5K0LA

Crystal structure of comt in complex with 5-[5-[1-(4-methoxyphenyl)cyclopropyl]-1h-pyrazol-3-yl]-2,4-dimethyl-1,3-thiazole
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
219
structure length
219
Chain Sequence
b'GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
molecule tags Transferase
source organism Rattus norvegicus
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
total genus 80
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k0lA00
1JG4A 3B5IA 1NW5A 1JR4A 3SX0A 1G38A 5LR6A 2ZZMA 4CTJA 4MIKA 5BXYA 3BZBA 3FYCA 4HGZA 3ER8A 3AXSA 5IH3A 3EEOA 3HTXA 5ICCA 2P7HA 2YX1A 4QPNA 3M6VA 4E2WA 2B2CA 1M6YA 3R24A 3SM3A 3MCTA 2BR3A 3P9IA 3EVBA 5HEKA 2YUIA 2FYTA 1NE2A 3I53A 1L3BA 3FTCA 3G5LA 2P1DA 3PTAA 1U2ZA 4P7JA 5EIWA 4JXJA 1KHHA 2PXCA 3OFKA 2EG5A 3PT9A 8MHTA 4M7RA 5HFJA 2V7EA 3I5UA 5T64A 4FT2A 4U7PB 3OU6A 3WSTA 4RSRA 3TMAA 4M38A 3V97A 1MHTA 3OFJA 4A6EA 5LQAA 5F2OA 1R18A 4XUDA 4RTQA 4AZVA 4YUVA 1L9KA 1XTPA 5LQCA 3A26A 1JQDA 2A14A 3MERA 1YZ3A 4CTKA 5F2KA 3TOSA 4DKJA 3UA4A 2AOUA 3MQ2A 3FUUA 3G88A 4RYLA 1KR5A 4OQEA 3KR1A 1DCTA 1XXLA 3LDGA 4X63A 2GH1A 1YFJA 3ERCA 5IKMA 2H00A 1VPTA 1RJEA 4NECA 4RTRA 5EG5A 3FTEA 2CMHA 3BWBA 4PIMA 3KPJA 3EVAA 4ER3A 5CCBA 2ESRA 2G72A 3FZGA 4FP9A 2WA2A 5DSTA 3PLAE 3CVOA 3M6XA 4DCMA 1G60A 3AJDA 2FHPA 3FPJA 5U4XA 4ER6A 4OBXA 5K0EA 2GS9A 4YUWA 5LSAA 1PRYA 1D2GA 1FPQA 1L1EA 1WXXA 3M33A 3GRUA 3ID6C 5C9ZA 1SUSA 3EVZA 3NVMB 4YUXA 3TFWA 2IP2A 5CIYA 3PVCA 3UJ9A 4RTSA 5DXJA 3C3YA 4XUEA 3ME5A 3DXZA 3UJ6A 2EJUA 2AVDA 1VP3A 3KQTA 4QVKA 1NW3A 2AOVA 2P35A 3KQQA 2IDJA 3BUSA 4AUKA 4PYKA 2ADMA 4DCGA 4R8SA 5EKUA 5HILA 4MHTA 3PB3A 1ZHFA 2I62A 2ZWVA 3UZUA 3HVHA 1YFLA 3Q87B 2IH4A 4E33A 2FK7A 2GB4A 3I9FA 2OYRA 2BM8A 3ANXA 1X1DA 2OZVA 3AY0A 4GEKA 1B42A 4BLUA 2VDVE 3GJYA 5MHTA 1T43A 4BLVA 3FUTA 2ORED 3G89A 4KIFA 5K0BA 2C7RA 3HCEA 1EIZA 2E5WA 2ZBPA 2YR0A 3GXOA 3UJCA 5FUBA 3KR9A 4LWOA 4QVGA 4UOEA 3LBFA 2PX8A 4OA8A 1NW6A 3NWBA 3UWPA 5FQOA 5H02A 5CVJA 2CL5A 1RI2A 1VBFA 3BGDA 5K0JA 4RTPA 5DTRA 1XDZA 2OB1A 4MWZA 4RVDA 1X1AA 2G8NA 2YTZA 1O9HA 5GP1A 2P3QA 3TKAA 3GDHA 2F8LA 4PYQA 3P9NA 3SVZA 1QANA 5DM2A 1X1BA 5EPEA 1UIRA 1WZNA 1P39A 4E70A 5DTMA 1FP1D 1BC5A 4RTOA 2O07A 2PX5A 2NP6A 2AOWA 1WG8A 3CCFA 5DSXA 1KIAA 4GQBA 4DZRA 3LCVB 3M70A 4H0NA 2ZSUA 2JHCA 3CJQA 3I58A 3Q7EA 4B17A 4GOND 1G8AA 1L3CA 3UFBA 1ZQ9A 2HNKA 3LDFA 4PYLA 4YMHA 2NXCA 1VL5A 1F3LA 1NBIA 1Z3CA 2ERCA 2PT9A 2VDUE 3GRVA 4HTFB 1L3IA 2H1RA 3B89A 5LQUA 2B25A 4PCAA 3HVKA 1YUBA 5DRTA 1G8SA 4FZVA 3T0IA 4EQZA 2YVLA 3CJTA 3LBYA 3HM2A 4RX1A 3HVJA 3CBGA 1G6Q1 2ZZKA 3DULA 2C7QA 1NV8A 3EGIA 3UA3A 1JTFA 3GRZA 4YV2A 1JQ3A 3HCFA 4PYNA 3CJRA 3M6WA 5EEGA 1EQAA 3EVCA 2PX4A 2V74B 3E23A 3SSOA 3DXXA 5DM4A 4CKBA 2JHPA 5EZSA 1XJ5A 5FWAA 4DQ0A 4M37A 4V0QA 5ERGB 4MQ4A 3G2MA 5FULA 2UYCA 3NTVA 3FYDA 2PGXA 4PONA 4IWNA 2C7OA 2BZGA 4PYIA 1HNNA 4RTMA 4R6XA 2FRXA 4PWYA 3HCAA 3VSEA 2R3SA 3DLIA 1ORIA 5FA8A 5GM1A 1RI4A 3FRHA 1RJFA 3P97A 1PJZA 1QYRA 3PS9A 1I9GA 2ZZNA 4HGYA 2OY0A 4RVGA 1EJ6A 2CKDA 5FHRA 4ISCA 1SKMA 5K0LA 2FPOA 3P71T 1D2CA 2AOTB 3T7SA 2JH8A 2XVMA 3EVGA 2QE6A 3HA7A 3SSNA 5EKXA 3C0KA 4E30A 3ORHA 4XUCA 5FTWA 2DULA 1TW2A 3ELWA 5EMKA 4OX9Y 2ZWAA 5E9JA 4YMGA 4RV9A 5KS2A 5E1BA 4EKGA 5K0FA 4CKCA 4OA5A 2XVAA 2PJDA 2GA9A 3HEMA 5LQRA 3FRIA 2K4MA 2AS0A 2OO3A 3KQVA 1RJGA 5CVEA 2Y1XA 2IBTA 3GRYA 4GF5A 1EAMA 3P2KA 4QDKA 1FP2A 2AZTA 2PV0A 3R0QA 2AR0A 1RI5A 2IFTA 4QTUB 3OPNA 3G7UA 3EGVA 5EVJA 5C1IA 3MTEA 2PLWA 1Y8CA 1R00A 3R9XB 3FUVA 2IH5A 3JWGA 3M4XA 2O05A 1VE3A 1INLA 3KPVA 4BP1A 3PX3A 5KQSA 2XBMA 1I1NA 4QQKA 5DTQA 3DMGA 2N47A 1UWVA 2PXAA 4KVZA 3C3PA 5K09A 4PNEA 4RTKA 5CCXA 3ELYA 3LX6A 3E8SA 5FQNA 2XYVA 4GC9A 4AZWA 3GRRA 3IYLW 4X1OA 1EJ0A 3K6RA 3UJ7A 2QYOA 5CD1A 3EEYA 2Y1WA 1QAMA 3IHTA 2G71A 2P40A 2NXJA 3R3HA 5DM0A 3B3JA 3DH0A 1AV6A 3U81A 2PWPA 4E2YA 4QDJA 2ZIGA 3KPUA 3FUXA 3P2EA 1YB2A 2O57A 3GO4A 5CVVA 1JSZA 4F86A 5HIIA 5EHGA 3QV2A 2ONYA 5GIOE 4P7KA 4HC4A 1ORHA 3TPZA 3KHKA 5E1DA 5DM1A 4CKEA 2PT6A 4EK9A 1HMYA 3HCDA 3SMQA 4YV1A 4RTLA 1XCLA 4BP3A 1VIDA 3GCZA 3KPWA 3HA3A 1XDUA 2HWKA 5DT2A 1DUSA 1ZGAA 2YQZA 3JWHA 2AN3A 4OQDA 4G56A 3EPPA 3GNLA 5HIKA 2CWWA 4C06A 2JJQA 2ZW9A 1JG2A 2ZBQA 5E8JA 3G2PA 5GINE 1Q0SA 2ZBRA 3KKZA 4R8RA 4OBWA 1M6EX 3SXJA 4GBED 2I7CA 3LECA 2ZTHA 2PXXA 4O29A 1AQJA 3EVEA 3NW9A 3THRA 4KIGA 2I6GA 2IGTA 3M6UA 4FSXA 2NXNA 1SQGA 3L8DA 2B3TA 1O54A 3OE5A 5DX8A 5T67A 3GWZA 1BOOA 2GPYA 2VDWA 2AOXA 2HV9A 2P41A 3HNRA 5T6BA 3TRKA 3SR4A 5KQRA 3UBTA 1R74A 1QAOA 3QOWA 1KYWA 1WXWA 4KDRA 2G70A 3KR0A 4PYJA 5EMJA 5FWDA 2JH9A 3TKYA 5BP7A 4L7VA 3EVDA 2H11A 3BWCA 5K0GA 2QM3A 4ER0A 2I9KA 1VLMA 1R6AA 4R6WA 1BKYA 3DLCA 3UJBA 3DP7A 1P1CA 3S68A 4V0RA 2YXLA 3TLJA 4LWPA 5EC8A 5ICGA 3P8ZA 1NT2A 4EVIA 3FPHA 4GOMD 4IV0A 5B1SA 4AZSA 2O0LA 9MHTA 3FPFA 1TW3A 1VQ1A 4ER7A 5LQKA 5CUQA 2UYOA 5FADA 1JG1A 3ER9A 4WVLA 5JUWA 3MB5A 2O06A 2IBSA 5KYGA 2Z6AA 5K0NA 3FTDA 1ZGJA 4C05A 1H1DA 3O31A 2PY6A 3JWJA 4P58A 3X0DA 2PVCA 3E7PA 4X41A 3B7PA 4DM3A 4ER5A 5CVUA 1JSXA 5E9WA 5K05A 5DX1A 2VP3A 1O9GA 4FR0A 2WA1A 4LECA 5HIJA 