5K1ZA

Joint x-ray/neutron structure of mtan complex with p-clph-thio-dadme-imma
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
229
structure length
229
Chain Sequence
QKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neutron structures of the Helicobacter pylori 5'-methylthioadenosine nucleosidase highlight proton sharing and protonation states.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords Aminodeoxyfutalosine nucleosidase
total genus 81
structure length 229
sequence length 229
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k1zA00
1YQQA 2A0YA 3NM6B 3UAXA 1SD1A 4FFSA 4DA6A 1YRYE 3LGSA 4G8JA 5EPUA 1SQ6A 4DAEA 3MMSA 2P4SA 5DK6A 4YNBA 4F3KA 2B94A 3OF3A 4LNHA 1NC3A 4F2WA 1U1DA 1T8WA 3O6VA 2PGAA 4JOSA 3IEXA 1U1GA 1JYSA 1SD2A 1U1FA 1B8OA 3C74A 2ON6A 4I2VA 4OJTA 2RJ3A 4MARA 3INYA 1V48A 1U1CA 1PK7A 2AI2A 4NS1A 3KVVA 2QDKA 2OC9A 3DJFA 3FNQA 1LVUA 1RT9A 4EB8A 3K8OE 3QPBA 4GLFA 4LZWA 4TS3A 3ODGA 5F7OA 1OVGA 2I8AA 5C80A 4G41A 3OZBA 1ECPA 2AI3A 4D8VA 2QSUA 4WKNA 1JDTA 4DANA 3PHCA 4QEZA 5JPCA 3OCCA 1ODIA 1VMKA 1C3XA 1Z35A 1YR3A 4GLJA 4D98A 1OTYA 3LA8A 1A9PA 3EMVA 3KUKA 1VFNA 4R2WA 1PR4A 4BMYA 4D8XA 4LKRA 2H8GA 4F2PA 3GGSA 5CCDA 1ZOSA 1N3IA 3KU4A 4M3NA 3KHSA 1VHWA 3PNPA 2Q7OE 2AC7A 4BMXA 4TXNA 2HWUA 1PK9A 1ZL2A 1Y6RA 3UAWA 3NM4A 4YMLA 3NBQA 5EUBA 4F3CA 1RXYA 5B7NA 4DARA 3ENZA 1YBFA 1Y1RA 1JDSA 4DAOA 5F73A 3UAYA 1PR5A 1TCUA 4TXMA 3ONVA 3BGSA 5CXSA 5CYFA 3DF9A 2HRDA 4TXHA 4NSNA 1JE0A 1PR1A 3UT6A 5B7QA 4LDNA 1G2OA 2QTTA 5B7GA 3SCZA 4NY1A 4K6OA 1ULAA 1V3QE 4M7WA 4R2XA 4EARA 4QASA 1PBNA 2A0WA 2A0XA 3LBAA 1A9TA 3BJEA 1Z33A 1K27A 1M73E 1RYZA 4BMZA 4QAQA 1OUMA 1T0UA 4RJ2A 4X24A 4TXJA 4P54A 1Z38A 4TTAA 1Z36A 3T94A 3PNSA 4TYMA 1OTXA 3BSFA 4ECEA 5KB3A 1ODJA 5F78A 4IP0A 1JP7A 3TL6A 4QATA 1T8SA 4DA0A 1T8RA 1JDVA 4OGKA 4YJKA 4OF4A 3OPVA 2HN9A 3BL6A 4TTIA 1I80A 1PR0A 5I3CA 2AI1A 1A9QA 1RCTE 1K9SA 