAA 1YUBA 5F2KA 4KDCA 5EMJA 2YUIA 3SX0A 4ZTBA 5LQNA 2IH5A 3VC2A 2G8NA 2PBFA 3U81A 4Z2YA 3M70A 2E5WA 5IKMA 5GP1A 2AOTB 4YUVA 4QVKA 3B89A 4E32A 3BXOA 4KW7A 4MIKA 1BC5A 2HMYB 1EG2A 1FBNA 2PXCA 3GRUA 1SVUA 3P2KA 3SM3A 1VLMA 3ER8A 1JQEA 1I9GA 5KQRA 1IY9A 1H1DA 3DMGA 2ZCJA 2FYTA 2YXDA 5EG5A 3KR0A 4FT2A 1VPTA 2YVLA 3BUSA 3P97A 5EOVA 4R05A 3FRHA 2P3LA 3LDFA 1RJGA 3PB3A 3A27A 3HCAA 2PGXA 1QYRA 3G7UA 3TM5A 2HV9A 3CBGA 1O54A 2BH2A 3H2BA 3DR5A 1NW8A 3NDIA 4OX9Y 3ME5A 3G2QA 1NV9A 2A14A 4C06A 3S68A 4R6XA 4YV1A 4PYOA 3FTEA 4OBWA 4AZVA 3ORHA 2BZGA 5B1SA 1UWVA 1F38A 2ADMA 3TLJA 4BP1A 3ELUA 3EVDA 1INLA 3PX3A 2P7IA 5EGSA 5BXYA 3G5LA 3DULA 5KS2A 1XJ5A 3FPGA 2G71A 2EJTA 1RI1A 2OBFA 5EEGA 2OB1A 5FADA 2G72A 4RTQA 3KQMA 4HTFA 2UYHA 2HWKA 5K8VA 3MTEA 5F2NA 2AOUB 2H11A 2Q41A 1QAOA 2C7PA 5BW4A 1KHHA 1KYWA 1YZHA 5E8RA 1XCJA 5K09A 3OZTA 3GGDA 5DSTA 1BHJA 4LWOA 2ZZNA 4RTNA 3CJTA 3G2OA 1N7JA 1KIAA 2AZTA 2I62A 3DH0A 2YXEA 2OZVA 4E2ZA 3KPJA 4C4AA 3M4XA 2ZULA 5E9JA 2IDJA 5CVDA 5K0LA 4PWYA 5EKUA 2P3OA 4E30A 2YTZA 5C0OE 1BOOA 3BZBA 1JQDA 4P7KA 3SMQA 4JXJA 1ZG3A 2AOXA 4ISCA 1JG2A 3TQSA 1G55A 2ZIFA 4PYIA 4E31A 3ELDA 3ELYA 3RW9A
chains in the Genus database with same CATH superfamily
4PBTA 2JFUA 2JJ2D 2RHTA 3DL4A 1WUYA 2GNOA 2PWPA 4WT7A 5BQFA 4Q1CA 3ETDA 2A1UB 4EY7A 1ILWA 1IEQA 1VL5A 2RH8A 3MSCA 1EUDA 1L8LA 3DMTC 2V7UA 1FP4A 3HCOA 4GC9A 4XD2A 1GGFA 4BAGA 3AHEA 4XDHA 2X0JA 4LK3A 1T34A 1U7XA 2ZVPX 3EVTA 3JW8A 2H1LA 4OUKX 3L6CA 1DQRA 2PA3A 1SQ6A 5TMDA 1YAHA 2DTEA 3GT0A 4WJZA 1N9ZA 3FNBA 5CVEA 4IMPA 1IHPA 3LHSA 5THXA 5ER6A 3U9TA 1M2OB 2YOGA 3I09A 4MX8A 3GFSA 2EATA 1M1NA 4PCLA 4YGYA 5JLAA 1VKNA 2XUHA 4UNQA 4FVTA 4PCUA 4G89A 1C9MA 4R83A 3E9EA 2ZRPA 4I5DA 4AU1A 1KY2A 3QOWA 4PF1A 3DHYA 2UXCB 3EHDA 3I1YA 4M0EA 2IT1A 3K70C 2GVZC 1BKSB 5TVGA 1UBEA 5ELMA 3WJ2A 1RZRA 3AUSA 1YO6A 3IBYA 3WAGA 3NMUF 2C9YA 3IHWA 1SRQA 2WP8J 5IJXA 3X1XA 3ICEA 3ZCTA 1T9AA 3H16A 1ZWLA 1U28C 4GPD1 4Y2HA 5A5FA 1XZMA 3SHOA 4K8RB 3RM3A 2QP9X 3HXQA 4BVJA 1F5SA 4IIJF 5B57C 4TUYA 2CXPA 3JATB 1KDZA 1EFPA 3H5TA 3QLVA 1W88B 3VU1A 4DCMA 4J3JA 4KWEA 5K8IA 3OE5A 4ANFA 3B20A 1H2RS 1U7HA 2JI7A 3SDBA 1XR3A 3FOCA 2XRZA 4P93A 2N3ZA 3BB4A 1VJGA 2DU8A 1G3IA 1GPWB 4E7PA 4AYTA 2YWDA 4BYGA 2QSUA 1RXVA 4TSKA 1TCUA 4RPJA 4E5UA 2PUCA 1D8TA 3QRWA 5IN5A 5LZ7A 2H5IA 2J1LA 4BOYA 4CU5A 2JLZA 1GU1A 3C97A 1ZUNB 3Q7RA 4ZYLA 3GN2A 2WU3A 3AFGA 5AKIA 1TM3E 4M55A 1T4DA 4FEYA 4BMDA 4DPKA 1WXWA 3U56A 4N5LA 4LDJA 4NI5A 5C32A 1OI7A 3MELA 4INZA 1RWPA 3FDXA 1T13A 4KXLA 2HUNA 4EW3A 1RMTA 1UBUS 4YWHA 4LEIA 1I3LA 1GP2A 2A6PA 5JSZB 2AOUA 4DZRA 1C29B 1MKYA 2AHOA 3CX3A 4N9WA 2C2HA 1GCGA 1TM2A 4JLWA 4KODA 1O94D 1F20A 4J1QA 3WQQA 3IAEA 2VT2A 2WHEA 1PIWA 4RHXA 5ALKA 3G2IA 3GLGA 4GRIA 1F60A 2IEZA 1PN3A 1JQKA 3MIIA 1LK0A 4CFZA 1KA9H 4CM8A 1X13A 2XWQA 1DKRA 3ZPXA 1NW3A 1XGKA 3AI2A 4WW0A 1YI8A 4IINA 3SQDA 5JYCA 4NCJA 4EFLA 4OEHA 4AJHA 5LQCA 5CR9A 1NR5A 1Z0SA 3A4IA 1R5JA 3QVKA 1JJIA 3HB9A 3MWLA 1CR2A 3G2HA 3LQ2A 3Q1KA 4JBNA 3M3DA 4HQRA 3G2MA 5I5GA 4PNEA 5L7WA 3TG8A 2YV2A 1CEYA 3DVQX 1P5RA 2W2VA 2CUTA 2QZSA 4KOAA 4NBSA 1N2OA 2BC9A 1OIXA 3E9NA 3EQ8A 5AMXA 4YUZA 2GMWA 4HN9A 4Q3NA 1F8UA 5ICEA 4Q03A 3DZDA 1OD6A 4XYBA 2ZSKA 3AVVA 1XQVA 2GFHA 4G0ZA 4FYYA 5AUPB 1XEXB 4YY3B 3AEYA 2NP7A 2H1IA 4WADA 3TZLA 2X8WA 4Z51A 4N0EA 1A27A 4MUHA 4AZTA 4M0DA 3FHLA 3HNPA 1Q1BA 4EAAA 3KWJA 4BNIA 5BURA 5IJ9B 5KINB 1OILA 1KPIA 3WKBA 3OJCA 1NUPA 1RIIA 1AHPA 2IXTA 1TFRA 3PUHA 5LD2B 1QHYA 4ZKDA 2N1BA 4TWBA 4AG3A 4U2KA 4F5YA 1TADA 2ZBPA 3RS7A 2P77A 1CJCA 1AV6A 4W9RA 1P9NA 1UPTA 5K0JA 1Y8QB 4M1TA 4WKGA 1A0OA 4CNBA 1X7YB 1FUEA 4QTTB 3SC2A 1D4OA 1B42A 1V26A 5BUSA 1W87A 1FX0A 1XLTA 4BJHB 1QQ7A 4HQKA 4G4GA 2A7XA 2HWXA 4N5NA 4RV4A 4CTKA 1XPUA 3AR5A 5DT9A 2PQ6A 1U3UA 4KWTA 5FD8A 4BNKA 5AKYA 1HLFA 2OYRA 4UD2A 3KPWA 4Z4HA 5K3DA 3CRVA 4K9LA 1Y6FA 3RHZA 3UVEA 2MINB 4Z49A 4MARA 4PZAA 4TZ0A 1DEAA 1J8DA 2GVNA 2PXXA 1EUCA 2WG0A 2X41A 4U0KA 2WFLB 5DBIA 4ZQEA 3QKRB 4XSHA 5C1BA 3EZ9A 5EJ9A 5K9ZA 5K0NA 3IAAA 2P3QA 2R6FA 5KKNB 1IN7A 4D79A 3SKVA 1LVGA 3TKYA 1WPXA 3V80A 1BNCA 2VNIA 3OMLA 4BO1A 2P2YA 1E77A 2HSWA 2ZIWB 2H18A 1UUFA 5B7NA 3F6YA 4C4RA 2IYNA 3U44A 1TQ2A 1W0JA 4F9EA 3WLQA 3K0FA 3DJFA 2XCIA 1DJMA 2GF0A 1QG6A 3L82B 3TTSA 3AF2A 4YBZA 3DBIA 3T5AA 