5K0JA

Crystal structure of comt in complex with 5-[5-[1-(4-methoxyphenyl)cyclopropyl]-1h-pyrazol-3-yl]-2,4-dimethyl-1,3-thiazole
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
220
structure length
220
Chain Sequence
b'GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 79
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k0jA00
1WXWA 3ME5A 4FZVA 3IV6A 2P3LA 2KW5A 3P9NA 2WA2A 3TPZA 3JWJA 2BH2A 3BWMA 3GRUA 4V0QA 1EJ6A 2ORED 3FPHA 4GOOD 4PCAA 4RX1A 1EAMA 1VQ1A 3OE5A 2IIPA 5C1IA 1INLA 1YUBA 3MB5A 1NW5A 2H1RA 4DKJA 3UFBA 3TM5A 5LQJA 1G8AA 1G38A 3KQYA 3P2IA 3M6UA 2Y1XA 4JXJA 4QVGA 3HCEA 3SXJA 3NVKI 3LL7A 2PXAA 4YUVA 5U4XA 4QVKA 4PIPA 4PYKA 2Z6UA 5T64A 3DOUA 4Y30A 5EMMA 4ZTBA 5EMJA 5G02A 4X60A 3O31A 3C3YA 3VC1A 3KR0A 5LR6A 1VPTA 3G7UA 1EQAA 4RTLA 5C9ZA 3D2LA 5JR3A 3OZTA 4C4AA 2YXEA 4GC9A 4H0NA 4OX9Y 2ONYA 1YZHA 3GIWA 2PKWA 2XVMA 3PFGA 2OXTA 1YB2A 4WXHA 3PT9A 3RIEA 2XVAA 5GIPE 3KQTA 1N7JA 4F86A 4Y2HA 1XVAA 2VDWA 3TOSA 5EQJB 4E33A 4LWOA 4ER5A 1DUSA 2C7QA 5LQRA 2AR0A 3E23A 4PGHA 5EZSA 2YUIA 1KPHA 2AOUA 2H11A 2PSSA 1VP9A 1WS6A 2O07A 3FUUA 3MTIA 2G1PA 1F38A 3KU1A 5EC8A 3HCDA 3NDJA 3VC2A 3MHTA 3G2MA 3MGGA 3P2KA 5FADA 5EMKA 3TFWA 4EQZA 3THRA 1O54A 1PJZA 5CCBA 4RTSA 2DULA 1MJFA 3BGVA 2AS0A 2OB2A 3GRYA 3HA3A 4HGYA 4DF3A 4E31A 5DSXA 4UOEA 3ANXA 2ZULA 3KQWA 2JH9A 5CVUA 4PYJA 5CM2Z 2BR5A 2FPOA 2PBFA 4IV0A 4DZRA 2IH2A 2H00A 3MQ2A 3SX0A 3KQSA 3VSEA 1G6Q1 3DXZA 3HCCA 1G60A 2Y1WA 1VIDA 1DL5A 3TR6A 3I53A 4GOMD 4AZWA 4C08A 4XCXA 3LECA 2YXDA 1ZHFA 5LSAA 4KDCA 1RJFA 1H1DA 3CJTA 4QQNA 2ERCA 5F2KA 3DXYA 1BKYA 5EPEA 4CTKA 2ZBQA 2PWYA 2FYTA 1JR4A 3MAGA 4PGGA 5CUQA 2A14A 2I6GA 3LSTA 3PB3A 3C6KA 5E9WA 2HNKA 3I9FA 3B3JA 3EVEA 5FQOA 3FUWA 3T7SA 2IBTA 3A7DA 3BGDA 3ERCA 3UJCA 4M36A 4BLWA 3FTFA 1L3CA 2IDKA 1EG2A 1Y8CA 2AOVA 5FA5A 1TPYA 5KS2A 2O0LA 5EHIA 3B7PA 3KPVA 4QTUB 4U7PB 4X1OA 2G71A 5KVAA 3K0BA 3AXTA 3HTXA 2E5WA 1XDUA 3MCZA 2PXXA 3UJAA 1G8SA 5FHRA 5K0FA 4MHTA 3A7EA 5E2AA 3PLAE 2DPMA 1I1NA 2ZFUA 4KRGA 3V97A 1NW7A 3DP7A 1M6YA 5T67A 4YV0A 2QY6A 5B1SA 3AXSA 3KR9A 2PJDA 3FPJA 3PS9A 3P8ZA 4O29A 3MERA 2I7CA 1NBIA 1VLMA 3SSNA 4ER6A 5F2NA 4RTRA 3KQOA 5DTRA 8MHTA 1JSZA 2G70A 3CCFA 3QOWA 3P9KA 2AN5A 3BUSA 3HCBA 4HTFB 4LWPA 1OR8A 5CVJA 3SR4A 1P91A 3PFHA 3UZUA 2OZVA 3DMGA 3KHKA 4EK9A 3ID6C 4E2YA 3KQMA 2ZLBA 3R6TA 3A27A 2V74B 4ISCA 5H02A 5K0BA 5K0LA 3P71T 1ZG3A 1R00A 1VP3A 4M7RA 3LDFA 4AZSA 4BLUA 2CMHA 5ICCA 3NVMB 1JQ3A 3IHTA 5LQUA 4ATNA 3G5TA 3G8AA 5EMLA 1RJGA 3SGLA 5GINE 4OQDA 2ZZNA 1SQFA 3BKXA 3M6WA 3C6MA 3HCFA 2P7IA 4P7GA 1QAQA 2YR0A 3LPMA 4FSDA 4HSGA 2OB1A 5HIMA 5IH3A 1SKMA 3T7RA 5E2BA 1HMYA 4ER7A 2HR1A 3ELDA 3LCCA 3F4KA 5P8WA 1XJ5A 4E2ZA 4LECA 4CTJA 1WY7A 5EHGA 4GEKA 5K09A 4MIKA 3S68A 3HA5A 2JG3A 1L1EA 2IGTA 2AOWA 1KYZA 3BWYA 3EVFA 3LGAA 3ELYA 5DT2A 2HV9A 2IDJA 4CXMA 3EMBA 2ZZMA 1NV8A 2PVCA 5EVJA 1L3BA 3JWGA 5EIFA 3SSMA 4IV8A 5EIWA 1SUIA 3BZBA 5HIJA 3EEOA 1U2ZA 1JG4A 2QM3A 3GJYA 3ER9A 4PONA 3T0IA 3BT7A 3EVDA 2OYRA 2ZIFA 3EGIA 4BY9E 1L9KA 5HIKA 1NE2A 1UFKA 5DXAA 5GOZA 3M70A 3FTDA 4KW7A 1RJEA 2B2CA 4HC4A 1QZZA 4E32A 5M5BA 4RV9A 2EJTA 3GU3A 4OA5A 5DWQA 4AX8A 2ZW9A 3G5LA 5CVDA 5GIOE 2UYOA 2VP3A 4AUKA 1WXXA 3FZGA 4GOLD 2IH4A 3HVKA 3Q7EA 2OKCA 1VL5A 1XTPA 1N7IA 1RI5A 3TRKA 4BP1A 3FYCA 4BP3A 2P35A 5DTQA 1ORHA 4FR0A 1KPIA 2YQZA 3DULA 1TW3A 2NXCA 5DRYA 2EFJA 3A26A 1DCTA 4AZVA 4GF5A 3VYWA 3CGGA 3B89A 3MCTA 3OU7A 1HNNA 4QPNA 2B3TA 2P41A 2UYQA 3UWPA 4YV2A 2P3QA 2ZBRA 3KQVA 2G72A 4MTLA 2P40A 2O06A 4L7VA 1ZKDA 2GPYA 2EJUA 4MWZA 4DMGA 4RVDA 4YMHA 2CMGA 1AV6A 1NW8A 3DTNA 2B78A 5EG5A 3DH0A 1KP9A 3NDIA 3OPNA 1Z3CA 5DSTA 2B9EA 2ZIGA 5GP1A 3FUTA 3M33A 3KPYA 5CVEA 1KIAA 3CJRA 4CWAA 5CVVA 2BM8A 1XDSA 5FCDA 4E2WA 3FYDA 3LKDA 4PINA 3BGIA 3UJ9A 2Z6AA 1YZ3A 2ZBPA 1D2CA 1P1CA 3PX2A 2PGXA 4GQBA 5DTMA 4RTQA 1FP2A 1QAMA 2EX4A 4P58A 2K4MA 3EVAA 4RVHA 2Q41A 2YXLA 2JHPA 2UYCA 1NV9A 1V39A 3A25A 3NW9A 2ZCJA 1G55A 1NW6A 1X1DA 1KR5A 2BM9A 1JQEA 4R8SA 5DX8A 10MHA 4E2XA 3LDUA 3MTEA 1R6AA 2IPXA 3DUWA 3G2PA 4G56A 3JWHA 3LX6A 5HIIA 4EMSA 2V7EA 2JH8A 2P7HA 1PRYA 5K0EA 1ORIA 3M4XA 4FS8A 4KDRA 3KR1A 1FP1D 3ORHA 2PX4A 4RTMA 3NTVA 2ONZA 3G8BA 2AOTB 5K0GA 3LCVB 4U7TB 3KPJA 5GM2A 3BWCA 1FJXA 3GRVA 3EGVA 4FT4A 3O7WA 1IXKA 2YVLA 3KQQA 4ER0A 1ZGAA 4PWYA 2Z6QA 2PX8A 2ZSUA 4P7KA 3Q87B 3P2EA 3ELUA 2ZTHA 3REOA 2QE6A 5D1HA 3ELWA 2WA1A 3P97A 4RVGA 3LBYA 3KQPA 1BHJA 3H2BA 3FUXA 5C0OE 3P9CA 4R6WA 5DX1A 1SQGA 2NXEA 3FPEA 4WVLA 5EKXA 3TMAA 4B17A 4HTFA 4K6MA 5K05A 4EKIA 2NP7A 4C05A 3M6XA 2YTZA 1TW2A 4RTOA 3BKWA 4M37A 3E7PA 4X41A 5E8RA 1T43A 1NT2A 1RI2A 2FRXA 1I4WA 3OE4A 2ZZKA 5FWAA 4F85A 2PT6A 2PV0A 5E1DA 1YF3A 3GO4A 2R6ZA 3CC8A 2LD4A 3NWEA 3FTEA 5LQNA 2ZWVA 2PX5A 1JG2A 2B25A 3B3GA 2QRVB 5CCXA 1KHHA 1SG9A 3V8VA 4CKEA 1R18A 4ER3A 3TQSA 1FPQA 5FULA 5EEHA 5EZQA 3WSTA 2O05A 3U81A 5KYGA 5K0CA 1AF7A 3E8SA 1KPGA 2XYRA 1JG1A 4KWCA 4P7JA 3SVZA 4RTPA 3HVIA 5DM2A 5DM4A 1JTEA 3UA4A 4PNEA 5CD1A 2IBSA 2GLUA 2CWWA 5DM0A 2VDUE 3KPWA 5E1BA 5E8JA 5EOVA 2ZVJA 4XUEA 1X1BA 5DX0A 3FRHA 1NBHA 2CKDA 1X1AA 1RJDA 