5K0LA

Crystal structure of comt in complex with 5-[5-[1-(4-methoxyphenyl)cyclopropyl]-1h-pyrazol-3-yl]-2,4-dimethyl-1,3-thiazole
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
219
structure length
219
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of Potent and Druglike Nonphenolic Inhibitors for Catechol O-Methyltransferase Derived from a Fragment Screening Approach Targeting the S-Adenosyl-l-methionine Pocket.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 80
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k0lA00
3UJAA 2XVAA 2ONZA 3HVJA 2F8LA 7MHTA 3LPMA 3JWHA 3OZTA 3DOUA 2FRXA 2IFTA 2Q41A 5DSTA 2AOUB 3M33A 3NVMB 4X1OA 3THSA 1X1AA 5EVJA 1PJZA 1F38A 4R05A 3A7EA 5FTWA 1JTFA 5CVVA 4C03A 3KR2A 3DULA 2OY0A 2ZIFA 3IHTA 3OPNA 1I9GA 3QV2A 4C05A 5K0NA 3UJBA 1YZHA 3X0DA 5FA5A 1X1DA 4P7KA 5GM2A 3KR0A 5FCDA 4DKJA 4PCAA 1EJ6A 1R8XA 5CUQA 1HMYA 2OZVA 4GOND 4RWZA 5D1NA 1BC5A 3UWPA 3LDUA 3KR1A 4R6WA 2G70A 3EVZA 2UYOA 3G5LA 10MHA 2UYQA 5ERGB 2GS9A 1NW6A 5BP7A 3KQWA 3FTDA 2IDJA 3KQVA 3TPZA 1WXWA 4MIKA 1VE3A 2YR0A 3C3PA 3EMBA 2FYTA 2I7CA 3KQQA 4YV1A 3BUSA 2ZBPA 3DXZA 1YUBA 5FUBA 3ER8A 3U81A 2JJQA 3A25A 3IEIA 1I1NA 2VDUE 4EVIA 3UJDA 1YFLA 2NP7A 4YUVA 3FUUA 1M6EX 3FUVA 3KQOA 1KXZA 1EQAA 2NXEA 2P3QA 3EGIA 3HP7A 3CJTA 2ERCA 4QQKA 2PXCA 5DWQA 3RODA 4ATNA 4PNEA 4RTRA 4RTOA 3ERCA 5EQJB 3LCUA 2YUIA 1FP2A 4FZVA 1O9GA 4WXHA 3E05A 3M6UA 1QAOA 2ZULA 3P9IA 2PWYA 5GIOE 3PVCA 4GF5A 4YV0A 1RI4A 3OFKA 5KYGA 4V0QA 3JWJA 3FYDA 2PVCA 1HNNA 4CTJA 2V74B 1N7IA 2O05A 3P8ZA 1RJFA 3HCEA 3BGDA 4QQNA 4U7TB 4PYQA 4DF3A 1D2HA 3TLJA 4NECA 4RTLA 1SQGA 1L1EA 3GWZA 3HA5A 3GRRA 5M5BA 5CD1A 3ELDA 3MTIA 1XCLA 2K4MA 1SG9A 3HNRA 4YUYA 2P3OA 4RTPA 2VDWA 1KHHA 5HOQA 3DXXA 4M36A 3TFWA 5LQNA 2QRVA 4FT4A 1RI2A 3K6RA 1ZGAA 2VP3A 4KVZA 4GC5A 4R8RA 5DM2A 5EKUA 3VC1A 2ESRA 2P8JA 3EVCA 4C04A 2HV9A 3BWCA 2VZ9A 5CCXA 3NVKI 1ZQ9A 4GC9A 1JG3A 5DX1A 5EMMA 4CXMA 2XVMA 2ZW9A 2QE6A 2PY6A 3DMGA 4DCMA 3E23A 2ZIEA 3LDGA 3HEMA 3MAGA 1SKMA 3EVDA 4Z2YA 3UJCA 4E32A 5EHGA 4AZWA 2G1PA 5K0FA 1R8YA 2OBFA 3DH0A 4UOEA 5KS2A 3OU7A 2BZGA 1NW8A 2P35A 2ZZKA 3BGVA 5EMKA 3MCTA 3P71T 4E31A 3P9KA 5CVJA 5EKXA 1Q0TA 3KU1A 2IBSA 5E9WA 2QY6A 4QTUB 2ZBRA 2LD4A 1P1BA 4E70A 1R74A 1RI5A 1IY9A 3G2PA 1XCJA 4LWOA 1L3IA 4FT2A 5DTRA 3TQSA 1L3CA 2NNWB 5K0EA 3CCFA 2PJDA 1AF7A 2JH9A 4X63A 5CM2Z 1QZZA 5DTQA 3KR9A 4YV2A 4RTNA 1NE2A 2AN5A 3EEOA 4RX1A 3KQMA 5EMJA 3P97A 3LX6A 1ORHA 3HCAA 1WG8A 4FGZA 4IWNA 4ER3A 3BZBA 3OU6A 1X1BA 1N7JA 3MTEA 4HH4A 3JWIA 2IBTA 2C7RA 2HR1A 1RI3A 3EGVA 2GB4A 3CC8A 3KPJA 3SSOA 4PONA 5DM1A 3NJRA 3S68A 3R6TA 2FK8A 3DLIA 5E8RA 5EPEA 1XJ5A 3HA7A 4QVKA 3HVKA 2OXTA 4GUAA 2ZBQA 3G8BA 5HIIA 4V0RA 4CKEA 4EKGA 3UJ9A 4BLVA 3HCCA 4R6XA 4YUWA 2AOTA 3UJ6A 2PT9A 2AN4A 5K0LA 2IDKA 1I4WA 4RVGA 2P40A 3OZSA 4P7FA 1KR5A 4RVDA 3BKWA 2DULA 4ISCA 4EK9A 2ZCJA 3UZUA 2BR3A 3FRIA 1XTPA 3L8DA 4L7VA 3DR5A 1P39A 2CMHA 3FPEA 3LCVB 5HIKA 1WS6A 3ID6C 4PGHA 2EG5A 4GOLD 5CVEA 3EMDA 2ZZNA 5K03A 3UA3A 2C7QA 3ELUA 3AJDA 4M37A 4QTTB 3LKDA 3DLCA 3KQPA 1EJ0A 5HZMA 3KQSA 2OKCA 3B5IA 2PBFA 3NDIA 4OBWA 4WVLA 4XUEA 1VP3A 1Y8CA 4PYOA 2BR5A 2EJTA 5KQRA 2CL5A 5E1BA 1EIZA 2AOUA 3FPFA 3ANXA 1R00A 1R18A 3OE4A 4QVGA 2BR4A 5FULA 4ER5A 5F2NA 5LQJA 3BWBA 2WA2A 4RVHA 4KIGA 3SM3A 4KRGA 4M38A 4RTQA 3PX2A 1NBIA 3TM5A 1JG1A 3FUXA 2NXCA 4KIFA 4DA4A 4PYIA 3CGGA 2NXNA 1MHTA 1VQ1A 3I64A 5FQNA 3SXJA 2Y1XA 3RW9A 3GO4A 4LECA 5DXAA 2IH5A 2GAFA 2ZTHA 2EFJA 1NW3A 2IIPA 3EGEA 3M6WA 4DCGA 2CMGA 5K0BA 4MTLA 5CIYA 3V97A 3Q87B 1VIDA 1T43A 2H00A 2ZWAA 3BWMA 3MQ2A 4H0NA 4KDCA 5DM4A 4DM3A 2JG3A 3A7DA 2PX8A 4PYNA 3EVFA 4YUXA 4Y30A 3GU3A 2NYUA 3E8SA 4KDRA 2FK7A 5C1IA 3SGLA 2UZ4A 4RSRA 1D2CA 4HTFB 3PFGA 5CVDA 5U4XA 5DT2A 3GRYA 2XYVA 3M4XA 5F2OA 3LDFA 5FA8A 2AOTB 1NV9A 4XCXA 1OR8A 2AVNA 5H02A 3T7RA 3FUWA 3ELWA 4M7RA 2CKDA 1FP1D 3EEYA 2BH2A 3LSTA 5T64A 4KW7A 3R9XB 1BHJA 4FS8A 3SMQA 1UFKA 3TR6A 2JHCA 3QOWA 2H11A 3LHDA 3O4FA 2IGTA 5DTMA 4IV8A 2YTZA 2G71A 3P2EA 5K0JA 4OX9Y 4ER0A 1VLMA 1JR4A 2A14A 4PYKA 5G02A 4AZTA 5K0CA 9MHTA 3GDHA 3OFJA 5GM1A 1QANA 5DX8A 3G2MA 3OCJA 4YMGA 3OZRA 3FPGA 4BP3A 3CKKA 3OE5A 2AZTA 2GH1A 2O0LA 2ONYA 2GLUA 3A26A 4B17A 3G89A 2BM8A 5HIJA 3CJQA 2Z6AA 2Z6UA 3EPPA 1JSXA 1VP9A 1EG2A 3CVOA 4POOA 5FHQA 3I5UA 4RTSA 3LECA 3BXOA 3LGAA 4R8SA 3GXOA 4E2WA 1RJDA 4FR0A 4PYJA 2XBMA 4U7PB 2ZFUA 3PTAA 2GPYA 3PB3A 4RVFA 5K09A 2HNKA 1DL5A 3KQYA 3I58A 3EVEA 3G2OA 2ZZMA 3DMFA 4XUCA 3HA3A 3PLAE 2O06A 3G88A 4PYLA 2PLWA 5EZSA 2HWKA 5EOVA 1XVAA 4IV0A 4ER6A 3NW9A 3ORHA 5K01A 3T7SA 1L3BA 4IKPA 3T7TA 2CWWA 1INLA 3LCCA 4FSXA 4PWYA 2PKWA 1JSZA 3D2LA 3KKZA 5ICGA 1AV6A 3OU2A 3TMAA 3AXSA 3R24A 3BKXA 1TW2A 4BLWA 1NBHA 2PXAA 3B7PA 4E30A 4GOOD 3TRKA 5T67A 1AQJA 2I6GA 4QDKA 5DPMA 3DMHA 3C0KA 3G8AA 2VDVE 3O31A 3QOXA 3BT7A 1P91A 2PWPA 3G5TA 1TW3A 4F84A 5HEKA 1B42A 1JQEA 4KWCA 4RTKA 1G38A 1P1CA 5T6BA 5JUWA 1L9KA 4CKCA 3B3JA 4JXJA 3R3HA 5K8VA 4Y2HA 1SQFA 1SVUA 4QDJA 2IPXA 2DPMA 1NT2A 2B25A 1O54A 3A27A 3B89A 4E33A 2I62A 4X41A 1ZG3A 1V39A 1WZNA 3MB5A 2HMYB 3GCZA 3HCDA 4HTFA 5FHRA 2FHPA 1FPQA 