4CLOA 3NBKA 2QE7A 1ZK3A 1VFNA 3CF6R 4WESA 3RIMA 5CFZA 1ZHOA 4PFQA 3V55A 1JR6A 4Q7MB 4BB0A 4E88A 1SVSA 1SKYB 1NI4A 2IX9A 4C0HA 5JHGB 1OVMA 2K2WA 4KI7A 4YS6A 3UK7A 5SY4A 3OPYA 1E3WB 1JVSA 1SK9A 1VBKA 1FXUA 2FPOA 2FUNB 2P62A 2X15A 4WVLA 1S9DA 4I3HA 1ZMRA 3HV2A 3QNWA 3G1UA 1JF8A 4WBNA 2XNJA 2ODBA 5H0IA 4B9AA 1FDOA 1X70A 2GM9A 4RGQA 3SYLA 5EJEA 5HKBA 2BSQA 1KORA 3WMRA 4A2QA 4Q1FA 3EPHA 1Q7BA 3ZCUA 1SXQA 4Z54A 3L04A 4R1NA 4DEYA 4MQUA 2FW1A 5ALSA 5CU7A 5AJYA 1POXA 2KMLA 1YB5A 4HSEA 2OP0A 3VM6A 2ZJ0A 3LCUA 1YTUA 3NBQA 1IZZA 5EMHA 3JALA 3MCWA 3N8IA 1WULS 3FSEA 3T9FA 3TCXB 4D0RA 2F9FA 2WY2D 3WK4A 1SKMA 4AQYB 4UDXX 1L6RA 3AM1A 2I03A 3N70A 1CW2B 3NPMA 4V1CA 1VFPA 3NDJA 1XJQA 3INRA 4BNTA 4EA6A 1P1HA 1PR5A 4TL9A 4WHMA 3PA6A 1RLMA 2ZIZA 2C03A 4PG6A 4JYAB 4RPIA 2SKCA 1PUXA 2QROA 3IJPA 3GU3A 1T4BA 1KDPA 4AY2A 2HBQA 4M6WB 3E70C 1RBYA 4FEGA 4M8IA 3LT0A 3U60B 1DZ3A 3AF6A 2WWFA 3CF0A 1LPBB 3IGFA 1SOAA 3FYDA 1GUAA 1M0WA 2P5SA 3ISJA 5T4EA 1NX9A 4RS3A 3FUUA 3QUSA 3GO4A 2HA4A 2X5XA 3QGMA 3HQ4O 4RNDB 4LQDA 4YJHA 5HIKA 4DV2B 3OT1B 4HNSA 3FPHA 3BHIA 1QGAA 3USZA 2X0DA 5T4HA 4QXMA 2OD7A 4KE7A 3H13A 4HS4A 1XJ0A 5EERA 4RGVA 1R00A 4DS3A 1EVKA 3HJRA 3ROMA 2VBFA 4L4RA 4QBIA 3S81A 1DBWA 2GZ2A 2EDAA 3VC3A 2PVSA 3RE1A 5F12A 1DEHA 2DQSA 3P2MA 4H2DA 2I9KA 2C9CA 1BVRA 2AA3A 2XUFA 1Z0FA 5HQ3A 3OQOA 2A4KA 2VCHA 2AC2A 4MWSA 3EUFA 3KXLA 1WKVA 4RZSA 2O8BA 4NG4A 1QKIA 3FIJA 4G0VA 1FQJA 4DGSA 3A32A 4D6XA 4X44A 4OBEA 1VG9B 3T6KA 3BK7A 3WYAA 1XX6A 2V7XA 3DLIA 4G97A 2NV6A 1NJ8A 3ED5A 3FCAA 1KMQA 2D8AA 5AJVB 1FXWF 1W2GA 1R5OA 2DFNA 1DKLA 3AB7A 3CBQA 3DE2X 3DYVA 2B8TA 2ZIXB 4FNAA 4GPIB 3IOYA 3WWCA 5I4KA 4PSDA 5CA1B 1M7BA 1JX6A 1XNGA 4XGRA 5CCBA 3FLBA 2HIHA 4Y2YA 1FLAA 1NAIA 2FMUA 2I4RA 3W1WA 2JJ8A 3FUXA 2JCBA 3OMXA 4CETA 3FUVA 4HVTA 5AK6A 5EMNA 1RABA 3AF0A 3R5FA 5HKLA 1IOVA 4I1VA 2B34A 4CL8A 1C0EA 3U80A 1YRLA 1ZOPA 5KTPA 2IL1A 3RSFA 1QE0A 3G17A 3MOSA 1A7AA 1RMQA 3L0OA 1Y5RA 1S2LA 2WWIA 3NDPA 3OSZA 1NY5A 1QQTA 4FILA 1O95D 3ZYCA 4UFPA 1MOSA 3IPCA 4KDRA 3CSDA 4OQ4A 2PYDA 3U7EB 1F8GA 2PCLA 3NJ8A 5A4JA 3OZAA 2UVPA 5BT8A 4M8NE 3O73A 5IAGA 4QIHA 1T9GS 4YRZA 1A5ZA 1JDBB 1X8LA 4KV7A 3BMNB 3QENA 3DTNA 4BUJA 4TXHA 5BUCA 3AGQA 1VI2A 4BQSA 3QE2A 4HAVA 3RAGA 5CP8A 2FUG6 1H93A 4F6RB 2QGZA 4XLTA 3T3MB 5C51B 3M6IA 2HO5A 1U0EA 4H6XA 3DMRA 1NBHA 5EZ5A 3PD1A 1CULC 4KYIB 1DMSA 4ARAA 1NJ2A 2DFTA 2FWJA 1J0BA 4KBYA 3ZLTA 4QG7A 4L4XA 1YS7A 1G6KA 5GOZA 1J22A 1QPBA 4FB4A 1O0BA 2IYLD 5LLSA 2DULA 3AF1A 3ASZA 1W5FA 3EVCA 1U7OA 2XY4A 2DSNA 2EWWA 4AW9A 3BT7A 1O6CA 1NUQA 3EZ7A 4FI3C 4P3KA 1E1QD 3N87A 3SD7A 4U6SA 1Z22A 5EJ4A 1Y1KE 1ZM3A 4QYSA 4NK4A 4JI5B 3KVVA 3HA7A 1L7XA 4M9ZA 4ZWNA 4B87A 4A6DA 4DLKA 1QR6A 1QZ3A 1XZBA 3HDYA 1WZNA 3I6IA 4GOKA 4OH7A 5KU7A 2IUSA 5M2QA 1XBTA 1EA7A 4D25A 4KL8S 1TVKB 3H9CA 3AVTA 4ME6A 3HXPA 3PHGA 3H5IA 1EE1A 4MJ3A 1RYEA 1EP2B 3F98A 5TQ2B 3RKSA 5A9TA 2CFTA 4X1KA 4RO0A 4NNJA 1UP6A 3NIBA 4LY0A 1KZ4A 4AY6A 1E3JA 1JLLA 1L7QA 1JUDA 2D13A 1T9ZA 2ZU0C 5K6AC 1EAYA 2COUA 5IARA 3WZLA 1CP2A 1NBAA 1W8DA 3ENKA 3PF8A 2Z2YA 4BVFA 5B30A 2C4KA 3W6PA 2ZR9A 4J6FA 4JLPA 5DIFA 5K6AA 1KDRA 5BR7A 1V11B 3TSWA 4EH1A 3JD4A 4NDAA 2BGGA 5HXAA 3G59A 1FYXA 1RAFA 4GX1A 3V2GA 1TO6A 3NEJA 1R0RE 2H57A 3D6AA 3WMFA 3H9BA 1RQGA 2VEDA 4XVUA 1CDEA 4Z3KA 3FKJA 4IZ6A 5HZKA 2XDWA 1M2EA 1S2MA 3OP4A 2NUBA 3CQ9A 3HCAA 5FLEX 2PGXA 2TRSB 2DXIA 4RELA 1IK6A 2VRCD 5AICA 3BTOA 1O54A 3EYAA 2PZGA 3RCBA 2BH2A 3QBVA 1L4HA 1MC8A 2JIOA 1ZCJA 5FT9A 2R8ZA 3WLKX 4EL5A 4BE9A 1A5SB 2KX7A 1P5ZB 1GL6A 1PKXA 2PH7A 3LI2A 2FV8A 2H4JA 2NZUG 3TD6A 2JS7A 3V8PA 3S8EA 2BZGA 1UWVA 3BFKA 1MV5A 4NZZA 3CG0A 5L7TA 1EGAA 1LBIA 4X1IA 3H4TA 1TIKA 3FPGA 5TQJA 3A36A 2UYYA 1Y3FE 1XVLA 3E6AA 4I7EA 4IUYA 5LZ8A 3ZNPA 3KQMA 1S3SA 3DEKA 1EDZA 3G8YA 2GBCA 4TRRA 4H7PA 2TMDA 3L7JA 3OOYA 2GUWA 2YXNA 4RZHA 4CQLB 5BW4A 3N0TA 4J0IA 1II0A 3PSHA 2HDWA 3HDHA 4LHEA 3ZBTA 2Y9MB 1ZGHA 1XQXA 2GTIA 3O8BA 4Q9DA 4X94A 4EQ6B 4AG6A 1P2VA 3BBLA 1DI0A 2OGTA 3HH8A 2JHFA 3K09A 2R8RA 4NOJA 2ZAYA 2Q8QA 1W85B 3B8HA 4N0DA 1E1CA 1WCV1 3VU3A 3ABQB 1J1IA 3GRKA 1CR6A 4DLYA 4OGLA 3OHPA 5EKUA 1KI6B 4FD3A 4H4DA 4OXRA 4DA0A 3IL2A 1JQDA 1NE7A 1SKQA 4QU8A 3SZUA 1L6IA 1BMFD 1Z33A 2QL9A 1G55A 4MINA 1QIJA 1IJEA 3IKJA 1PDVA 1RAEA 3DD1A 4KXNA 3GRAA 5BN4A 