3EVZA 1NKVA 1SVUA 3HVHA 5HOQA 2CL5A 5DXJA 4GC5A 3X0DA 3B3FA 3CKKA 3M6VA 4A6EA 4E30A 4PIMA 1AQIA 1JQDA 1VBFA 5E1MA 5FUBA 5K03A 1ZGJA 2NNWB 2VDVE 3PX3A 2OO3A 2NXJA 5CIYA 5DPMA 5K01A 4BLVA 4LG1A 2PLWA 3OZSA 4DCMA 3P9IA 3TKYA 2UZ4A 5JUWA 3GDHA 5ICEA 1MHTA 1Q0SA 2UYHA 4RTKA 4FGZA 5HEKA 5BXYA 1KYWA 2ADMA 2AOXA 4GUAA 1XCJA 3HNRA 5K8VA 1XXLA 3DMFA 3EPPA 1QYRA 3FPGA 3C0KA 3G2QA 3GNLA 4HH4A 4HRAA 4OA8A 3T7TA 2HMYB 3TLJA 3UBTA 3R9XB 1YFLA 3CJQA 2P1DA 2IFTA 3BXOA 3OU2A 3R24A 3TKAA 5LQKA 3LHDA 1BOOA 3B5IA 3FUVA 2P3OA 1UWVA 1IM8A 2AZTA 4P7FA 4A6DA 1B42A 2PWPA 3HVJA 1QAOA 4OBWA 4OQEA 4OBXA 4AZTA 1D2GA 3KR2A 3GWZA 4MQ4A 4XUCA 2ESRA 3RW9A 2GB4A 2GS9A 4YUWA 4PYMA 1AQJA 1UIRA 3AJDA 1ZQ9A 2IP2A 3GXOA 3HP7A 4R05A 4C03A 2PT9A 5ICGA 2ZIEA 1IY9A 5T6BA 5LQCA 1X1CA 3EMDA 2PXCA 3GRRA 4FP9A 4YV1A 5KQSA 4FSXA 1N2XA 3KPUA 2OY0A 4QPPA 5GWXA 5K0NA 2HTEA 4IKPA 5E9QA 1P39A 5HILA 3R3HA 3TM4A 4E70A 5KQRA 2PX2A 3R0QA 2NXNA 5E1OA 5F2OA 9MHTA 4FT2A 2PY6A 2O57A 2WK1A 2QYOA 2AVDA 3HM2A 2FK7A 2I62A 3BWBA 3HEMA 4QTTB 2BR3A 5EEGA 4PYNA 5FQNA 4DM3A 3DLCA 2VZ9A 2AOUB 4QDJA 2AVNA 3CVOA 3GGDA 5EKUA 5BW4A 3CBGA 5MHTA 4YUXA 4RYLA 3LCUA 1M0EA 3NWBA 1M6EX 2HWKA 1F3LA 3FRIA 2JHAA 4Z2YA 3UA3A 4R8RA 3O4FA 3UJ8A 2C7OA 4DQ0A 2N47A 3GCZA 1I9GA 1RI1A 4R6XA 3EVCA 4EKGA 4C04A 1O9HA 1Q0TA 4DA4A 3UJ6A 1RI3A 3OU6A 5FTWA 2FCAA 2AN4A 3EVBA 3SSOA 2FHPA 3UJ7A 3NJRA 2I9KA 4QDKA 3A4TA 3UJBA 1X19A 4XUDA 3EEYA 4NECA 4PYIA 3FPFA 3OZRA 4PYOA 5ERGB 3SMQA 2GAFA 5IKMA 2AOTA 3PVCA 4F84A 3G88A 3UJDA 1JSXA 2OBFA 4C06A 3LKZA 4KIGA 1XCLA 3IYLW 2BZGA 5GM1A 3DXXA 2XYVA 3E05A 1L3IA 2GA9A 4RVFA 3EVGA 4DCGA 3OFJA 5EGSA 1R8YA 5FA8A 5BW5A 1XDZA 3ER8A 2JHCA 1YFJA 4POOA 3I5UA 4HGZA 3G2OA 2EG5A 3OFKA 3I58A 2XYQA 5ICFA 7MHTA 2AN3A 4RSRA 4HG2A 3HCAA 3LDGA 4PYLA 2IH5A 2R3SA 3KKZA 1EJ0A 4M38A 4EVIA 1RI4A 5DLYA 2G8NA 3L8DA 4PCLA 5FWDA 1WZNA 3QOXA 3FTCA 4GOND 1JG3A 5FHQA 1FBNA 4X61A 1JTFA 1EIZA 4IWNA 3G89A 2QRVA 3HA7A 5E9JA 4YUZA 3PTAA 3RODA 4CKCA 1P1BA 5K0JA 2FK8A 1WG8A 3C3PA 1NW3A 1KXZA 4C07A 4CKBA 5D1NA 2NP6A 1QANA 3DMHA 3LBFA 4KVZA 3DR5A 1BC5A 3OCJA 2F8LA 4RWZA 5BP7A 5DRTA 2JJQA 2XBMA 3AWIA 2GH1A 3NMUF 2VS1A 3QV2A 4KIFA 4GBED 4V0RA 2BR4A 4X63A 4PYQA 4YUYA 4RTJA 2C7RA 1R8XA 3SM3A 3DLIA 5HFJA 4YMGA 5LQAA 3I64A 1O9GA 5HZMA 3JWIA 3GRZA 3EGEA 1R74A 2P8JA 3AY0A 3THSA 2C7PA 4RTNA 2NYUA 3IEIA 2OPBA 1SUSA 2YX1A 1VE3A 5DM1A 1D2HA 3K6RA 2ZWAA 4QQKA
chains in the Genus database with same CATH superfamily
1WXWA 1Y42X 4GBMA 3CLTC 3SBOA 2V4ZA 3ITEA 3QVXA 3AEZA 1IDOA 2E6UX 1BVHA 1OI3A 3G0OA 4I4CA 4U3JB 5HGJA 1L5MA 3UJPA 1PL8A 4N8EA 4UMDA 2ZI5A 2EKZA 1HBJA 1IG3A 2A1UB 3DE7X 3L7CA 5IYZF 5LQJA 3TAHA 4HAYA 5H16A 4E7PA 3OX1A 5FEUA 1VMEA 1YR2A 3K1TA 1JQBA 3NANA 4N18A 1KU6A 3SF8B 1STOA 1B6TA 4L07A 1DFGA 4LNUB 5GV7A 5EMJA 1M6VB 4YJ3F 2C00A 3USZA 4N41A 1J0BA 1KYQA 3FPAA 4HPWA 2XCQA 3TEFA 1R4MB 3DEIA 3OIVA 3RE1A 2YHAA 4OI2A 1I5EA 1JEEA 3V8MA 2J0UA 2MTBA 2ZBGA 4RIIA 3PGLA 2IZ5A 4ESEA 2AG5A 2EYQA 1AB5A 2E89A 1W581 2WWTA 1TZBA 2C9CA 1PQPA 2YY6A 2QAJA 4N0QA 1RM4A 5AUQA 3DLHA 2JFQA 1WDWB 4D4JA 5EQJB 3AOEC 4LWOA 3IX7A 1BIFA 3PL1A 1SVKA 1MFZA 4CV3A 2OUIA 2H2WA 5AFSA 2FQWA 3DMYA 5EE1A 3RYFB 1UMDA 3L0CA 4LTNA 1U1IA 4MMXB 2YUIA 3NHPA 1UJ6A 3N1UA 2VOJA 2H11A 3PT5A 4F2GA 5F23A 5KDDA 3RNLA 1JU3A 3JY6A 3SAJA 2MOKA 2V7WA 3KAKA 1LRLA 1P7PA 3GVPA 1LDGA 3TFWA 1VKHA 1QKKA 1JALA 1E3IA 1PQ4A 2GZ3A 3LBHA 4KYTA 5KI6A 1ADJA 1E1QD 1CQWA 4B81A 5KTRA 3L8EA 1DO2A 1VMIA 4HNUA 3EULA 2HPAA 3TCKA 3GRKA 4R69A 4OMUA 4RJIA 4V0OA 3FCCA 4IDNA 4FPXA 1FXWA 1M5TA 3HFJA 1MNAA 2PBFA 2XKJE 2F9FA 3BXXA 2YZNA 3RTEA 2H00A 3VSEA 1WPXA 1T29A 4OM8A 1NGSA 1LVUA 4BQEA 2KBEA 1GUZA 1M0WA 1JIVA 5E4TA 1KE2A 2UUAB 3NWJA 3LECA 4NABA 1PP4A 5GONA 5ITSA 1NQOA 3CHYA 4PZEA 2QUJA 4MB0A 2EP8A 3P0HA 4Y1EA 2VUIB 3HJAA 3K5PA 3NS7A 4L78A 3WNZA 1ZN7A 3PXEA 4GOKA 5A0VA 3NHZA 2CXTA 3B3JA 1W5EA 3BE6A 4TYNA 1PLLA 3ITNA 4BLWA 3UICA 2ATCA 5C81A 4G0XA 3HB0A 2BMFA 2HB6A 1ETHA 3CSSA 4JI7B 3FRJA 3ND8A 4ZVSA 4MCJA 4IF4A 2UU9B 4MRMA 2WE8A 4B09A 4NX2A 1GY8A 3F7TA 4AJ4A 4ZCMA 5A4IS 3A4VA 2QVLA 1SKBA 3SHWA 1VB5A 3WMFA 1Q21A 1X1TA 3WWDA 4RLHA 1L7AA 4H0CA 5CW1A 2QZ9A 5COAA 1XNRB 1NFFA 4PFKA 3PS9A 2GZ2A 3R44A 3QG1A 4FXOA 1RR6A 3H6KA 2O54A 1E77A 1UANA 3EOZA 3GLKA 4C6RA 2GK7A 3E1SA 3P9KA 4PLYA 4XSGA 4M9UA 3PFHA 4UU1A 3ZI7A 2BC9A 2VTKA 3E03A 4UTXA 1D2AA 3AO0B 3DHWC 5LBIA 1NVKA 5CRIA 4HB4A 1PSZA 3E84A 1BE6A 1DIAA 3PRJA 3IALA 4JLOA 4Q02A 5K4AA 3AG6A 1WZ2A 5L3SA 4CODB 1JKJB 5JNSA 4Q4AB 4FB5A 2V65A 2WIAA 3SGLA 2P2DA 4ZTUB 1UT6A 4NBVA 3VC3A 5AM2A 4DBLC 4YRSA 4I66A 2HDOA 1HA3A 4FSDA 1NF3A 4AZ0B 1MVNA 5EQTA 3RYIA 3FKSA 5CDTA 3PEYA 4G0UA 4XAQA 4FMPA 4M1SA 4IRMA 4BLPA 3BIJA 1SUEA 4AJJA 1SHJA 2XI4A 3BA1A 1G8KA 3MSXA 4FR5A 1GPDG 2A0FA 2CVOA 3FE2A 1F6DA 4HNSA 2AQIA 1LI5A 2DE0X 1OI4A 4C30A 4DC1A 2VATA 1D2EA 2V55B 1WSAA 1W4AA 1XA0A 3L0PA 5CTJA 4HTAA 4H7DA 3RRYA 3SSMA 3T06B 3VZQA 2Z0MA 1SA0B 2LGJA 3N2YA 4FR2A 5C4GB 5JY1A 3DV2A 2O7RA 2KWIA 3LQFA 4UCFA 3ZGYA 4Y2QA 5AR1A 4DWJA 4ZYUA 1ZBDA 3ER9A 4IJ5A 3U44A 2O8CA 3QF4A 3IMKA 