3A4TA 3MCZA 3NTVA 2OPBA 3FRHA 3FTEA 1WY7A 4PCLA 1ZHFA 2XYRA 4BY9E 1IM8A 4C08A 5MHTA 1PRYA 2P7HA 5EHIA 2ZSUA 2R3SA 3GRVA 4EKIA 1DCTA 1G8SA 3MGGA 5HILA 2XYQA 5GINE 3NWEA 4DZRA 3UBTA 2WA1A 2ZLBA 3DUWA 2P41A 4GEKA 5DLYA 2AS0A 2G72A 3SX0A 2H1RA 4PINA 1QAQA 5B1SA 4OBXA 2KW5A 4YMHA 1BKYA 1VPTA 2R6ZA 3FPHA 5ICFA 5DX0A 2ADMA 4OA8A 5E2BA 2FCAA 2IP2A 5ICCA 2OB2A 3GNLA 3TKYA 4DQ0A 2O57A 1NW5A 2Y1WA 3O7WA 5E8JA 1M0EA 2UYHA 4PIPA 3M70A 2E5WA 3JWGA 2ORED 1AQIA 2OB1A 2ZWVA 5K0GA 3HTXA 1YB2A 2GA9A 1XDZA 1YFJA 4AX8A 2G8NA 3E7PA 3I53A 4C07A 5KQSA 5LQAA 1ORIA 2B2CA 5C9ZA 3FZGA 5GP1A 3AY0A 8MHTA 3PS9A 1G8AA 3C6KA 1JQ3A 4FSDA 1XDUA 3IV6A 2OO3A 3IYLW 3UJ7A 1UWVA 1FBNA 3RIEA 1JQDA 2PGXA 4LWPA 4P7GA 3HCBA 5F2KA 4AZSA 4HG2A 3H2BA 4A6EA 1N2XA 2VS1A 2AN3A 2JHPA 3HCFA 3PFHA 4E2ZA 1MJFA 3GGDA 3VYWA 3V8VA 5DRYA 3UA4A 5E1DA 3WSTA 2ZIGA 5BW5A 3EVGA 2C7PA 3HVHA 1QAMA 1XXLA 2QM3A 3NDJA 2HTEA 5GWXA 1NV8A 4C06A 2N47A 4PYMA 4ER7A 5K05A 2EX4A 3FPJA 3SSMA 4E2YA 2QYOA 3SSNA 4CKBA 5E1OA 2QRVB 1UIRA 1ZGJA 3BGIA 5IH3A 4HSGA 2B3TA 5FWAA 2B78A 3GRUA 5EMLA 3DTNA 3B3GA 3LBYA 3NWBA 4EMSA 3KQTA 3LBFA 5E9QA 3ER9A 1RJGA 1JTEA 3FTFA 1G6Q1 1EAMA 2YXLA 2NXJA 5D1HA 3KPUA 4DMGA 2C7OA 5E1MA 1KYZA 3MERA 2FPOA 5DSXA 3SR4A 1M6YA 2P1DA 4QPNA 3NMUF 1G60A 1RJEA 3LL7A 2JH8A 1NKVA 3P2IA 3ELYA 3LKZA 1ZKDA 4OQEA 4HGZA 2ZVJA 3F4KA 5CCBA 5EIFA 3KPVA 5KVAA 2AOXA 3KPWA 1SUIA 4RYLA 5E9JA 4RV9A 1DUSA 1FJXA 5EZQA 3GRZA 5P8WA 4RTMA 3FTCA 3MHTA 2BM9A 1H1DA 4CTKA 2P7IA 1O9HA 1D2GA 2YXDA 3UJ8A 5LR6A 4GOMD 5EC8A 5EGSA 4BP1A 1BOOA 3TKAA 3REOA 5IKMA 4XUDA 5FADA 4PIMA 3G2QA 5HIMA 2PSSA 4X61A 1Q0SA 4MHTA 1RI1A 5HFJA 3M6XA 3PX3A 1G55A 2PX5A 2WK1A 2V7EA 3BWYA 2AOVA 3P2KA 1WXXA 4GBED 2EJUA 3B3FA 1JG2A 1XDSA 3C6MA 4EQZA 1IXKA 5LQCA 3AXTA 3KHKA 3T0IA 2B9EA 3CBGA 3SVZA 3I9FA 5EIWA 1Z3CA 3P9CA 2AOWA 2PX4A 1KP9A 5DXJA 3C3YA 3GJYA 4HGYA 3HM2A 4X60A 5LQUA 4BLUA 2IH2A 2PT6A 1VL5A 2AR0A 3AWIA 5CVUA 3G7UA 3KPYA 4HC4A 5LQKA 1F3LA 4G56A 4AZVA 5EEHA 1JG4A 2YXEA 3ME5A 4MWZA 4P7JA 1KPIA 3K0BA 1VBFA 1X1CA 4ZTBA 2IH4A 4A6DA 2JHAA 4CWAA 3DP7A 2O07A 3HVIA 5DRTA 4LG1A 5FQOA 3CJRA 3PT9A 5ICEA 5E2AA 2AVDA 2YQZA 1U2ZA 4C4AA 1TPYA 4GQBA 3M6VA 2UYCA 3VSEA 3FUTA 5JR3A 4P58A 1X19A 3THRA 3Q7EA 3DXYA 2OYRA 3FYCA 4O29A 5EEGA 2PV0A 5C0OE 1KPHA 3R0QA 5LSAA 3TM4A 5EG5A 3TOSA 2PX2A 4F85A 5LQRA 1R6AA 3EVAA 3VC2A 2I9KA 5FWDA 1SUSA 1YZ3A 1KIAA 3P9NA 4FP9A 5GOZA 4MQ4A 1KPGA 1YF3A 2Z6QA 4F86A 3GIWA 4OQDA 4PGGA 4HRAA 5BXYA 2NP6A 2P3LA 4E2XA 3EVBA 3UFBA 2YVLA 1QYRA 4RTJA 4OA5A 4AUKA 5GIPE 2YX1A 1KYWA 5BW4A 4K6MA 5DM0A 4YUZA 1NW7A 4QPPA 2PXXA
chains in the Genus database with same CATH superfamily
1U8CB 1IN1A 2F8LA 1Z35A 1MB4A 3CRW1 5AM5A 1BXRA 2CSXA 4FHEA 1KDTA 4HK4A 3EIOA 5KOHB 4PYRA 3UTCA 4IMJB 3RLFA 2SICE 2JRLA 3ZGLA 2QAJA 3TIFA 4ZHQA 4AKIA 3GLGB 3ZV4A 2ODNA 4D02A 3OMLA 2JPDA 4YPOA 2X9NA 5JJCA 3BWXA 4FONA 2ZVPX 2JJ1D 3W2HA 4HV4A 2R85A 1LCIA 2JFPA 3CCBA 3WLPA 3N2EA 3PQ8A 1Z2DA 4BNFA 5JAPA 1JHXA 1QTNA 2R60A 1ZIXA 1NPDA 2I67A 5D1NA 4JJ7A 1CUXA 5HFAA 2FUG1 1N5KA 3I6YA 2NPFA 2VTEA 2IE8A 3GMDA 1VL0A 4MNTA 4MROA 4MV1A 3VR0A 1T8YA 3ZGNA 4DM4A 5JMOA 2YC2C 1ESEA 3DAFA 2NYRA 3PE6A 4XW2A 1SCJA 1MLDA 3K5IA 3SHVA 1GGHA 3F67A 1H2WA 4IH4A 1SVLA 5DFAA 1CF4A 1FFXA 2JGFA 1RP1A 4RCYA 3CH6A 5HP4A 5C81A 3SXPA 3WZ2A 3FSRA 2I7CA 2F4VB 2YH2A 3P27A 1FSZA 4L9WA 3ER8A 1ADJA 2PH1A 2XB9A 4EITA 4EG6A 4QQRA 3OIUA 4RHUA 9ATCA 1YUNA 3L18A 4DIMA 4COKA 1E9VA 4ID9A 1QB7A 1E18A 4RK1A 3QKIA 3KOWA 3OMXA 5SICE 1JI3A 2LR0A 2Q6OA 3HXTA 3ROFA 3ERCA 1KU6A 1NI4A 4YO8A 2I3DA 1HE1C 3OZFA 4RVUA 4X64B 3RPEA 1UZUA 4D3SA 1SC9A 2GBPA 3PL1A 4JZYA 3HYSA 3AONB 5A9RA 1VPEA 1HEIA 1FNDA 4P54A 3JWJA 4DJDC 4W5TA 1PZEA 4ZQHA 2O05A 4L76A 1EK5A 3FNHA 3Q12A 4A8JB 4YRNA 1R8SA 4NG5A 4CETA 3TLJA 5A03A 2IHNA 2OLJA 2W2PA 1OAAA 3PJFA 2D2VA 4XR9A 1XQVA 2R5FA 3IIMA 3P2OA 5I8ZA 3E3NA 1UFRA 1RJ9B 3HABA 2PVSA 3K4HA 4NATA 1P9RA 3VKVA 2CXPA 5ERXA 1GCUA 4FT4A 1RI2A 1EX9A 1NLZA 1DQZA 5EKUA 1JH9A 1JA9A 5I7VA 4QYWA 4XVUA 1U0TA 1B15A 2HQ1A 4YC7A 4C04A 3L8MA 1RQ2A 2YICA 2EEPA 2VYND 4KIWA 3OZIA 1PJAA 5ALRA 2VQEB 4B46A 1GV0A 3B52X 5LVAA 3LO8A 4FQ8A 4WDQA 1DIBA 4KBFA 4UCXA 3RNOA 2PLRA 3U0BA 4BVJA 3K0AA 4ETMA 4A16A 2ZIEA 2PGDA 2QJWA 1GQQA 3BFVA 1X39A 2IYEA 2NO4A 1Y5IA 4GBGA 1C1DB 1LUAA 3W6NA 1NJ5A 3ED5A 4JOQA 3OWXA 4QBKA 4NFLA 1AKYA 2BDUA 3PD0A 1GPYA 2XWSA 3MG9A 5E9WA 1QF7A 3QBEA 5DNDA 4EHAA 1Z36A 2WYOA 1SJ9A 1IUKA 2FZWA 2QVYX 3UUGA 3DCYA 1C3EA 3KXKA 3GDGA 3OQPA 3Q5EA 2A5JA 4JR1A 4UTXA 4EB0A 1MTZA 2VF7A 3WL3A 1ESNA 1W0JD 3PQ7A 4P84A 4RSHA 3EQ2A 3V4LA 4HGRA 1KWKA 1JIKA 1NI4B 4BQOA 1KI2A 2DY0A 3EZNA 2AN5A 2Q0SA 2Q0QA 3GW8A 3OZVA 4GWGA 3W5DA 3T7CA 1ZP6A 3B6KA 3S29A 1SNYA 2VZLA 1FTSA 1JR6A 3BZBA 4BMOB 4JELA 2NZJA 3D6NB 3F6PA 2DKOA 1J21A 3EXHA 3H1PA 3MWDB 1Z0KA 2FU5C 1C50A 1AC5A 3I1JA 2ZCVA 3AESB 2CHUA 4HUJA 1ENYA 1X7HA 3EGDB 1CUJA 3BL5A 4MINA 4YIHA 3ZWAA 2D00A 1QP4A 1SXPA 1CSEE 1HKUA 1PR0A 1Q6ZA 1A97A 2LV8A 4ZRDA 3VR2A 2J4CA 1Z73A 1B14A 2H7YA 2HEIA 4NYMQ 1USWA 3USES 1WF3A 2W8BB 2BEJA 3OSZA 4EKGA 4F56A 5JQGF 2X6RA 3VZDA 3UJ6A 3D7LA 1X13A 