1Z6XA 3AEXA 3C41J 4L8GA 4X20A 4RJ2A 5FNVB 1H1LB 1ZIPA 4O4HA 4DM7A 2CHFA 3A10A 4B3IA 3K1YA 5BMVA 1OFHA 3IMKA 2M1ZA 2PRKA 1EDBA 1YZTA 2JGEA 2XEXA 1OXKB 3K9QO 3Q3IA 4RA9A 5TARA 3RRNA 5CYFA 1DKUA 5C1IA 3IH5A 3TW0A 3GG2A 2BYTA 3EVGA 4BLTA 4BY9E 3SQXA 1DGQA 2P2DA 2PS3A 1R4MA 1ZIYA 1ZD4A 2R8YA 4MVJP 3AK4A 5LL6P 2JK1A 1IUKA 1PEAA 3H97A 1DAGA 1UAGA 4MQ4A 3ND8A 5D00A 2F1JA 3DUWA 1B0ZA 2BFEB 3DA8A 1U7WA 4RLFA 1B0UA 5BYJA 1MC4A 3SNHA 3V1UA 4ARSA 4AX8A 5LN1A 3WWZA 3O21A 5KYVA 3HLTA 5E3HA 1COZA 1L5KA 1NRXA 1LQ2A 2YVAA 4IQ0A 3EUEA 4JEMA 3U9SA 3I64A 2FW8A 4BX0A 4HQ0A 1Z12A 3KZKA 4HWSA 4IQ8A 1TF2A 1AK1A 5K99A 4G5YA 2OMEA 3C5VA 4W82A 4Y9TA 5BP7A 3W5UA 2DX7A 1E8MA 1QFXA 1AQYA 1AKVA 1PT6A 1V4NA 5CTAA 2X0EA 1BGXT 2IXEA 3TAHA 1CBUA 1FQWA 2JFYA 3QMVA 3F78A 4C4OA 1TQ6A 4IQFA 4X62B 1THGA 2O2EA 4ZVMA 1E58A 4WLVA 3TLGB 5BVHA 4HFNA 5EHGA 5FUQA 3H5LA 1J06A 2C2YA 2VJKA 4MS3A 4DT1A 1EEHA 1AF7A 3KYBA 2H0AA 4RD1A 3ZCXA 2ZATA 5EIBD 5C1PA 2QTNA 2IELA 3AUYA 1P8JA 2PLRA 3TKLA 3UJ7A 1QTRA 2I2BA 3RAJA 3HYSA 4CMKA 3NGXA 5ES4B 3R8FA 1TQDA 1LW7A 2V45A 4WOCA 5FPHA 3WB1A 1T1JA 5CDGA 1SBZA 3OEED 1VE7A 4AJJA 4DGQA 3QV1A 2F4NA 1V7ZA 3L1KA 5IHPA 3UXMA 4MAFA 1XTSA 3MINA 3TL3A 5JW6A 5I8PA 4R16A 2B8NA 1AF4A 3P9KA 1VE9A 4ZQCB 3AF3A 5AI4A 1R8YA 1XPRA 3BFPA 4ZHQA 1DG3A 2EBFX 2NAPA 3EGWA 4U2BA 3I39X 3ZE2B 1BVYF 3IQHX 4CDGA 3UUWA 1C3EA 5CRIA 1D2MA 2Y05A 5KX5B 4H1TA 2HJRA 1TXGA 3E3NA 4NXNB 3T9CA 3N86A 5H82A 5J23A 3DE3X 2A3NA 5G0UA 2C2BA 2FUCA 5L4SA 4BWYA 1J56A 4JLDA 2JGFA 3R3WA 4AJNA 5K3CA 1Z2NX 4L57A 2XXAB 2Q3DA 3PR2B 2X8JB 1KH2A 1FNSA 4NENB 2XNDD 4TLCA 3MJRA 5WRFA 5L51A 3H5WA 4BNFA 4GKKB 1PAUA 3ETHA 2A86A 2RAUA 4JVNA 3CH4B 2BFBA 3ZNOA 1NNI1 4DREA 4MPRA 3Q11A 4KXYA 3PS9A 4BGIA 2CJXA 3LYAA 4BMNA 2B92A 1AKTA 1BROA 1XG5A 5EZSA 2J5KA 3UGQA 2HXSA 2YS7A 3VTZA 5JZBA 3D1VA 4YDRA 1MIHA 2A30A 4CQNA 4EFMA 1FTSA 5HZHA 1HMYA 1AMUA 5ELXA 2L0XA 1NQAO 2F1HA 3MTJA 4NMXB 1SZPA 2HDOA 3ND5A 1UXKA 3NIGB 3OIGA 5KAPA 3L0DA 4PC3A 1HYBA 3EMDA 2ZRIA 2X9VA 2E2WA 5EWJB 1OAOA 2D1FA 2HA0A 3WFJA 2J9XB 4WN9A 3PLRA 2UUCB 3A7DA 5KVSA 4IL5A 1SQ0A 1XZQA 4FT4A 5FNVF 1F2TA 3V1MA 3V97A 4EWLA 2DPXA 4WAUA 3RJTA 4KQ1A 2FMHA 2QVBA 4DIOA 5IWCA 3DPSA 2IQ5A 4PZDA 5CH5A 1HTTA 1UJ2A 5CB0A 1KI7A 4CKXA 4RAQA 4ER6A 3MTAA 4DV4B 2BFCA 3ZGXA 5K5EA 1A2OA 1KQPA 1M7HA 2OQVA 2NUAA 3N5CA 3I6BA 3ZWNA 1Q57A 1XTBA 3HJUA 1U0SY 4RK1A 1JDZA 3KQTA 4D3DA 2B83A 2FEXA 1JPJA 2FEKA 4QQNA 1MFPA 2FUEA 3A1EA 2NP6A 4QVGA 3IXLA 1VJTA 3LAWA 1JEAA 1N5DA 1RZUA 3OOSA 3P0IA 5IYZB 1WNTA 3PC8C 2XSZA 3QFFA 4LZNA 4QJ5A 1YXMA 4HNHA 4KXMA 5AJTA 1DV1A 2GVDC 4RIEA 3SR0A 5GINE 3KQUA 2D7JA 2OWEA 3OIDA 3PRJA 4RD2A 1AGXA 3HCFA 2IYXA 3DS8A 1KL7A 1O58A 4MTCA 5K3AA 3RRFA 3OCCA 3W9BA 1S8AA 2FW9A 1IPEA 3EGDB 2EZUA 2ORED 4GLLA 3SSOA 4RJLA 3LKDA 3ZCPA 5B7QA 1PVOA 1JBQA 2FE4A 2VJNA 2VJQA 4JQZA 1HDEA 4WCVA 3PG5A 1PJLA 1G1MA 4B3XA 3A14A 3FW1A 3EGIA 5FL7A 5AM4A 2JGMA 3AU9A 3DDSA 4QREA 2P9BA 2ZBQA 2EJBA 3QKUA 2IYUA 1V16A 1Z07A 1Q1ZA 4HDKA 1MRZA 1CX9B 1C9YA 2R1VA 2XE8A 3AFMA 3K2QA 4YACA 4HNAB 4KMOA 1TU0A 4OQEA 5AOBA 5FA5A 4WCFB 3SIRA 4D9FA 3H8WA 5EWLB 2EP5A 4EECA 3Q7QA 5DCWA 2DBQA 1NU8A 2NSYA 2OMKA 3EWSA 1LWNA 4JUIA 3O4HA 3PLNA 4QGHA 2NSLA 6LDHA 4CIYA 1FS6A 3B1VA 1DJLA 4OHXA 3BHJA 4PHCA 4TZ6A 5KQSA 1GR1A 1S8NA 2WWRA 3DBRB 4DWWA 3BQ9A 1X1TA 4DR4B 4Q3LA 2FFHA 3H6KA 2R8XA 4YT8A 2FU5C 1JR3D 1MPTA 4MCAA 4G1CA 4B3SB 1TEXA 1XMSA 2BAGA 2JVKA 4NPHA 1LWOA 2X2PA 1W1WA 1JSLA 3Q8LA 1V5EA 2NU6A 4C29A 3H1EA 4CPDA 1GGMA 1TCCA 2ONCA 2FK8A 1R3UA 1WA5A 1JLRA 1ZDMA 3UMJA 4EHLA 3UHAA 5JADA 2IOHA 1ADYA 2VK8A 4GE3A 1DINA 1Z74A 4KQFA 3RK0A 1PQYA 3T7RA 1H9BA 1KAMA 2JW5A 3I9FA 2NVOA 1IFXA 2Q2VA 2ZQZA 3L9XA 4LGYA 5F64A 1ND6A 3RUEA 4M54A 3QKTA 4MR7A 5EJ2A 4BO8A 4Z7QB 2V96A 4WZAB 1PF7E 2JZOA 3FF1A 1XQ6A 1ATZA 1IZ7A 1X94A 1GPDG 4TV9B 2CBGA 2ZYDA 5CHEA 4DYHA 1DZIA 3IV7A 4P4SA 1O87A 3QF4A 4D0GA 2IYWA 4DBLE 4WXPA 4WNAA 4BB6A 1LQUA 4E5DA 1Y82A 2FEPA 4R1SA 4QECA 1YWGO 1QIMA 3OBIA 2H2WA 3RLIA 3UENA 1HGXA 3DNPA 3T35A 3UUEA 1J6UA 1HETA 2PUBA 4OMCA 1T35A 1W5AA 4RZ2A 2FVXA 2VJOA 4ZVRA 4AKSA 2EW2A 2VDKB 4GWGA 1LRLA 2WTAA 3GELA 3MJ4A 2JGDB 4Z86A 1E6KA 2WTBA 2XJ4A 5DNYB 1YKGA 2FFRA 1EG7A 2P67A 4W5HA 2Y4NA 3DUFA 3L43A 3LU1A 1W4LA 1JDTA 4J16A 2K5UA 4F71A 1W30A 2BFMA 1MR3F 