5EJIA 4RXMA 2MIIA 1UL1X 1E6MA 3EA4A 4JUCA 3V8EA 4BY9E 2VQDA 3EC2A 4E03A 4OFZA 5L6LB 1EWVA 4JJ7A 3TLCA 5C8YB 3PF8A 4OLFA 1RJ9B 3T52A 2B1GA 1NMQA 2Q28A 5C5DA 1TOAA 4KR2A 5CEJA 1JLLA 4H1VA 1N6KA 1GDDA 3BGSA 4ZYLA 2A5LA 1DEOA 3CUEF 1L5HA 3THWB 3MJTA 4Y2RA 4JQZA 4UXJA 3LUAA 2XRMA 1C1DB 3DMTA 3EZLA 4QZVA 3GDOA 4R51A 1RP7A 3H11B 3L6RA 4BMVA 1EFAA 3B13B 2OM6A 1VG0B 1OILA 4HS9A 1POXA 4RE5A 4B40A 4Q19A 4EF4A 1YR7A 3VU9B 1MQAA 4JKYA 1RXEA 2ZROA 1X7XB 1GUDA 3CZPA 2GCOA 4LK3A 1YOVB 3MT0A 4HAUA 3WB0A 4JBNA 3L92A 4WZBB 3JQAA 4MTLA 3DFZA 1XE3A 1Z88A 3RVMA 1PFWA 3MEQA 1ZKDA 3KLBA 5AKEA 2EJUA 4I1RA 5AVRA 3R76A 1ZRHA 3KB8A 1WXHA 2PXHA 1XTQA 2GA8A 2QL6A 2A9FA 1G1MA 3DTNA 3R7WA 3ROZA 1WKBA 4IX9A 4KI7A 3NDIA 3HJFA 4KQXA 3PNVA 1HLDA 3KUDA 3PGJA 3L93A 2PSEA 3JVDA 3KPYA 5CVEA 3SCZA 2NADA 4XJVA 3P2JA 2PSHA 1SCUA 3FYDA 3K0HA 5AK3A 4DKXA 1BQ4A 5JS2A 1XTTA 2RHHA 2FX3A 4MITA 5LB4A 1QO9A 4RTQA 1YAHA 3OIFA 4H17A 5CG2A 4DLLA 621PA 2R2GA 2BGLA 4LPSA 3MD0A 5LD2B 2QUKA 2AMJA 4YRDA 2TMDA 3G1UA 1ZR4A 1PD1A 2C4NA 2Q5OA 4JSTA 4RKFA 3RRXA 4E51A 3K71B 3L0SA 2IPXA 2FVXA 2FKAA 4J3FA 3U7FB 3LX6A 4D0SA 3I83A 3WGNA 1CUXA 2QLLA 2CSUA 1R0RE 3HJGA 4W9NA 1BMDA 3ANTA 3KT0A 3NTVA 4MUJA 1SWWA 1JDBB 4IOMA 4NTZA 4WT7A 4HUTA 1HFJA 1I7NA 1SK8A 3O03A 4IDQA 4K9LA 1C4OA 4S1PA 2H3HA 3T15A 3WK5A 1CLEA 3ZZTA 1BYIA 1UZMA 1Z6ZA 4B45A 4Z4QA 1NUUA 3OPYI 3RKSA 4CM8B 4LDJA 4F5DA 4C3OB 1RXSA 3LWZA 1JHYA 1M0SA 3SOPA 3VISA 1BHJA 2MINA 3FUXA 4RDCA 2ACEA 1U8FO 4EL0A 1EFCA 3RD5A 2PNJA 4K6MA 4AU1A 2P0AA 4H1HA 2HPZA 2ETVA 2X76A 3ENNA 4C05A 4ZQGA 1QH8A 1Z0ZA 1TW2A 2YTZA 1A2BA 5IBQA 2Y71A 2D6FA 4LOKA 3K73O 2DQKA 2GD1O 1XVLA 4NV1A 3K5HA 1WWKA 5FTMA 4BB0A 4RKWA 3RHFA 5DN9A 3GO4A 3BMOB 3NTUA 5BQOA 2LD4A 1ECPA 1ZLXA 1JG2A 4MW2A 1C8KA 3D0KA 1KHHA 2VNJA 3N5KA 1EXVA 4DLZA 3TQSA 4AIIA 1PN3A 3FUCA 1E9EA 3HWX1 5IW8A 1EDEA 3X1XA 5JZBA 2FN3A 3DV0B 5IPFA 1ZUNA 1S3SA 3BMCA 5E4JA 2NZXA 3BWXA 4PLTA 4EH1A 3B20A 3MM4A 3CCCA 3P1JA 4KWCA 5ALOA 1NQWA 1E3WA 3AB8A 5ENVA 2MSWA 2C8VA 4YP6A 1SZJG 4LN1A 1KAQA 2VHTA 4I3GA 3NHSA 4WPGA 1RU3A 2D5BA 4GLOA 4PQRA 3WZ2A 5C5EA 2CNWA 1L5LA 4YJFA 4PZYA 4FDLA 1TKCA 3IUMA 3U4QB 3OCYA 3I23A 3TIXB 1XEWY 2YIDA 4BNMA 4C5CA 4F8EA 2IS2A 2Y2UA 3L1HA 4ADSG 2C83A 2WZQA 4CMAA 3L7MA 2R5WA 1AT1A 1J24A 1W2HA 4B7XA 4AWAA 4PTLA 2IYRA 1WBJB 1OXMA 4N39A 5M29A 4WNCA 4WW0A 3D81A 3RVRA 3NP7A 4F9FA 1G6KA 3FAKA 4KX5A 4TV9A 4WADA 4NFLA 1C14A 3TKYA 3SIRA 2YYAA 3V8BA 4BN5A 3L7OA 5CIWA 1F2UB 3NIBA 4LYJA 5KNBA 3CVWA 1SCDA 3LQ1A 1PGNA 4J1TC 5IAKA 2DR3A 4B46A 3O94A 1LLDA 2ADMA 4EFLA 2GVZC 2YFKA 1K2VN 1E2HA 4M76B 2I4LA 3B38A 2FZVA 3NCTA 4NK4A 3LFUA 3CLSD 5FBHA 2V7BA 3G9QA 4G81A 3N2GB 2D1TA 3ZNPA 1CE8B 1E2KA 4GECA 1XUOA 1QJCA 5K1ZA 3Q8LA 3OU2A 2WFMA 2ACWA 4A6DA 3A3OA 2VDQB 1IH8A 3CLRD 5LQSA 2PWPA 1HQYE 1MG5A 1NAIA 4ZOBA 2YXBA 2GR9A 1UPBA 3AERB 2IF2A 2W6MA 3EQ7A 3IRUA 1CS4C 4PM4A 1PEKE 4DABA 4Y6PA 3TJRA 2IZOA 4N54A 2WMOB 3WLJA 4X85A 1HURA 2Y1EA 3ASZA 5H68A 2EZTA 3SYLA 1NASA 1X1CA 1UBNA 4KLNA 2XQJA 2C5BA 2O5RA 1T2FA 2IYPA 5K3OA 3TGLA 2OV1A 2XUOA 4D25A 4QRIA 1N2IA 1O03A 1J6UA 2BF4A 3UOGA 5FOQA 2WQZA 3GEPA 1JWBB 4U7FA 5E1OA 4KBYA 3V2GA 1U9IA 2XUIA 3RC9A 1HT1E 2GM5A 4ZT6A 3CY6A 3QFSA 2I54A 5AOCA 4G0WA 1VPEA 1ODLA 4XEHA 5CH3A 4RZUA 1TXGA 3C3BA 1QK3A 4EG4A 2HWKA 1NJ6A 1YRLA 5B1EA 1W5AA 1OFVA 3DBRA 1VRCA 5I4BA 4RULA 3JYOA 2I6UA 1GCIA 4CM6A 1L7NA 3TTXA 4GPEA 3EVCA 3PHIA 4G9BA 1Q95A 4DNFA 1O9HA 2G5PA 3ZQUA 1DAHA 2W58A 2SKEA 3B1KA 2AEJA 3A4TA 3NBXX 3M1LA 4IQ0A 4YCSA 1J99A 2R1UA 1N77A 1VLHA 2EDAA 3DOEA 1DP4A 4Z4HA 2JNWA 2B2XA 2BUCA 1WPQA 1L4EA 3H19A 3EQZA 3IDQA 3IELA 1ZVQA 4ZAWA 1CJBA 1DHTA 2EP7A 4YAKA 4RAOA 1XCLA 4INJA 3I9MA 3VA7A 5KYNA 2QG9A 1XDBA 4NYMR 2FZEA 3E3OA 4CT5A 1DJNA 2YBEA 3QLVC 1J0DA 2IOFK 5ALTA 3P20A 3QKWA 5AKIA 1WZUA 5FPPA 3GZ4A 2LV8A 2R4TA 5B6PA 1OH8A 1YCGA 2PRKA 3HO1A 4P36A 2G9NA 4REQA 1D09A 3O9ZA 1M5RA 3TQIA 4F0JA 2C03A 3A6PC 1R0CA 1MRNA 3B7WA 1ZZEA 4E5DA 2BKUA 1GRNA 2FOLA 2I76A 1I3LA 4W5WA 5DLYA 3ZGLA 1WZNA 4KJZA 3TSZA 4PN3A 2GBIA 4Q21A 2CXNA 3QOXA 2ALJA 5AHKA 4CF7A 3EBLA 1FBNA 2QAGB 2OP1A 4BLOA 3KYDA 2F67A 1W30A 4UBMA 4X65B 3DFKA 2NG1A 2UYGA 2G6TA 3O2QB 4MJLA 4XPIA 4LWQA 1GEEA 1Q1QA 1JBQA 2QE7A 2K6GA 4QU9A 4UQOA 2I6SA 2YV4A 4CKBA 2QENA 2VYCA 4I9FA 1S6YA 4ZCSA 3RSFA 2R66A 3DR5A 2W2MA 4UHDA 2NUPA 4ZD6A 4O4HF 1RFGE 2MJLA 3D4IA 3QWFA 3FGNA 3GVXA 5JZSA 3FTNA 4HFJA 3MINA 2X7JA 3JR7A 1IN8A 1ONPA 1QX3A 2DLDA 4NZMA 1TD9A 1DKUA 2CN1A 4OJQA 1Z5UA 1R8XA 3NAMA 2C3PA 1AOXA 3GJTA 1PBTA 1A9XA 4YMGA 2GHIA 3H9BA 3I09A 2IW3A 4FYYA 1N9KA 4OCZA 2ZSFA 3CM0A 2HQ1A 3AEUA 3EGEA 3H2HA 4R84A 1NJ5A 2GCEA 3GOHA 1LA2A 4OP1A 3IEIA 4Q5IA 1MUUA 5IS2A 1BWRA 2B5VA 3PA8A 4IIFA 3UWDA 1AGRA 4FZVA 3P9NA 2Z09A 3JWJA 4FQ7A 3QX8A 3I52A 2HT6A 2YH2A 3RU3A 1DFIA 2H63A 2ORED 3R5XA 4J16C 2OHOA 4XD7D 4Z0TA 1QG6A 5J2UF 1V7CA 2OFFA 4E21A 5KYVA 1NW5A 1K4YA 2O0HA 4QWMA 3KJEA 3UFBA 4A03A 1G38A 3TD6A 3RC1A 5C2JB 3PEVA 4IMJB 3ZD8A 2W71A 2Y1XA 1QIMA 1HYBA 2LXNA 1Z5GA 4DB4A 3W06A 1JVNA 3G2HA 1PJSA 5T64A 4WOJA 2IY8A 1P4HA 2C7VA 3MGAA 4GI3A 3PNBA 4J07A 