2QTGA 1PKEA 5IU6A 1PR2A 1Y1QA 3DP9A 1RSZA 4KN5A 4TTJA 3UAZA 4TXLA 1CG6A 1OU4A 1JDZA 4UC0A 4PNPA 4L0MA 1RXCA 2OXFA 4L5CA 5CXQA 1A69A 1ULBA 4GMHA 3UAVA 1JE1A 2HSWA 3FUCA 1U1EA 3OOHA 4TS9A 3F8WA 1Z37A 3OZCA 1RR6A 1ODLA 1Z5NA 1RFGE 4OY3A 1TGVA 1Z39A 3P0FA 1A9RA 4OGLA 5CYGA 1PR6A 1RXSA 1PWYE 4L5YA 4DABA 4U2KA 1JPVA 4DA8A 4PR3A 3MB8A 3K8QA 3IOMA 3E9ZA 2OECA 3FAZA 4JWTA 4QFBA 3OOEA 3FOWA 2OC4A 5CCEA 1Y1SA 1OV6A 1VHJA 3EUEA 4D8YA 4R31A 4L5AA 1NC1A 4DA7A 1Y1TA 5K1ZA 3PHBE 4GKAA 3E9RA 5F7XA 3U40A 1PW7A 2GUWA 4D9HA 1Q1GA 1NW4A 1TCVA 3KVRA 3EEIA 3DDOA 4BN0A 5F7JA 1PF7E 5F76A 3E0QA 1V2HE 1QE5A 2ISCA 1SJ9A 2A8YA 1YQUA 1LV8A 1Z5OA 1K3FA 1TD1A 4OEHA 4JP5A 1Z5PA 1B8NA 5IFKA 1V41E 4L6IA 1WTAA 1A9OA 1TGYA 1ODKA 4LNAA 2XRFA 4F1WA 1CB0A 4WKPA 1JDUA 1Z34A 4MCIA 3O4VA 1T8YA 5F7ZA 4WKBA 1FXUA 2IQ5A 1A9SA 5ETJA 3FB1A 4E1VA 3FWPA 3GB9A 3OZDA 4G89A 2BSXA 2QPLA 5B7PA 4WKCA 5FAKA 5F77A 1V4NA 1V45E 5EFOA 4YO8A 3NM5A 4MCHA 4QARA 4M1EA 3DPSA 3D1VA 1Y6QA 1XE3A 2I4TA 1LX7A 1RXUA 3KVYA 3OZEA 4H1TA 3P0EA 4WKOA 3EUFA
chains in the Genus database with same CATH superfamily
1YL5A 2ZFUA 1YQQA 2ZZKA 3KUDA 2JFFA 3JD2A 4XPIA 5P8WA 5LKAA 3BD7A 4FFSA 2YR0A 1QAMA 4F0JA 1V11A 3JSAA 3LYHA 1IJBA 1S8FA 4DA6A 4P5DA 4DSAA 3RT1A 4HNTA 5EPUA 5ARDA 5E6UB 3FNRA 3AKCA 4JZYA 4C7MA 4MUXA 1GPLA 3P9NA 3KQNA 5DTQA 1SUSA 4ZQEA 1BG6A 3GJQA 5DHUA 5K0ZA 5KJCA 2FW7A 3NWBA 4MUMA 3HN2A 2R96A 2Z4RA 4BQRA 4ZYXA 2P78A 1PHRA 1V6CA 1WL8A 3D81A 3DJYA 1TUBA 5JY6A 5AXCA 3UT5A 1ULZA 3ZLTA 2IHBA 2R1VA 1P0MA 4QAJA 2RDMA 3LO8A 3PHHA 5LL6P 3PXGA 3K2BA 1G1MA 1VKNA 3N0RA 5FPQA 4DZTA 2AIRA 3CXUA 5T8KC 2IWRA 3LRTA 2O2SA 5FP0A 4FYIA 1FYXA 2LCFA 1AA6A 1M2OA 3CLUD 2VOEA 4C29A 5BQOA 3UATA 4IWXA 1RQXA 1V1RB 3A04A 3SJAA 4BNVA 4XYMA 5HJ5A 2O3JA 4KLNA 4QGHA 4DC9A 1CZHA 5F5NA 3AJEA 3QRWA 4F5EA 5K0FA 5AP9A 1PSZA 2VTVA 1AKYA 2YMQA 4HI0E 1Y9JA 1Z17A 4X65B 1IUOA 4QOJA 5E2IA 3KB2A 2AD1A 4NZYA 