4YPVA 3GW8A 4HVAA 5CBKA 2QRVA 1PQ4A 5TPZA 3RJZA 4U2GA 3DCYA 1G9XA 2AMFA 2XZTA 3AV0B 3X1YA 1M34E 2C5LA 4DQ0A 3TZ6A 3ZHRA 2PD6A 5CIYA 1U9IA 3W8EA 3RBXA 1G4HA 1HORA 1M6EX 3IEKA 4WZBA 3P0HA 1HEUA 1VBMA 3CIFA 5H68A 4LV5B 4CIAA 5CJPA 1O4WA 2MR6A 1J5XA 1FUYB 2QRKA 2I9PA 2GZSA 1XP8A 4R4JA 2RGYA 5ALYA 2ZXFA 4CM9A 4PZZA 5IYZF 3UNXA 1OREA 2PZJA 3MTDA 1DEOA 3LT5A 3ZZMA 4F2PA 4G4SP 1F2UA 1ZOSA 2BUAA 1TZCA 3SC6A 2JGKA 3ZY5A 4LXHA 4PRYA 4IDPA 5CVJA 5LKAA 1G20A 2AXPA 4EHDA 2AW5A 2FSUA 3NJRA 2AIRA 3KJNA 1XDDA 1JU4A 2P68A 1X42A 3SSAA 1BA2A 1M7GA 2FR8C 2Q2NA 1SAYA 2GNPA 2O23A 1KR5A 5CT9A 1U99A 3IVGA 1KJZA 1UJMA 2R9VA 3D4OA 1Q16A 4URUR 4N3NA 3FYCA 4YJGB 2FQQA 3THSA 3LV8A 4QM6A 4B74A 2OWDA 1RPNA 3OPYI 3O8QA 5I7OA 2EZ8A 3SYNA 1R3DA 2GAFA 9ABPA 1SB8A 1PU2A 2Q2OA 3QLVC 4V2IA 3JWGA 3ZGYA 3LYLA 1ACMA 1FDSA 1OFGA 1XKLA 4BKMA 5C52B 1GZ3A 1LEHA 3U17A 2ESRA 1E32A 2FJPA 2EHJA 1B74A 3SR4A 2OEPA 4DJDC 2JFPA 3A1TA 4AF6A 1EIWA 4KX3A 3CZRA 1DT5A 2XMRA 2VCEA 3ZU2A 3GP8A 2C2OA 2AF3C 3KJQA 3TIGA 5K8UA 2NGRA 1YU9A 5ARBA 1QH1B 2QMUA 4WK0B 5IXJA 1DPFA 1NE2A 3EVBA 3CXRA 4NCXA 4EJ2A 3AR4A 8OHMA 1VSVA 5JZOA 1TYEB 4GD3Q 2ZYRA 1SUIA 1CDDA 3FDZA 4RADA 1VTKA 2ET6A 1RKXA 2PMBA 4EGQA 1CJKC 4FS8A 1OC2A 2DPGA 2ZPUA 4YH1A 4F2WA 2RGRA 1DC6A 4QNMA 2BKLA 1KZHA 3B2QA 4RH0A 4I1RA 4B4KA 5FI1B 2W2QA 4YFYA 3TW8B 2XD9A 3CUSA 4S1PA 5DLQC 5HDQA 3R7BA 1J8VA 2YW2A 4C3UA 2JGAA 5FAKA 2OKCA 2JI4A 3EVEA 1T8UA 2NX2A 2CL7X 1P9LA 4YV7A 5KYWB 4DBVO 1B6RA 3OJFA 3ZDZB 1Z8NA 2VYNA 2O05A 1H2BA 4R84A 1Z4LA 4RSMA 3RBAA 5B5SA 3ISTA 3GMTA 6YASA 3U16A 4BIMA 2C3YA 4D26A 3FUTA 5HIJA 4B35A 4E4YA 2XTZA 4ZCTA 4HDMA 3HABA 4NU5A 3FCOA 3PDUA 3CLRD 5IK2D 2BMVA 3GVIA 2AN1A 4PZLA 1U9ZA 4ZAZA 4RWZA 1X7XA 2QLFA 4V0LA 1HXHA 4BP9A 1I32A 3CCCA 3EODA 1MVNA 2DP4E 2V6GA 1ZJ4A 1L4GA 2CVZA 4GPBA 3D3WB 4LBWA 5LA6A 2Y0PA 3BMOA 1F17A 4D1YA 3WG9A 1EG2A 2XODA 1A7KA 3STTA 2ZYWX 3S40A 3WNDA 5C7YA 4Q1DA 2A78A 1MIOA 1M9NA 3QY0A 4YLYA 3FNGA 1L7EA 3BHMA 4DLSA 4DV3B 3AEUB 2J9GA 3IBGA 4KGXA 3P97A 2B4YA 2ZIVB 2I66A 2X2FA 3ND6A 5F51A 2G4VA 4CF6A 4XRGA 2C99A 3F5MA 5IC6A 1NKTA 1UP7A 3A1SA 3TM5A 2CHGA 5H4GA 5K2OA 5IKXA 2BGJA 5EIEA 2XCTB 2H06A 3RVBA 4DLTA 5BOSA 1Q20A 1W0KA 3MGBA 1JE1A 3GT4A 2G17A 1G8JA 3VTKA 4C06A 2A14A 3D4BA 4TMFA 3NAQA 4WUVA 3PVZA 4GBJA 3U9LA 4XYLA 1XLTC 3TSOA 4RMIA 1DNPA 1KO7A 3UJNA 3RROA 4WRRA 4DARA 1TJYA 3F3MA 3D7SA 1GGVA 2I67A 4D6YA 4WXEA 3GEBA 2H1CA 3TI7A 3HEAA 4CR8A 2DQZA 5EEGA 1TA4A 3ECAA 1AHIA 2QTZA 5JNTA 4GNKA 1M2FA 3DE0X 2GEUA 3H2KA 3O5AA 1Y80A 5EP2A 1S2NA 1W29A 1E20A 2H11A 2ZI7A 4LRUA 1CLEA 1QVRA 1CY7A 5CFRA 2C7PA 3GDWA 3INYA 1XNJA 5G1NA 1IK4A 2XNHA 4OI1A 3T34A 2FMXA 3FTQA 3GFBA 1R10A 3V8RA 2AJ8A 3VJKA 3WO1A 1QX4A 4I36A 2J48A 2QSJA 3DZGA 4Z4FA 1TO2E 2W2OA 3R75A 2UXDB 3R6LA 3VQTA 1GSOA 4JQOA 5ALJA 3UKJA 3HKCB 3R5XA 2VJDA 4H4CA 2J32A 4UQOA 3COJA 2G1KA 3QYPA 3M4XA 4FFPA 3ZKWA 3CPSA 4ZYZA 4IMRA 3SJCA 4HQFA 1TM5E 4RDCA 2BPOA 1PDOA 1L4EA 2PZAA 4P7KA 4LDQA 3T7IA 3A1DA 1ZMXA 4GMDA 4PYIA 1W36D 3ELYA 2VHEA 1GRQA 1MCZA 3ZHVA 3P20A 5EA2A 4A15A 5ADWA 1W44A 4U9UA 1R88A 3W4KA 5CEJA 2O8DA 1SU8A 3E05A 3HR7A 5IN4A 4LJKA 3WKDA 2HJVA 1G1AA 2A1TS 3ITEA 4D8UA 3ZQKA 2R7MA 5J40A 4M0CA 3TJZA 2PJZA 1C1XB 3C98A 2HHAA 3OX4A 4MVJE 4NR0A 4D3FA 4ROTA 4UARA 3WIDA 5E1DA 5FB3A 2X23A 1QYDA 1NJ5A 1PSZA 1P2SA 1B00A 2H07A 3CNNA 3COYA 2RGGA 3LC7O 5BWBA 4JI2B 4KN6A 2WMDA 4DIEA 2I1LA 1TUEA 3HBFA 5JC1A 3L6OO 4JC5A 1RT9A 3OKCA 1FTNA 2R7AA 3R3VA 4ARUA 4CUZA 2P11A 1T6NA 1P0QA 2VF8A 3C3PA 1N2ZA 3HZZA 4MEBA 4UOQA 5AR1A 1JDNA 1T5HX 3F46A 1HDZA 3L79A 3R76A 2C1XA 2QPTA 3LS2A 2IIQA 3IHLA 4IV8A 4CIXA 3KPVA 4JXXA 2XWPA 3B3GA 1IJBA 1NUUA 2DWOA 3AW8A 1HE4A 1K3FA 2VNHA 2OO7A 2HSEA 3CZCA 4NV3A 2BEVB 1U8AA 1NDUA 3U48A 4HDNB 3TTXA 3ZD8A 4D9BA 1JA1A 5EINA 1UFKA 5DLEA 1M34B 4IO1A 2O52A 2FFJA 1MVOA 3NYQA 2DLDA 3BWCA 5G0SA 1XDGA 2G0NA 2XBLA 2R6DA 3C24A 5EP3A 1TEZA 3MRXA 3T06B 3ZTWA 4EHNA 3KJXA 4CF7A 4RA6A 4UM8B 3S28A 4EPTA 5FWAA 3AMVA 2F3RA 1RWVA 4MMYB 3K9FC 4COOA 3ZBQA 4DXHA 3C4JA 4HH4A 1QP7A 5IDQA 1ZK0A 1AOXA 2RG7A 2P9FA 1KSGA 5BV1A 1YFLA 2PT6A 1TVCA 4XA8A 1OX4A 1WZEA 3W5BA 4IGFA 5EUMA 2CLDX 2NMVA 3H5OA 1F0KA 1VOTA 4HH3C 4L50A 4POAA 3NONA 2GM4A 5DW3A 1UWKA 4B47A 3L0SA 4PV7A 3L07A 4RVFA 1B7GO 1T1GA 1KOLA 1K6XA 3TIXB 2IHZA 