4FDLA 2CLMB 2C78A 3INYA 3ILVA 2R00A 3NNNA 4FZRA 3RYTC 2XGJA 1KR5A 3HJGA 2UZ1A 1EFRD 4KFTA 1KDYA 1TVCA 1XTIA 1ZGCA 2BR3A 3FRIA 3UT5A 1QDEA 4XQEA 2PZEA 5AH0A 2W6ID 1J23A 4YB8A 4H1WA 5JZ9A 4IHKA 1IJKA 2EKPA 2EZ9A 2PMBA 1M1YA 3DDZX 3F2IA 4U1RA 5T7BA 3BCUA 1ODKA 2BFEA 1JHRA 2EGGA 2PBFA 4YK7A 1IZ8A 3H17A 3BZWA 1AHIA 2IHYA 3DAYA 3GEGA 4LW8A 3ZYZA 1N92A 4ZZ3A 3ANXA 2V5UA 2BR4A 5F2NA 1YCDA 3URKA 4JU9A 3TF5A 2YOHA 5LA6F 1YBAA 2IK8A 3FCAA 3SHQA 5DYGA 3VU8A 3IQFA 2OFPA 1NVAA 3G0OA 3VI3B 4KE8A 4IL5A 3CNBA 1IVNA 1HEUA 1ZMRA 4BN4A 1JMVA 3WE7A 3ZK9A 4DANA 4OLHA 4D4MA 1RLJA 2NZWA 3OKPA 4LE1A 3ZW8A 5FJJA 5JHGB 3E9YA 3PYXA 4LF8B 3ZI4A 1BDMA 1NW3A 3GJ5A 1SUPA 2A0UA 3OHSX 2V7GA 4H35A 5BRAA 1RHMA 5LXTB 1NURA 1XCBA 3U7HB 2PSFA 2GN9A 3VNRA 1GYQA 1XEWX 5H3CA 1E3MA 1A50B 3EVFA 1O0CA 1PDOA 2CLSA 4JOBA 2ZB3A 3PU6A 3EIUA 4L9SA 2WZQA 4H6WA 7YASA 2H1SA 4HQFA 3KOOA 4KYVA 1E3SA 2XQFA 2XMCA 1ESCA 2QN8A 3MFQA 3SS8A 3QSYA 1N34B 3DP9A 1EUCA 4MUKA 3QQ5A 2VNAA 4KXNA 4HLUC 5DYIA 3CF4G 2ACVA 4UUOA 4Z99A 5M3BA 3HBAA 3N2LA 3SMQA 1AD2A 1XJWA 5GONB 1FFEA 4OAQA 2YV3A 3S81A 3H3FA 1FMFA 4RH1A 2OFFA 4S1TA 1MT0A 4GPAA 3ZNOA 1JR4A 1R5OA 4DSNA 3GZ4A 1CY1A 3DLTA 3L7IA 4F1JA 1J33A 4R2XA 2P79A 4NNJA 4URFA 4Q4CA 1SIUA 1VKOA 4P93A 5JS1A 1LPPA 2WNIA 2A86A 3E0XA 1LU9A 3GLHB 1L5OA 4UVDA 3OE5A 4G5YA 5D2CA 5LU9A 3A26A 1KRWA 3ZW7A 4U2EA 4N3AA 3STXA 3TDKA 1N77A 2BM8A 5EXSA 2C0QA 2O2IA 3TH5A 4C20A 4ARZA 3MTJA 3GGOA 3AR6A 2Q5LA 2IYTA 5IJZA 3LECA 5HUHA 3LGAA 4QU5A 4B4OA 3TRHA 4KGXA 1G3UA 4MO9A 4B5KA 4PYJA 4PPNA 2ZJ1A 4WFQA 2CXSA 2FG7C 4L6AA 1EXDA 5GOTA 1LGYA 2GJ8A 2ZS9A 1BMFD 3C3KA 4UBNA 4CR6A 3PE4A 4YRQA 3JQPA 3EC1A 4TWRA 4A0GA 3IMCA 2QTBA 4PQGA 1M6WA 1ND6A 2Y27A 1JFLA 3LFUA 5LN1A 3H11B 1NVKA 2XTAA 1JDVA 3H7AA 1Y82A 3ZU4A 4EGJA 5KUTA 3GLRA 2GXQA 5DCYA 1F2TB 5TARA 4BLPA 4Z3KA 2Z0MA 5HKOA 3IVAA 5CB4A 3AXSA 1APBA 3DZFA 1XLVA 5KEIA 1GNVA 1NBHA 5KTMA 4UHFA 1GZ7A 1T0IA 1AQJA 4PBTA 3A3PA 5T67A 1TMOA 3CRRA 4H3KB 3K0SA 5TV2A 1NATA 1JTVA 2VA8A 5BNFA 4DSTA 2WJPA 1C2TA 1DJQA 4PAOA 3KSRA 4PZ9A 3ZQKA 4F84A 1TK9A 1DS6A 1FFAA 2ZSHA 3O3MB 2JHFA 1RCFA 2NSDA 2WI8A 2X0NA 2ZUDA 3GLKA 4KLRA 4DLBA 4W5WA 4BO3A 2IXFA 1T3TA 3E58A 4TMVA 1UADA 3A0RB 1B8NA 3T5TA 3KKPA 3U9LA 1QMPA 1T2AA 1Y6QA 2OG1A 4CM9A 3QY0A 1OD6A 3RYHA 2D5AA 1YONA 2ZGVA 3SR0A 1DRVA 3TRDA 4TZ6A 1HRDA 3GFTA 4BZWA 5KO2A 4BXOA 1VB5A 2B25A 2DPMA 4ZEXA 1DDGA 2XECA 4EHFA 2NADA 3W5SA 1W2WB 3DFMA 1W5AA 2C4HA 3LH5A 2VJMA 3SK0A 2XOKD 1SG0A 2XDAA 2BM0A 2OPBA 1LJLA 3LHIA 3IVXA 1PG2A 5DJ5A 1EHYA 3JAWA 2PPLA 3NV7A 4BKOA 4KQWA 4BE9A 4DSAA 3S1SA 1F3OA 2HSZA 2Z1DA 1QKKA 1WVMA 2CZGA 4BNKA 4C0LA 4LEIA 3TQCA 3DBLA 4F46A 1E3DA 1ZJZA 1LLUA 1Y34E 4FHZA 5DHQA 5JC1A 3KFLA 4HNVA 2IYPA 2G72A 4CCSA 4R1SA 1E9SA 2CCGA 1MVOA 2KB0A 4P08A 5J63A 2KW5A 3QPWA 1JAXA 1R2QA 2FCAA 1HGXA 1GSAA 3CX6A 3GUHA 4KE9A 4MGZR 4YMVA 2V96A 3F0TA 4EY6A 4ALNA 1M2WA 1GTZA 5LP6B 5HK9A 4B6SA 4G0PA 3EDOA 3NPMA 2K2WA 1WTCA 2PRIA 2GDJA 1E7YA 4A1OA 1YA8A 3QA9A 4C6HA 4CMEC 1KEWA 3KC2A 3RUEA 2IU3A 4L50A 1TVEA 3S1AA 5CCEA 1CUWA 2GEKA 5CB4F 4FBGA 1BO6A 1RJ9A 2CVPA 3AY0A 3OTIA 5JAOA 3Q9SA 3K5WA 5D3ZA 1W4AA 3KD3A 4UU7A 1RMYA 1VYTA 1JQ3A 1MOPA 1OY1A 1WEHA 2AD5A 4NBKA 2BFFB 3EUEA 1Q1ZA 5BUCA 4AKGA 3R4CA 4M1WA 4W99A 2MR5A 3FNFA 2EFEB 2WICA 3I8XA 4KPYA 4IWYA 3ZDFA 4PRKA 4EHIA 1I4EB 2Z4RA 3DL7A 3ODGA 5FOSA 4AFNA 3RIYA 3F3SA 3HN6A 3PHIA 1GP2A 1BXGB 2Y2VA 1IUOA 3MT9A 1XMSA 3MLAA 1KDOA 2QTAA 1OYVA 2OK7A 2VP6A 3FB4A 2DP4E 3UA4A 1DJOA 3LT2A 1EM6A 3T15A 2P4SA 3NCTA 3WGLA 4D0LB 1CX9B 2ZR0A 3LQQA 1CDEA 3N0VA 3QPBA 4AYWA 2SKDA 3SBXA 2WTUA 1G4UR 4XPIA 4IKEA 5DHPA 1U7HA 1U3FA 3IV7A 3ZWQA 2RHJA 2O4CA 4IW3B 4PVCA 3TRJA 1G8MA 1ZBQA 1HQCA 3OAAA 4BO2A 2IS6A 3EZXA 4MA0A 4GPIB 3C3BA 3OZUA 1VDMA 2C5AA 1PTKA 4RANA 3ZWPA 2BCGY 4EMSA 3KYIB 4Z9AA 5JYEA 4HN4B 5I7EA 1KYZA 4PN7A 1CC1S 2GRAA 4M53A 1OI4A 3NEJA 4UM9D 1G5HA 2JIZD 4IZOA 3RWMB 2BMEA 5JS2A 2HF9A 2H0QA 3SWWA 3CCCA 1HOXA 1Z2OX 3KQLA 1Q83A 1TYZA 1UCFA 4LA4A 4OK5A 3QTBA 4TKUA 1DRKA 4RM2A 1NP3A 4CV2A 2QVCA 2TSYB 3NG1A 2XWPA 4P82A 1ZKMA 3A58B 4UUBA 5DF1A 4DLTA 4F3CA 4WZAB 1A9ZA 2ES4A 3PPIA 3IPXA 5B7QA 4ITVA 3ETGA 3A2LA 1CUFA 5HE8A 3A1FA 2CFIA 5T8KA 5BUSA 4BP1A 2HYIC 2I4OA 3D0QA 1MIOB 4J94A 4Q12A 2OBMA 5TMPA 1H2HA 1ZM3A 4FHDA 1IUNA 2GAIA 2V7BA 3JAKB 2CFOA 3PITA 4MVJG 2P2ZA 3FZNA 4P3NA 3H86A 2M6KA 3C1TA 4RLHA 2RJ3A 4DJFC 5BW8A 5LXTF 2HSWA 3GVHA 1SC3A 3H2YA 3R9WA 3BGWA 4Z7JA 1ZI9A 2D2EA 2QW0X 3IOMA 4MYHA 5T4EA 3W77A 3NC4A 1G5PA 4MW4A 1LBSA 2H07A 3DVLA 3GN2A 5KTTA 2CZQA 2QYSA 1BFKA 2H52A 2ZWMA 1WZUA 1BHSA 3NM4A 4XB1A 2AOWA 1U1FA 3CXUA 3NB0A 4OHRA 3ZE6A 3W5VA 3WJ7A 3BMNA 3NYWA 4KN9S 2PZ8A 2VAMA 1M8GA 3AWIA 2AG5A 2XITA 3EYWA 4JBWA 5LQKA 4Y2SA 1DJLA 1O6CA 4QODA 3VZPA 4P7JA 4XM1A 5BMOA 2F3SA 1A8IA 4MQFA 1NXWA 4Q4DA 1U31A 4KX3A 2O07A 1WWKA 4WZAA 3WADA 3PT9A 4NPAA 4BPBA 1U2ZA 3OJWA 4UFPA 1JXQA 4RH0A 2FLWA 1MRZA 4LOAA 5JS8A 1P4HA 1ZICA 1ONSA 1QP8A 5DM70 2BGIA 3ZU3A 2JLWA 3P0RA 3UAOA 5FFFA 3IFSA 4OP2A 1RXEA 5F1KA 2DKNA 4F85A 4K9OA 5A2QA 3D6VA 2EJCA 2QZJA 1C3VA 3P26A 1YF3A 1T8WA 1KIAA 2R8OA 3L0PA 1GCOA 4RCVA 