4FDTA 2ADOA 3C3DA 1WKBA 1HE5A 5FAXA 4BNMA 4TM8A 1PI3A 3N2GA 3WA7A 1MA3A 3EARA 1KJQA 3ADOA 3D8TA 5EHIA 4CF5A 3PDIA 2GZRA 1WQ1R 2PSHA 3OCZA 4JVNA 4F9FA 2GA9A 4DR2B 4GECA 2W6JD 5HRAA 5F3WB 5IM4A 2CDCA 4U3JA 4YMVA 3MPUA 2XOEA 1U3UA 3FOBA 1XL0A 1RLJA 2X22A 4FT4A 1L3CA 4M9RA 3QF4B 4JMPA 1RYHA 3WTCA 5AESA 5HF8A 3CO0S 1LPBB 1C7EA 4KPUA 2A58A 3K8OE 1EXWA 5DNEA 2RE8A 2C83A 4PC3A 1DG9A 4G8CA 3WQHA 3ZCUA 2Z5GA 4IQ0A 3HKBB 1S96A 2HLNA 4DTCA 5J2UA 3NPAA 1E9EA 1EU1A 4CKCB 3O2SB 3ZDRA 2WSLA 4RGVA 4OP2A 5CA0A 2HSJA 5C80A 4BNWA 5IT5A 5CH8A 4DV3B 4O4JF 2Q2QA 2RHHA 1GG2A 3D4PA 5ICCA 2XMBA 1RU3A 4WW0A 3JQFA 3QEJA 4H35A 3HDJA 5FTLA 2I91A 3I52A 3V4ZA 3BDAA 4UHDA 1QIFA 3L7JA 1ZFNA 1VBKA 1U02A 2GDZA 4R01A 3BFPA 3ZY6A 4BJ3A 3PKJA 1TI7A 2F4NA 1ODIA 4D5GA 3ZGLA 4LBWA 3MAJA 3ZGXA 5JAUA 3H9JA 2JVIA 5IHPA 3L1VA 1GT6A 3C70A 3ZTTA 2R62A 3PIIA 3SR4A 3UANA 4GBED 2YW9A 3CVOA 3SSMA 2OCYC 1UOPA 1XEWX 3EEYA 5FD8A 1A9PA 3QOXA 3IBGA 3RRXA 3S2SA 1M83A 1XF9A 2IYAA 3KDAA 4ANFA 4AX8A 1XEXA 2QMQA 1USGA 1YR8A 2O3SA 1MTOA 1LX6A 1E3IA 1M6YA 4M0KA 2NGRA 4PLYA 5DTIA 2A3NA 2FSHA 1HKUA 1SKUA 2OVBA 4ND8A 3L49A 2QPTA 1VSUA 5B3JA 3S1AA 1CTQA 5D2CA 5KX5F 1V47A 1DG3A 3E8XA 3HV0A 1UDAA 4JBLA 1E20A 5H3CA 3RVDA 3DFUA 1NXOA 3NBMA 3LX6A 3VSAA 3I05A 3MGBA 1Z4JA 3O3NB 4HXEB 1OFTA 3F8SA 4D0LB 5DHPA 2DAPA 3HWX1 3ON5A 3O2QB 4HV4A 1TK9A 2A2ZA 2IYUA 1K89A 4RD0A 4P3OA 3ZYCA 2IU3A 5JE8A 1GR1A 2QRLA 3ZHCA 3IP1A 4LSMA 1DAMA 1EX7A 1N9ZA 4ALJA 4Q9AA 1IFXA 3OY2A 3ESCA 4NVRA 4RV4A 2VHZA 5KYKA 1NURA 1HRKA 2SHKA 4UQPA 3D6HA 3TQRA 2F43A 5ISMA 2F8MA 3RADC 3B78A 4NYMQ 3A6JA 3JQFC 4BO4A 3NV9A 4IFEA 3VZBA 3HVKA 4Z5XA 2QUHA 1M5RA 1YS6A 5EZYA 2J08A 1T1EA 2PUEA 4JLWA 1N0WA 4YT8A 3PXEA 2WTMA 5DEIA 1P4RA 1QKJA 3C4VA 3DE6X 5FA6A 1K66A 3LCJA 5F73A 4I50A 3OUUA 5AKIA 5JAMA 3WTBA 1H2HA 1HZZC 3THOA 5LPNA 2WZQA 5C8XA 3RYCB 2BHSA 2WHXA 2COKA 1BCRB 3D6TB 4LDPA 4B45A 1JLLB 2YHBA 3PUIA 3AM1A 