4B6OA 5ANRB 3KR1A 5T57A 3T94A 2PMKA 1Q0PA 2PUEA 1L4LA 4DR2B 4S1NA 4FYIA 3WNVA 2Q3EA 3THWB 2F1IA 1SU7A 1QIHA 2Q5IA 3ZV5A 4HRXA 4U0JA 3L84A 2E37A 1KH3A 2OHFA 1JN0A 4WXMA 2AEFA 3GRRA 4F3RA 4X54A 1KFCB 4QULA 2IS6A 1ESMA 5I9LA 4GSYA 3ZJ5A 4K9MA 1D8AA 3G68A 1RDFA 4M1ZA 1FIUA 4QWWA 1RKUA 4IX9A 5FTMA 5HRUA 3GIDA 3ANSA 4DILA 3DTYA 4KB5A 4XSGA 1PFQA 3HU2A 4HRAA 1VBFA 1IDOA 2KQUA 3VHXA 4AWBA 4EA8A 2OCXA 3GUVA 2J3HA 3I28A 1NA5A 4IO0A 4ILEA 1BWRA 4A27A 2H1RA 4Z0HO 2GBPA 3LGXA 4GUDA 2TS1A 4UFNA 1RXWA 2QR2A 3LH5A 5BMOA 2O0MA 5GZ1A 5KYGA 1KRXA 1V37A 1DTEA 2VXOA 2YHSA 3TUIC 2WHXA 3NIFB 3IDFA 4PG8A 3HJGA 4ZAXA 2YV5A 1QRAA 2I2WA 1N5IA 1L5FA 5J2TB 4LY9A 1B2LA 4N0PA 3W4JA 4D9KA 5HTOA 4K6OA 3N6VA 1AQUA 2XNSA 1P2BA 3JAWB 4JODA 1GWNA 4E11A 4US2R 5D3KA 1W1IA 3LL7A 5HM8A 4IDAA 2RHBA 3NXKA 3FTNA 1RXIA 4RTMA 1FFYA 1EB8A 2I3GA 2QU7A 3BH6A 5IBCA 1VYVA 2VZLA 4L5CA 2C98A 4FN4A 1V9LA 4TKMA 2HMTA 2H7XA 1FL9A 2ZIUB 3P45A 3QVWA 4JLSA 2GBGA 4LRXA 5GGYA 2BFFB 1BKDR 4EO7A 4IDFA 1P0MA 1Y8QA 4BMCA 4WACA 1ODKA 3R41A 3MCVA 4FZ3A 2BD0A 2CLFB 5JAZA 1V43A 3OTGA 2JCYA 1NQVA 3E84A 4JFRA 2F4VB 2IUEA 4GP9A 5B12A 3JVVA 4JKIA 1EGMB 5HFJA 4YAGA 2NVUB 3RH0A 4OHKA 4HGYA 2NO9A 1P18A 2MINA 1NR1A 3IILA 1XZNA 3DJYA 2Q1XA 4W99A 2WFLA 1WXXA 1TCBA 4JP8A 4ZDIA 3CVJA 2AQHA 2Z2ZA 2W4QA 2NQTA 4M0PA 4RJKA 4FDAA 2GD6A 1U1GA 1K2WA 1PYOA 4UNSA 3JD0A 3MD0A 1DAIA 2GD2A 4EMUA 1AS2A 5AI9A 1E2KA 2FEWB 3ER6A 3LC0A 3WMWA 4XWKA 1BDJA 3OCJA 4B2LA 1K8ZB 2OUIA 3IBCA 1RBQA 2ERYA 1UOPA 2JCXA 3AHDA 5HRCA 1ES9A 3WZMA 4KR7A 3QVSA 1ZNZA 1ZD2P 3D02A 3QG1A 1KJQA 2ZB3A 1FSZA 1WVGA 3PENA 4OUDA 4TMZA 2P2GA 4BN0A 4FM9A 1XKQA 4EMBA 4YYZA 4UTXA 2H54A 4NU6A 3NP9A 1IU9A 3DHEA 2O2ZA 3AB3A 2QAIA 5CGZA 4C3OB 1VPLA 3AC0A 3GDHA 3G0DA 4FQ7A 1TZBA 1E4YA 3GPIA 3LMKA 4IDGA 1LFAA 2C07A 1PR0A 2HY7A 4FFRA 3TFQA 1E3WA 1D7OA 4PO8A 5AVTA 1GM5A 1K6EA 3LECA 2IYRA 4TL8A 2B0JA 4ADSG 4RK4A 3CNEA 5SY9A 1M2KA 2WJPA 3DQQA 3E0XA 4M7OA 2V7TA 1GPBA 3TNDA 1P3DA 1KBOA 3M1LA 4MVJH 2FWPA 2A7QA 4Q7EA 4TL6A 3BKWA 1BE8A 2AJDA 1KZ1A 2VQDA 1U6JA 4DUPA 3DEIA 1CVLA 4BAUA 4EI9A 4F3TA 4U02A 2ZRJA 3JARB 4JJIA 4C0AC 4HD8A 1EFLA 2ZWPA 1ECPA 3HSSA 2V7VA 3ZXXA 1V3QE 3BRWA 1WXQA 2VOJA 1IJKA 4HJRA 4CG3A 3AL2A 2HAEA 1QGYA 4G0NA 1IHUA 4AICA 5CLLA 3DXZA 5K0FA 2Z30A 1GT6A 2MIIA 4DCNA 4EVRA 3DDWA 4L51A 3QLUA 2GFQA 1AGYA 3NBXX 2ILTA 2JJ2A 4F6LA 3NVMB 2XGSA 3E7XA 2JHGA 2RKBA 1GLNA 2DBVO 3IUYA 1YA4A 3R7SA 1E94E 2JA1A 4NRDA 3C5HA 3VR5D 2R11A 3ZY4A 2QN1A 1OW3B 2GM5A 2OG1A 4NBUA 4BEVA 3BGDA 4BZQA 4EYEA 2O54A 2Q3HA 4TWZA 4QYXA 3AKCA 1KZ7B 3U3OA 4HLUA 1V7CA 4MSUA 2OZLB 4MWBA 4MW0A 4DABA 1DIGA 4X97A 5DM2A 5ADVA 1W36B 5U4QA 3SQWA 2BP7B 3BZWA 2XI4A 3K09C 1ZSVA 2WYHA 5IDVA 4Y2VA 5KNDD 5FQOA 4KO2S 2Z56A 2VPIA 4LF9B 1UH5A 5IJWA 2M6RA 2ZUBA 1OBVA 4I4TB 4I55F 3OZCA 4P38A 4AJOA 5AIBA 2GOYA 5J4YA 5JCPA 3M5DA 4HXGA 1QXSA 1ZEMA 4Y0NA 2D3TA 5D84A 3H0EA 3MHPA 3B48A 5HE8A 2EX4A 2AI1A 3NWEA 5DNCA 1P4GA 1AXGA 2IYAA 3WSTA 2O8FB 1Q3KA 3OHMA 2MJLA 2AT1A 1MRNA 3DFZA 2RBGA 2XOKD 4HYEA 4I8IA 4UPDA 5KO2A 1JAYA 4UVHA 1TX4B 1WAMA 4YASA 4DSZA 4NC9A 1K98A 1ZESA 1B76A 3BE8A 1ADCA 3AG5A 3DOJA 4X61A 5ALGA 5GAJA 1NWCA 1NOIA 3BF7A 3QV2A 4TMYA 3ZS9A 1GAXA 1S2OA 4WEOA 1USUA 5HILA 4DEXA 3T9BA 4IEFB 2FZWA 4GP7A 2WSSD 1JILA 1HFJA 4NICA 2BFAA 4F3CA 4NZOA 5DXFA 3WK6A 3CLKA 4LYFA 1ZVJA 1NVAA 1PYDA 1Z0IA 4HUTA 3T3NA 1UDAA 4OP2A 1A8PA 3NWJA 1Z6GA 3A4YA 2WF9A 3DZ8A 4QPNA 5CM2Z 4NH4A 2Z2IA 4P7FA 3U09A 1PL0A 4ID3A 1XVIA 1G8KA 5CT6A 5CA1A 2EX0A 1JR2A 1A96A 2CL5A 3ITNA 3A58B 1U02A 1T8WA 3QBTA 1GQ2A 4GOLD 1D3AA 3HKEA 4ZARA 4C2AA 3LUHA 5LUAA 2BHTA 3LLMA 3RKUA 2DF8A 3D3NA 4Z1MA 1O4VA 4BX8A 1AKWA 3R3UA 1MO6A 1UM9B 4IZHA 1N7IA 5FUVA 2O1WA 2ORYA 3QVGB 2AZXA 1B15A 2ZLBA 4UCQA 2B21A 4JJGA 4QNRA 4YJ2F 4G0UA 3PXAA 1CFJA 4X7MA 5CLQA 2W2KB 4Z7NB 2VH2A 3OKFA 5IAKA 2HR1A 5EQDA 2WYUA 5DKFA 4IXDA 3CGGA 3PQ7A 2TMKA 4LMRA 4QJIA 1L3IA 1VE5A 2W4MA 2BTOA 3AF4A 4N03A 1E0JA 5DX0A 3OX3A 4DV5B 1HTBA 1GADO 2Z98A 2JFZA 2ZCUA 5U9CA 4B5LA 1USWA 3NFYA 1VCNA 1T8TA 4MXDA 3AZQA 4B4VA 4MS4B 3TSYA 1HNWB 4IWYA 2HXYA 2O2GA 4NS1A 4O3FA 3O83A 1M1ZA 2P40A 5DN9A 2WAOA 3Q8WA 4OQDA 1UDRA 3K2BA 3YASA 2JLBA 5AW3A 2IJGX 2C61A 3RREA 3CZ4A 4YT5A 1VA5A 1UKAA 1PG0A 4BEBA 3RYFB 1XA3A 4ZQFA 2IDKA 3U7JA 1VJCA 2D0IA 4YDHB 2P0AA 