1JUDA 1W85B 2FWPA 3AI2A 5D00A 4EW1A 3K70D 3Q6NA 1R6VA 1CNFA 2C9OA 1Z68A 1ZGZA 2G67A 3N0WA 1USGA 5J5AA 3UGTA 5DKFA 4OIMA 4A6PA 4DMCA 3IMGA 2J7PA 5GIPE 5L8VA 4YHHB 4I4TA 2VPXA 3GT3A 4UHHA 4WXMA 3WNBA 1JDUA 2JL1A 3B85A 4KQ6A 3PUIA 3RIXA 4BBPA 1UZAA 3MMSA 4BOYA 2GCPA 5KDLA 1LDYA 1KJZA 2QY9A 5B55A 3PE3A 3QX3A 3JWHA 3OZTA 3V1MA 3T5BA 1I32A 3QWIA 3DKIA 4S1OA 2B98A 2VSNA 4JI1B 1UAGA 5FTWA 3Q4GA 4JSYA 2WHPA 4W1SA 4C03A 2CJFA 5JVDB 3Q9LA 2OD9A 4O1MA 3RWOA 5FBKA 2Q3DA 3PXEA 4WN9B 2K7FA 3U0VA 4WKNA 4F97A 4L75A 3UJBA 4BUCA 1Y6FA 2KLHA 4D80A 3QEKA 5IMSA 2GAAA 5B2ZA 3DYVA 3PUVA 3W5JA 1LH0A 1BEUB 2ZAGA 5AJYA 2ZATA 3TZQA 2AJ8A 4R71A 3WWYA 3G8YA 4N6NA 4YONB 4OV6B 2VDMB 2WTNA 1P1KA 2DB3A 3AVXA 1XZGA 3OPYA 3D1JA 4IUCS 4BZPA 2YR0A 3C3PA 5B7GA 1F2VA 2P67A 1N2CE 2R8EA 4WEQA 1THTA 4K9QA 4OL9A 2HMTA 4E7OA 4DABA 3JASB 2Q1TA 5CMLA 4QVIA 1E2HA 3TB6A 3PQ3A 4KGZA 1UPCA 1J1IA 4P4LA 2GZMA 2PE5A 1VI5A 1WPRA 2D1QA 2QMOA 1RLOA 4U7JA 1E64A 4X3OA 2BL4A 2R96A 3KDSE 1U8UA 1RCTE 1MJGA 1C0LA 1S2GA 3HP7A 3PQ5A 5CYPA 1UMCA 4I55B 3RK1A 5B30A 3ND5A 2V8OA 4IVNA 5EQJB 3LCUA 5LQDA 4C7OA 1E61A 5IT0A 3DHEA 5IMBA 2OGTA 3QU5A 1IM5A 1U7PA 1M2JA 3HMKA 3L1VA 4QRIA 4YNBA 3U48A 3GLVA 1PX0A 3GGCA 4EGAA 5AVVA 4HATA 5I7AA 4G07A 4EOGA 4N12A 2WV7A 1C3OB 1XRQA 4ZYLA 3ZU2A 1L1EA 1XZMA 1XZCA 2IYLD 3AF3A 1JH8A 2O3QA 3W6UA 5MN6A 3NOOA 4F5DA 1AE1A 4KYTA 5D8DA 4QUAA 1ZW1A 3PNYA 2E49A 2V3CC 4MB2A 4OFWA 1GCIA 1NA5A 2BFCB 4BQFA 1EDBA 2FR0A 2D0PB 2PCJA 2P78A 4RESA 4MQLA 3T7DA 4K81B 3I9JA 3ZE2B 3OO0A 2EFCB 4UQPA 1TQDA 1KU0A 2COUA 2JIQA 3P9RA 1LNQA 2VZ8A 2YZ2A 1G9TA 4NCAA 1XD2A 2FZKA 2PBRA 3WYFA 4BQNA 4Z8YA 5G4KB 2AXQA 5LBTA 3HEMA 1VBNA 2WIDA 3EVDA 5C1PA 2G4LA 5IDXA 1QPBA 2IYNA 4FD3A 3IUQA 1OB5A 1R8YA 2G04A 4GMXA 1SZJG 1YDHA 2ZTLA 5CX1B 3AV3A 3E9EA 1T9HA 4OMDA 1Z4LA 1VIAA 1XDBA 1Q0TA 3TINA 4DJJA 2ZI7A 2VHVA 4BU0A 5BOSA 5CDYA 2QY6A 4TLCA 3GZNA 4GM4A 2QRLA 4E70A 221PA 2AXNA 5E0KB 3TQSA 3SY8A 4ARZB 5FPHA 3KKLA 1EB8A 1TYBE 3UJNA 2SBTA 5B7NA 4R4JA 3BXPA 5BNIA 1W1IA 1Z83A 1DSSG 5L6LB 1HY3A 1YXMA 1SELA 1NE2A 5EJAA 1HQYE 2OM6A 1V5GA 2J7KA 4EHJA 2L19A 3Q9UA 4FGZA 3DC7A 3F4LA 3NORA 2XKJE 4IUYA 2D7CA 3CX4A 4LVNA 4JYZA 1Z62A 2JFFA 4P1ZA 2JD0A 4RF3A 4X0EA 2OKGA 1KQGA 1NJSA 3AERA 2GB4A 3MNFA 5DM1A 1HYHA 2DQ4A 2QX8A 2WOJA 4YT2A 4O02B 2O2DA 2OCXA 2RKBA 2ZBQA 1R0YA 1G21E 1QX4A 3G8BA 4YLYA 2GCOB 3O8OB 3ZUPA 2HLPA 4BLVA 2PX3A 4NNOA 4A6XA 1ZD5A 1EK1A 2NSLA 2O7SA 5IJ9B 3TL2A 1LFAA 1IRXA 3AIIA 2C9MA 3WLNA 1KKLA 1R64A 1UPBA 2VA9A 3BCRA 1XTPA 4P3XA 1QRTA 4RHCA 2B94A 3EIFA 1Q77A 1NR5A 5KHAA 3UMRA 5BY2A 3A1UA 3DLCA 3CF0A 1P6QA 5E0OA 3M6LA 3ZVKA 4X93A 4E3ZA 2UUAB 3DO5A 1TM3E 2FMKA 4L7QA 3QEMB 4AP9A 4EPRA 4Z1OA 2R79A 1S2IA 3EF0A 3QG1A 3E2IA 3NHYA 4RTQA 1WCV1 3NT2A 4DCPA 3AILA 3E9ZA 4N8EA 5JO0A 4JBHA 5M34A 1UMBB 3MK31 2XNJA 4UHKA 2ZJ6A 4QGSA 3OM9A 5FNVB 5U1PA 1JG1A 1QB8A 5GVSA 3ZD7A 3RWBA 3GQBA 2OXRA 1QHFA 3FOAA 1PTJC 2EJVA 1T15A 4QXMA 4XB2A 3RW9A 5HRUA 3VNUA 2OQ2A 1HTBA 2OGWA 4CHGA 1QBGA 5DGHA 1PAUA 3NTRA 3T95A 3ZKWA 4BB5A 1US8B 4LGMA 3V97A 1VIDA 2QTCA 3WOHA 3RFCA 3WRWA 4DM3A 3O26A 1N32B 3KWMA 4L5BA 3NC0C 2WSLA 3EWAA 4OK6A 5CD9A 2DT5A 2Y4OA 4JI3B 1LA2A 1QFJA 4LN1A 3IP9A 2Z04A 2ISCA 3QYPA 4CUZA 4QXOA 4TV8A 2I65A 4U7FA 4UNNA 4C4RA 1K4YA 2WJJA 3KEGA 4P92A 4OMFG 3USZA 3WBFA 5I51A 5KNCH 5INTA 4LX8A 2OAGA 1CR1A 1G8GA 1BGXT 1U9CA 2V54A 3GCWA 4Z4IA 1ONNA 3UUEA 5I7WA 5CRIA 3E7WA 2AK3A 1EZ4A 2FWIA 5IKOA 2YFHA 3OKFA 1MX1A 2JJMA 2XUIA 3KNZA 4RD4A 3R9XB 1N6RA 4A2QA 2ZCUA 5EYPB 2IF2A 3KJNA 3BMNB 3U60B 3INRA 1HZZA 1UC9A 2JFOA 3LPDA 3WYGA 4QHTA 4QSMA 4AZTA 3AUFA 5H4HA 5AJTA 4U9UA 2QSUA 4V2IA 4XWOA 4EG0A 4CLHA 2IIVA 2I3GA 1KQOA 3X1XA 4DC9A 3RAFC 3G2MA 2JK1A 2QIPA 1WM1A 4X45A 3I76A 1X0VA 3LI2A 5DN6D 5LLTA 4Y9UA 4FB5A 3RJTA 4DTIA 1O57A 3QUAA 4ALJA 4CBVA 1OT5A 5EJ9A 2F17A 4UDYX 2FDCA 1VP9A 1JKMA 1L5MA 1ZVMA 2FN8A 2X1HA 4ZYZA 1WD7A 4FMCB 1FFYA 2HQBA 1ZA2A 3LPCA 4B7ZA 3NRBA 1LNZA 3K09A 4NYMR 1AKUA 2FFBA 2J3JA 3TL3A 1R5NA 4EJ2A 5L3QA 5EIAA 1NDQA 2VP5A 3BAFA 4L8VA 5C8XA 5AFSA 3BERA 3HJNA 3R2JA 2I2DA 3RT7A 4I50F 3ETDA 3FFTA 2I1QA 1AZTA 1ECGA 4WLUA 3ZCPA 4QC2A 4BS9A 1ML4A 4MKXA 3A8TA 3VKGA 4OQPA 1SUBA 3EHDA 4K2HA 1L4EA 1RQXA 2GM3A 3IV9A 4JOSA 1AHHA 4I8IA 2VJCA 3E61A 2KWIA 5FL7D 1JECA 3OKCA 5C18A 1EHCA 3HBFA 4BLWA 3LA8A 1XU7A 3RC3A 2DY1A 1EFKA 2NTYC 3CVVA 3DMHA 1S2MA 1N1DA 3CE9A 2PWZA 2Q9UA 1W6RA 1OI3A 3KRTA 2HUNA 4PTLA 1E6LA 4IHJB 3G5TA 3OY7A 2P68A 5IBCA 5H3LA 3GCXA 1F2UB 4Z4HA 2VCYA 3ZHYA 3JATB 3K8OE 3ELBA 4JJZA 4QREA 5ALUA 4MUGA 2EFHB 2NUBA 1RABA 2PSEA 3MXOA 1LLDA 4FE3A 5F12A 5HQJA 3AM3A 5C1OA 1U2TA 5HTOA 1CEYA 1SOUA 1R4MB 1SVUA 4O4HA 2P69A 3EIQA 3KYCA 3NYIA 3KFVA 4L5YA 4WJLA 3AVYA 3DBOB 4POAA 1KJYA 1G5FA 3MSCA 3WL6A 3IDZA 1I5RA 4LZOA 1QV9A 4LY0A 1FVOA 1TK3A 1ZH2A 2HMYB 3DV2A 2FW7A 1X9GA 2VSQA 3KLOA 1V7ZA 2X1LA 4FMPA 2FHPA 4KRYA 3KV3O 4RYDA 3HHEA 1WY7A 3OE7D 2MSCB 2XYRA 4MQMA 5JXGA 3KJQA 3O9MA 5CK5A 4NWIA 2Q5HA 3DCNA 4J16A 3VO1A 4ZIRB 4YWJA 4K6GA 5F33A 2VUUA 5FBWB 1Y3IA 1JG7A 3WIBA 1G3MA 1U8YA 4E4RA 1KMIY 2WWVD 2PYZA 1MH1A 3MBKA 3T0FA 4XTRA 4MEAA 