2VH5R 1KP3A 1U81A 3PJRA 1H05A 2FX2A 4O4LB 3CZ9A 4OOEA 1HEIA 4J2TA 5HS6A 5BMVA 3IEUA 5BMVB 3N2YA 5ALLA 3PPIA 5TGZA 4NSNA 5E38A 5SYMA 1DJOA 3W4JA 3FWKA 1ISHA 3T4UA 3X2EA 1XVUA 2BCJQ 2VLIA 1EVKA 3FTEA 1WSBA 4B5LA 4DNPA 3IE0A 1TU0A 4WY8A 5EKSA 4OMCA 1EBFA 3PQ5A 1RKBA 5GVSA 4BNJA 5U4XA 1CJVC 4HQKA 1OC4A 3RHZA 4YMWA 5PGMA 4M7WA 1M34A 1WOYA 2H00A 5KJ1A 5JLJA 1ZJWA 3T3OA 4Y18A 1EK2A 3GGOA 3IX7A 5BT8A 5DWDA 3G5LA 2JBWA 4ZWNA 2IW3A 4KODA 1BVUA 5AIAA 1ZC4A 2VSQA 4UU0A 3I9NA 5BR7A 3U1VA 1IB0A 3EVBA 5DM4A 1R0CA 4QUAA 4XVRA 5K0SA 3DM9B 1ACLA 1WG8A 1E4EB 1QLWA 3CE6A 3PEVA 4D0GA 1B8VA 1J20A 3TJMA 1A4RA 4E12A 5BVGB 2GETA 2HCBA 1JBEA 1OUMA 4NNOA 1YS4A 4QAQA 5KTSA 1PYOA 1BS2A 5IBCA 2FJPA 3IQXA 4FMPA 1J7KA 1Z0SA 3OZGA 5C0OE 1X1QA 3TSAA 4BIIA 4GVLA 3U1TA 2J9GA 4FDLA 1E89A 3T94A 2ZBUA 2WJPA 1LQTA 1TM2A 1FLDA 3E70C 1CQPA 3NHPA 3U81A 3B52X 1AB5A 4H7PA 3RRMA 4FB5A 4XRRA 1ZD3A 3ZVMA 2P67A 3W2EA 2YNMD 3ITNA 3A9VA 2FF5A 3TL6A 4D4GA 1WEKA 3PLAE 1JG1A 1SIOA 2OKCA 3CGWA 2ILTA 3G23A 4XFDA 5FQOA 3ZDCA 4IH4A 4WZBB 1JQKA 1KI8A 2XA1A 2I76A 4LF4B 5JS6A 5IBPA 4KQXA 3MSCA 5KSPA 2P75A 4CHGA 2YYAA 3H5RA 3G2MA 2VZ8A 2MSNA 3FZYA 3QOYA 5JYCA 1P1HA 2D5IA 3B48A 2XB9A 5HIJA 1DKUA 1F2DA 4CODB 1RCTE 1K7FB 3ZWYA 3CNLA 3D54D 1LJ8A 2AR7A 3KEMA 2WHQA 3PQ4A 4ZP1A 3SDZA 2YHIB 3ZLBA 6LDHA 3R24A 1PKEA 3PRYA 4DSUA 1NVDA 2A84A 3DBHA 4U2EA 5AKHA 4HYQA 4X20B 4WNAA 1E3JA 3D8NA 3C5EA 2BTQA 5I8WA 2IH2A 1WA5A 1TAQA 3TH5A 4R1UA 5B1HA 2IDZA 4EIWA 3EH2A 5F9HA 4WDRA 4Q9HA 5LLTA 4IDPA 3HKBA 4RVSA 2G76A 4B17A 1UMCB 4UC0A 10MHA 1XRNA 4PNPA 3ASUA 2XNHA 4PPNA 4UTXA 3T5MA 3CHYA 4C0AC 3I04A 2Z43A 2XTNA 4L0MA 5CXQA 4QOEA 3TVTA 4DJAA 1GU7A 1DUIA 5HUHA 4JI6B 1L4MA 5AVOA 2GXSA 4BZZA 1JEYA 4UM7A 1XU9A 2XT6A 1MOPA 5J4HA 1FYVA 3ZE0B 3OZ7A 4E6EA 1KHHA 5AW1A 5BO5A 3EAFA 3NVAA 1KXJA 3BCUA 1RXIA 3OP1A 1YZYA 2EOAA 4M0PA 3TQSA 3WQRA 5AVVA 4NBTA 3IPRA 2A0FA 1B8PA 3TZHA 5KBYA 5BNFA 4EABA 