2DWQA 1MB3A 3DEZA 3NC1C 1ONSA 3CX6A 3RD5A 4LI0A 4R1LA 1MAAA 3QWIA 1H3EA 1ST2A 3V3KA 4YJFA 2CBZA 2M9MA 2VDLB 1TVKA 2OCAA 3LHDA 2QORA 5KQMA 3ADOA 2WNIA 2V7GA 4J49A 1EI9A 1YDHA 3L1JA 4OQQA 3NBMA 2IZOA 2C5SA 2DOKA 3ZDAA 2O8NA 1EP9A 4IH4A 3KWFA 3SIXA 1CERA 3LLCA 1M66A 3ZWDA 3FFXA 2DEUA 5E6SA 2ODWA 5JZVA 1K7FB 3F4LA 4NOKA 5HPYB 2CUNA 1JVNA 1RJDA 1PUIA 3G5TA 3OQMA 1XK7A 3P5SA 1M5UA 1O6FA 2F48A 2R00A 5IT4A 1E0AA 2FZGA 3OD5A 2X0NA 5IW8A 4MVJF 4QEKA 4RM2A 3UWMA 1R18A 4R2KA 4TM8A 2PSEA 2YHBA 3I2HA 3KXDA 4PLCA 1J1UA 1P19A 4UQLA 2Q62A 5EUCA 3N58A 4QUAA 4I4TF 3ORRA 1NSTA 4EQZA 3HYRA 3HXOA 1N4AA 1NQWA 1UBLS 4LJLA 5EMJA 1AMNA 5ALLA 2Y2UA 5E0KB 3MYYA 4ZI2A 1J42A 4CMIA 1R9JA 2QLBA 2FG7C 3T5BA 5GY7A 1OAOC 4D99A 2KLHA 4GLBA 4HTAA 3ORQA 4JEIA 4B6GA 4MIKA 3VVCA 1C1HA 2VDPB 3ABRB 4R0NA 4D7AA 3NASA 1A4IA 5L4LA 4L8WB 4X45A 5DLPA 1MOQA 2X1HA 3D4IA 4HHEA 1BGVA 1Z4JA 3NANA 5K7SA 2Q3JA 1JHOA 1XD9A 2VTVA 1VPTA 2P6OA 3GG9A 1QFZA 4Z4EA 4NMHA 1RJGA 3GFOA 4EB0A 1PX0A 3MJEA 4PYRA 3GNSA 4E3ZA 4MV7A 1A8HA 2CNKA 3WL5A 3A1NA 2LIPA 3AO0B 1OIVA 3LCRA 1JAIA 1WDWB 5A3VA 4MUGA 1QONA 1EDOA 3CO5A 2OO5A 3MMZA 5J63A 4I9HA 2ZPAA 4CQLA 2SICE 1KQ3A 1RPZA 3RT7A 5HKKA 4I6JA 4UEJA 1TLTA 4JC0A 3LKBA 2W6JD 1PSWA 4EPVA 4EQ6A 3GHYA 3K15A 5B53A 1RTKA 4P80A 5JBQA 2P7IA 3A6DA 3UC9A 5A9RA 4WKOA 2G71A 1W85A 1BD3A 2YZMA 4KG7A 5TJHA 1CF9A 3FOBA 2VHTA 4KUHA 4RKQA 1KI6A 2OGZA 1Q2XA 4O59O 1LVHA 2HWKA 1CUAA 3OHSX 4P86A 3MTEA 5SYNA 1OAKA 3E9MA 3CIOA 2JLRA 1E3IA 1ZYUA 3IVXA 3MAAC 3PHBE 4LRWA 1XRLA 3R9IA 4CM3A 1XTKA 1YZHA 2QW1A 1BWQA 4NPCA 5DHPA 3UFXB 3KOXA 5DSTA 2GRUA 4NQRA 1MW8X 4DLBA 2HQOA 2X6TA 5AVUA 3G49A 1T25A 2R2GA 3TNFA 1KIAA 1CQPA 4J94A 4Y2TA 3UH1A 2Z09A 3DH0A 2HJGA 2XUZA 4C4AA 2OBBA 2H0RA 1VGQA 4UHHA 1N2HA 4DQXA 4CL2A 4HRYA 3EIWA 3DE5X 2A35A 3IUBA 1YRQA 1NF2A 1H05A 3C1UA 2BHSA 3BQMB 5ERYA 4F3KA 1VJ1A 2YWHA 1RQPA 4JDUA 3BF8A 4NFLA 2BFEA 3ZY2A 4BUZA 5IX8A 2ZI5A 4KMSA 5AI0A 4RKEA 5IJZA 2YKGA 1C3OB 4Q9IA 1A9YA 7REQB 1AQIA 3EARA 3VPBA 3TRIA 4F5ZA 5KSOA 1IJFA 1H66A 3U49A 2XWSA 3TECE 4XPIB 2D2FA 2G3YA 2JIMA 3NKVA 3W9UA 3ZC3A 5LQAA 2B82A 4G0QA 1E2GA 5B3AA 2FEMA 2OHJA 2OXIA 5JXJA 3N5KA 4EKGA 2NXWA 3DOEA 2OFFA 5BUZA 3WLAA 3ZD6A 3UAYA 2CFCA 3OFVA 4G26A 2CZQA 1U8CB 1N4DA 1OV4A 3FETA 3KQOA 1EP3B 4R2XA 1YIDA 1L7RA 2E3JA 2NADA 4YT4A 1L5OA 1UZAA 3A4VA 5JTTA 2RD2A 2C4HA 1XEAA 4FINA 4QGFA 2IFTA 4N3BA 4W8GA 4TWRA 2PT9A 4B9EA 4QTYA 3AGPA 5LMNB 3TGPA 2B6NA 3W9YA 1VG1A 4DM3A 2PEYA 4ZMBA 1Z2PX 3KWMA 3KXPA 1HWYA 1XTIA 3AEKB 1YBHA 1WVMA 4R8LA 4RVHA 3VKWA 4EOGA 3HXMA 3WGYA 3I5AA 2Z5LA 1DRUA 2OBNA 3WZ2A 2JAWA 4RV9A 4ZJYA 4IIHA 3VYWA 4UOZA 4BFUA 1EX7A 5L3ZA 3VHQA 4O1IA 5E3JA 3OJXA 3CRZA 1MQ9A 3PXCX 3TR5A 5I45A 2B25A 1B8NA 1LBQA 1QQAA 1GHTA 3ILHA 5HOQA 3V4OA 4C6RA 4B3RB 4LTMA 3NTXA 3NIDB 1HSZA 3R0ZA 4KAFA 1M1XB 3FGZA 1FMLA 1KI8A 1E1KA 1XVAA 4RPGA 2X2EA 4QO7A 3FR8A 3QJYA 1F7UA 4CKBA 4EF4A 3MS4A 1NXOA 3W3AH 1V8PA 3TSZA 2EIXA 4MJLA 5JZ9A 1QAMA 3HCRA 1JIIA 5NULA 1QUFA 2OY0A 3HBLA 4M8KA 3AFHA 2PO7A 1LBSA 5BSRA 2R79A 1B41A 3D4LA 3OZGA 3TJMA 4J0CA 3WIEA 1Z73A 2P9CA 3BMCB 1CQIB 2WYWA 5KX5A 4J16C 3MJVA 5BQ3A 1BE0A 3CKKA 1L7AA 4Y2UA 3AUUA 3EE6A 2GD1O 3ZUGA 5HMLA 1Q0HA 3X0DA 4EGCB 3QPUA 521PA 3MQFA 2O9JA 2XXAA 4MAMA 2OXFA 2X8JA 1YNSA 3ODPA 4DXDA 3EEYA 3M1AA 2VNJA 1U9IC 1IY1A 1O95A 4TVOA 1HFEL 4Y98A 3V1NA 1NN1A 4QJ3A 1EAMA 1ENZA 1I3NA 1P0CA 2C3MA 3FROA 3HY6A 4GWKA 4H16A 5CYGA 4LE1A 1SIWA 2UZ4A 1R0SA 4Q9HA 3LY7A 5CG1A 5DNUA 3LTNC 1A9PA 2UU9B 4FGSA 2QG9A 1UBHS 1T91A 1RE0A 5DCLA 4I1SA 4DLZA 3P2YA 2R4TA 4DOMA 4DE5A 5FEUA 4YVFA 3SEQA 3WWYA 2RAFA 1U2EA 1JXMA 4DMKA 1O1YA 2WWGA 4ACAA 4HVLA 1AG9A 3K8YA 4DW8A 3WBBA 2CDNA 2B20A 3FPAA 1FUKA 3QW2A 3RYIB 5AIAA 5IDYA 2X0IA 4EHFA 4DJJA 1CWUA 5EWJA 2YWGA 2O07A 1EGVB 2P41A 3HYNA 3ROFA 3T7TA 2NN3C 2BE9A 3G89A 3L8GA 3ER9A 2VP0A 4IRMA 1NMEA 2Z9CA 4O0MA 3K70B 3AM5A 2XZDA 1K6JA 2C58A 2O2XA 4IEEA 1KNXA 5FH9A 1E1QA 5JD4A 2H2FA 1CUZA 2I7CA 2QUHA 4G5SA 5F52A 5TRTA 2HT6A 1SVIA 1W48A 2XHZA 1SULA 3M0EA 4AD8A 2GO7A 5KDOA 1JH9A 2PJDA 2KLBA 1YDWA 1UBCA 3GWZA 4GL4A 1TAHA 2KM1A 3DB2A 1ODSA 5LDHA 1XWWA 2FOLA 1HLDA 4WERA 4J90A 3DDNA 4ENSA 2RGNA 1BXKA 5ITZA 4JBLA 4JT2A 3HN6A 3UK2A 4H35A 2DHEA 2IU0A 5T4FA 1RM4A 1T2AA 2KWIA 4LHSA 1Q7CA 3PD7A 3B1YA 2Q50A 2NXEA 