1N2GA 4MKIA 2OFXA 4QBIA 5DX0A 5LYYA 2A5GA 2LNDA 1K0FA 3I8SA 4OA8A 4ZCQA 5HZKA 2GFQA 5CTAA 2WP0A 4ZEVA 5G53C 2R6GA 5DW3A 1I2ZA 4O4JA 4KDEA 3JYPA 3WZMA 4Z49A 5ENZA 4RM3A 4LXQA 3EOBI 4C07A 1ORIA 3I9NA 4CKXA 5JYDA 3U49A 3UPUA 1O58A 1FTYA 4FJ1A 4MVWA 4Q82A 4AF7A 4EHDA 3BH7A 1GIAA 621PA 1Z6PA 1OA1A 5IANA 4EUSA 2NZ8A 5KYTA 1UKVY 4RAOA 2IS2A 5CXXA 2R1TA 1J5PA 1H4VB 4C3OB 3CX8A 5FT9A 2V7VA 1ZY2A 1GGKA 2FWJA 2OCBA 5A4IS 5ADVA 4A8PA 3II6X 4M7OA 3RIEA 1GTJ1 2CUKA 2VXOA 3GELA 3QWAA 2FE4A 4NLLA 1U0LA 2P65A 3S5JA 4MV4A 1E5DA 4PZYA 1U5BA 4H3SA 1TM1E 2V7UA 5JTTA 5LZ4A 1XXLA 3M1YA 1ZCBA 1EM8B 3ESZA 4LK2A 4Q39A 1T24A 2Y4NA 3RKSA 1GGMA 2W00A 4BBAA 1UT6A 2HREA 3CNLA 1UT5A 1X6VA 2V6JA 4WPGA 3AQ4A 5E1OA 3SJUA 1RYMA 4EFDA 4QUDA 2WLTA 3HB4X 3JSAA 2Q3BA 4GRDA 4JJIA 4BMSA 4MSUA 5EQTA 4INJA 1MAUA 1DPGA 1NE7A 2CMKA 4G86A 4JIMA 4ZQBA 4RY2A 1RAHA 3B6ZA 3VSBA 4D92A 1QRSA 1E6EA 4RKWA 4FGJA 3DEJA 3DTNA 1DKMA 4MKHA 5REQB 1KBZA 4C7VA 4JENA 1P9OA 3FLAA 3FTFA 1EAMA 5JE8A 2I3AA 2WWFA 3ZWYA 4MYTA 4WKCA 4DMLA 2YN4A 2HKIA 1P9WA 2IYVA 2R8YA 4QPNA 4YJHA 5F73A 1RM5A 1RXVA 3DBIA 5IASA 2DF8A 2A9QA 3PR1A 4FC7A 4JLWA 5C3UA 5IARA 2GERA 3UXMA 4QU9A 5BQFA 1MQ9A 4CEIA 3QUTA 2W83A 3UATA 4RHYA 1L1QA 1SOVA 1TF2A 1FZQA 5IABA 4QECA 1XG5A 2RAUA 4PHTA 1WSAA 3WWPA 2ZYAA 5FP0A 4R81A 2WAAA 3CSSA 3FTCA 4DHEA 1YB4A 4MCJA 4B32A 1GQ2A 1GSOA 4HWOA 5CIQA 2BTQA 3UJ8A 4GVLA 1EHIA 4TVSA 3TKAA 1EFLA 1AK1A 1Q1NA 2WIBA 1N6KA 3EEBA 2FN7A 1U1IA 4ENVA 2JVKA 3L0OA 4MYDA 2OHXA 4X61A 3GYBA 4NYIQ 5CYOA 3URMA 4CMAA 5JZSA 1RLUA 5KWIA 3F5DA 1M2KA 3RYIA 1YQQA 5A6SB 3T1NA 4NX2A 1OV4A 2IYUA 3DV0B 4W5HA 1ABFA 1HQDA 1JV2B 1Y3CE 3IBTA 2NU8B 3KCNA 3T5AA 2XAUA 3MRSA 1SURA 5ADHA 1GILA 1KBOA 1NR1A 4LHVA 5EIWA 4E07A 1KP9A 4J1TC 1RS0A 4ZAVA 4ME6A 5BQ5A 2QUZA 3REQA 1Z5OA 3W79A 1JAZA 1TE2A 1KDRA 1XTQA 2R47A 1ZXLA 2QZ9A 3N6VA 5CVUA 3ZU5A 3DMTA 2MIIA 1MOZA 2XGOA 4J2OA 4M0EA 3LC0A 3T3NA 1EP2B 1JG4A 3Q2IA 1FDUA 4FFDA 4IEFB 4X1YA 5AQEA 4C7BA 4JQSA 2AEJA 5HJ5A 4YACA 1EDEA 1B8VA 1ULBA 4AD8A 1R4ZA 1WDLA 5DRTA 1UFQA 1SB8A 3EEFA 3W5UA 3VOSA 5BSWA 1THGA 3LX5A 3JSXA 3VX4A 1G8JA 3VSEA 1O9BA 4M8NE 2XUZA 3EBLA 3L43A 1CUVA 3RYFA 3FGOA 4GBJA 4HAYA 3A1WA 2I3ZA 3B78A 4FMDB 2QG4A 4IDCA 4MS3B 4OLFA 2P11A 1LV8A 5EEGA 5H7XA 4YP6A 4ZALA 3S27A 3CB2A 3D7RA 3WLOA 3AVUA 1PGNA 1XMVA 1ODJA 3MWGA 8AT1A 1SKBA 4WFIA 3QX8A 3T06B 1JI0A 5JFOA 5IC5A 2RH9B 3ROPA 4J0JA 1A88A 3MW8A 5TS2A 4GNKA 5AOCA 1U2GA 3UC9A 2EEZA 3VR1A 1ZGHA 4AK9A 2H08A 4HRAA 5DBIA 1ACMA 3H6HA 2W5UA 3K9CA 3DF7A 5B1HA 4AUKA 2QNIA 4LDAA 2Q0XA 3FMIA 1IN6A 1OPRA 3MJHA 3QVKA 2GEFA 4Q0MA 1U04A 1CUYA 4WESA 2NUTA 4U63A 1E20A 3MMZA 1UMBA 2YHAA 4QM6A 4TV9A 3H8JA 1LSUA 2ATIA 2FRXA 2Q41A 3P1JA 1NYRA 4K40A 3T7IA 2ZE6A 3ZGVA 1EWRA 4DHWA 2JATA 3A6LA 3AP3A 4NBWA 2AYZA 1WMSA 3SQWA 5AXCA 3BREA 2QJFA 2B20A 4YYZA 2ZTSA 3A4NA 3TZBA 3VDXA 1WBJB 1RXCA 3N8GA 5CM8B 3QY9A 4EARA 1FQOA 2R9VA 3QG5A 3AH8A 4LYHA 1CERA 2KQUA 5TDHA 5EHNA 4A2CA 2FDXA 4S12A 4BFTA 1JVNA 1LW7A 1L1FA 2O8VA 1TUIA 1DTWA 5CUQA 2ZAMA 1QCCA 3DPSA 4Q05A 3UCFA 2XA2A 4IYRA 4YYEA 3ZEAA 5KHLB 3KR1A 5ALXA 4HCJA 2UYQA 5ERGB 4IGAA 4MI3A 3LVQE 1VI2A 2GOYA 3PENA 4BP9A 1RHJA 2FRDC 3B3AA 3DKKA 4I2NA 1IULA 2C00A 3T8YA 4DG5A 1VZ3A 4WK0B 2HDHA 4P83A 5BSHA 3ZV3A 2V6BA 4BAGA 2FYTA 2I8AA 1H0SA 1TZ2A 3KB1A 2OUKA 2DPXA 1L5YA 2VZ0A 2J0SA 1OGJA 3VR6D 1TQ4A 1HT1E 3IEIA 1IBMB 2RGRA 4B3FX 2WJYA 3PTZA 4Q3DA 1KERA 4XWGA 3F4BA 5CHEA 5CW2A 3I28A 3GJ7A 4V02A 1VSVA 3GK3A 1DAMA 1SCBA 3EGXB 2QRKA 3ZV7A 3I9OA 4PCVA 4MPPA 3TE7A 4RTOA 3OQNA 1JLMA 1O9GA 2ZRHA 4AX4A 1XYGA 3M6UA 6PFKA 1XTVA 5F5XA 1C1HA 3V2HA 5KAMA 4RK0A 1I6KA 1KDZA 1UIMA 3N0RA 4UOQA 1RKBA 3OFKA 2YL2A 3PNSA 4DV2B 3FYDA 4XYEA 2G9NA 3UO8B 1ZUD1 4AY6A 2A9VA 2Z3WA 4RJJA 4FINA 5FTMA 4RKFA 1DNPA 1SCUB 2KS6A 4GMFA 4WXRA 3VR4D 4DF3A 1YDGA 3N2KA 4NECA 1GG8A 2O7QA 3GA5A 3VHLB 4B43A 1D1TA 1QIHA 4UAVA 2ROQA 1K5GA 3PDWA 5DYTA 4E5DA 4KMRA 3AF4A 4GM0A 2IEAA 4X1KB 1UP6A 2PANA 1EFPA 1GFWA 4ZDJA 2C8VA 2G77B 2VP3A 4LXIA 3W05A 3J80A 4KR9A 2Y8EA 3C8ZA 1IBCA 2D2FA 1I0IA 4WFJA 3WGMA 4CG0A 1UT8A 2VZ9A 1TAQA 4HN2A 4ZYVA 3CNOA 2VPTA 4UNRA 2IITA 3D6FA 1U2GC 1PNOA 1E9CA 2ZW9A 3K9NA 2WC1A 2B9VA 2GNAA 3HWRA 4QXRA 4E1AA 1ILEA 1SUDA 3IOBA 1BGWA 4K6KA 4Q19A 1M7BA 1KOLA 2OA0A 1W581 4BZXA 3DE3X 3MM4A 1ZJJA 4P0TA 5I9TA 3B3QA 5T41A 2LE0A 4E5UA 1THZA 1CDZA 1KEVA 2X7XA 2HSEA 2Q2OA 2B92A 5E95A 2BF7A 4EHHA 5CVJA 5IDQA 1J2EA 2XHZA 2XCUA 1XP8A 1SEPA 4QTUB 3U7FB 3ND6A 5J2TB 3B1KA 1B74A 4ZK2A 1QQTA 1RMTA 2QTWB 3G2PA 2BMWA 3EIHA 4OBEA 4I1OA 4C6TA 4KQ9A 3N2ZB 3VR5D 4AIIA 3HFGA 4IPTA 4IO1A 1DT5A 2CF5A 1SXJE 4P2BA 1R4MA 1XPOA 3DM5A 4CF4A 4TN1A 4WLOA 1ZNYA 2GPAA 1T9BA 2QMYA 3ITDA 2W2KA 3LRXA 4DA7A 4KHPB 4F2HA 3R4VA 1HNXB 5C7YA 1CIPA 4W9NA 3RV4A 3KXDA 1LBHA 1P3Y1 5JS7A 3HWX1 4DUYB 2Z8XA 3TLKA 3PCRB 1F4VA 1W96A 2O14A 2OM2A 2FK8A 2I4MA 3PXXA 4M55A 5EPEA 1PL8A 3VC7A 5TX7A 3AG6A 1T0BA 3U1TA 2H17A 2GTPA 3JD1A 3NBAA 3NLLA 1A69A 2LCQA 4OOFA 1JJFA 1SB9A 2PT9A 4F11A 3UMMA 1R0RE 1GADO 3JR3A 4YDSA 1WABA 3UAWA 3D3QA 4DWJA 1PNVA 2P40A 1UKZA 3B53X 2GM5A 3G82C 1ZITA 1CF9A 2HD4A 2V4ZA 3HXLA 