5HVNA 4YV1A 2JIDA 4FCCA 4D43A 1CLEA 3ROXA 1SBIA 3F8WA 3OEWA 1VSBA 3OM0A 2BM8A 3FNIA 1T9KA 5J2TF 3FPHA 2AZDA 4EZIA 1WDKA 2HBQA 3NDIA 1F2TB 3HJBA 3OWHA 5DHAA 2C04A 1Z9BA 4I9NA 1SPBS 4UE3S 4Z9AA 5K8TA 2F55A 1YJBA 1H85A 2X77A 4PC2A 3VZPA 2AVDA 4B4UA 1TTPB 4PCLA 3MNFA 3SD7A 2C4WA 4H3SA 5B2ZA 1A9YA 4ZJPA 5G3ZA 5ADHA 3T52A 4FPXA 3NBKA 4P0PB 4CKEB 3NW9A 3OQHA 1P2BA 5JXGA 4NQZA 3FCUB 3Q8WA 3KL4A 1JLKA 5EESA 3ZW7A 4EG0A 2IW1A 1I9GA 4RV9A 4DDTA 1H4QA 4M8NE 4K03A 2MCFA 4ENTA 2REQA 3CYFA 3O8CA 4DBLE 3L7NA 3R76A 4J03A 3FHJA 3WL7A 4B7ZA 3I5YA 3SSOA 4KWTA 4NE7A 4BE9A 3NLLA 5I4CA 1T8TA 1H3FA 3EBOA 3GDGA 5TQ0A 2DY1A 4JI8B 3SIXA 3CTMA 2QG4A 3H1BA 2OG2A 5DP2A 5AYVA 1KZGB 3NEAA 5KQRA 2QTRA 5BN5B 1IZZA 2F43B 3SI7A 3W3AH 4K9RA 2AJLI 1KU6A 1P74A 2QMUA 1AK1A 2BGTA 1J0DA 1GPDG 2ZSKA 2A59A 1QFSA 3G68A 3OQPA 3Q87B 2C29D 3X2FA 2OT3B 4L4XA 4RF4A 1VRVA 2C9ZA 3WQQA 5KKNB 3S2ZA 2WAAA 2WWFA 1ULTA 5H81A 1FDUA 4BFZA 2PZGA 4B09A 2HFKA 2OO7A 1OREA 2OAEA 4PAGA 4PO8A 2IV3A 3SOPA 1IDN1 1LI5A 3K1AA 2E21A 2HLDA 4GZLA 2ZU0C 2WE8A 4MQUA 4LHWA 4RFSB 1KSHA 3AIMA 3FVQA 3Q3IA 2P30A 4M83A 5FL3A 3ZD6A 2IA5A 3FPSA 3NQ41 3OURA 3GUHA 3R7DA 1OWMA 1NP6A 1TYZA 1TEXA 4UHJA 1SQ0A 4NZ9A 4QICA 4F85A 1WQ3A 1XGKA 3DOFA 1E8NA 1X1AA 4NYIQ 4BV2A 1W4AA 4FT2A 4MV7A 1I1NA 1QMPA 1AX9A 4M89A 3NHBA 4M9ZA 1GUBA 3QE0A 2UZ1B 1XLTC 2JVKA 2X42A 1LPAB 4FFWA 1HSOA 3DL2A 2HBYA 3V7WA 3PJDA 4JI4B 4UDYX 1PF7E 1UBFA 4UULA 1SXJE 1I13A 4IX9A 5TQJA 1MO5A 3JV7A 1UMDA 2QP3A 2J07A 1Y5NA 1GQFA 4F8JA 1B7GO 1QAOA 1F17A 5C1BA 5HR5A 1L5LA 3EUWA 3PZRA 2J5RA 3F5MA 5I5EA 3BJZA 2XCIA 2ZT6A 1QE5A 2C5LA 3IAAA 3LPMA 4WZAB 2A8YA 2V7BA 2XQKA 2ZGVA 3EXG1 1NF9A 3UZUA 2HCRA 5M04A 2QD4A 3D3NA 3HFGA 3DT6A 1WY5A 1E4EA 3DAOA 3IILA 4II2A 4S24A 4NYJR 4Z2YA 2EFYA 4PZDA 1ZIDA 4R51A 3ZIDA 4BX3A 1G6KA 4LVCA 3C3AA 1IEXA 3KEFA 1J09A 2IXTA 2HM7A 2F90A 4CIXA 4G0NA 1KQPA 4HQRA 3R77A 3UKJA 3VFDA 2ZWPA 5KYNA 2O8BA 