5CTJA 3UF0A 2C7QA 3LX4A 4EG8A 2KBFA 3LQRA 2VWPA 3NJ4A 3M6AA 5LWQA 2Q6IA 1U8UA 2DQYA 2WFAA 3JQDA 1H6BA 3EGDA 3WYEA 2I2XB 1N34B 4UUPA 5LB2A 3CUKA 3ON5A 2V7EA 1I30A 1KFJB 1J9GA 4XEHA 5JAPA 2WSLA 3UBTA 4RTRA 2AFIE 5HR5A 5EI5A 1SCNE 1SK8A 3OKPA 1Y63A 3QI7A 3PIDA 3V00A 2Q2WA 1JIUA 1KAHA 4RSRA 3ULKA 2ZWMA 1ZUWA 2C92A 3AXTA 5CFPA 1DUSA 4XFKA 1QGDA 5EWLA 3DW3X 4YRTA 1AN9A 1QS0A 4RESA 1PT7A 4D81A 3VKVA 1QIIA 1BU5A 1B16A 5C7LO 4O1MA 4OMDA 3QX9A 5FWXB 2C7GA 2D2XA 3T99A 1TF7A 3RHTA 3DBRA 4F3YA 1N2IA 2A84A 4FHZA 3REFA 3FTFA 3NYIA 3RPEA 4BO4A 4IFIA 1NR7A 1TJ3A 2HF2A 3FNFA 2G80A 4RORA 1E7YA 4H18A 4WIAA 4XUGB 5AI8A 3FNEA 3DTVD 3TIIA 5KTSA 4G81A 4OHPA 2ERCA 4GECA 3UYKA 5M5BA 4MPJA 4WH0A 6ABPA 1W0CA 1NVUQ 4ZI7F 3N53A 1H4SA 2PJUA 4Y2SA 4AZ3A 1WU8A 2BDTA 2MU1A 4ZZ1A 2RIRA 1I2DA 5DHSA 1ULZA 2GT1A 4HNVA 1O9HA 3NEAA 1SCIA 1PJCA 1NZDA 5FBKA 3VSAA 5KTOA 4IM7A 4R1OA 3BWXA 1GCOA 3KVRA 4HFMA 4JQYA 2XTMA 1CY0A 1A95A 2P1RA 4NYMQ 1N5OX 1L5MA 1WUJS 1XWFA 2QSZA 1JEQB 1SEVA 1MZPA 2R6R1 3GGGA 2G77B 4V03A 5DNVA 4YJFB 5I3CA 1IPFA 3GFFA 1EFCA 1SCUA 3KOMA 1BVUA 2EFEB 4WZAA 1WLSA 2VDMB 2DR3A 1P45A 1BMFA 2Y99A 3D0KA 4WWHA 2GK3A 1E3EA 1ZD9A 2YIJA 4TV9A 3K8OE 1D0VA 4UHCA 4QDKA 2WIGA 4TTRA 4B79A 5G02A 2EEZA 3IKTA 1QV6A 2WWVD 2XT6A 4EG4A 1SBYA 4J0FA 4JUBA 3HJCA 2XKBA 1AB6A 3VR6D 3FFAA 3LA8A 3DCNA 2BR5A 4UD6A 3ZQUA 1GQYA 2ZZKA 1YR6A 2XB9A 3IT1A 3KEQA 4JCOA 4MCJA 5F5LA 5JSYA 5EHIA 5T5QA 3TEFA 1TQ8A 1E4OA 4I5GA 2Y1GA 1RI2A 3PGKA 4DLXA 4LG1A 2Z0MA 2XUQA 3A8TA 4F4HA 821PA 4FZRA 1A1SA 3HDVA 1RJ9B 2ES4A 2X4GA 3B12A 3TD2A 3EGOA 3OE7D 4U6NA 4BLOA 4DMCA 4PLWA 1T0IA 1DC7A 2IOYA 1XFDA 4F2DA 1VLZA 1W8IA 2QRMA 4E14A 5BN5A 1QNLA 4ZVPA 1JSXA 4R7ZA 1P77A 4PZ0A 2G7ZA 4Y18A 3COSA 4A6EA 1RC8A 2BSXA 1GPNA 1E60A 1Z08A 4EVQA 2QQ5A 4F21A 4AM8A 5KYTA 1MX3A 3CUYA 3O4IA 1RCTE 1V5GA 3QFSA 1HDIA 3KM0A 1M3SA 4OV6B 5JIBA 3HYLA 5K0ZA 4DCSA 2FN7A 3EYWA 5DHUA 2ZI6A 4B3GA 5LXTF 5K4GA 1C4KA 1Z0JA 2ONZA 4Y6OA 2R1ZA 5LPNA 4GH5A 4LGCA 4KIWA 3RB8A 4AUNA 2VYQA 2W8BB 3GARA 3PPWA 3ROEA 3P7MA 2OQ2A 4Q1VA 4RPLA 3VH4A 1BX3A 1GCIA 1E7SA 4NYJQ 4LBZA 5CJJA 3FA2A 5A4FS 3MZ0A 2WP0A 2YZKA 2CJWB 3K31A 4UU0A 2AYXA 4E4TA 1FVFA 4JASB 4KTVE 4DANA 2F3TA 5CXQA 4IWNA 4DLNA 8ATCA 4WOBA 5FUMA 2YWJA 1TF5A 3F7TA 2JZCA 2LKDA 5TLSA 3AY3A 2O2YA 1TK9A 2Q8PA 1D2RA 3TD9A 4Z3OA 1I6LA 5F76A 5JANA 3OEEA 2GHTA 3FZQA 4O33A 1KO4A 2ZTMA 1JDSA 4MK4A 4QRDA 4YJGA 3ZWWA 5JS7A 4L07A 2WSYB 3PUZA 5K3FA 1OY1A 4TLAA 4DHWA 2ZUUA 3UPUA 4REQB 3SJZA 1FSFA 4FBGA 3U5TA 3CLUD 3F71A 5KVQA 3DBLB 1B0AA 1Q1EA 1PK7A 2YDYA 3K1ZA 4GXNA 3GBPA 2I1VB 1RBMA 2QD4A 3ZDRA 1M72A 2H29A 1MUUA 4FMPA 2DC1A 3Q7SA 5JY1A 3F5FA 1VP9A 1YA6A 4IOLA 5ULLA 5KOIA 4IHJB 2EKQA 1NVGA 4MB6A 1J0DA 1NU6A 1SUCA 3BIOA 4AS2A 1I4OA 1SKUA 2B4KA 4KU4A 3B1ZA 5LYYA 3O8RA 4YT2A 1QH1A 3ES9A 1SELA 4NKRA 4HDCA 1KJNA 1T9GR 1JXAA 1UZLA 3BWDD 3M82A 4XYGA 4JEUA 3W5VA 2H2IA 4HBGA 3PWKA 5JSKA 2G08A 3KBOA 2IHBA 2BM0A 2XNDA 1WQ3A 1ORHA 3CRW1 3LZDA 4J4TA 4LQLA 5ALHA 5JBIA 1G8FA 4JQSA 3T5PA 3D6MA 1II8A 1N8TA 3GA0A 4NTZA 3FUWA 1XN4A 2KBEA 1USGA 4OJMX 3JQCA 4B3JA 3QVUA 3VNSA 4ETIA 4PAWA 5KIAA 3B3JA 3OI7A 2PWYA 2TMGA 3SWWA 4CLDA 1GTG1 3I12A 4EK9A 1PLKA 4OA8A 5KWIA 2X58A 4YXWD 1JFFB 1BE1A 3MLBA 3TW8A 4RENA 3ESCA 1GFWA 3RVOA 1SEPA 1UFVA 2EJCA 5CG2A 5LZ9A 3KD2A 2SKDA 1F1JA 3E35A 3VZSA 3X3HA 4CTOA 3HUEA 5JPCA 2QTCA 4UDYX 2ZWVA 3Q10A 1GNLA 2CVQA 3TAUA 1DRWA 4HDSB 5D51S 5FOUA 1JQJC 3PFGA 1TAGA 2RAPA 4MUFA 3NNDA 4X0EA 2R8PA 2HNAA 1GZ4A 1NDQA 2AMVA 4XWAA 3RG8A 1VIMA 5FPYA 4CKCB 1IQRA 4FDUA 3L7BA 1ODTC 4MP3A 3BXEA 1TFUA 1GTL1 3V8NA 4B4UA 4ND2A 3FFTA 2XHEA 3VMFA 4DDHA 3DDHA 3DQPA 3C16C 2AKYA 4QGSA 1O96B 4MQEB 3PTAA 3D3WA 1GU7A 3UT0A 2VH1A 3KFVA 2FSSA 2PVCA 5DWVA 4CCYA 1KEEB 2WWXA 3AFIA 1W25A 3CH5A 3R77A 3IQEA 1RP1A 4UAJA 3UH0A 3UV7A 1JWLA 2QT0A 2MSDB 1Q84A 3NHYA 4GM4A 2VF7A 4JU9A 2IYTA 1UDBA 1QJCA 1EBFA 2F2TA 2W2LA 3N39C 3ORSA 4AJEA 3SHFA 1P4HA 3TN7A 3AVPA 2QJOA 3AYXB 3H1BA 2GKOA 2C2ZA 4ZOLB 3VDNB 1YJQA 5C8ZA 4P1ZA 4IYRA 1OT5A 2VATA 2HMYB 3D4PA 1CB7A 3QEOA 4PHHA 3LPDA 1V35A 3L7YA 2A58A 3OEWA 1P6XA 1RQXA 5DBEX 2NAFA 3EK2A 4A92A 4DWJA 3KR0A 3OIYA 5AUNB 1U2QA 2OAGA 5EOVA 4KFUA 1UK9A 3E27A 2ONJA 4D4IA 4B73A 1SWWA 3WRVA 4L16A 3G7UA 3IAS1 3LLUA 4W7IA 2CDCA 4X3PA 3CBGA 5A3JA 5JCZA 