3WYGA 1DZIA 2J4DA 1VIAA 3VC1A 2P9JA 2RHBA 4HB2A 4O0MA 4W6ZA 3PC7A 4XQ9A 4L2IB 1WUKS 4N3GA 4RTLA 3S81A 3G2LA 4LEIA 4GG1A 4R5MA 1MNQA 1AKMA 4OX9Y 4IGFA 1B0UA 1Q44A 1POWA 2HCJB 1YH3A 2NXWA 4QDZA 4EWLA 1BS9A 1QE3A 4R81A 3MQ4A 3P9RA 4IW3B 1E1MA 3HSSA 4C2TA 3IAEA 2JLUA 1WUYA 2EKQA 1Y7PA 3P2OA 4CUKA 1L5KA 4C2UA 3FY4A 3GLSA 2XRFA 2JFWA 4IQ4A 1NXOA 1VLVA 2A33A 1U28C 3CTMA 3F98A 3NOQA 4HWTA 1YV9A 4C7JA 2B99A 2NSDA 1QFSA 1LV8A 3KU1A 4C4PA 4I9GA 4CM7A 3HCDA 2EQAA 2H1WA 2XY4A 5IAEA 2Y1DA 2ZDHA 1KS9A 4TKLA 3GG9A 3EXIA 2D4AA 4B2YA 1U7ZA 4NE9A 4DQKA 2JCSA 2ZPTX 4MO2A 3GCGA 3SZMA 5EJ5A 4QPJC 4HFRA 3VR6H 1COWA 1G59A 2UYYA 1Q0RA 4CG0A 4EB6B 5DLEA 1WOMA 4XIYA 3HZOA 4M0DA 5HX7A 3Q3EA 1A97A 1SOWA 2IE8A 3SX0A 1G6Q1 4BRZA 5HW0A 2HFKA 4KV9A 4DJFC 5HGXA 1MJGA 2Z1DA 3WWOA 3K6KA 4LOHA 4CIAA 1HTTA 4B85A 1E3MA 1XVVA 2CFCA 1GTL1 1I6WA 2CK3D 2HU2A 3F2IA 3ON5A 4G37A 4Z7NB 4DN6A 1UC8A 2Y3IA 5BOVA 4QQNA 1XQ1A 2BZ0A 2WYHA 4DM7A 4Z49A 5EA2A 5K3DA 1GNLA 5HMLA 2O2YA 5FQOA 4YDHB 1EM8B 3T7SA 3GLHA 4RHEA 2J3QA 5IKOA 5HS4A 4KR7A 2AEFA 1U63A 1QWSA 3FTFA 3F78A 1GGFA 4MVYA 1CCWA 1KEVA 4ZAVA 1TPYA 2J7KA 2AMFA 4BVHA 3JYNA 4NJMA 4RY2A 2ZP1A 1QQBA 3QX3A 2MMCA 5CB4B 4BX8A 1XDUA 1JLMA 1H9AA 1T5SA 1C0IA 3LHSA 2TMKA 1OF1A 4FDAA 5M3BA 2IIQA 4R01A 4E08A 3LIPA 5IVKA 5T67A 1ZAYA 1K7FB 4G8DA 2P9GA 3HU3A 4KHZA 3PSHA 5BWBA 5DF1A 5DV9A 1IN4A 1GITA 4K8OA 4C20A 5HQ3B 4HX5A 3DKRA 4UD6A 4N9WA 3LA8A 4B32A 2C1EA 3I5MA 1X9HA 1VI5A 1SO8A 2BBOA 3HJRA 5IC5A 3A1WA 1EEHA 4MUYA 2ZLBA 1FNDA 3DWGA 4MQ5A 4EJSA 1ZH0A 4ISCA 1X70A 2CXOA 4MAAA 5HK9A 2FPKA 5DM60 3WQHA 3AETA 5LQUA 5LZ2A 4TXJA 3OZ7A 4OB6A 2VHWA 4NBKA 5K3BA 1SQFA 1Z4QA 2FDXA 1E64A 2P7IA 1UP4A 2WTXA 4KCGA 1N3YA 1K6MA 2DSNA 4RUKA 4ZAFA 3LCCA 3VZSA 2XTNA 3JALA 3PVSA 5ALSA 5K8UA 4B76A 3D3KA 2BGWA 5B58T 2EL9A 5JW6A 4P35A 1GO2A 1G8MA 2BFDB 1CJUC 2R4UA 3LOPA 4L9WA 3DONA 5GQSA 3GPLA 1K6IA 4MHTA 2C9ZA 5AP9A 3EVFA 4MUKA 2OHIA 5DT2A 4EY8A 4FNGA 3W1VA 5HTOA 3INGA 5D3MB 3R0ZA 1NJFA 2PVCA 1KNXA 1L3BA 2QVXX 5CYOA 2LCQA 5EIFA 3G2IA 2GTHA 2OBLA 3PD7A 1A69A 1SUIA 1U9YA 1XCOA 4ZZ1A 2RGRA 1WW8A 2QM3A 2XYHA 3IEUA 1C7IA 1OOEA 2QVZX 2O2DA 3JQ7A 1DQSA 1OI7A 3VR6D 4CQLB 3SJZA 3B78A 3QTBA 3EGIA 2P9ZA 3KFLA 1Z5WA 1HLGA 5C35A 1BHSA 2C9DA 1HE5A 1N5OX 4MQMA 1SBZA 4YCBA 1HZJA 4KW7A 1JMYA 1E0SA 2AJBA 1DX4A 3WZMA 4S04A 1R3DA 1QE0A 5FEMA 2RE8A 1RYDA 4EF6A 5L7WA 1VB3A 3GU3A 4C07A 4ZZ3A 1DUIA 5DZSA 3VYUB 1M9NA 3IDZA 4GM4A 1SCKA 1XMPA 2GESA 4MV7A 4DMKA 4F92B 4Q4CA 3HNPA 3UMCA 1EUCA 1VRWA 3HVKA 4E09A 2I6XA 4EJ2A 1FYDA 2EKDA 2QS9A 1IUOA 4Y6SA 3WXMA 2CXXA 4C3VA 2D7CA 3O84A 1TTQB 3JD0A 3T1YB 2QR5A 3D4PA 3FGZA 4ERXA 5JPCA 1EFPA 1ZZGA 4LZZA 1E32A 1VYHA 5NULA 2OWDA 1SAYA 2PKQP 3D7NA 4X95A 2IXTA 1QGDA 3HVUA 3MCAA 3LY8A 1CY8A 3H9QA 1YS2X 2A7XA 4RVDA 4FCCA 1M72A 2TRSB 3K8ZA 3H4MA 4I08A 1G3IA 4K9MA 3Q3CA 4K6GA 2MSDB 3FJOA 4PQFA 5GZ6A 3KSDO 4DMLA 3OF5A 3DB2A 3D6UA 4BYMA 4PX2A 1N0UA 3F0TA 3HKBA 5J4YA 4MLCA 1O77A 2XMBA 3H2IA 1XPUA 2VK4A 4HUQB 4RANA 3BGIA 1W5TA 1UUFA 1EVKA 2PGXA 1W88A 3CLUC 1LPOA 4CLRB 4CM4B 1QAMA 2QMUA 2Y1CA 4F7WA 3D8HA 3CSDA 4G07A 1W52X 2MYUA 1Z39A 4WBXC 4CTMA 5T4BA 2NVOA 5BMOA 1IZ0A 5ITZA 4X1YA 3TGPA 2E82A 4NIMA 1VLQA 3OCUA 4MVCA 4A8HA 4KNWA 4P5EA 4BNYA 5ES4B 1JHAA 4MMZB 2P7HA 4E5NA 4F2PA 3E4DA 3PEUA 3UHOA 1Z68A 1UP6A 3Q85A 2JBHA 3VOAA 3S5UA 3FSEA 3CFYA 3IPRA 1MABB 3ESQA 3KM0A 3W5AA 3HLTA 4RXUA 4U7TB 3K0FA 1TU3A 2ADFA 3KKEA 4E46A 3BIWA 6LDHA 4FT4A 1NZFA 4X64B 3B6JA 1XZFA 1NRWA 3V6MA 3HBJA 2W0SA 3FMOB 3Q87B 2LVBA 5DW3A 5HSGA 3HM9A 2XUFA 3REOA 1G3UA 2YIJA 4MS3B 3ELWA 4CIVA 3KKLA 3PD0A 3LBYA 1PW5A 3UAXA 2SECE 2RHGB 1GR1A 1Q0QA 2HJHA 2XDQA 4G0YA 5M5BA 3WSWA 3FPSA 2REXB 2G4VA 2Y0CA 1V4VA 5KTKA 2JJ8A 2H0AA 2OCGA 4KH1A 1PGOA 1JAHA 2CCJA 1TJ5A 4NL4H 4J3NA 3GG2A 3R9IA 2FB9A 3QW4B 2ZRBA 8ADHA 3HBMA 3U7EB 1FUIA 2ZYHA 1GA4A 4LRTB 2G3YA 1QB7A 1QIGA 4GYJA 1E5XA 2JIOA 4XOUA 3ZHBA 5JAUA 2OTCA 1H3NA 2JJ1A 2Q6VA 2R7MA 4JJ4A 4OYRA 2OG1A 1JYSA 1SULA 3A2MA 4BXOA 1AHPA 2B25A 1T5BA 2DWUA 3UWKA 1GGKA 2H29A 5JVDF 2NTEA 4CKCB 1NFRA 4BYGA 1Z4KA 2R6AA 5EEHA 5KNDA 4ISBA 2VDJA 3B51X 4L8FA 5B3LA 3GFBA 3TW8B 4DRXB 2C57A 2D5AA 5KZMB 4XYGA 3HNOA 1ZIYA 1MEOA 3HK2A 1B4DA 4PNEA 5GADl 4URFA 3E70C 4ND4A 3LPDA 2F7SA 3KXLA 4MDYA 4RW0A 3K2QA 1CUAA 1J8YF 5AUOB 3IP3A 3IHLA 1T2VA 2WSSA 1VE6A 3CONA 3SBDA 5DX0A 4D43A 1E7MA 1OIWA 4K9RA 2ORVA 3QVLA 3ROEA 2DFVA 3HHPA 4E12A 3S7TA 2ZIUB 2HD4A 4H6VA 4ZOLA 3AJAA 3SHOA 3NEYA 1WHTA 4PIMA 1OLSA 5C37A 3NH9A 1TCVA 121PA 2G83A 4BBJA 5K03A 4EEKA 3AMVA 1KIFA 2JGMA 3ZE8A 2NXJA 2AI3A 1R15A 2QT9A 4XX0A 4WINA 3KFXA 3LK7A 3FCXA 4LG1A 3K4QA 4L57A 5CP8A 5DP2A 2X0EA 1ZS9A 4AJIA 7YASA 2VZLA 1DBRA 4RK4A 3WK7A 3ABRB 1G9TA 3UW3A 2CFTA 1X7DA 5HEKA 2BOVA 4PS1A 3MELA 1SUDA 1YZLA 3HEAA 3N0XA 4NQRA 4E88A 3BEDA 4AS2A 2P4QA 1P75A 1HORA 1NQ5A 1UQUA 5BSWA 2HYIC 2FW1A 3GLGB 3R3YA 4W5TA 4I2VA 4M2LA 4O4JA 4GVPA 4IX1A 2C2YA 2CXQA 1KEWA 5DOVA 1OXUA 3T0FA 5A9SB 3OQHA 3UBTA 1P17A 4BEWA 4Y6QA 1NOKA 4Q3KA 3KNZA 2PO5A 1UBFA 4IEFB 2HDWA 1DINA 1E9VA 3Q98A 4LZPA 5JCOA 1C3LA 2VWHA 4GGPA 3SMVA 