5M5BA 4AZTA 1XCJA 1ZG3A 3A25A 3C6MA 5DLYA 1JTEA 5D1HA 2PSSA 3NMUF 3CGGA 5E1MA 1XDSA 3LCCA 4RVFA 1AQIA 5DWQA 5E2AA 3BKWA 5G02A 3VC2A 3GIWA 2YXDA 3DOUA 4PINA 2ZIFA 4XCXA 1UFKA 3OZRA 5DXAA 2UZ4A 2GLUA 5DPMA 4PGHA 4X60A 3KQSA 3OZTA 3RODA 3LDUA 3UJAA 2ZULA 1IM8A 4GUAA 2ZFUA 1QZZA 3SSMA 2BR5A 2ZLBA 3AWIA 3D2LA 3B3FA 3BGVA 2JHAA 3ELUA 3RIEA 3UJDA 5JR3A 1N2XA 3MAGA 5EOVA 4CWAA 5GM2A 4E2ZA 3ELDA 3PFHA 3NDIA 4EKIA 5HZMA 5LQJA 4M36A 1NW7A 3PX2A 1RJDA 4E32A 1NV9A 3KQMA 3LCUA 3P9KA 4FS8A 3FPGA 4E2XA 1WS6A 3EGEA 3A27A 4Y2HA 3MTIA 5D1NA 4KW7A 4QTTB 4RVHA 5DX0A 1VP9A 3O7WA 1P91A 4KRGA 5EEHA 3F4KA 2NNWB 4YV0A 3IV6A 2ZIEA 3HCCA 2IH2A 4C07A 2HMYB 2PBFA 2QRVB 2GAFA 4F85A 4C4AA 4YUZA 5K03A 5KVAA 2DPMA 4CXMA 5EQJB 2IDKA 3AXTA 5E1OA 1DL5A 1BHJA 5EIFA 4PCLA 1SG9A 1MJFA 1YZHA 2YXEA 4R05A 3OCJA 1JQEA 4GOOD 2AVNA 1YF3A 2Z6QA 3MCZA 3HCBA 5E9QA 1SVUA 5K01A 3MGGA 1Q0TA 2VZ9A 3OU2A 2Z6UA 4FGZA 1AF7A 3KPYA 5K0CA 3REOA 3TM4A 3MHTA 5HOQA 5E8RA 4ZTBA 2CMGA 3HA5A 3TR6A 1IXKA 4KWCA 2ZCJA 3HVIA 3P2IA 4DF3A 2R6ZA 4AX8A 5K8VA 2HTEA 3KQOA 3CC8A 2AOTA 1D2HA 5C0OE 3G8AA 4PYOA 4WXHA 1XVAA 1KP9A 5GWXA 4P7GA 3KQWA 3LSTA 3O4FA 1EG2A 5DRYA 2P8JA 2OB2A 4Y30A 3DXYA 5EHIA 3NVKI 3E05A 1FBNA 4IV8A 4BLWA 3BWYA 2B9EA 2IIPA 5FHQA 4U7TB 1G55A 4HG2A 1F38A 2AN4A 5BW4A 2PWYA 3T7TA 3A7DA 2XYQA 1KPGA 2WK1A 2PX2A 4BY9E 7MHTA 1I4WA 2QY6A 1KPHA 2LD4A 3JWIA 1KPIA 4RTJA 2G1PA 2EFJA 1R8XA 2Q41A 3UJ8A 4F84A 1V39A 2KW5A 2AN5A 3HP7A 4POOA 3DUWA 1SQFA 3IEIA 4PYMA 2UYQA 4P7FA 4YUYA 5GIPE 5E2BA 10MHA 3BGIA 4C03A 3C6KA 1IY9A 1NKVA 3OZSA 3FPEA 3EVFA 4LG1A 3DTNA 4MTLA 3BT7A 1R8YA 3NJRA 3R6TA 1N7IA 4Z2YA 1FJXA 3TM5A 3OU7A 5P8WA 2FK8A 3BXOA 3BWMA 5HIMA 4C08A 2C7PA 3VC1A 3FTFA 2IPXA 2OBFA 3I64A 3KU1A 3NWEA 5F2NA 2OPBA 1NBHA 1RI1A 3PFGA 4C04A 2B78A 5EZQA 2P3OA 1TPYA 2OXTA 2NP7A 5EMLA 3A7EA 2PKWA 4FT4A 3FUWA 4DA4A 2QRVA 3A4TA 4QQNA 2BR4A 3H2BA 3G2QA 3QOXA 1N7JA 5FCDA 2NXEA 5CM2Z 5LQNA 4PIPA 4X61A 3CKKA 3EMDA 3B3GA 3KQYA 3LKDA 2ZVJA 3G8BA 4PGGA 3G2OA 5CVDA 1QAQA 3V8VA 4GC5A 3NDJA 4KDCA 4IKPA 3LL7A 2P3LA 4K6MA 4HH4A 5GOZA 3RW9A 1ZKDA 4A6DA 1KXZA 1WY7A 3T7RA 3DR5A 3G5TA 4FSDA 4HTFA 3KR2A 3DMFA 5EGSA 4E31A 4HSGA 4ATNA 1OR8A 2BM9A 3P9CA 3TQSA 3LKZA 2VS1A 3GU3A 3KQPA 1X1CA 1RI3A 5ICEA 1JG3A 2FCAA 4RWZA 3BKXA 2EX4A 4EMSA 4RTNA 2UYHA 2EJTA 2JG3A 2OKCA 3LHDA 2HR1A 3DMHA 5FA5A 2AOUB 4GOLD 3LPMA 2NYUA 5ICFA 2XYRA 5BW5A 1NW8A 1KYZA 4QPPA 2BH2A 1M0EA 3EMBA 3K0BA 5EMMA 1P1BA 1X19A 2P7IA 3VYWA 3LGAA 3OE4A 4HRAA 3SGLA 2ONZA 4DMGA 3THSA 1SUIA 3GGDA
chains in the Genus database with same CATH superfamily
1J49A 2A9PA 1MJNA 2JFHA 4XQGA 3ZCQA 5E6RB 4IHJA 3WBKA 1IZZA 2CXPA 3FMOB 3V1UA 4JUAA 1JEJA 3JZAA 4L95C 3ZJ5A 1D0IA 2XH8A 1C3LA 3FLAA 1J9EA 2BEVB 4J3JA 3CV3A 1D07A 2RKWA 5FX2A 1ZOPA 1GN9A 4V02A 3L4EA 5I7FA 1IN1A 3RFUA 3V7YA 2LV8A 2AT1A 1ZCZA 1NDQA 3C4VA 3DMDA 3FNQA 3SQXA 3KSAC 1RBZA 4TSRA 3TUJC 2YYZA 3OJEA 1Q1QA 2HFKA 3TNJA 4HDOB 1GCAA 4RD2A 2RD2A 4TZ0A 3KVYA 1ZN8A 1FA9A 1ZSYA 2AR9A 1IVNA 3LA8A 2A0KA 4MVYA 5ALRA 4TZ6A 1NOJA 3PNPA 4HLQB 2APJA 2X41A 4M38A 3RNLA 1EFRA 1CUBA 4BJ3A 4NONA 3L4KA 1K7XB 1YQDA 5EUCA 2QSYA 4AMUA 1ULTA 2N3ZA 4CETA 4DLSA 3LXRA 1JQDA 2FUG1 4LFCB 4G4GA 3DHWC 2O5EA 3ABOB 2KBFA 2A0FA 2X42A 3BXFA 5DHQA 3FUUA 3AFGA 2PUEA 3WYFA 2GH1A 4X45A 4LVUA 5SY4A 1JWLA 4JP2A 3QU4A 4DM7A 1X0VA 5F1KA 2OQIA 1C7IA 4LHYA 5IXYA 4GXRA 4NAUA 1QZ3A 4FEGA 4WZAA 5K6AA 1N9GB 1YC5A 4IO0A 2WA2A 1NVFA 4LBYA 3VNQA 3NIWA 1JDPA 4O6VA 2RG7A 1FL9A 1OLOA 2G76A 5K0EA 3GRAA 3KD3A 2GCIA 2P2LA 3QVTA 4IOMA 1FPQA 3HACA 4N5IX 4UJ5A 2WQZA 1VCHA 4HH3C 1N25A 3AVQA 1C9KA 1K5DA 4ND1A 5AI4A 5JDCA 2EKQA 5BWLA 3OOWA 4RA9A 3ZY6A 3GK3A 4ZYZA 1P0MA 3C87A 4UTZA 4EYGA 3WYBA 1AMOA 4MQEA 4EVQA 3OOYA 3RUIA 2KX7A 3B53X 4BFYA 1WBDA 5DGIA 2ZUEA 1D2NA 2VYND 5LJLA 3MELA 4IJKA 4BIIA 1URPA 3DCYA 1YACA 3F6BX 1CEYA 4GR4A 1BS9A 5KNDA 2QQFA 2DBRA 5ANRB 4ZMSA 3H1BA 1U8TA 1N5LA 3A1EA 4UHKA 2V1UA 2XUGA 1AH2A 3ORQA 2IYSA 5GV7A 3H19A 3I9FA 4M6WA 2CXNA 2VXCA 3TO5A 1C30B 2W2TA 1E5DA 4X8MA 3OO1A 4BN0A 1EIWA 1WMSA 3ZGXA 2NIPA 2XTZA 3UMYA 2PZLA 2QUJA 3ISVA 3Q41A 4BQRA 3ZCTA 3HCEA 3WYDA 1EUCB 3JRNA 5TMDA 3R7BA 1WZCA 3KR9A 1TMYA 1OKKD 3UMVA 2BZ1A 5H16A 1PT8A 3ZUGA 5FQOA 4EI7A 4KFSA 3Q8LA 4G0OA 1H2WA 2HI0A 2A58A 1QQTA 2P5UA 1PZEA 4MUJA 4R7ZA 3UK7A 3H2GA 3PNOA 5GP1A 1JDUA 2A9FA 4HDRB 3TKAA 2LKCA 1VC2A 1X9GA 2VCYA 3AI2A 3GDHA 1ADYA 4RE6A 3RLFA 3RARA 1AE1A 1RRPA 3TECE 3QXCA 3UPUA 1QVVA 3OLZA 4TSFA 2HBYA 3WIBA 4KDEA 3BGSA 1A4UA 1B0UA 4NJEB 3CCBA 3E1SA 2VNSA 4GR5A 4WY2A 4B2IA 4GMGA 4BE7B 5DE3A 3VPSA 4BWYA 3LCVB 1ST3A 2B61A 2JHCA 1FDWA 1Q0UA 3I58A 3PICA 1NIPA 1J09A 1XE3A 2WR8A 3NRBA 4ZODA 3M5DA 3JV7A 1EM8B 1F3LA 1LSSA 1KFEB 2VDUE 1M2EA 3BE8A 1NQ5A 4L9WA 1SN7A 2MSEB 1BH2A 4AJLA 3N1UA 4BC1A 4UDYX 3I8XA 3X1ZA 1G41A 3AR4A 1R2QA 1G3QA 3H1AA 2POCA 3EGDB 3G17A 4ACAA 3LUKA 1M7BA 2WHQA 2X19A 3N6XA 1QK5A 4ITRC 2GCNA 4RZQA 4KFCA 1JDBB 4EEZA 3VSDA 2Q8QA 4B6OA 1NSFA 4CG0A 4R3NA 1D6NA 4BYGA 2HU8A 5DTJA 5E4TA 2ST1A 1SHLA 1B4DA 3B13B 4TTJA 3PPVA 5B7QA 5BN4B 4PZEA 3LFTA 4X00A 2W6PA 3ROKA 1P73A 1RXUA 