2QGNA 1HLGA 1RWVA 4X90A 5ELLA 1NF8A 2GQ0A 2IYRA 1TVMA 1AGRA 3IE2A 3I1YA 5AHXA 3RIMA 2CMHA 4WECA 1J97A 1LNSA 1RBQA 2GZHA 4OYRA 5KTSA 2PUVA 3ES9A 3WLMA 4ZVQA 4UVEA 5EMNA 5BSGA 4XH9B 3PNBA 3MS7A 3SKVA 3QUQA 2PMWB 2G1UA 5LJLA 1XP5A 1PEDA 5EIXA 1NJ8A 1T26A 2V59A 5EJ2A 2FMIA 3Q41A 5BVGA 5FULA 4GVXA 2HI0A 1J42A 1MABB 3ZZ0A 4WUTA 5ESRA 1Y1TA 4ZDKA 3COPA 4L0CA 4HWKA 4KRGA 4HL6A 2CLDX 5ALSA 4KQMA 5E7MA 4J3JA 3WJAA 3UB2A 3NQ41 2A1TR 3D59A 4P5EA 3OEHA 3I64A 3TQIA 2I3BA 1KI6B 4Y1GA 5BO5A 1JDBC 1MB3A 1P0MA 1AGNA 3BFXA 4BUZA 1EA5A 3ZI0A 5EJMA 1PNQA 4BTVA 1HX7A 2H06A 3KJIA 3TQRA 3ESYA 3B9QA 5AK6A 4NZMA 3RV3A 1AVTA 1YR6A 2JG3A 3GLIE 3B6MA 1TUEA 4OLBA 1E2JA 1DAIA 1LXCA 1TQ2A 2J9XB 3O0DA 4K5QA 3ZCRA 4G84A 4KDRA 3THXB 4IIBA 3MWEB 4JP3A 2UZ4A 5FB3A 1ZK2A 3TG8A 3GLGA 4O4HF 2BE9A 3EIXA 1NASA 4R2LA 4C0AC 1SXGA 4AKTA 2PUTA 3QJ5A 4EJMA 1DDOA 2XX3A 2XYVA 4NZNA 4OI1A 5C32A 3NYQA 4HLQB 5FLEX 3TMYA 2PZMA 2IC5A 2DTXA 2BGMA 3CZ9A 1DUIA 4A91A 1PZHA 4FIDA 3L82B 3V8QA 2ZSIA 3T9DA 4MKRA 3HZOA 1NX9A 3DFFA 2CKMA 1UEXC 5D3KA 4PZDA 1KI6A 1H93A 5FEMA 5D51S 4MVJF 1ADYA 1I2CA 1E2QA 3IODA 3KALA 4MP3A 2H48A 3IDAA 5A5EA 1D4AA 1N5OX 4ZOLA 4H31A 1Q44A 1MW9X 1X15A 2POCA 1VSBA 3UMBA 4YMGA 3BHNA 4AJJA 3OZRA 3FPGA 1G5RA 4GYJA 5F7OA 2GH1A 2YKGA 2ODBA 4XSVA 3T94A 3RTEA 1EJBA 5KYUA 1G21A 5HXAA 2Z6UA 4PXYA 1Y5NA 3KUXA 4ACBA 5AUOB 4PSVA 5EXDA 3NHJA 4QIHA 5HHTA 3E3LA 3MCUA 3QMVA 1RJDA 2PQ2A 3CPEA 3SICE 1VTKA 4DXDA 5JH7F 2PMCA 1JMYA 4FD2A 1JQJC 2DWPA 3SEZA 4YV7A 4BDSA 4ODIA 3G88A 4HEHA 1UXHA 4ENTA 1PT7A 4PPFA 3L77A 5FRDA 1I2AA 3O1IC 4ER6A 4BMDA 5A5DA 1ICIA 2QUAA 2N42A 4XGKA 2LDXA 2E1PA 3T5CA 2HM7A 2HZ7A 2XKBA 5JD6A 5KQRA 4V1CI 3D2BA 1R5BA 2L18A 2JAPA 3NH9A 3OU2A 1IY2A 2FHSA 5E38A 1XEWY 2O2ZA 2DPGA 1W4RA 2V65A 4KR7A 4MCHA 5F4BA 2CHFA 2IPNA 4HO1X 3CU5A 3TSCA 3Q98A 2UU9B 3BT7A 1I33A 1FS5A 3ONNA 5IAJA 5AQ1A 1IPFA 3PHJA 3E1SA 1DUVG 1MNQA 1JQEA 3QXGA 1M54A 2GILA 1P1CA 2YINC 2Q27A 3ZWOA 3M6AA 3IAS1 1KJWA 2PZJA 3ESBA 5BNWA 1NDUA 5K8VA 1H0KA 3LBIA 4MV3A 4URYR 5BSTA 3OJFA 1R0KA 3R75A 3RC2A 3NHLA 1OVMA 4QYIA 1Y81A 2P9JA 5FPYA 3RBAA 1B41A 4MWTA 4MICA 3HCDA 4P3PA 2RGWA 1OVGA 4B6JA 4WOJA 2CJWA 1AZSC 2QTTA 4V39A 5F1YA 2PAFA 1J07A 2P4HX 3T52A 3TIVA 4F71A 4MWSA 3WWDA 3B1WA 1QHSA 1L5QA 2AK2A 4EPYA 1NNEA 3PI6A 1RZUA 3CH5A 3RRXA 3IKMB 4BRSA 5KPJA 2XSZD 2C58A 3M5DA 3S7ZA 1G1MA 1B26A 5ITZB 3K7EA 4A0RA 4IBOA 1L4BA 2H1RA 2Z58A 4PG7A 2Y9MB 3JRXA 1OFTA 1SCNE 3RVRA 3RSGA 3IAFA 1G59A 2RGDA 2Y71A 5DHAA 1H8HA 2OB2A 1Z45A 2N1MA 3RSOA 4B3BA 2LPMA 4D7AA 2QMUA 1JR3A 1LBQA 2QXUA 4GI1A 4KN6A 5G3YA 2H54A 3JQ8B 3ORRA 3OEEA 4LDPA 2GCEA 2I99A 2WMYA 4PE5B 1EVYA 4I5FA 3G1WA 1TU4A 4YRTA 4NFSA 2HDOA 1NUHA 1V1RB 2X8WA 1R6TA 3ZZ1A 1SVMA 1ZHHA 4JJEA 4RA6B 5A7GA 3QVGB 1VMEA 3QFSA 3AETB 4RZIA 5K3AA 4AY5A 2PMKA 5H82A 1ECFA 1P2TA 3IDFA 3L49A 4Q02A 3NDPA 2BZ1A 3I0NA 4Q7EA 2WJIA 3W34A 4MYCA 3OTGA 2FX5A 3PC6A 2IHZA 2XV1A 4FGWA 4AZSA 3NATA 1EDZA 3V7NA 3DHWC 3GGDA 1H4QA 4X8HA 2L42A 4P4GA 4Y7CA 1ISGA 1U8ZA 1N1MA 4Y6OA 4G5FA 2BUAA 2Z2IA 4H4CA 2Z56A 2HXSA 4L3VA 3SQDA 2VH1A 3HXMA 2W48A 1GHTA 1H22A 3DBHA 4CTOA 2X0KA 1X7YA 3ORSA 2JEYA 1V1MA 2C4NA 4KFCA 4F2GA 3T9FA 1YJ5A 3ZWXA 2IIQA 3FFAA 1HRKA 2YJZA 4HD8A 2B3TA 3AUJB 2DCMA 5FH9A 1TMYA 1Q22A 1MJNA 1V7QA 2D0IA 5C4MA 3VPAA 1KEZA 2CYAA 5ED0A 4B8ZA 3DBHB 3GUVA 3UK7A 2LWIA 4LSMA 3BQNB 2COKA 2QNRA 3I6BA 4MPRA 4R9NA 3VV3A 5G0VA 3UMVA 4LDQA 1SBNE 2Y9PB 1DX6A 4C4XA 5HRCA 3WLAA 2DPYA 1WCIA 2YW2A 2HPVA 4N0MA 1RHKA 1RSZA 5ALDA 5JU6A 1OWNA 4JN6B 5KVAA 3PC8C 2RI0A 5GAJA 5KYKA 1DEHA 3L1UA 3O8QA 2ZAOA 1JJBA 4PZLA 4HQRA 5EZQA 5ADWA 3KUUA 3DEKA 1KZYC 4QJIA 2YXDA 3DM9B 5EE3A 1ST3A 1Z28A 2ZYUX 2ZVQX 4FXOA 4EG1A 3LTNC 1BOOA 4Z51A 2PSDA 2X41A 3FCCA 3LT5A 4ZI2A 1U0BB 3H1BA 3LF1A 1JLLA 4RA6A 4B2LA 4P0PB 2QN6A 4UDNA 3TSYA 5BRNA 3RTAA 5KWVA 5DE3A 2ORVA 3M6XA 3S2EA 2XVYA 3PX3A 1AXEA 3C1AA 4DLUA 4ZI3A 2JI8A 4Y9SA 3ICWA 1H3EA 1EESA 3CMCO 4G4SP 3ZD8A 4BCDA 1E9AA 1EGHA 3FR7A 2B9EA 1XRMA 1GRQA 1VYUA 5DOVA 4EX7A 2BY4A 3DFKA 4CIAA 3ASYA 3U3XA 3ZBQA 3D3KA 2QV0A 1CYDA 3KSAC 2FLVA 1VL5A 4FYJA 3M3PA 1WVIA 4LRXA 1GTSA 4TUYB 3NAQA 4ZZ1A 5ALJA 2JNWA 5BV7A 1E3IA 1KS9A 1MC5A 4PX2A 3OEHD 3ISTA 1KZ7B 3TECE 3CJRA 4D3FA 4M89A 2QRJA 3HZHA 3G17A 1NQ5A 1DKUA 1TZJA 4FJ2A 4MQEA 3GFBA 4W9MC 2ZUUA 2FEWB 2CDAA 5FUVA 1N7HA 3H0KA 3I1IA 3KZNA 2RGYA 4B7XA 3IB3A 2ORYA 2PJUA 4R3UC 3FG9A 1GQRA 1Q21A 1XCPA 3JD0A 2EARA 1LRLA 2AB0A 1GPBA 3E5RA 4HHEA 4M8LA 4GZLA 5BN1A 3CLUD 4J43A 4HRVA 3NFYA 4IHQA 2FPIB 4O4IB 3ZKAA 3TW8B 2YWGA 3CRNA 2VNHA 1R27A 1F7VA 2G4VA 2Q5EA 3GIWA 1LVGA 2X4LA 2R4TA 4L3WA 4MAMA 1D6SA 4E2XA 1DI0A 1BZYA 5ENVA 4ZJYA 2JLUA 4RTJA 1NNUA 4ZZIA 1HDEA 5FOQA 3ZBUA 1JR3E 3JQAB 2BMVA 2EF1A 3LDHA 3L84A 3P5SA 1IVSA 4A10A 2WVGA 2FG5A 3HI4A 2P6UA 4FCVA 5EQDA 4XA8A 2X5KO 4TZTA 1AK2A 3CR8A 4QOEA 1I7SB 3TAUA 1C81A 3VR5A 1Z0SA 4G1CA 1XKQA 2LCIA 4P8RA 3MWJA 1UBMS 4KXYA 5EUCA 1UXJA 1W29A 1Z6GA 2D4AA 3LXMA 1T4BA 2IIBA 5HBRA 2KHZA 3GX1A 5JDCC 3ANTA 3UW1A 4LYEA 2WUWE 4HDSB 3WGHA 3SQLA 1Z2NX 1ZRMA 1T5IA 2OV8A 2XWJI 3LLSA 4Z9YA 1QRRA 2FF7A 3KVOA 5K0NA 4BX0A 1HT2E 1QG6A 