2HCBA 2YQ4A 3OEHD 5DVZA 1F14A 4Y2TA 4GLBA 4BQRA 3TL3A 3FNEA 4ETIA 1AQJA 1T9BA 3DO5A 5PNTA 3GXOA 5HUQA 1W73A 3FLBA 4JT8A 3GLGE 1XB2A 2FH5B 5CFMA 5CPBA 1QVZA 3PQFA 4QUBA 4DCJA 3EWAA 1TEHA 2WV9A 3EGDB 4K3VA 1ODKA 3HY6A 4EUNA 2A5YB 3NDBB 3ZW7A 4HCJA 4PHFA 5E9QA 4ZKEA 4E70A 4PSVA 3A2LA 4E14A 3U6KA 1N78A 5K6AA 5FNVA 4TXNA 3F8SA 4RFVA 2FEXA 1ZNWA 4KP7A 4QM7A 4Y0NA 4ZODA 1JH9A 5JVDB 2GXAA 2PQ2A 2P9CA 2QV7A 4QDTA 2QGNA 3U4AA 1E9DA 4WL0A 3BL8A 2ODPA 3QVUA 1RWVA 2WRZA 3OPYA 4G1MB 5DFAA 1S2OA 2HI0A 4FFLA 3LCUA 1YC2A 1E8NA 3DF9A 4DSOA 4NU0A 3DBLB 1CUWA 2G7MC 2BE7A 5I4KA 2PFKA 2FN4A 1MENA 3V4ZA 4DV1B 1P9OA 1TJ4A 2EX0A 4NZZA 3PXAA 4LTDA 1J56A 2Z1NA 4LC0A 1N1EA 3IKVA 5FTWA 3RAGA 3D7MA 3RC7A 2Z3WA 4A6XA 4YCLA 3SVLA 4EX6A 5SY9A 3FOZA 3TQCA 5LMUB 2GNAA 2XUKA 1ATZA 2Z4SA 1FTQA 4PYIA 3E7XA 3SMQA 2OGTA 5EJ2A 2BSAA 5FYDA 4UZSA 1W5FA 2FEPA 2FPIB 1E5VA 3RJZA 1OB5A 2V7UA 2OBFA 1QCZA 3SS9X 3FCYA 4D81A 4KIGA 2RKOA 4BUJA 3JYHA 5HIAA 3QA9A 1IULA 5A0FA 2H57A 2EQBA 3G82C 5EGSA 3NBMA 1KZ6A 1XLTC 2YJGA 3QEJA 4W1RA 1YS4A 3I6QA 5C34B 5I7RA 1XEFA 2DZDA 3ER8A 1CFJA 2JAOA 2ST1A 4NBSA 4FEYA 1J42A 3C4JA 2G9ZA 3M7IA 2OMKA 7MHTA 1BRMA 2AN3A 1S2NA 1G21B 2I1VB 3T5PA 1A95A 2OL4A 4RLQA 4DHWA 5ADHA 3T41A 1Z7BA 1Y63A 1T0PA 2JFVA 3MOSA 5E6SA 3C3MA 1JB1A 2D0PB 1YJQA 6YASA 1E6EA 5LJLA 2PG3A 2O19A 2P2CA 1GLGA 3CNEA 2WMDA 3C41J 4RFSB 4HWSA 3A10A 2O8DA 5C80A 1QHXA 5JCZA 3BMNB 5JTUA 5K2OA 3L2OB 4FFRA 4DIOA 1JHVA 2EBFX 3GHHA 2XE6A 1K5GA 4PIVA 2I22A 3O93A 4FKMA 1ESEA 2FRVA 1ZY2A 4PYQA 5G0VA 3A9CA 4F4CA 2Q4RA 4FS3A 3UPUA 1UXIA 3PKZA 4PR0A 1GNSA 2OBXA 1GYQA 2Y05A 3DLIA 3OH8A 2X77A 4L73A 2FPWA 4QE3A 5ENDA 2ZDGA 4B3DA 5EMHA 1HYHA 1SU7A 4NBNA 2J9XB 4W9MC 3JWIA 1HZZC 1UJ4A 1T0IA 2X8AA 3VDMA 5JJBA 5FI5A 2VJNA 4LGVA 5HHTA 4OQFA 5LKAA 4K9SA 5AH0A 2UVQA 2WICA 5DM1A 3K6RA 1QIJA 2VP4A 2PIAA 1OWLA 4P3PA 3GBSA 4XWGA 1OU4A 2D1QA 2ONKA 3JQPA 3CWQA 2O2HA 4CLOA 1EVLA 3AHHA 3E9NA 3ROPA 2O2GA 3L9XA 4NCKA 5EN4A 4W5JA 3RRFA 3UMGA 4PCAA 4F4IA 2MYNA 2WJJA 5LOVF 1YUBA 4UU7A 1MAHA 4BNNA 1E2BA 2D2VA 5JE8A 1MB9A 3Q3IA 3W5CA 2EW2A 5CBPB 1Z5VA 1ES9A 4MZDA 4RZ3A 3AY7A 3SXJA 1LBSA 1ICEA 1MAUA 1SC6A 2PXAA 3ICOA 4ALJA 3WHLA 5EZYB 5IKEA 2WUWE 1WULS 1ACMA 2AL7A 3T1TA 1SUAA 5HFAA 4EI2A 4Y30A 2R7AA 5C51B 4X24A 5CLGA 1WOYA 5EMNA 5KDLA 5FRDA 2ZSIA 3G7UA 1NG9A 1UPXA 4BO5A 5JEDA 2I8AA 1X8XA 1PJ8A 5KYWA 4M46A 4BQIA 4OHMA 2CXRA 2ZK7A 3N9IA 2BGJA 1JWLA 3VKUA 5TY0A 4CR8A 4MV6A 2AC7A 3PFGA 1T9HA 2EQ5A 3GOQA 4CEIB 4B4WA 3DZGA 1I0LA 2FZ5A 2YFQA 3FKQA 1NDHA 2X5NA 5L7YA 2EOAA 2JEYA 5LQRA 1N2JA 2LP4Y 1P81A 5DNDA 1YQXA 3IVRA 2JFOA 4RVSA 4AWBA 1T2CA 4R2IA 4PLVA 4ZC1A 2CHQA 1YS9A 5DDIP 4QFDA 4XCVA 2Q0XA 4BFWA 5AVSA 4FCWA 2IP4A 3MGGA 4B7ZA 1AY0A 1Z4LA 4V3CA 4LOAA 4MRPA 4ZCTA 5IFLA 5THQA 4JI2B 3TYXA 3D0OA 2MDTA 4AMBA 3GXBA 3ND5A 1ODFA 2UUPA 3F1KA 3PYMA 4RD0A 5F7XA 4L15A 1UXHA 2ZJ7A 5CA1B 2IH2A 2ZRKA 3NETA 4J03A 1HMPA 3IR5A 4LRYA 1G7SA 3B3AA 3GD5A 1J0XO 3T7JA 4GWLA 3K9BA 3C97A 3FDIA 4OIMA 4R1OA 4QDUA 1BFKA 5F77A 4D74A 4EA9A 3G6KA 2P0EA 5LSAA 1N5DA 1RJFA 3CJTA 5C1BA 1LPBB 1W6UA 1GN8A 4MKXA 2PWYA 1VG1A 2WHXA 4MI9A 4KWIA 4YJ2A 2Y67A 4F4HA 2DG2A 3EQ2A 4YXWD 1PL7A 2PU7A 4HY3A 2HL6A 5HF5A 3PE3A 4D0NA 5KYXB 1S2IA 4FC7A 1IHUA 3FMPB 3VH3A 5BMVF 2EP5A 2RB4A 5DMXA 1Q83A 1W9HA 3I37X 3UUWA 1JBKA 2RFLA 1X1EA 1LS6A 3FDJA 1DXOA 1F48A 2R8YA 5FTNA 4OSPA 5LDGA 1OGYA 4IOKA 4UZFA 2IELA 4O4LF 3L77A 4M1WA 3TOXA 4B2IA 5A6SA 4K6KA 4ENRA 1NW7A 4LE2A 3MRXA 2BONA 2XQGA 3AXSA 1G66A 3SR0A 5LYJF 2PRYA 4CE6A 2AE2A 3C14C 4EVQA 4ZHQF 1N2CE 1VLMA 3QE0A 3PX7A 3MLAA 4JS0A 3W3AH 4A27A 2B1QA 4MUAA 4WWHA 4AS1A 1CIJA 4NHOA 3J7AC 2CZCA 2I4IA 5GTDA 4RPHA 2PZ8A 1A5SB 1YS7A 2GPJA 2VPPA 3CIOA 2F4VB 4HJXA 4XWTA 1BTOA 1OBOA 2OWEA 3ILSA 3OKAA 4M7RA 3VOTA 4EX7A 3FHOA 5ICCA 2HRZA 3OETA 2E4AA 5CT6A 1THMA 1B8OA 1RYBA 2BHRA 2BL4A 1SXJD 5KKAA 5YASA 4H60A 4UM8B 3M6WA 3ULKA 1F8YA 4HAZA 4P7GA 4Q82A 4NCAA 3ADKA 2B1JA 2EX1A 4KAAA 2ZJ8A 4GLLA 4KQJA 5IH3A 4LGYA 1YZTA 3S3TA 4MQBA 3A1TA 1GQYA 1HMYA 1EGHA 2CFSA 2GHTA 1W29A 2Z2XA 3FA2A 3IVCA 3K09A 1OA1A 4YQEA 1EFRA 3EZ9A 4XVRA 4DSZA 5JJIA 5IAOA 1JEYB 1CQIA 3IP7A 4JYMA 4F97A 4E2ZA 4RCYA 3NIFB 1QG2A 2I34A 5CHYA 3M49A 1E7SA 5EHGA 4L50A 1BH6A 1YRBA 2WFZA 4HGPA 4DDKA 4L3OA 2VJKA 1W87A 3E7DA 1E8DA 2Z2ZA 3QPAA 2M1ZA 2Z9DA 3EUFA 3O4RA 3ST7A 4ZT5A 4YMLA 2PANA 4ARZA 4E1BA 3ZQJA 3H83A 2P4SA 3QTLA 4JT2A 5C1PA 1TVMA 1YACA 1O96B 4N0PA 5HIJA 3ZTTA 1XZEA 1QCYA 4QECA 4U7JA 2JLBA 2ZRIA 4Q3DA 1O9BA 4WXYB 4L5JA 1A4RA 5B4TA 3KJZA 5FI3A 2W0MA 4D9MA 7REQB 1MTOA 5JYEA 3VSAA 3GJQA 2PYIA 3TLYA 1FCJA 5LXTA 4A15A 1VG8A 2HT1A 1RACA 3WB1A 1V5IA 1GPMA 2BH9A 3AY6A 4G0OA 3NJ4A 4F6RA 1JP7A 3TOZA 3G5LA 3MAJA 3OE7D 2GJSA 1ZR2A 5LUBA 2X9LA 5REQB 4F3RA 2AC4A 3Q7EA 1T10A 1IUKA 1UMCA 2A1IA 3RS2A 1W96A 4LQ4A 2WWIA 4BP3A 2J1LA 3DEYX 2C9OA 4X8LA 1I3NA 1IJEA 2RI6A 3FN4A 4LHWA 3WB9A 1KPIA 3DULA 3M1IA 3QYJA 5LYJB 3N8NA 1NVEA 3U7QA 5I8WA 4IJMA 3ZTWA 1M66A 1J25A 3AKDA 1AE1A 1QU2A 2CJWA 2UYQA 1RTTA 1ZYUA 2Q2NA 2YHUA 3BXZA 4QGBA 4M1TA 3IKLA 1PHPA 2J0SA 1TI7A 2XEDA 2FMTA 4MB2A 3KT6A 