2XQGA 4P5PA 4UUBA 5CYGA 3D8SA 3ONFA 1CQWA 2P6MA 4RWEA 2XDAA 5F51A 2CHQA 4MV4A 4HQFA 4PWYA 5GY7A 4U4AA 1NE7A 3BFPA 1ORIA 2BM0A 4ZPJA 2JJ8A 2V6GA 1MF7A 1QYRA 3C8MA 1DIHA 3I1JA 4KV7A 5LZ7A 2ONJA 1F14A 1I9GA 1W5SA 2GZSA 1GDDA 1X87A 4RV4A 2CLOB 6REQB 1NGSA 3K09C 3U6BA 3KZCA 1CIVA 4AMVA 1L8OA 4DBVO 4MWEA 1X7ZB 4O0LA 1ZZGA 2XKBA 2TYSB 1E94E 5DCWA 2OGZA 3SSNA 4Z7OB 2AE2A 4RUKA 3ZU5A 1DEHA 1DAMA 1KJWA 1S2NA 2CL7X 2JF0A 3OM9A 1RQXA 5G1OA 5I9BA 3IVMA 1QO0A 5TC4A 2IRWA 1JAYA 2DG2A 4B0PA 1JL3A 2OV8A 2HHCA 3PNLA 4XVQA 2ZUTA 2AV6A 2HMUA 1W5TA 4OOFA 3H5WA 3KT8A 1E9RA 3NBUA 5DNEA 1EAMA 2BFWA 4A0SA 2GESA 4E15A 3RYFB 1FP2A 2W71A 2QPOA 4K6KA 2RI0A 2IFTA 3IUBA 4DLUA 4M86A 2BBTA 1RVDA 3V1YA 2CLKB 4WGFA 2QL6A 2YWHA 1COWA 3FZQA 3WK5A 4ALNA 4UEJA 1DMSA 4R01A 4PGFA 1JT9A 1CFJA 2NPOA 4H4DA 2XUZA 4U7WA 1E59A 4BFWA 5EWLB 3QVXA 4I50F 3HMKA 4O59O 4LNUA 1F6BA 4RTKA 2JI4A 4MQBA 1IVYA 1LLDA 1US8A 3QUSA 2HWUA 2R79A 4LOIA 4UCWA 3E8SA 1P31A 2JIPA 3GRRA 4UPEA 1JHVA 2ZK7A 5YASA 5K6AC 1GZSA 2G6TA 2XMQA 1QIMA 1XF1A 3V7NA 1E3DA 5DM0A 4B8YA 1VE5A 2O8CA 1KDPA 1SUCA 3DBRB 4IDNA 4CTOA 3L49A 3VDNB 1TM7E 1JG7A 1W0CA 4IFIA 4DCJA 4C76A 2QDKA 2FMKA 2X8WA 4IY1A 3I3SR 2I9PA 4RPCA 2D0OB 3B2NA 4K1LA 2QRHA 1G1MA 1F9EA 4IKEA 4RM2A 3UANA 3STYA 1WXGA 2Y93A 4ZT2A 4JLVA 4DLTA 4ETIA 3ML1A 4V2IA 4FB5A 1ZUD1 4C29A 4WIAA 4ND8A 1GSAA 3T5TA 1ZFNA 4Q9KA 4W5OA 3KJFA 2EHJA 3QVLA 4PF1A 4DLVA 1HTWA 2N1MA 4QBGB 2X6RA 2X2PA 4D4HA 3SQMA 5J2UF 3U4GA 2QRUA 4NOJA 1A9XA 5EIXA 3P94A 3E5MA 3S2SA 4Q48A 4ZT7A 2ZBQA 3IBTA 2UZAA 1LVHA 4UTNA 1DO8A 1U1IA 1VGRA 1TUIA 4RO0A 1NUSA 3F9CA 1XTBA 3NW9A 3O21A 4M8LA 4N49A 3NDRA 4KIGA 3WAJA 3GV0A 1SQGA 3L8DA 3OPQA 4JWTA 1WMBA 1XZKA 3DYIA 8ABPA 3HI4A 1ZK3A 4GI5A 2V7XA 1R74A 1LF5A 1FOEB 2HWXA 1Y5RA 1WVMA 3MMZA 2LCQA 2XMSA 4BNFA 3W2IA 4B44A 1TUBB 1OWOA 3DWGA 4C0XA 4JBNA 3PGLA 3PQ3A 3KETA 3DEZA 3H86A 4QO7A 3RHTA 2EGUA 2HRDA 1CUYA 2PMBA 2ZR0A 2HOQA 1QTQA 2OAP1 5L53A 3QVMA 2NTNA 3GIDA 4LRUA 5K5EA 4DG5A 2BTQA 2OL4A 5BPHA 4WKOA 2C7VA 3VMFA 3H6HA 1D9XA 1M3SA 3F1KA 3R0ZA 3SZUA 4PZ9A 3AR9A 4JYMA 1BSVA 4B3DA 1NUPA 5IBPA 1Y7LA 2GBLA 3IIEA 2CBXA 4KN6A 3ST7A 3UAXA 3X2EA 2WTMA 1J2TA 4M0KA 4LECA 4PN7A 1NNLA 1RBYA 2ZJBA 4B3XA 2H2AA 1JTEA 3MTAA 3SSAA 1P7ZA 4IVQA 4KAXA 4P4LA 2MT9A 2HJWA 1G20E 1I1OA 3KXPA 4GPD1 1BQ3A 1J70A 1DARA 1PO7A 3IEUA 3QOYA 2BMAA 4WACA 3SHVA 5JNVA 5BV2P 1JEQA 5E7JA 4AO6A 3GLFE 3PQ8A 1KOGA 1U7UA 4YLYA 2WTXA 3DL2A 3B51X 1AXEA 2W2QA 2C8LA 1BHSA 1V4BA 1IM8A 4EYKA 2FEKA 2PG3A 2XNHA 3MRXA 1CERA 1QZZA 3KJNA 2HIHA 4DREA 3QMMA 2G5TA 2WZDA 5K20A 1M34B 2PX6A 5EOVA 2QVGA 1KNQA 4ABTA 3GPBA 4BTEA 1P4SA 3M4JA 4DZZA 1Q7BA 5BNTA 5IM4F 3S3TA 3GBSA 2B8TA 2Q3JA 3KV1A 4KXWA 1PWXA 4Y2HA 1PR0A 5D3ZA 3R76A 3Q8MA 4I3GA 3U62A 3E8MA 5EJ8A 3FH0A 2YFQA 4R2LA 3PDUA 4TV8A 3STWA 4IIHA 1IPEA 1YCGA 3GLKA 4G37A 5EERA 2I2AA 3CEPB 4IUDS 1T6ZA 4BYMA 3K1AA 4TS3A 2P0YA 3FCEA 3RKUA 4KXVA 1RYFA 4CLHA 3C48A 1K75A 2VCHA 5JISA 1Z26A 3FN4A 2H06A 2HPVA 2X9GA 4XDGA 4NE2A 1PL0A 5ED4A 1NYRA 1AV7A 1PJTA 4KN5A 3FWHA 1NJ1A 2YY7A 1Q0RA 4IIJA 3WGZA 5KVVA 1M2HA 2JBAA 1HX7A 3DPSA 4FIZA 4B32A 4EUKA 4EWLA 1J90A 3SF8B 3ZVLA 3UMMA 3L5KA 4B6JA 8OHMA 1LV8A 1RD4A 1LWOA 3IR7A 3OLXA 1ZM3A 1UXGA 2WIJA 4B3JA 2XD4A 2NT4A 3MF4A 2FEPA 3HO8A 1PT6A 4J0FA 5FTJA 3UMJA 1JAZA 4OK6A 2ZM6B 4HDNB 2QT9A 1UANA 3GFRA 4D02A 1PKXA 1YUNA 1E4VA 2MYNA 1APBA 3QHPA 5ILQA 1KYIA 1CVRA 1LI4A 1JDBC 4ZOLF 3SI7A 2CNNA 3SHFA 3TEMA 1QGOA 3QMPA 1SXJA 4M9RA 4REOA 3MJ4A 3O82A 4DWWA 1RQGA 5HCUA 4O4LB 5BW4A 1NBOA 1C2TA 1PEKE 1S3SA 1QFSA 2FMIA 2YHSA 2YV4A 2UVQA 3EE6A 3LY5A 4Q9AA 4WCDA 4OSOA 4RY2A 4F96A 4YRGA 5FWNA 1E1MA 1Y9EA 5CPBA 2I6UA 1P77A 3RAFC 4BKQA 1E3MA 5D7NA 3QYAA 5EE9A 1ODKA 1XKLA 1C1DB 3W5JA 3KZKA 5E2BA 1HZZC 3VJRA 5L9AA 3E3NA 4LISA 5DJ5A 4BMZA 3H2YA 1IY9A 4R7TA 2ZS8A 4ER5A 4G09A 1ZNXA 2HJRA 3CISA 3A6FA 1YE5A 4J0HA 4KUEA 4AY5A 4X6LA 4EA7A 5B30A 1AMUA 1Y98A 2CCJA 2FWAA 2Z95A 4RFVA 3RU3A 3TXYA 1UBUS 3V1KA 2QNRA 1VL1A 1ENOA 3JSAA 3IT1A 3WFZA 4TRNA 2OBFA 1L5SA 2AN1A 3FMGA 3FSJX 3H17A 2HT6A 2F43B 4XCVA 3WBBA 4C1NA 1HK7A 4ECAA 3UJNA 4P33A 4FFBB 5DHRA 4J7AA 4RD4A 5ECGC 3WWZA 1DKOA 4DRXA 3FRJA 2IHYA 1JN0A 1RKQA 2B3DA 3OA2A 2XKJE 4KMMA 2WJVA 3A7EA 4XIIA 1J0XO 3AFNA 4P80A 2VDWB 1NUUA 2FNAA 5BN5A 4INJA 4R9RA 4HNAA 1YHYA 3K4HA 2JI8A 2PGAA 4AF6A 2GN0A 4ROTA 5C37A 2REQA 3T3NA 3TSAA 4EG3A 2PAFA 4HXGA 4ZDJA 3PE3A 3NS7A 1ZAYA 4XFJA 1PS9A 1SCIA 3KQLA 2A0YA 5FOTA 1UZLA 1XZNA 3WRXA 2R2AA 1DI0A 2BLLA 2NVUA 3T1HB 3RU7A 5BN3B 4IV5A 1UDAA 3UJHA 1X8LA 3EQ2A 2RAFA 5LZ4A 2HDOA 2WOOA 1SQ5A 3AY6A 2VWHA 2W7TA 3Q6NA 4KQ6A 1AA6A 1UWLA 2YY5A 4J0DA 4O4JF 2O48X 5ALOA 2VDKB 4OHXA 2VTBA 3BULA 4B0OA 4FFOA 3ZY4A 4RMJA 1L5QA 2FCRA 4HDKA 3O4VA 3U19A 1DBSA 1M75A 5B3KA 4GYYA 3D7SA 5CX1A 9ABPA 1P8JA 4GKAA 3PQCA 3FSEA 4DCOA 2WZCA 2NN3C 4QXAA 5BW6B 2IYAA 4BO6A 4Z54A 2UYHA 4NEHB 3EAGA 4KPEC 2AOUB 3ZDRA 3D3EA 1NUAA 3T61A 1ZJWA 4CGZA 3HRIA 5LA6B 2ORWA 1Z73A 5REQB 4DLPA 1M1YE 1YQEA 1VHJA 2X0RA 1ZITA 4BLRA 5ICFA 1YONA 2I4IA 4OMDA 2BY4A 4DSOA 3H5TA 4IIBA 3FYHA 3KFLA 4TS1A 3X1MA 1UBEA 3CZ5A 4IP0A 2P7IA 5JPIA 