2PGNA 3ESXA 3K31A 3TOZA 4DKJA 2CBXA 2NZ2A 4U6NA 1YULA 2HGZA 3GP8A 4GOND 4X97A 5F4ZA 4NPHA 3C8HA 5T3UA 3NTQA 2XQVA 4I8DA 1ZX1A 4DDMA 1G21B 5HKAA 2IYFA 5FOWA 2WVAA 1NW6A 3ZXSA 2H65A 4DGSA 1I3LA 3CNNA 1A9SA 3NRCA 1C4WA 1W48A 3F74A 3GUUA 1T3LA 3LFHA 4PLZA 4YJHB 1E2EA 1QV6A 2FPRA 3FTQA 3HE3A 5AKHA 4ESHA 3EVNA 2PUGA 4TZKA 1M8FA 2YBDA 3TOXA 4GP6A 4DA8A 5B2FA 1HL7A 2CXQA 4DZZA 4E03A 4BX3A 5B53A 4RPIA 4XGIA 1G8KA 1X8JA 2H2AA 5SYAA 2NP7A 5KOYA 1L7BA 1N5RA 2PKRA 1PW7A 2QM8A 3FUVA 5HJ2A 3RF6A 3PRYA 3N05A 1V8PA 2FMXA 3GDOA 5DWQA 4RHTA 2E4VA 3L8CA 4Q3CA 1WW2A 3LT0A 3PK0A 4WXHA 3FNEA 2HFKA 4RGBA 1U5BB 1G8PA 2WTBA 3NOVA 3NALA 2CBGA 4KMSA 3T9BA 2GHIA 1E4OA 1MA0A 4TMXA 2P9TA 5KYGA 2O59A 2AMJA 3AYZB 3SIXA 2X2FA 1HE4A 3JQGB 1DFGA 2OHFA 3H83A 4Y98A 3IQXA 1WUIS 5I9MA 5M7EA 1BRTA 4JT9A 3OLYA 1OX4A 1WQ4A 1ZHOA 1R0SA 3LLUA 4EY5A 2XE4A 1EUDA 4GZ6A 1QGDA 1Z75A 4K3VA 3IALA 3MTIA 4RZUA 1MJHA 2F48A 1TKAA 2FSUA 2DFTA 2EG9A 2P3OA 2PX6A 5B5SA 4ZVNA 4JEIA 3P9QA 4PWZA 4QXQA 1R4NA 4M36A 1EBUA 1HI9A 3PGMA 4HTAA 3C7KA 4LTNA 4YALA 3WQSB 2WPDA 5B3JC 4FGUA 3CTPA 3VU0A 1FFXB 1ZZEA 2PS3A 2PZGA 3BWCA 3KVVA 3W8DA 1U9JA 3GUCA 1TEVA 4H7EA 4FUTA 5DX1A 1BMQA 3FGNA 1N33B 3AVQA 3E9RA 5EWLA 4V0KA 1H8HD 5B4VA 2I29A 4PLHA 2E4WA 1EH5A 3IP1A 4W1PA 1ODLA 4HGQA 4KSBA 3T4XA 5EHGA 3L8ZA 4D74A 4BFXA 2OBFA 1NBME 3AHGA 2CEKA 4Q4LA 4M0UA 1YV9A 4RS4A 4MPJA 5GZ6A 2CDNA 1VJ5A 2BOVA 4QOGA 1SCUA 2D0OB 2IBSA 4Y2UA 1LPMA 1SA0A 1TKBA 1LQUA 5AW7A 2J6BA 3GZJA 2LD4A 3WWZA 2G88A 4LJ8A 1R74A 3AEQB 2G17A 1QYVA 4MKZA 1N2EA 1L3CA 2QMQA 3CR7A 1BAPA 3HP4A 4FYHA 3JZMA 4JK3A 2NV0A 3TDNA 2ECQA 2FSVC 3O7MA 1XEXB 2O1EA 1BOFA 2ZSAA 4RKRA 4EB3A 2DBYA 1YB1A 5JLJA 3AY7A 5AW0A 4E4TA 5EMJA 1YVDA 2LW7A 3C5VA 4BLTA 1LPAB 1USIA 2Q3JA 1UWKA 3Q5DA 1NC1A 4MPDA 5GMOA 5BN3B 2DG2A 3TJZA 1BHQ1 3AFHA 4UULA 3IEUA 4AJHA 3FHTA 1MZPA 5LYJB 4YMUA 2A0XA 2XNSA 5LLDA 1UEIA 1J7KA 3DLIA 3JCZA 4XPIB 4D97A 2A5YB 1DOAA 4C6RA 3SYKA 2PU7A 3UJ9A 2VF8A 3PGA1 3PHBE 4Q3AA 1LTQA 2I2FA 2D74A 2JFZA 1RADA 2XGGA 4FN4A 1NOJA 4Y1EA 4EMTA 3QX9A 5CBKA 5I01A 1B43A 2OC4A 2WIAA 2XODA 4IDPA 4FYKA 2CHEA 4UFOA 1JNYA 5EE1A 1U7DA 3H87A 3UZUA 3VHQA 4EK9A 5LMNB 5LB2A 3QXCA 1W5EA 2OILA 2RB4A 3PQFA 3I3SR 5FLKA 1IZ9A 3DTTA 4JFAA 1P7VA 3I9V6 1TTTA 2VDQB 3RT1A 5K03A 1K27A 1VYVA 4C3ZA 5C1DA 1TKRA 1OKKD 2E18A 5H16A 4XCQA 3DOJA 2WD7B 3DOIA 1RAEA 1E98A 1VP3A 5FXMA 3PPXA 1ARZA 4QDUA 2DXIA 5E1BA 2AT1A 4W7HA 1AKMA 3ZLTA 4LGCA 2HT1A 3AKZA 5DWVA 4TUYF 2BEVA 4ZYTA 1CVRA 3U3RA 5LWQA 3KETA 3A4YA 5JO9A 2MINB 4MVCA 3TX6A 4WZAE 4BLSA 3TM5A 3EB9A 4LAFA 2XNCA 1IHOA 4DA4A 3AJAA 3EZ7A 4J3FA 4FNOA 3ZDQA 1QO0A 2XCRB 1RE0A 5FQNA 3SXJA 1IQUA 1JP7A 1HKHA 2PZBA 4X8OA 3WLTA 1UPTA 5H9VA 3W90A 2X1MA 4B3DA 2WAXA 4R98A 2E9SA 1CZKA 3EPHA 5ANRB 4WINA 1ZWKA 1ODSA 3HMQA 2IA5A 1AOXA 3LSYA 4CU5A 2Q5FA 1EGVB 4PHGA 3FSJX 5FOUA 4X3CA 2PX8A 2ODAA 4AULA 2P9ZA 4KVAA 4AMUA 5CX4A 1YRLA 1F2DA 2WWRA 4R41A 3F90A 3RU7A 4JWTA 2QRHA 3SHWA 1EFVA 3WJ2A 5C1IA 2CDRA 2ZB8A 3KJXA 3PCTA 4LUCA 3FTPA 1BDJA 4DRXA 3BD6A 5JSZB 1EP3B 1WCIB 5KWSA 4NK4A 4YAEA 1K3TA 3M9WA 4JXKA 4TV8B 5AI4A 4YRCA 1BD4A 1ZMBA 1CRWG 2UVPB 4HH3C 5F2OA 4DEYA 5A1JA 1B3BA 1CUIA 2HV8A 5H02A 4QGHA 2GVZC 3ENQA 2CKDA 3ND9A 1KO7A 2DYKA 4O08A 3LSTA 5CNKA 1ULTA 1CIVA 1L7EA 1V11B 2FOIA 4R31A 1T4GA 1BS9A 3ZUGA 1JL3A 1Y3BE 3F7OA 4XVHA 1YS6A 1MXHA 1SVNA 2YDXA 1G2IA 3BMOA 1B6TA 1T6ZA 2XRMA 3FBTA 3N2GB 9MHTA 2C2XA 2GO1A 3RK4A 3PXCX 4LRTB 1K5DA 1P7PA 3I92A 4IOJA 3DAHA 3PGVA 4WBXC 2ZQYA 2DTEA 3FDXA 3OMWA 4D45A 1WMBA 4Q7JB 2F6RA 4UUAA 2AZTA 2O0LA 3CA8A 4HSEA 4ZT6A 1F2TA 4K6FA 4IXWA 4D4KA 1ZNQO 5T4FA 5KYYB 4ZTZB 4CLRA 3HY4A 2EHJA 1JLLB 3GAMA 3WLKX 4DDKA 4HP8A 2M98A 1CK4A 3BRSA 1S9HA 3BXOA 4LFBB 1H2ZA 4MB0A 1GPAA 5C8ZA 1IBLB 2Z8YM 2HNKA 1N2CA 3BICA 5SZIA 1Z56C 3E2MA 4BV2A 4ZQCB 4EZEA 1CQIA 1JEQB 3DMFA 2FQYA 3R7DA 4MGKR 3FKJA 1UODA 2IY9A 4KQ1A 1KYVA 4TSRA 4YQEA 4YRZA 2C94A 3EMKA 2PRSA 4YDHB 3OE7A 2QRNA 1OWPA 4QUHA 4JBGA 3A05A 5KMGB 5KZMB 1FU4A 1UJ4A 3QXXA 3G0DA 3CNEA 3EG5A 3VXKA 1AG9A 2VTDA 3E48A 3Q8MA 5CLFA 4TLBA 2AUTA 5KAPA 1AZLA 1A82A 1MCZA 4MIOA 5DSZA 4CKEB 4E30A 1QLHA 4DLXA 3Q7RA 3QOXA 3E1GA 3R3UA 3ZLBA 2IYXA 2XQGA 1Q92A 1X87A 2DFPA 4AO7A 2NUAB 4IX1A 3R74A 4M1QA 5HSGA 2JCGA 1SWVA 2PR7A 3F7MA 4OU4A 4GE3A 1Q19A 2NYAA 2QJOA 4RK4A 1QKIA 4X7RA 4OHFA 4Y8VA 4E15A 5JAUA 3R3HA 5LIPA 4B79A 5M2QA 4NCNA 3T1HB 1GJRA 1O77A 3G2LA 2B3DA 5DP2A 3UHJA 1SZCA 1X1RA 3PLRA 4JLSA 4A15A 2G09A 3QGMA 5HQ3A 1QK4A 3IBGA 4RDHA 3TLGA 1YR2A 4B71A 1BA3A 1VFPA 4Q4HB 4EVQA 1U0FA 2F1RA 4GGOA 3FVWA 1TJ4A 3LIIA 3QHQA 1KVUA 3H16A 3WKCA 3HUEA 2PGIA 2WFAA 4WOBA 4KTVE 4KX5A 4AU1A 1EG7A 5DV9A 2LKCA 3NBFA 2O8FB 4ON9A 2HK9A 2ZSUA 2R3SA 1GAXA 4I55A 1MQ8B 4JR0A 3D6UA 4KK4A 1KMNA 3QKWA 4PLVA 3U3MA 5KREA 3E15A 3L92A 3EEQA 1L7VC 5B2EA 3DW1X 3ZWMA 3EXEA 3U7JA 2R87A 2VT3A 1CUHA 1ZJ6A 4QYXA 3FMOB 5CPFA 3REQB 3ILHA 5DNCA 1MV5A 3LUPA 4CG2A 4DLNA 1TJNA 1X3LA 4U6QA 5E2BA 4B75A 3WL7A 1T1IA 2QTGA 4F3KA 3O38A 3OT1A 3I8OA 5LOVB 3GJ4A 3L93A 5DBOA 1M72A 3JQ9C 3M3DA 1AS3A 2EV9A 2VEOA 1KJ8A 4XDYA 1IFXA 1PKEA 1RXYA 3KTOA 4MRNA 3TS1A 