5BVGA 2OHHA 4UKDA 4Z9XA 3R0IA 4FHGA 2NLOA 2OXRA 4Y67A 2UZ1B 3P9ZA 5LPNA 3B6MA 4WV3A 5EG5A 3NHBA 2QD5A 2QW1A 2ZQZA 4UOZA 4E13A 5FL3A 3H5NA 4RU1A 5K8IA 1Z15A 2X9VA 1D5CA 3W3AD 2GVNA 4L4UA 3DNMA 1ZCFA 1RYMA 2H52A 4CLEA 1JHUA 2Q3CA 5BUZA 2PN1A 5JJKA 1ND5A 16PKA 4LYYA 4XD7A 3LT5A 5LZ9A 1I01A 5DGCA 2P69A 5DK6A 1JA9A 3OHSX 2ACKA 1EEXB 2Q3MA 4DEXA 1QB8A 3RT1A 2EKBA 3V8NA 2XX3A 3IERA 4M0PA 4YHHB 4XYLA 3HI4A 3VR5D 3IJEB 1YFKA 1NUPA 4Y6GB 1JQEA 5B12A 1M2OB 2C0PA 3C3XA 5HE8A 2GD2A 3EF1A 4KPUB 4BBPA 3UMYA 1ZU5A 2QMEA 1MV8A 1AUVA 4YS6A 1KRHA 5DMHA 1TZKA 3PNQA 1V2GA 1WV1A 2BDEA 1H8EA 3DM9B 1X7WB 4LXXA 1F1JA 3QLUA 1NZJA 1OE0A 1GRRA 5EWJA 1XK7A 2BKAA 2WKQA 4QYMA 3V7UA 4FYHA 1TPZA 3GJZA 3GRVA 2BBTA 3KD3A 2M1XA 2X0NA 1V5EA 4PWYA 2OV2A 2DBRA 3REQA 2E4UA 2GPNA 2YY5A 1SC1A 1U0NA 1ULHA 4OXNA 5ALFA 3VVCA 1MAVA 1QIFA 4MGHA 2C9BA 3NT2A 4BFSA 3K0CA 2EJWA 4B31A 4D6YA 4JHLA 4PAGA 4P81A 4RM3A 2R6FA 2I3GA 5IU6A 1XMVA 1JHZA 2Q5LA 2J0QA 1PYOA 1WAMA 4CCSA 1FW8A 2CNKA 3WWEA 4GW3A 4JGBA 1K0UA 3M6XA 2WPNA 3SZOA 5F3RA 4GFDA 2WUFA 3BKWA 1DC6A 4LWZA 2OENG 3UMMA 4HNRA 1R5BA 2V7PA 1E2IA 1BCRB 4R3NA 2R6JA 5E1DA 2OBYA 3CXRA 3P0RA 1LTQA 1O0BA 1APBA 4DMCA 3GBVA 3VR4D 1FLDA 4M8IA 4TS3A 2XOEA 3M9LA 1K7SN 3UMSA 4B84A 1N5KA 2AG1A 2HJWA 1IBLB 4K9QA 1R18A 4BNXA 1OBVA 1ZX1A 1RIIA 2PA3A 3H5WA 4QBIA 3IUJA 5DCWA 4TL8A 3Q11A 5E6UA 1XA3A 3HJCA 1J2RA 1PR9A 4Q15A 3TVTA 2YJZA 5DM4A 3UA4A 4Z3OA 5CW2A 2G80A 4WOBA 2GK4A 1EQ2A 4IWYA 2VDUE 2CK3A 2CLLB 4TSKA 5E1BA 5EOVA 2O4UX 4FVTA 1P5ZB 2FPSA 4OLBA 1E9AA 2Z2IA 2IUYA 3WLFA 2ZREA 4WI1A 1ZGBA 3DVSX 4IHJA 3KYCA 1CJVC 4TM8A 4W5OA 5DT9A 4DBVO 5JCXA 1KZ4A 3FZQA 3LPLA 4E30A 3LLMA 1C1XB 2FGJA 3CURA 3E27A 4XW2A 4DCTA 1R6XA 4L0QA 1CHNA 3AW8A 2OO3A 5BRNA 2A0XA 5CIYA 1Q0UA 1DRKA 1H2BA 2WAXA 5JWHA 5JV5A 2HBZA 4DV3B 3R6LA 3PNKA 4ZVKA 3JQ8B 4TTAA 2UZ4A 1SCQA 3L0YA 2ECQA 2OHGA 3ASYA 1XRRA 4B6EA 3EJ6A 3GDHA 3V1LA 1QJ4A 4LJ4A 3K6SA 3H1PA 3HJBA 3TE6A 1V41E 1PUIA 1FP4A 5H3HA 2RHOA 5K8VA 4RD3A 1OGJA 4IIDA 4W5QA 5G53C 4H3VA 3E18A 2YRWA 1ZN2A 4QRHA 5I8ZA 5A3VA 4E1VA 1ZSVA 3PGA1 3QKIA 2KHZA 3TLJA 4RIHA 2C4UA 2ZVDA 1P3Y1 3ZE7A 2W6QA 1KZ7B 3AF2A 4Q66C 4A8PA 1A4XA 2PGIA 3MJCA 4JKOA 3VPFA 3ZU5A 1C3EA 1KC1A 2Q0SA 4OQEA 3TEJA 4OBWA 4AKIA 3JQGB 4NXNB 1UBRS 1QC5B 2QUAA 3BE4A 4LYEA 1N57A 4IICA 3OG9A 2GDJA 4AJPA 2OR3A 3FNFA 2UVPB 3B82A 1EUZA 1Y6ZA 2NTYC 4H27A 4R0MA 3ADCA 4UTPA 1HV8A 4R05A 2DJ5A 3MZ0A 5DOZA 5JS8A 1A8IA 2CXPA 4ML3A 4UXIA 1ZD5A 5FKJA 2CZGA 3PHCA 1GPNA 1ZM4A 2AT1A 3A1DA 4NJOA 1WUIS 4H3SA 4QPPA 4D4IA 1CRWG 3M6MD 1NW4A 4JCCA 2PMBA 3KTOA 1DC5A 2CV2A 1M34A 2BBSA 2W4QA 1ZAKA 3AP3A 3AV3A 3OOJA 4ZJZA 4P34A 4IDCA 4CT4B 2XBLA 1DAIA 2Q5EA 4L0DA 1IATA 5FQNA 2J46A 4OOFA 1RWBA 3RKUA 3TSCA 3U7JA 4ZGGA 1XO1A 2XOKD 3GGDA 1I2DA 3S2YA 1FSSA 1XPOA 1GKYA 2VSOA 2J32A 4ZAZA 1USWA 1IHPA 2VNIA 4K26A 4CL3A 3CNNA 1YC5A 1YRQA 3A9SA 2C7OA 4GBJA 1VKRA 4EZIA 2BFNA 4YCMA 2OGZA 4MJ7A 4YJGA 4WKGA 4DJJA 4CIYA 3A6GA 1IJFA 4RDHA 4LFAB 3KQNA 3ESXA 4IG9A 2GI4A 3UF0A 1A7UA 1A9YA 2F4NA 4PPYA 3BJIC 4Q3CA 5K6AC 2X58A 4MKZA 5ERGB 3JAMA 1E92A 2PAFA 3W6ZA 4PTYA 2XKBA 3QBEA 5K6RA 1GJRA 1VL2A 1A9QA 1R5OA 3CTPA 1RHMA 4OGKA 3OJWA 3ZNQA 3OO0A 4QUHA 5K99A 4TZKA 2BZGA 1O8CA 1KF0A 1YKGA 3DXXA 3FFBA 3JPYA 1SG6A 3Q7QA 2XT6A 1MGOA 1IAVA 3ITKA 3O3OB 3NOXA 3OEYA 3QEMA 3JQBC 3U4IA 2RG7A 4TKZA 1ZH6A 2DERA 3LDHA 4KQWA 5FR2A 2HC9A 3WGVA 1U0OC 2JHCA 3CO5A 2I2DA 1NX9A 3D43A 4RESA 1E2GA 3FCSB 1AHIA 1HSZA 1XOIA 2SICE 3SF0A 2A9KA 2EF0A 4WNAB 4LDZA 3AHEA 4DLTA 1QZ3A 3PEEA 3A9UA 3FZEA 1VJDA 2OZLA 2PZEA 5HE9A 1CK4A 2A9QA 3B5EA 1CLUA 5EJGA 3UY4A 3VV3A 1WUJS 3A9VA 2B5OA 3R5KA 2FZLA 3TNFA 1WD7A 1F1BA 4RDXA 4HEQA 1B76A 1VJ0A 2PQ0A 3DQQA 1J2UA 3L0DA 4ACBA 4F46A 2IS4A 1UJCA 3QU5A 1OHHD 1L7VC 2OQVA 5E9JA 3VPGA 2WHPB 1YRAA 1DTWB 4KQIA 2O20A 4L72A 4QU5A 3GZNB 1KKUA 2CLKB 1LSOA 4IUDS 3U3DA 3BXFA 1DRVA 4RBNA 3KZ1E 1T2EA 1VTKA 4A8JA 3OCJA 5JXWA 4RWZA 2JJQA 1P0FA 1WCYA 5ICSA 2PKYX 5IFKA 3ETNA 5ISMA 1F9AA 2GLXA 5CDGA 2E3JA 4YMWA 2CZQA 4U8GA 1M8PA 4N5NA 1H69A 4GU5A 2QRHA 3ECCA 4JI5B 2RGNA 2PKRA 4NENB 4NJEA 3VI3B 3ZJYA 3MMSA 1H5NA 4L5IA 5CJ2A 2ZYAA 5DGTA 3ZZUA 3LKBA 2A58A 2FSHA 3U5ZB 1NQVA 2OCBA 1ZW6A 3GRZA 1HUQA 1U11A 4II7A 3VNRA 1E6UA 1NT4A 3BH6A 2CJYA 3C15C 4H2DA 5BRAA 5IN5A 4H7IA 2ZTVA 4N7RA 3WZLA 5K8CA 4QQKA 4CL2A 4EELA 4GPTA 3ME5A 3ZD9A 5AHOA 3L6BA 1D4AA 2ZR8A 1I6LA 2BH2A 1YULA 2I71A 5KVSA 1PE0A 2XZTA 1RPTA 4MV3A 4GOOD 5AT1A 4R9VA 4EPTA 2DBVO 2C8JA 2GFQA 4RX1A 4OPMA 3ZD6A 1J90A 3BA6A 3RUHA 3AR7A 4MVJD 2HGZA 3ZU6A 2RJ3A 4TMFA 4POAA 1JSRA 1Z73A 4IJWA 3P2IA 4HQKA 4KTTE 1P29A 1VJ5A 3MWDB 4TOIA 3INRA 4NF2A 1YQTA 4EI9A 2WJVA 2X5JO 3QKTA 3OPVA 2E1RA 2C8KA 3OA2A 1DJMA 4EL5A 3OVMA 3AZQA 2BPOA 4PLWA 3C3YA 2JJMA 4HMQA 5BSTA 5JANA 5C1OA 1FFAA 4MR9B 4DR6B 1EQAA 3GWGA 2H18A 1CNEA 3HFSA 1Y6RA 3WYBA 1XI2A 1TQ8A 4WECA 2OBMA 4B3XA 1QZUA 2ZXFA 2QF7A 1Y1TA 1Z8NA 4OI4A 5LCXA 4Q4LA 3ZXYA 5ITVA 1TUBA 1T9DA 2RH9B 2ZUUA 4PFSA 1F7VA 3R77A 1A27A 1AK9A 3D0QA 3I30X 3Q0EA 5SY4A 4F86A 1FK8A 1HH4A 2B2NA 2WJ6A 5B3KA 4X5OA 1FTNA 2C7QA 2D7DA 3C39A 