4K26A 1QRRA 3JQPA 1B43A 1RYNA 1B73A 1XZHA 2PA0A 2R65A 2VT6A 3GA0A 3QF4B 4LEIA 2HF2A 3H7AA 4C4SA 1P2DA 4U3JA 5CLJA 1WW3A 3NHAA 2EZ9A 2GI4A 4KO2S 4YCAA 4I3HA 4D4GA 1FTQA 4RDHA 4WCFC 5AM5A 5B1HA 3SZMA 3IA2A 3RS4A 2IZOA 1XMSA 4C5BA 4CU2A 3EEOA 1PSZA 1HQKA 3AERB 3OZWA 4BQPA 4IX1A 2CE2X 1AS0A 2WT8A 1TOAA 1BWSA 2BMEA 3SFVA 5IAOA 3AY3A 4MVJI 4R2KA 2EFEB 2QE7A 4GM4A 4RL4A 3MSCA 3ZQ6A 5CDFE 4W5RA 3I53A 5BMVF 2H1LA 1XC7A 4RELA 3T9FA 3Q4GA 1B6TA 1U2ZA 2H1WA 1KZHA 5LUAA 2C4UA 5GZ6A 3QW2A 5EMHA 1FYEA 4EG8A 1GZ7A 1PHPA 1QV7A 3H97A 1L7QA 2C9YA 1F8FA 5HFJA 1ABBA 5DH9A 1T5OA 4FT2A 1R8SA 1E6LA 3N2GA 4ZU6X 2BF4A 4XVUA 5BWOA 4GRAA 4ZU3A 3GEDA 4RESA 2OHJA 2AUNA 1V4VA 4LXTA 4DIBA 1T9GS 3UQZA 1JXMA 1RCTE 2J7PA 2XQVA 3OZDA 4JSTA 4Q37A 2OBNA 4N82A 3TOSA 2ROQA 4J2OA 3UA4A 2Y0CA 1D6JA 1VHWA 4RPHA 1V8ZA 3W2HA 3WKBA 4EG1A 3O83A 2FXVA 3HVRA 3BB4A 1Z0JA 1K3UB 2HA0A 2DLNA 3EIWA 4RJ2A 1XLWA 1GQQA 1IEVA 3GZNA 5KTMA 2BFAA 3HXTA 3TI7A 3E84A 4JI7B 5CCBA 1YDGA 3TCNA 1A4XA 3IHKA 4ZOBA 3AETB 1GGVA 3KAPA 5CAEB 3VYUB 4A0HA 4EFLA 3X44A 1G60A 3A9WA 4FILA 4GBJA 5CMLA 4YUWA 5LSAA 3WK4A 2AF3C 3KQNA 3HCRA 4N3CA 4PAOA 3OBBA 1BWQA 5JSZB 1JNXX 5IM4A 2C77A 1COWD 3GMDA 3NAGA 3UT5B 3EASA 4FONA 1WSDA 5B7PA 1NZFA 4XX0B 5DXJA 3X1DA 3SYLA 4IM7A 1DBQA 4RF2A 4BX0A 4YQFA 3L5OA 1PR3A 2J48A 3IDOA 2AOVA 5T3UA 2R6CA 3RFVA 1QKKA 4CF3A 5INTA 3E9CA 3F4BA 2IEDA 1GUYA 3NIFB 2AKEA 4HB4A 5JFOA 1YRWA 2F1IA 3CH6A 3HG7A 5L8VA 5FORA 4TTSA 4EG0A 2BMVA 5FL7A 2FHSA 4X8LA 4WEOA 4WK6A 5K45A 1Y89A 3CNNA 4LZWA 4HX9A 4NAVA 1S2LA 3A4MA 3ANXA 2OZVA 1TK2A 3TX6A 4DJEC 4UDNA 1TF5A 3E5HA 3P5BA 4R51A 3ZGLA 4ZI7A 3OD1A 3LY8A 3ZPXA 1GPBA 3NPAA 2JLUA 3ZDCA 2B4YA 2X0IA 1XMIA 3AEXA 5BV7A 3K6SB 16PKA 1WMEA 1HDXA 1YL6A 1Z4PX 1BNCA 1P6UA 5K3CA 2C9MA 2QDXA 2HMAA 3LBFA 3M1AA 3AJ9A 4G85A 3ROZA 4RH1A 4MHOA 3MYYA 3B6JA 2X1VA 2CYCA 1BN7A 1L7PA 1PNOA 1G2IA 4O08A 3WNZA 5K0JA 2WSBA 1UBTS 3L02A 5DF1A 6PFKA 2OHHA 1U7WA 2H57A 3PI6A 5LC1A 1NI3A 3NLLA 3U4HA 5A62A 5CGQB 4Y2TA 3QITA 1OXSC 3BE4A 2WJ4A 1H05A 1PFKA 4HLUC 5AKJA 4A03A 5DIFA 4B31A 4F93B 4EDFA 1MEJA 1QGDA 3QTLA 2C5HA 4GQBA 1LH0A 3EWIA 2NTJA 3LYUA 2QTHA 5FUXA 5TB5A 3VJKA 1BKSB 1MG0A 3NYWA 1ZQ9A 2R4UA 3CZ9A 3LDFA 1IAQA 3N7AA 3PF8A 4LOHA 3M5WA 3C85A 4TLMB 4WZBA 2YWCA 3UHJA 4I1IA 3U7FB 4NZNA 4TLEA 4ARCA 1RPAA 4NK4A 5JFTA 4MH0R 4PCAA 2E37A 5T4HA 1N1MA 1E2JA 4AN1A 3M34A 3ESDA 4WT7A 4EHJA 1MH9A 3T9BA 1VLZA 2ZZKA 1YZFA 4BZQA 2C7QA 4J90A 4E2XA 5JRZA 1JTFA 4FZ3A 4WZBE 4G89A 3K70D 5EEGA 1ND6A 1Y7HA 1W4CA 1V11B 1B2LA 1KY3A 5G3YA 1ZVVA 4GI3A 1G9XA 3OWXA 2VHUA 3CPSA 5HGJA 3R3SA 1DRUA 4DQ0A 3LOUA 1J8FA 1PKEA 2I8CA 2NAFA 2R5FA 3K8YA 1IEWA 5ERGB 1JFRA 3MWDB 3KJZA 4WA8A 5SYAA 4PONA 4D2IA 3AR8A 2UYCA 1HNNA 3T06B 1Y33E 3IUEA 3A1CA 1DBWA 3OT5A 2OV2A 4RHCA 2PGNA 4YBRA 4YXFA 4Q4HA 4Q18A 1JXOA 3FRHA 2CMDA 3VU1A 4AZ3B 2GZ1A 4E5MA 5ARBA 2HPAA 4YMUA 1OVGA 5CH8A 3VU9B 4B2PA 1G5IA 3BE6A 5CDYA 1JBEA 4BNNA 4O2BB 1ONSA 2ZWIA 3WLQA 4J2TA 4ND2A 7GPBA 2COEA 2I0FA 2XJ9A 2FPOA 3P71T 1WMAA 4NBRA 1D2CA 4UBNA 2IKSA 3UUEA 1Q5PA 4XUCA 1J0CA 1UBGA 1VB3A 2DULA 5BNFA 4ZQFA 1CZUA 2Q45A 5KS2A 1GD1O 2LDBA 4EKGA 1OBVA 1BMTA 4WUTA 1XPOA 5AHWA 4ALJA 2CXQA 2JFYA 2QTLA 3KEFA 3UYKA 4HL6A 5IPFA 1I36A 2OFWA 3RK1A 4H7FA 4IJMA 2WFMA 1G16A 1GCUA 1WSAA 4UDXX 4A1OA 1FDIA 4OF4A 1J21A 3BXPA 4DM4A 1EMDA 3DONA 3SBOA 4A2WA 2OK8A 3OLQA 2I2XB 4OYRA 1X9HA 4DCNA 2QGZA 3KJHA 2G67A 1IDN1 1N5OX 1U98A 2JZOA 4FFVA 2VF5X 3U7QA 3VKUA 2C96A 2O3RA 2JCXA 4P3XA 5L95A 3KSRA 4K7JA 3F2IA 3L07A 1HDOA 2JAPA 5DBHX 5KTYA 1V5IA 3NO4A 3UFXB 1GRNA 4M8KA 3WL3A 2H2DA 3K6RA 2QYOA 1I7LA 3WK8A 1ZCBA 3N5CA 1W25A 3KQKA 1IMOA 1CK4A 3DH0A 3KNZA 5GPBA 5K9ZA 3GAZA 2P3SA 1U7XA 3BN3A 5GJWC 4K9KA 5ALTA 2Q9UA 4XWAA 1T4BA 2BISA 3CE9A 2OGTA 3NOVA 3QV2A 1SUPA 2V03A 3RG2A 3WHPA 2BGKA 4HC4A 4GZMA 4MVJH 2IYVA 2JD0A 2AQKA 1CY0A 2IUUA 5IRCD 3EUWA 1SKYB 3KLMX 5IVPA 2BC9A 3Q3CA 4UCFA 1D8TA 3GEEA 1KYTA 3HA3A 3KWMA 1ZC4A 1G8JA 2V7UA 5AI5A 3SEFA 1ZGAA 4BAGA 3W1EA 1PD0A 1Y5NA 2VYFA 3INYA 1DDOA 4KLZA 1D4OA 5D5PA 5H9VA 2XUJA 5C18A 3SYNA 1KF0A 4LRWA 2BGTA 3KKZA 5TARA 1BAPA 1R3UA 4ZQGA 2D2IA 2JAUA 2W6JA 4A4DA 5EAIA 4DMRA 4F4JA 4YT2A 2R47A 2BMJA 3SXJA 2QX6A 1IY0A 2B4TO 4MWGA 4L57A 2HBRA 1AUVA 1N92A 1I2MA 2NXNA 4MKRA 1O54A 3WBFA 4YT4A 1U0FA 1FP7A 4EIWA 1GADO 3UBTA 3NONA 2R97A 3RYHB 1WXWA 3HR7A 4N7BA 4RDCA 4W99A 5EJ5A 5FUQA 2A5LA 4C0BA 3VTAA 4RSGA 4WK4B 1LV7A 3E15A 3OC6A 1JQLB 4S0XA 2WM8A 1JI3A 3OQHA 4Y7DA 5TQ0B 1QTRA 1E3SA 1AO3A 1DDGA 2BGNA 4XJXA 4CL0A 1I2AA 1I2ZA 4IV0A 4C0JA 1EDEA 2OYSA 3C7AA 1ESDA 2YOFA 5FADA 5B12A 3TD2A 2B4QA 5C31A 4WNIA 4LQDA 2N46A 2C92A 1JLKA 3ZGYA 4BATA 4CV3A 1N0UA 4UATA 3JQAA 1QRTA 5I7OA 1HFEL 3COZA 4L2IA 3HWX1 4G84A 4TTAA 4D6XA 2XAAA 1MB3A 1QH1A 1U5BB 1RHUA 1LB1B 1PJ8A 1JDVA 1UP7A 2B1RA 2VHJA 3ONVA 4TXHA 3U4MA 3AETA 3VR6H 1Q1ZA 2FWNA 2XMZA 2DVMA 4S04A 1OXBB 5ALKA 1O08A 5KB3A 3W8DA 5JSKA 1G66A 3KWFA 4K9QA 5BVHA 2I91A 1QS0A 1U28C 2UZ4A 2JATA 2GPNA 2GLUA 2HX1A 4IS3A 4BLSA 6ADHA 4AKSA 4RZUA 3FOWA 5EFOA 3OC0A 4Z4IA 4FC6A 2DYKA 3PUIA 1EDBA 1U8YA 4FJ1A 2HN9A 3BGVA 3AL3A 1YRQA 