2LCFA 5ECYA 2MMGA 1FRNA 3RYIB 1Y3AA 4BFLA 1E60A 1H2BA 1VG1A 3BULA 4UPEA 1JB9A 1FJ2A 1Y5RA 1Q7CA 5CLIA 3FZGA 4D0SA 2IUTA 1U63A 3K9GA 3D64A 4EKNB 8MHTA 4G1BA 1E66A 5JBQA 2RKOA 3KZKA 2AL7A 2RHBA 4E46A 5E4TA 1M1NA 1DWQA 3IV6A 4NTZA 1GN9A 3RNLA 3ZHSA 1RLIA 3LVRE 4IIYA 1FUYB 2XZOA 1JAYA 4N5DA 4ZZ0A 2JI4A 3GT7A 4BVGA 3CB4A 4EYSA 1JHUA 3H2BA 5C3MA 2VAPA 1IL0A 2JFXA 1EA7A 1ZNWA 2F64A 2Q46A 1XAIA 5KTRA 2Q3CA 2J9RA 2OZEA 1KI4A 1U8XX 4FEEA 4UM7A 4XDHA 2YY7A 4J3NA 3ZW9A 5EWMA 5KYUB 4OCZA 3TQHA 3DE7X 4N03A 4ZJUA 4DLKA 1EDDA 4FN5A 1AV7A 2GEBA 3HDGA 4WY2A 3D5QA 4IICA 1J70A 1N0IA 1BVUA 2PD3A 3TK1A 3I42A 1RAGA 2O2GA 5G1NA 3CINA 3PDCA 1YRHA 3FGZA 3UEOA 2OXCA 3L0IB 3BIJA 4RDCA 4RLSA 2ZS7A 3WYEA 2EX1A 3KTAB 4QSHA 3ER9A 2CN1A 2J8ZA 3ZV6A 1NXOA 3SOPA 4RQUA 3SC2A 4CQMD 1E2BA 2WFMA 1JX6A 1OX4B 2XEDA 1ST2A 2ZSEA 4TMZA 3RVNA 2NZYA 5CAEA 3PFNA 2JH8A 2Q21A 2WSYB 2XMQA 1ZH4A 2PTGA 4MR7B 4ETNA 2E21A 2AFHA 4L0QA 1ZKDA 3QVJA 1ZU5A 4MR9B 1SU6A 5DM60 1L4HA 4XX0B 4GL2A 1S1MA 1ORVA 3A9UA 1GKYA 1JMKC 4Y6QA 1Z0JA 4Q66C 1OC2A 4QEKA 4YLGA 4X1IA 5IM5A 5T4BA 1I4OA 5CT5A 5LDHA 4NQZA 1EX7A 3LYUA 1TAGA 5BWCA 3DPUA 2BKVA 3CBQA 1MORA 1XHEA 4F8YA 3HKCA 2EW8A 3KAQA 4G9BA 2XBLA 1PLJA 1VJRA 1E1CA 1VKJA 3REOA 3GRAA 1X1TA 5CJJA 5HM8A 2F8TA 3KUKA 4YFVA 1MRSA 2UZAA 4JHXA 4PZEA 2WJVA 3C1UA 1UWLA 2XVZA 4M1SA 4WOCA 2NO7A 4LRSB 4XTCS 1VXOA 2FI1A 4DIEA 4TS9A 4DSOA 1ZWLA 4D9NA 1NM5A 5JNLA 3BXXA 1QQBA 3P2KA 4I1SA 4QOSA 3DVRX 5FPSA 1DGQA 3LC2O 3OPQA 2BEWA 421PA 1ULZA 1ESMA 2BP7B 5E6SA 2ETXA 2GXUA 2W6QA 2XNKA 3T0IA 1WU7A 4PSKA 3P9CA 3PXGA 3U3KA 1WKVA 4X65B 3SQXA 3EY4A 3N39C 2YUTA 1T25A 2VVTA 2W58A 4B1FA 5THKA 2ONCA 4LI3X 5LQUA 4FFNA 3VC3A 2D1YA 4P4SA 3OC6A 2B8WA 4BNXA 2GM9A 1SCDA 3IX7A 2IEDA 1KRHA 2EW1A 1T2NA 3G7UA 1W76A 1Y1QA 4NZ9A 1XELA 4U9HS 5BPFA 4AZVA 3IPCA 4MWZA 3GUZA 1AB6A 1I3NA 2FZEA 3HYCA 1C4KA 1F8UA 2H4XA 2OHIA 3HWWA 3KJZA 4YIKA 3OECA 2BUBA 5A3VA 2R4UA 2AHOA 2EZUA 3BCHA 3LPAA 5IT9A 1U5CA 5TVKA 1WHTB 1PZMA 3LQFA 1W36C 3GNQA 1U1GA 3QYJA 2IEYA 5LUAA 1QOZA 1T5BA 1GGVA 2FPKA 1X19A 2Z5GA 5ALQA 4N3NA 3MT7A 4MRMA 1L5ZA 2QYHA 4PC7A 3THRA 2JCYA 3WLSA 3KEMA 4CIDA 4B48A 4DCUA 4AG6A 2XTJA 3WSVA 3Q3CA 2P9EA 1ZNZA 2QZZA 3Q88A 4YA6A 3V7UA 5LSAA 4YJFA 1HL3A 1L5KA 1UH5A 5CDSA 1FDRA 5FWDA 3HXQA 3WLIA 2I9KA 3ZQ6A 4B87A 4ZDIA 5ITSA 5A7HA 1FL9A 4QYTA 4JI0B 2CB9A 1JHZA 2QLBA 1N57A 2BW0A 2HBQA 1YJQA 1D0VA 1J0CA 5I5GA 2AQKA 1IC6A 1CY6A 3MBOA 5K7SA 2Q4BA 4OA5A 1T6BY 3LYAA 3C3EA 1UBKS 1GFSA 1KYWA 4IWXA 1COWA 1IHYA 4OJYA 1T2FA 1QPGA 1YC2A 1QCZA 1N3IA 1UK8A 1YRBA 4DCSA 2IW3A 3R20A 3L5KA 4KR2A 1NXVA 3EUAA 1TC2A 2J30A 1FJHA 3GVCA 5FO1A 2WTAA 6AT1A 5IM4F 3IUJA 3K73O 5H5JA 3BD7A 4XIFA 3T7EA 1X1AA 3RVOA 3IP5A 1Z25A 3S1LA 3ENVA 5TQVA 1P17A 4IJWA 2IY7A 4NQRA 4DSUA 2OCYC 4TMWA 3IUNA 2B2XA 3DZ8A 4I5EA 4EF6A 2HA5A 5IAOA 4EL0A 7MDHA 1Y98A 4D0RA 5JIBA 2AA3A 4CTNA 1OFIA 4FTWA 5G2OA 1S3IA 2RB5A 3QV2A 1W5FA 2QX7A 3F98A 3KR0A 2C31A 4Q37A 1KL7A 4H1UA 1ZPDA 4QOFA 4WT7A 4Z7OB 5C4IA 4GX1A 4C7XA 3DZIA 2QLFA 4HUQA 2K6GA 4M88A 1B1CA 4B7UA 4N47A 2UYOA 2OBYA 2MOKA 4H7HA 3PC7A 4INPA 4PQEA 2G5CA 3BRCA 3QZUA 5KNDD 4MA4A 2XZLA 3G13A 3TN7A 1IK4A 1VE3A 2ZUVA 1QIMA 4HFJA 1PJTA 2PUHA 3DSRA 1PFGA 2HBYA 3ZLUA 2DM6A 1WV1A 3RFXA 4DVGA 3P2JA 1K8QA 4JQCA 1FIUA 3U81A 1EK2A 5FAXA 2WJZB 1KSGA 2O2CA 4JMPA 4DMKA 4BATA 4ZCPA 2R7KA 1TJPB 2BFBA 4JGBA 3AX6A 1PR4A 1SRRA 4KLZA 4QQKA 3R9KA 3CJTA 5BSEA 5IBPA 3CVXA 3N2KB 4DLPA 5BT9A 1SCQA 2FZ4A 1E9DA 1FTGA 3DYIA 1ZIOA 2FAXA 1GV1A 1QAOA 2J9FA 2ZULA 5DWDA 2PWYA 1L8QA 2A88A 3G9UA 4D6PA 3LS2A 4UW9A 2VPZA 4JY7A 2HU7A 4OQZA 2NVOA 1LQ2A 2R1ZA 3V42A 3ZHZA 4ZT2A 2F43B 1Y9EA 1SHJA 4C9BA 5LYJF 4RJLA 3NHKA 4TM8A 3BGDA 4AKEA 1JVBA 4PYQA 2XYHA 6YASA 2Z2JA 5JNWA 4OMCA 4I14A 3FWHA 4D9CA 3ELDA 2UDPA 2R7LA 5K0ZA 2OT3B 3BCSA 4ZKDA 4S1WA 6NULA 1ESDA 4DAEA 4DDVA 1DADA 5MF6A 4NC9A 2AW3A 5DW0A 4EJ0A 2VRNA 1I0ZA 1L0BA 2HCTA 4C01A 1G3RA 4C4ZA 3PPVA 5HX7A 4ZCMA 1S2LA 1DBRA 5SV2A 2ZR7A 2PD4A 3EVCA 3K1AA 4LBYA 4GI2A 3E9CA 1PGOA 2WSBA 1YL5A 3QEJA 3AOGA 2FJUA 4NY1A 1S02A 1QWOA 4NU5A 4WBSA 2XVMA 5HZHA 1TJ3A 1JU9A 4J07A 2F55A 2NO1A 1C9JA 1PR9A 4KR0A 2Z4SA 5B1YA 4CZ2A 3PNOA 4K8OA 2D3TA 4QDXA 1BU8A 1E79D 3GMIA 3NVDA 3IP8A 4J1SA 3RO7A 2W2MA 5KTOA 2EL7A 3FJYA 3BGVA 3KWLA 1CT9A 2NO0A 4Z0NA 4QAJA 3AHDA 1G1AA 3A6GA 1O4WA 3ILSA 1RZ3A 2ZG6A 1NUQA 5CFOA 3NHBA 4DLLA 1FE8A 3UPTA 3GJ6A 4E1BA 1CEQA 1IY9A 2VAXA 2Q4OA 4WK4B 4XYGA 1JIUA 5FORA 3O3CA 3V34A 4CLRB 2DFNA 3O90A 5IU6A 3CCFA 3JQRA 1M6NA 1RYEA 4I6JA 4LXTA 2WYUA 4GX5A 4S0ZA 1MJ5A 3VJLA 1I7DA 2CW5A 4V0ME 1FPMA 5CURA 4KHZA 4OJNA 4HFRA 5CA0F 3HH8A 4WLVA 3ZNQA 5IVKA 3NU1A 4RX1A 5HKLA 1NWCA 3P97A 4A23A 2I91A 1CB0A 4ER3A 3WXBA 2TYSB 3T61A 1N7JA 3WG9A 4TWJA 2BFCA 4R5MA 2X4GA 4XDZA 1HMPA 1WHSA 2VFAA 3EZYA 1DKOA 2FGKA 3IRVA 3L0SA 1UUFA 3NTLA 4WXEA 3W5CA 2B2NA 3PYLA 4TMTA 4KFRA 1ISPA 5HR5A 1XMOB 3RDPA 2BGWA 1PV4A 5DHRA 2MHCA 4YRPA 1UBEA 2BCJQ 4IHJF 4GLFA 4OHPA 2PVPA 1LS1A 3HO6A 4RVGA 2VHWA 3H11A 3RROA 2O7VA 3E70C 4QPCA 3O4GA 1YIAA 4JB8A 4B9EA 3BJMA 5JQGA 4RIEA 3DONA 1AX9A 4IJ6A 3R0IA 1NTOA 1RC0A 2FV8A 2UZ3A 1M2OB