2TSYB 2XE8A 3DT9A 5A2QA 3OF2A 1C7RA 4J29A 1P1RA 1WDMA 4MYDA 2QT1A 1W85B 3PXBA 1KOLA 5D01A 2DCMA 3WBJA 3CVXA 3G0HA 4FYVA 4Q3EA 4DB2A 3P2YA 1TU4A 2JHFA 3G2MA 3AH8A 5I3ZA 1T25A 4RTSA 2D0OB 2QPLA 4RHYA 4TQAA 4J0HA 4YK7A 1T4DA 3AK4A 4E31A 2PMWB 1JPUA 1ZJ5A 1CVRA 2ZI6A 3VO9A 4TWAA 4QOFA 2NZWA 2W8BA 1UK8A 4WKPA 4YAGA 3EGOA 1QIKA 4L5YA 5E9AA 3KOWA 2VP9A 1BROA 4LZJA 2HMAA 4MIEA 2ILVA 1W0JA 5DP1A 1QVRA 4A9AA 4QQ8A 4DZRA 2XCRB 4GXRA 2W48A 3G02A 3HMKA 4OUKX 2BEWB 4BO2A 4NG5A 5EYPB 3WO0A 4TZ0A 3I6ZA 2VDOB 3NPAA 1X80A 3TPFA 2Q4TA 1Z4MA 1NY5A 1Z6YA 1H1DA 2XITA 4MJXA 1ABFA 5AJTA 3ZDAA 3BJRA 2BV3A 2COKA 3F49S 4C6HA 1Y81A 5DNVA 4AP5A 3PDWA 4BEBA 4J1NA 2I2FA 1VSBA 3I2FA 2X4LA 4BZZA 1QLJA 4JEIA 4KRFA 2IDKA 4LSZA 2BUBA 2JAHA 2QYTA 2VRBA 4EHAA 3A6ZA 1V9CA 2BWJA 2I8LA 1IY2A 1ZJZA 3EDOA 2QQ5A 3QKUA 4D42A 5KTYA 3EZFA 2OKGA 1L4HA 2R9VA 3AI7A 3L6UA 2O8EA 3G2KA 3GUHA 3QE4A 4RQAA 1Q20A 2FW7A 3MCZA 4EYKA 1Q17A 5FHRA 3H18A 1MEEA 4X3OA 2DPMA 3U0BA 4RA6A 5B1YA 3OTOB 1Y4SA 4LKOA 2IJGX 5DBHX 5TSDA 3RRJA 3V00A 4MVJI 2UXCB 2PJDA 3CPJB 3FPJA 1TA0A 3HACA 1RWMA 4IH4A 1GQOA 2VXCA 4M88A 3SSNA 4X71A 3QI7A 1I9CA 3QOWA 5E0OA 1O95C 3DD5A 1AS3A 3C85A 2HGSA 3UZUA 1P91A 1AS2A 4EPXA 1BKDR 1RZUA 4Z7JA 2HPHA 2XODA 4PWZA 1Z0IA 3DMNA 4S05A 2QBYA 1Q11A 3ZU4A 3LDFA 2KB0A 2NU6A 4UPEA 1XVUA 1J4AA 3HJHA 4F6LA 3SZUA 2Q6TA 1VHTA 5MFPA 2XLCA 1D0IA 2WYWA 4FYMA 1ZDMA 2BFEA 2Q7DA 4A1OA 5C9ZA 1BN6A 1IG0A 4DRYA 1GZ3A 4CF5A 3OQIA 5CX1B 2BGKA 3PFWO 1Y7TA 2W22A 3CQ9A 3O2JA 1QV6A 4JUFA 4RLFA 4JHXA 5H3LA 3L7BA 1ZP6A 1GFWA 1XMJA 5KUTA 2EJVA 2M32A 3WK9A 1O87A 1H1LB 2GN8A 4EA8A 4PVDA 4DILA 3WV5A 3SKYA 4CZ2A 3LMKA 4YQYA 4L4XA 4XJTA 3RTAA 1AM4D 2FEKA 3U1BA 5KOJB 3K2IA 3PFCA 2FF5A 1E6LA 3VVMA 4GKKB 3FNQA 5HYVA 3KSUA 4LJ8A 1NV8A 5AVVA 1GSHA 2PT5A 2D06A 1M67A 2ZQYA 5FUQA 4ENUA 3GFPA 4OAOA 5EIWA 4DXDA 4DXHA 3ETCA 4N65A 4TTPA 3X44A 1KO4A 3PNPA 5AJXA 3WRYC 3CT4A 1S4MA 1HE4A 5CJPA 1JEYA 4B44A 4PLCA 1UAGA 2EL7A 1DEXA 4Q00A 4I50A 1P3JA 4RGQA 5ICMA 2Y1FA 3EW7A 1H85A 2CYCA 2GD0A 4G0NA 4AUNA 1V0JA 3ACCA 2W6JA 5TQ2B 5GOZA 1LC3A 5BN5B 1RJEA 2E5FA 2JASA 2Q3BA 4RV9A 2R8ZA 2CNOA 3U7IA 5L3VA 4WFQA 3KWFA 5CVDA 2QTLA 5I4IA 1M8KA 1L4KA 4US2R 4GOLD 1KZ1A 3F6EX 3R3VA 4L95C 5DW0A 2VTBA 3E5HA 1VL5A 5DYWA 2RG1A 4P3YA 3FF1A 5J4VA 3KCQA 3D6MA 3WLIA 4OHRA 2FFJA 3WGYA 5CFRA 4LA4A 4IEIA 4PC2A 5KNCH 3A26A 3P0EA 2CYAA 1N0VC 2JA2A 2WAYA 3ISJA 5CCDA 1DAMA 2P41A 3D3QA 3O73A 4N6GA 3ZJ4A 5F12A 1TM7E 3OLWA 4WK6A 5KVQA 3OI7A 3N8IA 2G28A 2ZUWA 2ORWA 2GTPA 2I4MA 1LX6A 3B1JA 1CS0B 4YO7A 2EERA 4UFNA 3MRSA 521PA 4I55A 1GIAA 1Z3CA 4M4SA 3TE7A 1Y9DA 5E6RA 5IWCA 5IM4A 3GLFE 2R1VB 3M6AA 4LRQA 3KJNA 4UAVA 3W1WA 3FSJX 4CFYA 3G9XA 1OFUA 4DOMA 2ECKA 1DAKA 3I6IA 3ZBUA 2VYFA 1JN0A 2ZBPA 1OU0A 1N2GA 5FTJA 3D4NA 1JXOA 2QJOA 4YXFA 4P58A 2PZJA 5KEIA 5KTSA 3D8SA 4RVHA 4TVKA 4AM8A 4YGYA 4P33A 1ZL0A 1F5SA 1IBSA 1T2UA 1TYCA 1T9GR 3NW9A 4JN6B 4PLFA 5T4FA 3RTDA 3SN6A 4A23A 1R0KA 1Y5RA 1S2GA 2AC2A 4UUPA 2JFFA 2P2YA 2CUTA 3K1ZA 4XVHA 4B1FA 5BR7A 3DEZA 1RC1A 1SZPA 4FILA 2QDKA 2AFIA 1YZFA 4WXPA 3KZNA 4QUKA 4OLAA 3ZE0B 1LPSA 3N8KA 3W5JA 3WLEA 4ECEA 2V4MA 4C5AA 3UMVA 4MGIR 1G2QA 1OZHA 3IO5A 2G76A 5K0GA 5K4GA 5F9HA 1F2TA 5LP1A 4FDTA 4P38A 3BWCA 2M6LA 3NWOA 3U16A 2TMGA 1Y33E 1ILEA 3KQQA 4DIEA 3H8JA 4OXKA 3ZCQA 5MN4A 2AK3A 3P2EA 3GLFB 2HHCA 2QM0A 1H94A 2QE6A 4JXXA 1AVTA 1K9VF 1FMCA 2BMDA 1VZ2A 4Q16A 5DX1A 1N2OA 2KS6A 3FSRA 3EUWA 4OGFA 3ZH9B 1FMTA 2V45A 4F8JA 1FVXA 2NP7A 3UG6A 1M6NA 4MPPA 4M7OA 3ZWPA 1JDPA 1ZESA 4DTCA 4ZEOA 3ZBTA 1C1YA 5IXJA 3IQDB 3R41A 3DTVA 4EFDA 4CMKA 2IYZA 3Q2KA 4F85A 5AKKA 4LMAA 5EIBD 5A7GA 1X2BA 3W9UA 3ZHSA 3O8CA 4LF7B 2UV8A 2JLYA 2F8TA 1VJ1A 5DHQA 3HVRA 1KWKA 4MIOA 1ZD3A 1YGYA 4UDYX 1PR6A 2X14A 4D3DA 1FPQA 1HOXA 1Z75A 1S02A 2AH5A 2FMIA 4WOCA 1EGVB 3P9SA 4FGKA 3SYKA 3I61A 1XZQA 5EIXA 5HOEA 2HU5A 5J2TF 4M0KA 1D04A 3GX1A 4IJVA 4RH1A 3ZCVA 3I9JA 5E8JA 5KNCD 3NGXA 4TVSA 2YJNA 1QQAA 1N3LA 5CTAA 3UXMA 1Y5IA 2NZJA 3QPBA 4ZVQA 4TMXA 1U90A 1W6RA 1BRTA 2F1OA 2ODEA 2X9QA 4YXWA 3E7WA 1NN5A 2WJPA 3A05A 4AXBA 1B0PA 1P2SA 1SXHA 2I67A 1JQDA 1XP5A 1AKQA 2AW5A 4CUZA 1U3WA 4TTJA 3LH5A 2IUTA 1KEUA 5EPUA 1B41A 1ZK4A 4GGMX 4K9DA 1CF4A 2V7QD 4TV8A 2WR8A 1MORA 4D26A 3V34A 4DDHA 4DR2B 4CEHA 1NBEA 4MWTA 3GP8A 1QYVA 4X6XA 2V96A 2OQ2A 3BPSA 3FGOA 3UN1A 2P62A 4FGZA 4PSDA 3X1ZA 4EW3A 5WRFA 5CDHA 3DD1A 4MR8B 3ZX5A 4EHJA 4IQ8A 3I8XA 6ABPA 2WD7B 5LA6F 1Q19A 4J1QA 1ZHHA 5J4KA 4AJNA 1KY3A 5KMGB 2RGEA 1T4BA 4HP8A 3AVQA 3H9JA 1RLTA 1N5JA 3ES9A 2W8ZA 2ZAIA 3EGXB 3MTDA 1SKYB 4PZCA 4RF4A 3W5DA 4RJ2A 4Z9BA 3RPEA 1NG1A 1XBTA 4XR9A 4I1VA 2PUFA 3AVPA 4MWBA 4B6PA 4DREA 3NHKA 1Q15A 1FFWA 5FOVA 3NT4A 4L8YA 3ZK8A 4YRIA 3R6DA 2V7XA 2WU4A 2YJ6A 1SXJA 2B8TA 4RF5A 1YQUA 2VT6A 4UBNA 4MB6A 1VHQA 3C3EA 1L5ZA 4MYUA 1ZGGA 2H54A 2Q6IA 2HF8A 3A11A 1CR4A 4CGYA 2J87A 1OW3B 1Y8RA 1SKYE 1ZXLA 3ZC3A 3K1AB 4YV1A 4CMIA 3OQ6A 1XLWA 2G08A 1PJ2A 3N2KB 4IKPA 3R5JA 1EVYA 1U8TA 4B6OA 1L1QA 2V8OA 2A8YA 3PQ3A 3ZHQA 2VL7A 4DDWA 1HFWA 4FT2A 2K2WA 5FOXA 1A8UA 2A67A 2AVDA 3HM2A 1GTJ1 1CVIA 1E2PA 1U2SA 3BWBA 