3K16A 3OM1A 1HQCA 2BI8A 3TE6A 2DC1A 4FMCF 5HZMA 5M34A 1LBEA 5HBRA 2XDWA 3PX2A 5FTNA 2KB0A 2XKAA 5J5CA 2ODQA 4YVFA 2WJ3A 2I2DA 2QVXX 1IOWA 4P86A 4IJVA 2I87A 4QTTB 1W4LA 1P2SA 1P91A 2C0CA 4KRGA 3LUGA 1F8XA 1N2ZA 2YWJA 4X20B 4C07A 1T0PA 4BVEA 2PBFA 1Y8ZA 4ICIA 5AVTA 3B48A 5ADUS 1V7CA 4FNOA 1X1EA 4D8TA 3TRHA 1GL7A 1VE9A 1FXUA 3K30A 3GLUA 2VNJA 3C6BA 3SFZA 1Z0KA 1GA1A 2AVNA 2Z9CA 1W4RA 4HBGA 5ALYA 3I3OA 3UENA 1XFDA 5E9QA 1E58A 2VZ9A 3LVFO 4FI3C 1E2FA 4JIGA 4FD2A 3F7MA 5DHAA 4ZV4A 4S12A 3MB8A 4YUAA 2CMGA 1MVLA 2LR0A 3B6KA 4KWCA 1SKQA 1WD5A 1T8RA 2VAVA 1ECGA 1KE1A 2EJCA 3EQ9A 1K4MA 2HTEA 4YMLA 4ARBA 1CUIA 4Q7LA 1SCKA 2XZDA 2I3DA 2AK3A 1UBSB 2V6MA 4K81B 4QHTA 5DNWA 2XQJA 1YJXA 3VU9A 2BBWA 4YEDA 1Q84A 1MTZA 3KKNA 3G0BA 4UAVA 3LP5A 4EB6A 1Z5GA 3EIEA 1C7ZA 2PU5A 3RRMA 2E6KA 3VAYA 4ZGGA 1PG0A 1SQ6A 5BR1A 5ITWA 4KWIA 2WYIA 4LC0A 4X7RA 5B2ZA 1XZDA 3T94A 3QPWA 1GQRA 1RTTA 2Z5FA 4ZTUB 1F48A 4B40A 4XGQA 1UKYA 4I19A 4IXMA 3MJDA 4F72A 1PG5A 1OU0A 3M2TA 1JFVA 2YNMD 3R0JA 2WB2A 3J80A 4Q82A 1HT1E 3LQYA 1DQSA 2WW8A 3B5JA 3FBTA 2ZXEA 2DQZA 3E2MA 3NYQA 3QIVA 5CXSA 1O2DA 5HQTA 2HQSA 3DDUA 4BZXA 4D1YA 2ID4A 3I32A 2FJ0A 5ESXA 1ZNZA 1J56A 3BGIA 3IV9A 5GGYA 3ZX4A 4CKXA 5ITVA 5DM70 3DBOB 3CWCA 1FFHA 2OHIA 2AEFA 3KOUA 3PHHA 4NWIA 4H3SA 1NOKA 3F5QA 4KJXA 4Z2YA 2Q6LA 3K4QA 4FLMA 3SF8A 3TM5A 5C5IA 4KG7A 2J0VA 2MMGA 2VAXA 1DRVA 2Q0SA 2X76A 1P0IA 4C08A 3CR3C 1ECLA 2H6EA 4C78A 1PS0A 1JQJC 5CG2A 1PBTA 3UUGA 3D64A 3AR3A 4G6ZA 4NLLA 1U9IA 5MN6A 5AVJA 4R84A 1M1ZA 4QUEA 3VOAA 1II0A 3MTDA 1T0IA 2WKSA 3R6GA 4I8DA 4LZAA 4YWJA 4YT8A 4J8PA 3C24A 5CITA 2R84A 1O95C 1YDFA 4A36A 5AESA 2NPIA 1Q7TA 4TWBA 5AJZA 3GLSA 2IEGA 2BR4A 3QOXA 4QQNA 5HKKA 2I7XA 1I4EB 1U2DA 1X3SA 2VK8A 3T6KA 4M99A 3CS3A 1LTQA 3T52A 3Q5EA 3SE7A 3OQOA 2ZTSA 1TM5E 4N7MA 3VR4D 1EYZA 3BBLA 4R41A 1E4OA 2CL6X 2B0CA 1F0YA 2XXJA 1VMKA 3IE0A 3NDJA 5DTEA 1Y3BE 3QX3A 2J8ZA 2OAGA 1KFCB 3OJFA 1P2TA 2C97A 4WVFA 2IS4A 4KQKA 4RIFA 1Z2AA 3ZU3A 4OH1A 5M7EA 2FPLA 4YMIA 1KNXA 3GNQA 1NR7A 1Z22A 3A06A 5JD6A 1HL3A 1DKUA 2GHRA 2RHMA 4IX9A 2HLHA 2RHLA 3ENKA 4CZ2A 1WCIB 2MMCA 3LAWA 1KSHA 4FUQA 2OG1A 5G3ZA 4B6EA 5TMEA 1JQKA 4D3YA 4EHFA 4J75A 3JWPA 2FCAA 3GFGA 4PZDA 3BKXA 4QEKA 3O4RA 1DQRA 2QX4A 4OXIA 4C0LA 2J3JA 5K8TA 2DLDA 4GOLD 1GPNA 1POXA 5UKDA 1J0BA 1TZBA 2CHEA 2OSBA 3RROA 1KEWA 5JJIA 3CEJA 1OA0A 1BU5A 1WQ4A 3WAKA 5JQGA 3G79A 2PGJA 5ALZA 4C2BA 3DL4A 1PSDA 4YJ3B 3ZOKA 1H3EA 2JRCA 3PYXA 4MHSA 1Z45A 4BE4A 4CPDA 1ORTA 1RPJA 3ESCA 5IJAA 4EW3A 3DE3X 1M0EA 2IS1A 4EHBA 2ONZA 1RZ3A 3LWBA 3OI7A 4S1OA 1RM3A 5JAUA 5JV5A 1EUCA 4Z9YA 4RZSA 4C6HA 3KBOA 2AG1A 3QGMA 2Q4EA 4I46A 2XVZA 1FJGB 4NABA 5HF6A 1AZLA 2H7XA 1G42A 1O96B 3BZBA 4YQEA 1B8UA 2AXPA 1P61B 1TKBA 1J5EB 3BMOA 3AF0A 3O1IC 4B3MB 4URHA 4P4GA 3M6VA 1V4NA 3FJ1A 3JQBA 3VZSA 3LPDA 4NZOA 3FG9A 5AP9A 3S2EA 4YDQA 5C8YB 1GN8A 2J9RA 3PD7A 3HA2A 1L7EA 2DFDA 1PR5A 2ZAOA 1NE2A 3JASA 4N40A 1T2AA 4F2DA 3NHMA 1AO0A 3D9QX 8MHTA 1QK3A 4CT5A 4ZDIA 1F4LA 4EJ6A 3HB5X 1LS1A 2IY8A 3I5UA 3W8FA 1FEZA 2ZOSA 1DC4A 4IVRA 5GADl 3L7DA 3BL6A 4RSRA 1GPLA 1TJPB 3GGPA 4G1UC 4GPEA 5CLHA 5F2OA 3GGOA 1JSCA 1CNEA 3IQFA 5AOBA 4PAWA 4YUVA 5JS7A 1JT2A 5LQCA 1J5PA 2C88A 1QFYA 4ALKA 1BRMA 4O1MA 3I83A 5F5NA 1EWQA 3L7AA 1I24A 3WADA 3W79A 5KQLA 4XE5A 4DVJA 1Y8AA 4C4XA 2I80A 1QH8A 4RYLA 2NTVA 3LDAA 2G0TA 3G59A 4IWYA 3D1JA 3HLYA 2P9EA 1NP3A 1U0RA 1LTKA 2C8VA 3ZHRA 4EOGA 1OWMA 4OU5A 4FZ5A 2EEPA 3KB1A 3ZW9A 1AZTA 1YR2A 4OUDB 1O58A 1PR6A 3Q0TA 4KQ9A 4RDXA 3TLAA 4AO7A 1XRRA 3D6TB 3A10A 1K8QA 1MC4A 2PZFA 3K53A 3L7IA 3AJDA 4FE7A 2X0FA 3ZDBA 3KP1A 3MK31 4G23A 2XD9A 4OD0A 5KJ1A 4S1TA 3AX6A 3M9XA 2ZS7A 3DB1A 3OT1B 4X1YA 3WLJA 4LDAA 5KSYA 1QCZA 3VNSA 4RZ3A 4NG5A 4C3UA 3GLIA 3LWZA 4ZVKA 1MPTA 3JAKB 1JJAA 4W5QA 3TRDA 5GJBA 5IFLA 2FEMA 2H4FA 3BJEA 3FFTA 3NUQA 4YFVA 4MV8A 4YP6A 3QBTA 4KN9S 3U1BA 4DMHA 2WYOA 2P77A 4ZCRA 4ESVA 3QMWA 4B45A 4BFXA 4UPDA 4JQSA 4CNQA 5KYXA 3AB3A 3PB3A 4OO3A 3GNSA 2IYWA 3LP6A 4H16A 2J5RA 4OY3A 4D41A 1Z47A 7YASA 1DV1A 4HX5A 5KNCA 1SWVA 2GB4A 4E21A 4LFAB 1A2QA 2POQX 2XB2A 1PVVA 3DEJA 1YC2A 1PZFA 1Z6ZA 1YRHA 1ZH2A 2X2FA 3WNDA 3WB9A 1YZYA 1FTNA 1OIVA 5TGZA 5K0BA 2QLLA 3UY4A 1ZHOA 4M9QA 2ZBPA 4UOZA 3HKEB 3CA8A 1KKUA 1JQBA 5J5VA 5IK2D 5IJ0A 3R8FA 1PL8A 3LC2O 3PITA 4HLNA 1V35A 4LKRA 3U48A 1ZH8A 3K1ZA 5AKZA 3LUJA 5K8IA 1ODTC 1C1HA 3PNMA 3FJYA 4MRAA 4W8GA 3GLHE 3C3MA 4CR6A 2WAAA 3IQGX 4WOBA 4UHDA 4XM2A 2O0MA 4HP8A 2F55A 4D3FA 1Z4IA 4MZXA 3GJ7A 4GO1A 5DO9A 5KQGA 1GFSA 2CVHA 3MIZA 2ZJ8A 3CCFA 4QPCA 4F3RA 4DZRA 2XGGA 1QGED 3RR2A 1FRQA 2J0SA 1VL5A 1PL6A 4IZIA 4W1RA 3V1MA 4HTFB 5AVVA 5EQDA 3RREA 4YFYA 3PNBA 3EBLA 4FJ0A 4HYEA 4FZVA 1XHLA 5CNMA 2YVLA 5LNK1 3OUTA 3G0CA 2QBYB 1YSCA 1LI5A 1QBKC 3NC4A 4QFCA 1TK9A 2I71A 2NAPA 3VNAA 2XMDA 1H9AA 4IVNA 1D1SA 4OHZA 2IYYA 1YXMA 2WHRA 3KLPX 3RVJA 1EUZA 4EFKA 4Y0NA 1T4CA 3T95A 3SOPA 5DCLA 2E18A 3OCUA 2H16A 3L7BA 2M6LA 3DNFA 1HA3A 3PWTA 2FOIA 3L4SO 1EFUA 4TL7A 5BSEA 2Y68A 2VHVA 2IU0A 1ZU5A 4HYQA 1Q0HA 3W1VA 5ECWA 3AF5A 1IHOA 2I8LA 4A92A 2ZSEA 4P82A 3RADC 1XMVA 2R3SA 3NBXX 4NCNA 5IKPA 2ZYRA 