1RYNA 2A9FA 2Y71A 3SEZA 3K1JA 4JNKA 3PP8A 2REXB 3RAFC 2CLCX 4D5EA 1LFDB 4D82A 5B2FA 1OVGA 1CUGA 3DWEX 4R6XA 5LKRA 2JRCA 3VO2A 4PYOA 4PRLA 4F46A 3AJ9A 2BKXA 4OBWA 4Y6PA 4QSHA 3ZGOA 3IP5A 1EQ2A 3M2TA 1YS6A 2V03A 3ANNA 3QOYA 1IOZA 2KYRA 4RYDA 1NIPA 2GO1A 4YAIA 4KOEC 3KQKA 1YBFA 3HKCA 4DMMA 3Q2IA 3P9YA 3ANMA 4CCAA 1GZ5A 1SIOA 1RYDA 4JLNA 1XFAA 2A0UA 2Z58A 3LLVA 4DWOA 1KO8A 2G4CA 4LJ6A 3ADKA 5FLYA 1KMMA 2UVDA 1Y8RB 4BE7B 4MGZR 4MROA 3U19A 2I1QA 1QAOA 3G5MA 1RFLA 2VUIB 4FCTA 4UDNA 1KHHA 5CCDA 2YQ5A 1JNYA 4H4EA 1TZ2A 1PQUA 3RUIA 4Q7KA 3FVWA 1U9JA 4IHJF 3WGIA 4QPZA 4PZCA 5KHOC 3AUAA 3MTBA 1U1EA 4ALJA 1ZCBA 1OROA 1Y89A 1H0RA 3SBXA 1TAUA 4FCCA 4PVCA 6REQB 2HFKA 4L75A 2NZ8A 3TZCA 4BO3A 2CLOB 4J9VA 1P5HA 4HADA 4QARA 2IYOA 2A9QA 4XR4A 1BOOA 4PSVA 2C9BA 4HNUA 5KYUA 3LRPA 4M76B 1XTRA 4TLLB 3P2JA 4MIYA 1XL1A 1TL7C 1QOZA 2C9MA 2DH6A 4J0DA 3I45A 4Z7JA 2J6HA 5BXQC 1JEYB 2DHQA 2FW7A 3IP9A 2ZJ1A 4HL6A 5DN6A 4ZRNA 2I6XA 2HMSA 1U4NA 2QL6A 1SZCA 2AW3A 3OPNA 4D80A 1NJGA 2FLKA 3DPUA 3C3MA 3DDUA 1N6OA 1KYIA 2W48A 1IM2A 5AHRA 4C0WA 3WLIA 3OCXA 3GLIE 2YMPA 3JY6A 3DEFA 4O2BF 2PWAA 5BRNA 3HO1A 5KDDA 5TIIA 1ISIA 1Z7EA 5DCYA 4EB6B 3FH0A 4DUZB 3AG6A 1RRCA 3U4MA 2WJJA 3RF7A 3QLUC 3WGVA 5IC4A 3BRQA 2BEVA 2E4UA 3FGOA 2JH9A 3C6YA 3LWDA 1EFVA 4HDNA 1VHWA 3B60A 3TB4A 4E1BA 2GCPA 4DV6B 4KR3A 3AJDA 2QPAA 3PEEA 2O3UA 1MXHA 2ZUSA 1SCDA 4Q9JA 4U2DA 2PKCA 1X77A 2Y8EA 4M21A 2FWIA 2PPLA 4HLUC 5GZ6A 4C0XA 2NTYC 1WCIB 3C7KA 2QZ4A 3OC6A 1GFSA 2OVFA 2VQSA 1DT3A 2F67A 3EPKA 2UYOA 4G4SO 5IASA 1UBGA 1B8OA 1ACLA 5KNLA 3ZS8A 2IHJA 4ROSA 4WK4B 5DK4A 1EX9A 5LMZA 2BHRA 1A4RA 3GF4A 3HJTA 4EAQA 1XE3A 3IMGA 1S9HA 5ICFA 1I5EA 2Q5LA 3GNTA 3PDWA 5HBRA 3ZEAA 1KGSA 2AE2A 3I62A 4MRMB 3THWA 2VJMA 4ZOLF 3HJAA 3CPEA 3SZMA 1YJBA 3PRHA 4RCYA 5FJJA 4F12A 2RI0A 4LXUA 2G82A 4M9UA 2X14A 2HU7A 4TV8F 4KPUB 2A9JA 3NIWA 1KZ6A 4GF5A 2XMBA 3TTUA 3KEOA 3CM0A 2YYAA 2IPOA 1POWA 3CRRA 4FYHA 3AJAA 4WKPA 1BJRE 3HN7A 3TRKA 4QU9A 4ZU1X 2RI6A 4LDAA 3B9PA 4C08A 3UJ3X 1NW9B 3TX2A 4GX5A 1E66A 1QRRA 5HFAA 2D0OB 2X8LA 1T3LA 5D7NA 2J9RA 4CN9A 3SZ3A 4AUMA 4E6PA 5IT5A 4A26A 3QX7A 4L4ZA 4WXYB 2JDID 2Q27A 1XCPA 4L28A 4MYDA 2MHCA 4BVAA 4DR3B 4KIUA 3LVBA 4R9RA 1QIKA 4KVAA 3VOAA 3T7JA 1Y4UA 4WQMA 3CEPB 3WRXA 3OQBA 4E13A 1NNEA 1U2RA 1XXLA 4IRXA 4PZUA 3M2PA 2ECKA 1GUFA 1AKEA 1FY2A 3TL6A 5B7GA 4IQGA 2IP1A 3JAWA 1J2YA 4BJ3A 2ZRQA 4IJQA 1I80A 1EUQA 1XOIA 1Y3CE 4K6KA 1SXJE 3RVSA 4MRPA 2GAAA 2O14A 3OFND 4UMDA 1V39A 4CN8A 3WC4A 1RI5A 5EZYF 4F72A 1H5QA 1JDBC 1YS4A 3OOEA 4G84A 4N5DA 3ID6C 3VJLA 3ZDBA 4I0WB 2N47A 3IEXA 4YJDA 3OZ7A 5KHLB 2RGBA 2K4MA 2BKVA 2ADOA 2CDBA 3FDJA 3QLEA 1ONOA 4Q3CA 1OSNA 1U2GA 3DFMA 1BMQA 1H4QA 1TLFA 4DMUB 1H4VB 421PA 3S1SA 3AR2A 3U1BA 1R16A 3I72A 4YNBA 1XJCA 2MWMA 3GDGA 2C00A 4LNUA 3QFCA 1C1YA 4K6MA 3GROA 1R8SA 1X1RA 1X7WB 2HKIA 2LE0A 3UXEA 1UPBA 1YRWA 4MV4A 4G8JA 4EGSA 5J5VA 2ZQ5A 2QJTA 3F1KA 1OCEA 3C3CA 4AXBA 2P4HX 3OUUA 3MMXA 2QAJA 2BHNA 3L1VA 2C3UA 1T0UA 4NG5A 5IPFA 2FPGA 1W4RA 4TKZA 5EIOA 2ZTSA 4KLRA 3ZGZA 4CGYA 5GM2A 4ABYA 3BMXA 4F1KA 2XYGA 3LC2O 1GRRA 2ONYA 4HLCA 3BIXA 5IK2A 3MJDA 1T26A 1YCGA 2GYWA 2IZ6A 2PSSA 2Z5GA 4NBLA 2RHJA 3SX2A 4AYWA 4FB5A 5BRAA 1N2SA 4DCCA 2XQIA 4KGDA 5KYKA 1U2ZA 3DO6A 2D6FA 1XCOA 2P65A 4Y6RA 4I4IA 2Y3IA 1LDGA 2HCBA 1J5PA 2WRZA 3GEDA 4RGBA 5DSXA 4OYLA 3O75A 3NKFA 5HA5A 4XIJA 4HC4A 2HIMA 4QQRA 5B4UA 4E5KA 5DDIP 1RRFA 1KO1A 1RWBA 1VIVA 2YV1A 3KV1A 3QEKA 4MV1A 2ID8A 2O2DA 1V4VA 3WL7A 3VKHA 3Q72A 1B1AA 2FPPB 3HSKA 5DE3A 3SIWA 3OY2A 1ZK1A 3RVNA 4RMGA 4I08A 4X66B 2WR8A 2ZJOA 1GG5A 3DO5A 3GPDG 3OQIA 3Q9SA 4LOHA 1KC3A 5DX1A 3UG7A 5JDCA 5KPDA 2R00C 1AC5A 2AUTA 4LF7B 5FI0B 1Y81A 2ZBGA 1KU0A 4EJMA 1KTIA 2HFJA 1H2AS 3DW1X 3CR3C 4R81A 4G8BA 5A7GA 3GMDA 4BNVA 5EE1A 3H11A 3ZXIA 1VPDA 1KVUA 1NF9A 1P91A 4N6NA 5JMPA 5JS6A 3GDOA 1KVSA 3G0BA 5DGTA 4EW2A 1GPLA 1WXDA 4C2UA 3QU7A 2I2DA 3ESZA 5EEHA 4X6UA 3KKOA 5CDSA 4MS1B 4DYDA 1UDWA 4FKBA 1SUPA 1NLFA 1YE8A 3OTIA 4PR3A 2PGIA 4G25A 5CNIA 4MW1A 3J81k 3UA3A 3OZXA 1IBKB 4QDUA 1G66A 1JTEA 5DMHA 2RCNA 3GCXA 3KAKA 3GUCA 4LOAA 4PAGA 4ZT3A 2QU8A 4EARA 2WPNA 1C2TA 1C3VA 3OIUA 3PNOA 4Y2GA 1K6MA 1XNRB 1JKJA 1HC7A 3AR9A 1Z18A 2NLOA 1X38A 3MCTA 4L9SA 2QW8A 4AJKA 2O2JA 3T3EA 3KSRA 1CT9A 1ND5A 2RONA 1Q6ZA 2ZS7A 2H1SA