3C4QA 3MUNA 1EINA 2OGUA 2YRXA 3IOBA 5BT9A 3HUTA 4GL2A 2AOUB 1RKBA 4BEJA 3HH8A 2BJHA 1FFSA 5KX5A 4UW9A 3EH2A 2SKDA 1RLJA 2WM9B 4DEVA 3F5QA 3FRIA 4MWOA 1NUSA 1RKQA 3OC0A 3KJFA 2CD9A 1RI1A 4JLBA 5JS7A 1U2PA 4WOPA 2ZSJA 2RKBA 1YZGA 4MOWA 2VJMB 2WZDA 1P1FA 4EATA 3LLVA 1JF8A 2J9GA 3AEQB 3NJRA 4G1UC 4WA8A 2J4FA 3E1KA 3KEOA 5H8WA 3FPFA 3GLVA 4QOEA 1YL6A 4AT1A 3VQTA 4DSNA 1RYZA 2FW6A 4GZ5A 3N5CA 3LX4A 3ZH2A 1JHQA 3PRKE 1XD2B 1XU4A 2GT1A 1I32A 1PK7A 3VOBA 4BX9A 5G1PA 2JGFA 5KYUA 3V7NA 1JE1A 2NYAA 3VZCA 3NV7A 3OE7A 1M1NB 4PHGA 4F71A 4ZMRA 4CCYB 9ABPA 5H4GA 1SXQA 2WSMA 1L3IA 4KQ6A 1IIBA 4MV9A 2Q07A 1SQSA 3PHJA 1GU7A 1HRDA 1CY6A 3TTVA 3JASA 1T5OA 2HSEA 4P31A 4EO4A 1YB7A 2VNKA 5TC4A 1AK1A 3I58A 1U8UA 2NU8A 5HZGA 1JJFA 3DMTC 3ZWAA 5LA6B 3I1IA 4NZYA 1VL6A 4V24A 2J08A 5AJYA 4BNJA 1EJ0A 2ODWA 4ZDKA 3HRIA 1NNUA 1Y89A 3OZDA 4UU0A 1O6CA 1W47A 2C4VA 4RD4A 421PA 3EG9A 1A5ZA 1JG3A 2XMZA 5J4LA 3KKMA 2HMVA 3LP8A 2QP9X 3RS7A 2E49A 4ZQEA 3WQQA 2W6CX 5I9SA 3N58A 1HT0A 1UMKA 5A4DA 1T91A 2WW8A 1KGDA 5DTEA 1XZMA 1GDHA 1T8YA 4TLBA 2MCFA 4YX9A 1UP7A 2O2EA 2Q1WA 1P4AA 3QKSA 3QHQA 3VYSB 4BLQA 4EYSA 2HA3A 3ABZA 1NI4B 1FXWF 3A0RB 1AKVA 3C16C 2VT3A 4HYQA 3G6WA 3JRXA 5KU1A 3SM3A 4CEJB 1K89A 1ESCA 4PXAA 2BFMA 1UDWA 1U0FA 4RADA 4E6PA 5HZMA 4AXXA 4RAQA 2JAQA 1IXZA 1WM1A 3FSGA 5BWMA 2CVHA 1SVLA 5GONF 3OWHA 4DV6B 5C8DA 1BE8A 5EIHA 2A9RA 1DO0A 3ZEAA 3A4NA 5FWXB 4BN4A 3MAAC 4B6GA 3O3MB 1L5QA 5ALQA 2RGBA 3VR2A 1NM5A 3SDBA 3UYLA 2ZTUA 3UUGA 1UK9A 4EGQA 2WWXA 2MMGA 5ARDA 1S1MA 4W9NC 1BGXT 4BE9A 5KSYA 1EJ6A 1FNMA 3HU5A 821PA 3GD7A 5AIBA 2WUDA 3WJ2A 3I1JA 3NT5A 1DJQA 3ZVMA 4J7XA 3IBYA 2HSWA 4G5RA 1JLRA 3COYA 2ZJ4A 4WZAE 1JJVA 2PGLA 3TMKA 5KWVA 3VU3A 3ICQB 4DT1B 1N6PA 2ENUA 5FUYA 3UC5A 4GOXA 3ROQA 4JITA 2DAPA 5DB4A 4DIBA 2F00A 5CK5A 1DWUA 3HXPA 4NZNA 4XKJA 3DEHA 3CWZA 3LUKA 1UH5A 4TXMA 5F4ZA 2GJ8A 1KYIA 1I30A 3HCNA 1C1HA 3OSUA 4OHCA 5K3FA 3VR4A 5DJ5A 3PC6A 3OZTA 2E1PA 1TJ3A 3CZQA 4DUPA 4HKTA 5IDXA 3N0WA 2NUAA 2X19A 4QUEA 1ZOLA 1DIGA 2IOQA 5CLHA 5TB5A 3AR4A 5I7VA 1RBZA 3S40A 4YFVA 2A0YA 2RGUA 4UBLA 3B1XA 3M3DA 1K6JA 3CZ4A 1TYBE 1BN7A 4JUBA 1MOPA 4H18A 1AX9A 2J5XA 1CDDA 1E5DA 1AG9A 4MV4A 3MT9A 1KPHA 4URWR 4UNIA 1FFYA 3AF0A 4ZVLA 1WXQA 3MHTA 5DSZA 4EQZA 4X91A 1D1SA 1G6HA 3WGLA 2HFJA 1MJFA 3HZHA 1PFGA 3E2IA 3IQEA 4MA5A 3ZY3A 2ZBEA 1E89A 3BK2A 2ZULA 3OOWA 1UPCA 2BJWA 1TGVA 4LRSB 1PNQA 4RHTA 3EAGA 4II2A 3V48A 2J9RA 4YAOA 1ZUWA 4D79A 3MQ2A 2HK9A 4EVRA 3W0LB 1AQUA 4KQ2A 3VDRA 2XUPA 3TR6A 4WRRA 4XTRA 1PFQA 1ZA2A 1GZUA 1WQ1R 4FKZA 2RMKA 3MJSA 1S2DA 1XAHA 2ON6A 4XIGS 1MC1A 1OROA 3OP4A 3VVBA 1KDTA 5HZKA 1IZ7A 4OGWA 1Q1BA 2P91A 2J5BA 1D7OA 5D3KA 4AQYB 1AKNA 3RANA 5CLFA 1TTPB 1Q7GA 3HSYA 3PB3A 2PUAA 2IHJA 3NB0A 3AQIA 5M2QA 2ZJFA 3I28A 3I9FA 3IP1A 3L6DA 4JASB 2OPHA 2IHZA 1LS1A 3BRWD 4UXHA 4QNMA 2ZG6A 1Z7EA 2ZIWB 4MVXA 1NMSA 4MWEA 3T9AA 3TZLA 1IOVA 2GN4A 3EDYA 1IYZA 3ZG6A 3K70C 1TDJA 4MIYA 4U7PB 2I7TA 2WWHA 1TNDA 2NPIA 3OCVA 2WBLC 4DANA 4E3WA 4F91B 3DLBA 2ZS7A 2G17A 3RHSA 4ILKA 4TMVA 3V97A 3L4EA 4HQFA 3ISVA 1ZCZA 1ZVMA 3PCXA 4HH1A 4NOMA 4RK1A 5DLPA 1DAGA 1NBWB 3WR5A 3HG7A 1HDCA 1KFJB 1WPGA 2PSJA 5I9NA 2FG6C 2Z3ZA 2NPFA 1EP1B 3ZXXA 5I51A 4P54A 4PYRA 4B5KA 4LQDA 3ZY2A 5FWDA 3KWMA 3BUSA 4TZTA 3UKOA 3UGTA 2XOKA 5FWYA 3D31A 3CKLA 2JBAA 3FB4A 3Q5EA 3G1TA 3RVQA 4UQLA 3EX7C 2FZCA 1A9PA 1V1RB 2XPCA 4BAZA 4EHDA 1D9XA 3H2SA 3P71T 2BGGA 1ISGA 3GVHA 3OZXA 5BN1A 1QUEA 2GFIA 1JQ3A 3QJ5A 5L3SB 4K6OA 3G8AA 4LPKA 4BTEA 4RV5A 3R3XA 1KFKB 4D5EA 2Y66A 5JAIA 5BNFA 1KQNA 5K4HA 5IN4A 2QTWB 2ZPAA 2ZSKA 2PHZA 3B12A 3PPWA 3GJ7A 3CG0A 4MR7A 1QIEA 2O5VA 2KBFA 5BSGA 5IK2D 4KO3S 4ZTZB 3KAJA 3EODA 2SBTA 4BJ1A 4ER7A 4WK4B 5HJ7A 4LI3X 4YRMA 1KRWA 4LGCA 5JPIA 1TF2A 3IUEA 2YYZA 1UBHS 2B8EA 2FXVA 3EB9A 2GJAA 4TXLA 2FI1A 5CNJA 5FL7D 1A9RA 4LYFA 1MJ5A 1RWPA 2UAGA 2B30A 3I05A 5K09A 1IHOA 1LTKA 3D0RA 3GGCA 3DAPA 1EVQA 3HA5A 3AHIA 3P94A 2YVKA 3T35A 3ZI0A 1JR6A 3D2AA 3G7SA 1T36A 1X39A 5AVUA 1H65A 3AKYA 4YONB 1MW9X 2QXUA 4KJXA 1U3GA 4DAEA 1VIMA 2CUKA 3VYVA 1KMIY 4S1VA 1AD2A 2PRJA 2V98A 1M74A 4AMYA 3ZVNA 4G23A 1VCMA 1V1JA 3K0AA 1DIOB 4IIGA 4AKSA 3U44B 3P27A 3QF4B 4JK3A 3ZU3A 2BM0A 4DS3A 2ZE6A 3CLTD 3HXTA 4UDNA 3QE3A 1C9MA 1R9MA 3AEYA 5IF3A 1TLFA 1WA5A 1WBDA 1OHHA 2J3EA 1NJSA 4E32A 2GEJA 3BCSA 3QXJA 4AX8A 1H4QA 4N6OA 3O1IC 3O75A 4OXXA 1U0TA 2QMQA 3FZGA 4RH3A 5IJAA 3EXHA 5EUQB 4FMCF 4BP8A 2P67A 4BP1A 4L9AA 3G9TA 1WU8A 2JEZA 1U31A 4X7MA 4M8NE 1QQ5A 1EI9A 1RXVA 2X15A 2CLHB 3PZRA 3QVTA 2A1TR 2HN9A 3B1YA 1TW3A 2NXCA 2GD6A 4LJYA 5FBLB 1LDYA 1QYXA 4AN4A 4LF6B 2QLTA 4C1NA 1O58A 3ESAA 1T2AA 3UWPA 4CM3A 2VA8A 1MDFA 2XNSA 5FLYA 2GCOB 1O97C 2LDXA 3PSAA 2VDKB 3AC0A 1N8KA 1YTLA 2P40A 4Y1RB 2DKFA 5TRTA 3ZVRA 5L51A 4TTQA 4ESHA 2J30A 1DBPA 1TK2A 1X3LA 3WLNA 2H1SA 5ALLA 3DDUA 1O0CA 4U2FA 5KQGA 3TLZA 3IFSA 2HNAA 5C4IA 2QUZA 4ZI5A 3R7SA 1TVCA 4RFLA 1UMBB 2I4OA 2VUSA 3KC2A 4J4HA 1E1CB 2JLRA 3JD2A 1R16A 4ZO9A 2TECE 5DGIA 3TSYA 1NLZA 2Y76A 2NX2A 2O1EA 4MVJA 4K5QA 4EPYA 3HV2A 4TV9F 4Z8XA 1E3JA 2C95A 1V39A 3DXFA 3AF6A 4R8SA 2H07A 1CQJA <