1UK8A 5CT4A 2FFRA 4PV7A 2HIAA 2ZJYA 2DUNA 2IYOA 4KIJA 4UBMA 4HAZA 1OFTA 1T6XA 3LZ6A 4ENUA 4DTCA 5AK0A 1SPXA 4CIBA 1NXQA 2CKDA 2ZJ3A 1ZN7A 5FNVA 1T8PA 2V7QA 2FZ4A 3OEED 3THWA 2O7SA 3COPA 1JB9A 3EVGA 3HA7A 4FHCA 3U4CA 4B4OA 1G59A 3X2SA 2KBEA 3FWKA 4U7GA 3RVOA 3THOA 1P0QA 2VH2A 3ZU6A 1YB4A 4EFDA 1E0DA 5EP3A 1GZHB 5EJGA 2PLFA 3WB0A 4YMTA 4M0LA 2B4KA 1SOWA 3CW2A 2YFHA 2A9VA 1PK8A 4ND3A 4R9VA 3V8EA 7AT1A 3II6X 3IR5A 4Q24A 2IHUA 5FFFA 4A91A 2CN1A 2Q5FA 2QD4A 1WCYA 2G88A 2HDNB 4LI0A 4QYMA 2H08A 3DFKA 4F3TA 3V34A 4IIVA 4KLRA 1K8RA 4OQZA 1P7CA 3CB2A 1XCPA 3TSWA 4X64B 2A9RA 4OFZA 3TQRA 3IKMB 4MNTA 4YPVA 3E3LA 2CK3D 1I5RA 2QRGA 5EP2A 4E3WA 1OV4A 2AFIB 3I76A 2IWHA 5ETJA 1LSOA 3KVOA 4CIWA 5JBNA 3SQNA 4H1HA 1QLJA 1DAGA 3NOQA 1UC4B 3LX6A 2JFOA 1SO8A 3H11A 4MUYA 3U9SA 3TF5A 3O3CA 1P2BA 3BOSA 3UJ7A 1LCIA 2WZQA 3L1UA 2RARA 4F4CA 2EEZA 4IYJA 2ZYDA 2XEDA 3PZBA 2XCUA 3PLRA 2CUKA 3T35A 1G5RA 1TM3E 2OV4A 3SS9X 4OX9B 4LGYA 3H3JA 2XZLA 4F9EA 2XGOA 5A2GA 4Z3OA 4JJ6A 5AOVA 3AL0C 3HU5A 2ONYA 1XMXA 1QP0A 3Q7QA 4PO8A 5KAMA 4HDCA 4DDKA 2C1XA 1YH3A 3KHKA 4FTWA 5E1DA 4Z1OA 5CFMA 4Q4DA 1WB4A 1OX4A 1YVRA 3ZC3A 4UREA 5C5DA 4O2LA 1OHHA 4OI1A 1TZ2A 1KFBB 4QEDA 3TBHA 4DGSA 4EQ6A 3E9NA 4B6SA 3GLFA 1E4EB 1L5NA 1FX1A 1VI2A 4QDUA 3I72A 2Z8ZA 3DP9A 1R9MA 4GDMA 2IW1A 3HWWA 2P2ZA 1OA1A 3GJRA 4IW3B 4PZ0A 1Q0SA 1HOXA 4RF3A 4MRNA 4R2XA 4A5SA 5FBHA 1P33A 2BTQB 3C8HA 3O26A 3WV4A 2P4SA 1EK1A 3MCWA 4AECA 1SXGA 1QLWA 1OBOA 1W6RA 1IEQA 2VSQA 2NO6A 2Q0HA 2YIDA 3FROA 3K3PA 4MITA 1G8FA 1KC3A 1T29A 2GPYA 3V80A 2AOXA 4XJVA 5EXXA 2D2XA 4LV8B 3R3YA 3TZKA 4WCFA 5BR7A 3IMGA 5FO1A 1F0KA 3DT6A 4FYWA 4HI0E 1KS2A 2QM3A 1AKYA 2Z09A 2G77B 4CQMB 4D57A 4JXKA 1M2JA 4LKOA 3S68A 4B3HA 4X62B 4RSMA 4HMQA 3Q2IA 4C6TB 2I4TA 2WWIA 4GOMD 4MXDA 2KQUA 3A4NA 3ER6A 4PQFA 5CUQA 4BWGA 1U31A 3BWDD 1H0HA 3ZI7A 3K0HA 4ASUA 3DL7A 2FY8A 2V0NA 4DV0B 2NUPA 4IQ4A 4YRIA 2HQOA 2VDJA 1NWHA 1T1IA 4KLNA 5EJ2A 4ZCQA 3PQFA 1M34A 4CMAA 1C1DA 1L5YA 3K0KA 5DI9A 2ABWA 1FFYA 1CNMA 3B7PA 2GFQA 5E9WA 2VP3A 3L6UA 3WISA 4JMLA 4UHBA 3I01M 4DV1B 4XR9A 1NQAO 3VA7A 5F98A 4IZ6A 3OY2A 3BKWA 5J3JA 2PNJA 2AZDA 1I1QB 4PINA 2EV9A 2XYPA 1KRXA 3OP4A 1J00A 5DHFA 2YWGA 4KR2A 1CEXA 1JEYB 2XRMA 3N76A 1L0BA 4RHXA 4ZCLA 4E5DA 3BFXA 3GLHA 3LDUA 1WXQA 3I2FA 4GUAA 4HLDA 3D6NB 2BR5A 2D2FA 2JJ1D 4P5DA 3S29A 3CZPA 1EB9A 5H3CA 4Z4HA 1N2XA 3E9YA 5JR3A 4K9RA 4XSHA 2GZ3A 3T7IA 1Q0PA 5J1TB 4BQSA 2BRUC 4F04A 4LMPA 1WDMA 4IO1A 1I14A 1Y7PA 3IXQA 3LCUA 1GARA 3EIQA 3ITDA 2R00A 3A27A 4MQLA 5H9WA 3MTIA 3R3WA 4RVHA 5D1NA 4YV0A 1XA3A 3EQ6A 5JMOA 1PNVA 2GZ2A 2JL1A 5CURA 2GM9A 2G0AA 1PQUA 1YE8A 3R4VA 4HGRA 1P3JA 4M83A 1ZVJA 2EF1A 3CEMA 3BTSA 3PTZA 2C61A 3B12A 3PQ7A 3DBLA 3IMCA 1KDVA 4LE1A 3AVWA 1C3VA 1GRQA 3WLAA 3TEFA 1BHJA 2RHBA 3WL5A 5JWOA 1GUFA 2B94A 1IY1A 1NI4A 1YZKA 2Z43A 1JEOA 5A0FA 4F9FA 1XD2A 1MNAA 4XYBA 4KYIB 1V1RA 3KKKA 3DW1X 3IBFA 2RGWA 4PLPA 1L2TA 5C35A 4LZLA 5KHOC 3TW4A 3VAZA 4JKYA 4YWHA 1RWPA 1HZZA 4ZPXA 4PSUA 1BJRE 2K2QB 3NKVA 4JP8A 4PWZA 4UFOA 1OZFA 2R6ZA 4YYZA 3U31A 4GNKA 1CEEA 3GJ6A 4U39A 2PLNA 2ZCVA 3KAQA 3IKVA 3ZCVA 1LBTA 3R9WA 3JTMA 3O4FA 1LC3A 2OB2A 2OEPA 2P8JA 2BEWB 3I4LA 4OLHA 3PKZA 1KZ1A 2ORIA 4NCHA 4RGBA 1WR8A 2AZXA 2BFOA 2W4QA 3OPMA 3BWYA 4XQCA 3DD1A 3SLRA 1FS5A 1XALA 4KVFA 3UT6A 2VYVA 4P08A 4BRWA 1N4AA 3OOHA 4EHNA 4LHEA 5F12A 5AVXA 1WXDA 1T0UA 2CJXA 2PZ8A 1F6DA 1KPHA 2FR8C 2EFDB 3B70A 3IO5A 3A1WA 4JLPA 5D84A 4PBSA 1WTAA 1ZK0A 4W5JA 1G20B 3VO8A 3IEIA 2RHCA 1T2UA 4PYMA 2J09A 2QGFA 5IM5A 5JNWA 4GGOA 2E4YA 2LNDA 4MI3A 2BGRA 3I9V1 3PGXA 4IXWA 1IG0A 3RLIA 5KOIA 4BMOB 5LZ2A 2PMKA 3NHRA 3ZGOA 5TJHA 3MILA 3QTBA 4IDQA 1UEXC 3KAKA 4J94A 1XKTA 2ZE5A 3ABQB 3D7RA 4KQGA 1W0KA 4TSFD 3WFJA 2CV1A 4DNXA 1J97A 3GH1A 3T3OA 3BJZA 3HE3A 2CEAA 1KKMA 3URKA 2C7PA 3CLRC 5IF3A 4RSHA 3A8TA 4JQZA 3KD2A 2YVKA 2GAIA 1KMHA 1AQYA 1VI6A 521PA 1DP4A 3DT8A 1R6DA 2WOJA 5IUNC 2XWBF 3DVAB 4UM9D 4Z4CA 2ZUBA 3C7KA 2AUMA 3CRVA 4ARSA 3DL0A 1BFKA 4XGIA 3TOZA 4ACBA 2OECA 4F1JA 1M1NA 1AN0A 1RXCA 2CXHA 2FVYA 2QY9A 2ZJ2A 1FX0B 3AUKA 3H2BA 1DC3A 1R0RE 1HF3A 5FO0A 4MRSA 3K4PA 4EHLA 3EHDA 4FBGA 2AQHA 3OZGA 4HQRA 4MARA 3QI2A 2AFVA 4XDZA 2BGGA 2MSKA 1N5JA 1IPHA 4GMXA 4X7MA 4YLGA 4ZEXA 1GOTA 3I39X 2JCYA 3KKPA 4TL8A 4HN9A 3GQBB 4IKPA 2X40A 4WNYA 2ON6A 4BMDA 3QUCA 3M3PA 2WTUA 1HEIA 4CDGA 1NQOA 4L85A 3T7RA 1R6VA 2OHXA 3HDQA 5B5SA 2Q1TA 4KYVA 4AZ3A 4JI8B 1YK1A 1ZM2A 2MDTA 3DMFA 3UXYA 2AD5A 3AP2A 4LYGA 2XCIA 2FH5B 4CQNA 2ACKA 1QC5B 3KQPA 3MRSA 1QR6A 4IDDA 5EP4A 1XPUA 5J4VA 4MQMA 2OCIA 3DOHA 4OAOA 2OCGA 1PN3A 2A9KA 4QJ3A 1T34A 1PZXA 4HFRA 2ZRJA 2H8KA 3DMHA 3KAJA 1CC1S 1TVKB 3SOZA 3WKAA 4CJXA 1Q3KA 2FW0A 3VI3B 4F4UA 3KLOA 2FX5A 4X93A 1H8HA 5AM4A 2H4HA 3PDHA 5EXPA 4D5EA 5C1BA 4X90A 2HJHA 5DV9A 4Q39A 3WI7A 1GZVA 2R6HA 3I0MA 3SEAA 5FBQB 4BX2A 1PYGA 1A9ZA 4M1SA 4AQYB 1VLHA 3WRVA 3Q9NA 3CHYA 3JQGA 1U0JA 1N34B 1A04A 3AJRA 8GPBA 2HDWA 3KL2A 3KXIA 1WXEA 1K86A 5IXSA 4JGIA 3KYCA 5JZSA 4JZKA 3MJCA 3R3UA 3HTXA 1JAHA 3HP4A 1PR1A 2GEFA 1IM2A 2JFQA 2YX1A 1UQRA 2YZNA 4EYSA 3W5BA 1GQOA 4XGRA 2VFAA 4ZA2A 2E4UA 2EIXA 3EEQA 2EZ8A 3WGKA 4O02B 3AEQB 2CT8A 1E7QA 3P9IA 1EB8A 4QLBA 4R1LA 2C2WA 1P0FA 1AQUA 3PYMA 2RGUA 2GN1A 2B6NA 3PTAA 4MCIA 1CCWA 5IULC 4OQXA 2AG0A 1TQHA 3VNVA 4ARAA 1USIA 3ZGNA 1JAXA 3GDGA 3KZMA 3VR2A 1GRVA 3PNQA 5T64A 3ELBA 3RSZA 3ZVNA 1NN3A 1B76A 1WETA 2BW0A 3K9WA 4WLNA 1MHTA 3NC0C 2DBVO 2Y77A 2WMDA 3LX4A 1EESA 4FD3A 4EJ0A 2Y66A 1Q7EA 5FIUA 2A1IA 3HFRA 4HEA6 4U0KA 1XAJA 1QM5A 2NSYA 2XA2A 2DPGA 3LXUX 1LPOA 3HN6A 3KEMA 4AKGA 2BYTA 2FPIB 2OTCA 3FTEA 2ZJ7A 5EG5A 4DCVA 4UNSA 4XYMA 2FW6A 1L5ZA 1QB8A 5AJUA 3KL4A 4YMSA 2HA5A 4CQJA 2G72A 3OCCA 3L18A 5D6OA 3BDVA 1KIMA 2G04A 1TMOA 3G8YA 1MP0A 2PH1A 2H1OA 5K3OA 1YULA 4HUQA 5D3MB 3J81A 2XDQB 3ZW8A 3LPAA 1CR2A 2WICA 3IEMA 1E2LA 4TKVB 4YJFA 3V8MA 4C14A 3ITKA 2O1EA 1U02A 3LF1A 1NVMB 3BILA 4M9CA 1CDZA 2NU6A 2LCFA 2PO5A 2GBFA 2QJOA 3B1YA 3GP3A 3NHLA 3T1TA 3QY0A 3PPWA 4HR7A 3BUSA 4LJYA 3O8DA 3MG9A 4JOSA 3QG5A 3WYAA 1LK5A 1LVGA 4G0PA 2Y0BA 4OJNA 5CAEA 5IBCA 1L5MA 2DUUA 2QUHA 1M2VB 1XN4A 5J58A 3T5CA 2ZWVA 3UZUA 5AIAA 5SZIA 1IEXA 5B4TA 1VJGA 5EJAA 3VBEA 4G0VA 3W90A 5CIWA 1FYDA 3SIRA 3PPIA 1QK4A 2BM8A 4ZJYA 3ZE6A 3EZLA 1RCFA 1FUYB 2WJZB 4WAUA 3HGMA 1T43A 1L1FA 3LQ2A 5CH5A 3ZW7A 4PX9A 5DK4A 5LMZA 4DA7A 4KIFA 2C7RA 3UG7A 1WAMA 4I8IA 4ZEOA 3ANSA 1P81A 2YR0A 4Z2AA 1DHRA 3A28A 4J2HA 3EC1A 1JIJA 1CF2O 3V1NA 4B4WA 4S2EA 2QPAA 4NAHA 3JZMA 5G0VA 1II8B 5IZCC 3QELB 3LQQA 1NW6A 3NWBA 4G5QA 3N2GB 3L82B 5FJIA 3AMVA 3EUFA 3HQ4O 1J25A 5CA0F 2CLEB 2VQDA 4S1NA 3OFNA 4YJ2B 4QZVA 4CFZA 3AEUA 4MWZA 1EP3B 3WFIA 1OWNA 1NF8A 2ZYWX 1YVDA 2CXXA 3P9NA 4ZV9A 1IY2A 1Q1AA 2B2NA 4Q01A 3BREA 3SR0A 1CUEA 3W5IA 3WK9A 4ERXA 2H2WA 2AOWA 4Q47A 1QGYA 4DRXB 4TPKA 3I45A 1DB3A 3S2YA 2FDXA 3IMKA 1GXSB 4UAUA 4EUFA 3IQEA 3M70A 1H1LA 3OMWA 5JRDS 4GOND 4DR5B 5F1YA 1PNTA 1BDBA 2F3RA 2YYSA 3W7BA 1L3IA 3IPRA 1G17A 2FX2A 3TCKA 1G8SA 1QX4A 1TEHA 5EIEA 4BQEA 1EGQA 3T7AA 4YJHB 1K6XA 3TUIC 3NM4A 3RS0A 1KK1A 1OVMA 3JQGB 4KQFA 2W6IA 2NVUB 2HO4A 1QZTA 2O6HA 3RBZA 1DCFA 1GWNA 3IQHX 3UWDA 2G7ZA 4B76A 2BN4A 3MGCA 2N0SA 2F00A 1P75A 3AJ8A 2ZYAA 4JEHA 4R5MA 2IEZA 5BSWA 3VR2D 5EN4A 4PYNA 3WNCA 4HB0A 2VNAA 3OJXA 1GNPA 5BT9A 1UWKA 2IPNA 1MOPA 3PWSA 4WZBB 3TGWA 2FRDC 3KE8A 3A6GA 3ZKWA 2PGXA 1U6JA 2YV1A 3EJWA 3HB1A 3Q72A 3WLIA 1PV2A 2OPHA 4DM3A 4UBIA 1BCRB 3AM5A 2XTAA 3ILXA 3OLCX 3IAS1 4GXTA 3GMTA 3KZOA 5FUWA 3ODPA 5FA8A 4ZOLA 3W78A 3WZMA 2QMEA 1LNQA 2XCOA 5BYJA 1KJYA 3KKQA 4I55F 4KZKA 3WRWA 1SD5A 5CFLA 4ZZ3A 2JAOA 3S7TA 4JXZA 2VHEA 4WA7A 1XWWA 1EJ6A 1OLXB 3CUWA 1E6EA 1RTKA 1EH5A 3IDFA 1U8EA 2OSVA 1QIIA 3T0FA 1XDBA 4V24A 3ROXA 1Z0AA 4M9XA 5BORA 4F12A 3B1KA 2R66A 1ZN2A 4ZYUA 2NTEA 3AYXB 5AKIA 3TW8A 5LMNB 4JXXA 1QRSA 1RMYA 4LPKA 3W6PA 1K7CA 1ZD4A 1X2EA 2QN9A 2AJLI 3OKPA 5TR9A 1JKJA 2O1XA 2PZEA 2E9SA 4ZQCB 5C3UA 2UUBB 4FZJA 3OZEA 3I23A 1E79A 2J5KA 2OO3A 3E1KA 5AKEA 3COWA 3L0IB 3P2KA 2GZDA 1D7AA 5CCEA 4IL5A 2AZTA 2PV0A 3R0QA 4KNWA 1PX0A 2FWRA 3OURA 5EVJA 3SHQA 2GK6A 1OGIA 4OTZA 5JAQA 4DQDA 3BTUA 4AXBA 2GNAA 2ZAGA 5JH7F 4ZXFA 3ICQB 3FM9A 3MTEA 4Y8VA 1PLJA 2ISCA 2IELA 1OB5A 1E7MA 3R9XB 1MIOB 3M4XA 2O05A 3Q8XB 4WBXC 4DXHA 1V6SA 1X9IA 1ZM4A 5JNRA 1T9HA 2B6HA 4KNYA 3OIVA 2N47A 1QMGA 3B60A 4JC5A 1YMVA 4ZQBA 1LBHA 2QAJA 1C5KA 2VYQA 3C1UA 3HB9A 3U9LA 2HGSA 2XA1A 4ZHQB 3U56A 3V4VB 3A1SA 1RDFA 4MSUA 4O4IF 4UU0A 3O4HA 1SOUA 5TT1A 2CVZA 3T5MA 1GITA 3M6LA 1TVKA 1M1UA 4DDMA 1U1CA 2VP9A 3R40A 3I6IA 3PGKA 3K32A 1Y7IA 1W76A 3GO4A 4FDAA 3ESBA 4MLPA 4PFSA 4ZVQA 1OAOA 5I9LA 3AGQA 4WNAA 1H6BA 4D8UA 5JJLA 1JPUA 4YAFA 2GCGA 2ZYIA 3G9TA 2P9JA 1ULBA 4OGLA 4J16C 4YONB 3WLRA 3HCDA 3ZE0B 1NW9B 5HCIA 1IU9A 4UASA 1GGNA 3AOEA 4C7BA 5F76A 2H3HA 1KJJA 4LYEA 5KYNA 2CB0A 5HRAA 2A4MA 1UMDA 3EPPA 3SYTA 1FNCA 4IDCA 3DHYA 4QM6A 2IHNA 3K2IA 4QT4A 1FNMA 5CCDA 5LMCA 3L43A 5L3QA 4O29A 1UBLS 1ADBA 3A36A 2AJDA 2ZE7A 1C0LA 3AOGA 5AVYA 1XD9A 1ZVMA 5K8JB 2LZ0A 4MX8A 2NACA 2PFGA 2ZANA 3RSQA 2DFVA 1R5NA 4RJIA 1GUAA 4Z9XA 1TA9A 1W46A 3BF7A 1N1GA 1OXMA 2HXGA 2D1RA 4LTNA 1O8CA 1GTSA 4LJ8A 1PR2A 1UBFA 1WQ3A 2H11A 4OQMA 1BA2A 1E1DA 3AF3A 4NP6A 2VP0A 4ER0A 4ZK6A 5DHSA 1FSFA 3IMEA 2DWPA 4WFKA 4EO9A 3QBVA 4AM8A 4QKQA 2WJGA 1YUMA 1E6KA 4GIBA 3RS8A 2Y9PB 1Y1PA 3DYBA 1MJGA 4LZPA 5LQKA 3VKHA 1BFDA 1U6IA 1SBTA 2FP4B 4F46A 3LVRE 2BEUA 3QWAA 2WJYA 3PR3A 4PEVA 1KEEB 3QH4A 2E2WA 2OLKA 3BD9A 3U7QB 3HBFA 4G8CA 2Z6AA 2DB3A 1DO0A 3ETGA 1XRNA 3JSXA 4GVLA 4K05A 3ZV5A 4AICA 4MHTA 2XMRA 4N54A 3TIIA 2X8AA 3WX0A 5A0TA 3E35A 4DV3B 4FR2A 3WNBA 3PC8C 3SC2B 5TQ0A 4ZCMA 3MTBA 2HF8A 4GI1A 3U9TA 2F4NA 3FYUA 1I3OA 5E1MA 4WWHA 3RVLA 2F8TA 2F67A 3RYFA 5E2AA 1R5OA 2XUHA 2W8ZA 4GX2A 1LBQA 3B82A 1TU0A 4R9SA 5L3SB 4PHTA 1CIJA 4QREA 1OFVA 2JJ2D 3E6AA 3V7UA 3FNEA 2RKBA 1E63A 4XVRA 3VDRA 5DPMA 4G36A 4AS2A 3KQSA 2WAXA 3PL1A 3B6IA 5DBFA 3KZVA 2QHXA 1DQNA 4XGKA 1X86B 3D2LA 2DETA 1AGRA 1MX5A 1QWOA 2WILA 5A3VA 3UJDA 4M0PA 1DSSG 4CLOB 4EPRA 4INAA 4DA6A 4Z51A 2QAIA 3NDIA 1Z0UA 4DCCA 1Y37A 3BA1A 3PDJA 5E95A 5I45A 1HTTA 1VE7A 5CJPA 3C74A 4WECA 2QVZX 4IF4A 4YB8A 4B33A 4X1KB 1HYQA 1C1XA 2FQXA 3MT7A 4TT3A 4ZT6A 4OI2A 2E4AA 3PFCA 1A8PA 1MABB 1VP9A 1E3TA 2HNAA 2R25B 1VCOA 3G23A 2RDMA 3IV6A 4KXLA 1GZ4A 2CCKA 4IIJB 4HGNA 3QPBA 2QAGB 5KVAA 4F5ZA 1CDOA 4M0CA 2IDKA 3OOSA 4RNDB 3KYIB 2CBZA 4OATA 4BEVA 1XD2B 2ACEA 2FSVA 4TS9A 1TKAA 4D7AA 3A1TA 4PCLA 1SXQA 2YXEA 3MSXA 4EZIA 1WB5A 1H8EA 1JQEA 2CFRA 1EBFA 4F97A 1W6UA 2VZ0A 1FIUA 1ZOLA 2GLTA 1S3FA 2IZ1A 3ABSB 1FQOA 3W6UA 3DAYA 1WV0A 1M1YB 1JECA 4QASA 4CF4A 1ODIA 5EJMA 5C8DA 3ZDDA 3BMNB 3N07A 2EU8A 3PK0A 3QVSA 1M8FA 1ODLA 1U2TA 4IIFA 1DUIA 2QRMA 1V3TA 3HVIA 2P4QA 1KEVA 3P2IA 4LHWA 3N0RA 3DM9B 4YQYA 4DILA 4YV7A 4U7DA 3U4QA 1D2HA 4TUYB 1BDIA 4UBLA 4YY3B 4FOTA 3W4JA 1JHXA 3RRZA 5KC8A 3K92A 3Q7IA 2F1HA 3NHPA 2JFNA 3LYHA 3W5HA 4C7MA 3I52A 5J1SB 4KPUB 3MOSA 3AL2A 4IJUA 5EHIA 4JUIA 4BO1A 2WYVA 1TT5B 4G9BA 4OHFA 4Y6RA 2IIPA 4ZVSA 1DQPA 2FZLA 4HG2A 2EX0A 4UD6A 4AJJA 1T2EA 1GGFA 4PICA 3FZEA 3KX2A 4WOKA 3ZTTA 2AMLA 1CS0B 4HLCA 4Z6KA 5JVDA 1GY8A 3SC2A 3DTVA 4NZMA 3RWOA 2V7QD 2ZYTX 3K72B 5DI3B 3AFMA 4BKUA 4F3YA 5KWVA 2PR7A 5DNAA 3R44A 3WO1A 3SMVA 1V6CA 3ICVA 4D74A 1UAAA 3AY7A 3DS8A 1H0RA 3I92A 1I2BA 3HBLA 1VG9B 3IVGA 3P2OA 3SKYA 4F38A 5GVSA 10MHA 4C03A 4NYMQ 4R71A 1VJTA 2Q27A 3BH6A 3STXA 3P2MA 4GL4A 2JGAA 1A71A 1XTZA 2CLIB 1OC4A 2GD1O 1VCMA 4URYR 3EX7C 2XCLA 5LD2C 1PUJA 4OQFA 3OU7A 4ZEVA 5BVGA 1SBQA 3U3OA 5IWAB 1U1EA 2AMYA 5JZVA 2VHWA 5DW0A 3FTFA 2YRXA 3O8LA 2HPZA 4ZXPA 3D3WA 3N0WA 1K8XB 5IDXA 4C2TA 4C5AA 5A3JA 4CLRA 3GFQA 3JYOA 3DGEC 5AKXA 5DMHA 4AP9A 3BZUA 2C2GA 3ILHA 3H9UA 3EZFA 2ODWA 1YQ9A 2CJWB 3C5VA 5FR2A 3PQ4A 4GZ6A 2IPAB 3NFYA 3ZDYB 2EDAA 3V55A 5ADHA 2D74A 5CFOA 5C5CA 4KPGA 1GAWA 5FXMA 3R7LA 3IAXA 5CFQA 3SC6A 3DNPA 2PSDA 2XNJA 3V8VA 3GFBA 1D5WA 3BTVA 4HQ6A 1UFOA 3TW6A 4D6YA 4XWWA 2X5NA 4H6PA 4JGBA 5BW8A 1UOPA 1QCDA 2Z2IA 4PPNA 1WBBA 4D99A 2EHDA 1NR1A 3M6AA 3RFXA 4YCCA 5LA6A 4M9ZA 3TUZC 1OLSA 4BJ1A 1PR4A 2PKQP 2WWFA 4JH0A 8LDHA 1P2UA 3KUDA 5BSVA 1KERA 1BROA 4FGSA 1FDVA 4JC8A 3NEPX 5JYBA 3HUUA 3QXGA 4NYJR 1N6LA 4WBNF 4RZIA 3T3HA 1VCNA 3OPYA 3AV0B 4JU9A 3ZCUA 1SY7A 2JIRA 421PA 4LQCA 5D87A 4LJ6A 4D46A 1QHSA 5BRNA 2GPTA 5T41A 1KWKA 4F6RA 4M89A 1QHGA 3K0BA 1L5OA 1RCUA 3LGAA 4RK4A 4TX1A 4WESB 3T4EA 3X1XA 2BFBA 4JB0A 3ZZ0A 4KACA 2ZI5A 2GN6A 3EEFA 3UWMA 2FP4A 4ZZ1A 1Y9JA 3D6HA 1R6UA 2EZTA 1P5HA 2JLSA 3GGDA 1VIYA 2HKIA 2OK7A 2OBXA 4LF8B 2JA2A 1ZMBA 3HWSA 5ESRA 3V3TA 1EXWA 1QUEA 2Q29A 3F1LA 4NV3A 1YFZA 1P2GA 3ZI0A 1A3CA 3F3KA 1EZ1A 2O0KA 2W4MA 4RV5A 2E89A 3PUHA 1M6YA 3WWOA 2JW5A 1LLFA 2BE7A 3ES9A 3RU9A 4DOMA 4Z8XA 3I8SA 2ZUFA 1TC1A 1Z7EA 4G24A 1ELOA 3K1TA 2PCLA 4OGGA 1G7SA 3MBKA 1L3BA 1U1DA 3H75A 3G5LA 2Z5VA 4Z9AA 5BT8A 2ORYA 4CM4B 1KHHA 2PXCA 3VOSA 4GU5A 1BKDR 3JPYA 1WNFA 1PU2A 5AW1A 2EFHB 2PL9A 4YDRA 3RHSA 2FPKA 4MVWA 1O6FA 4RLHA 1BGXT 2P0EA 3MMSA 4WESA 1W0JD 5TX7A 4QQFA 2Q5LA 1SBZA 1W52X 3BWEA 1Q0ZA 1T8TA 4LHXA 3RC1A 4CF6A 3OMXA 2FPPA 1G5HA 4MS1B 5MN4A 2WV9A 3JQAD 4DA0A 4U9UA 2C3MA 1TD1A 3LO8A 2R8RA 3PUVA 1GTZA 4LXYA 1UT5A 3H4MA 3SZLA 4CQLA 1FYFA 4I5DA 2JVKA 5A4JA 1A9OA 3F8TA 3NZEA 4L7QA 1KR5A 1DCTA 1XG5A 1A69A 4RIHA 3TLYA 4CM7A 3GI1A 1N8NA 3E70C 3D3QA 1FVFA 2IODA 4K9SA 4NZ9A 4NENA 2P9GA 5H4HA 1LDMA 3FGZA 2VPTA 4IDGA 5TS2A 1A5AB 4GXQA 3RAPR 4AY6A 2JGMA 3GLGE 4HNSA 3VC3A 3FPJA 2PBZA 4FNAA 5AXDA 2OXIA 3CF4G 3EB9A 4GDFA 4DR6B 4ARUA 4RC9A 3U3ZA 4MW9A 4JJIA 4Q66C 3K20A 1IHXA 2GPJA 3TRFA 4FOLA 3C3YA 1CB0A 3U2QA 1PX2A 2DCMA 1I7DA 2X7HA 2VJLA 1T8SA 3NALA 1N57A 1H8ED 4MIEA 1M74A 4PYKA 1MDFA 1W47A 1T9ZA 4QUIA 4V2UA 4W9NA 1S2GA 3RV3A 1KVRA 2J07A 2XGSA 1Q2XA 1AZSC 4P4SB 2JC3A 4Q00A 1A5BB 4YJGA 1W1IA 4CTKA 2PNFA 2BPOA 2H1HA 2OXCA 2VDVE 2IU4A 3DDSA 3QYPA 4HNQA 4XCQA 1NX9A 3GH3A 3H42B 3ZE7A 5JMWA 5AW4A 1DAFA 4RFLA 4CM3A 4DS3A 1QDUA 4PZPA 2E5WA 3ZQJA 4Y6GB 1K0UA 3GXOA 1N8TA 2PM8A 3RFTA 4H60A 1R16A 4DUYB 4D26A 5A9SB 1H4TA 4IQGA 5KX5A 3F5MA 5AI9A 3IPXA 4G1CA 2XCRB 3GL9A 1OSNA 4P7BA 1R50A 3DPIA 2XE4A 2CL5A 4OHCA 2W2KA 3SQLA 1D2RA 3BJRA 3AM4A 3G2NA 3EWSA 2OQRA 4EHDA 2QU7A 3LX8A 4MDYA 4EUNA 5CB4F 5ELLA 1LJUA 1FX0A 1X1BA 4PX2A 4ARVA 4E70A 1IY8A 2QENA 1AU9A 1HI9A 4D9KA 3R6WA 3FXAA 4YJ2F 3EFOA 2ZRCA 4NFLA 2C5EA 1IOZA 4GE3A 2A5JA 2G7MC 1ARZA 1Z2OX 4INZA 4PN3A 5A5FA 1Y6FA 1QLHA 1BVRA 1RWOA 1UFVA 4V38A 4EEXA 2MYTA 3AHIA 1G63A 1BMFD 3D3WB 3DFIA 4H6WA 1JGTA 4BOYA 1S4QA 4NOMA 4NMXB 3CTPA 3KJQA 2AWNA 1NVXQ 1X39A 1P5JA 3HN2A 3HY4A 3EXEA 4LYDA 1KVUA 5DRTA 4C22A 1AHNA 1EFRD 3ZVMA 2D1FA 2IW3A 3F47A 1K7EB 3HVJA 4DPKA 4HQLA 5AM2A 2H7CA 4M46A 4R54A 1H3FA 3DULA 1N0HA 5JAPA 5L3RA 3KSZO 1J99A 1ZRHA 3AQ4A 5BXQC 2B7LA 1NJ2A 3GRZA 4KE6A 1U7DA 2I1QA 2IHVA 4EJSB 1DUVG 1BW9A 2HK8A 4CKBA 4YCBA 1E2KA 1PS8A 3F90A 4MCHA 3ZWMA 1U99A 3GLGA 3MQ4A 4DQLA 1EHYA 4U63A 5AHOA 2HM7A 4UVEA 4I5EA 4K9PA 1M34E 1S89A 2BH9A 4MPTA 3TFOA 2R7KA 3HR8A 5DN6D 2H4WA 4TVSA 1A9PA 2GT1A 4OHPA 2QQ0A 1ZGCA 2CDRA 1G8YA 3TW0A 3L92A 2E1PA 2I2CA 4FFLA 5I7RA 1WW2A 2BMFA 3SDBA 1JFTA 1E9CA 5KOJB 5JANA 2FUEA 2W98A 1IONA 3CZCA 3RV4A 2J7PD 1MHPA 4D9EA 2OV3A 3ZJVA 2ZQ5A 1TZKA 1IJEA 1QFMA 1SKYE 4AKIA 2JH8A 4PZCA 4B82A 3VUEA 4DV7B 2JK1A 1C29B 7MDHA 2IP1A 2VBGA 3EVNA 3NHSA 5L7TA 1CQXA 4AN0A 2LCIA 3D0QA 5ITZB 1A5ZA 4OA5A 1RBQA 1RWWA 4JT2A 2VBIA