4G1CA 4L15A 4WKGA 3RUFA 5K8JB 1HNNA 2HY7A 3LUJA 3UGQA 3RAEC 4X44A 5IWCA 4DJFC 4FIZA 1TMOA 5ALTA 2AC4A 1T3ZA 2YOGA 1S2MA 2ZBRA 3I3OA 3C41J 4GKBA 3UXHA 5IF9A 4L5IA 2KMLA 4PG8A 3UHOA 4Z0NA 4YFVA 1O7JA 3COJA 3CNEA 2ZRJA 1YOVB 3ZE2B 5K0JA 4ND5A 1NN3A 2J9FB 5FOXA 1JJFA 2H1SA 3DB2A 3OMXA 2UUOA 2M6KA 3AUTA 3CN7A 1XDDA 2DKFA 5G1PA 4KSBA 3PDIB 4FJ2A 2NQTA 3IGFA 3TZCA 5I9LA 3K16A 3ZDFA 4YXFA 3WG9A 3FB1A 3LMKA 4DCCA 1WUJS 3FWPA 2JVJA 2C7GA 4IR7A 4CF3A 2W6QA 4ZOLB 5K7SA 2R8BA 3WYDA 3OZDA 4MPRA 4YRCA 1KAGA 1DJQA 4DMGA 4M1OA 1PK8A 2YVKA 4UCWA 1PJCA 1P7VA 1XRQA 4RESA 2J5QA 4QDXA 1APBA 4TTPA 4ZQGA 2Z2ZA 4YUAA 5IDXA 1PZHA 5CVDA 2WJIA 3DLHA 3H5TA 2IHNA 1KI9A 1ZRSA 3CLSD 5BPFA 3N3AC 1XX6A 2XYRA 2BFBB 3HZHA 4BASA 2JC3A 1NATA 4HWTA 4BEBA 1YZTA 1RI3A 3SN6A 1DLJA 3TQHA 4KB5A 3TX2A 3KALA 5K3OA 2VXOA 3B1JA 4LGMA 1BKDR 4ERXA 2GM9A 4NMXB 4RJTA 2P1RA 3O90A 3VYWA 2PSJA 5DNCA 3HBJA 1VJRA 3DG9A 2GNOA 1RLUA 3OLCX 4EUSA 2CLMB 2W2PA 1T5DX 1XE3A 3H9GA 4DZRA 1LX7A 3L40A 4GIBA 1E77A 1HRDA 1E2EA 2XQVA 4HC4A 3OZEA 4MQLA 3VNAA 5EEGA 3K0SA 1EP9A 3CX7A 2MIIA 4QLBA 2VBIA 3FSEA 3CJRA 2FPGA 4BE7B 1F6DA 1U7UA 2H51A 3HRIA 2V6GA 3DZDA 1XTQA 4M37A 2QMEA 3FWZA 3PUKA 4RM2A 3OCUA 2HWWA 4JL8A 4IQGA 4YRLA 3RVJA 3N87A 4EVIA 2VYCA 4BO6A 1KERA 2NXJA 2FB9A 4JGBA 4R9NA 4OMDA 4A92A 3A05A 1CJUC 2CFCA 2WJGA 4X3PA 3MERA 5I4IA 1MW8X 2HU5A 4W8GA 4LF8B 2CBZA 4ZA2A 4H15A 5A03A 1I10A 1NHGA 1NW6A 1SWWA 1PGJA 2P7HA 3KAPA 1HF3A 3CPEA 3MWFA 4KWIA 4IWNA 4F3KA 2XGSA 2QU7A 2XTZA 3OF3A 2ODAA 4LYHA 4E07A 2WWTA 4Z4CA 4BKMA 4N54A 1FUEA 4S1TA 1Z0UA 5KYTA 5CFZA 3UJ6A 5L7TA 2IBTA 3SQXA 2INGX 4D44A 3CSDA 1M74A 2PGAA 3VH2A 3Q8KA 1E99A 3P2OA 1L8LA 3IEXA 1QX3A 3OO0A 3UJBA 5C4IA 1JA0A 2D1QA 3VO8A 2ZM5A 1CUCA 3IAM6 5LQMA 2IITA 3C24A 3R7AA 1J25A 3G8BA 1LDYA 2R6GA 1GGHA 4QVGA 3DE1X 3UF0A 4RK1A 3W05A 2FFBA 3D3KA 4W7HA 5DHSA 2EZUA 3OT4A 5K0LA 3U4HA 5KNCA 5J2UB 2YWBA 3WK4A 2P8JA 2XA2A 3RYHA 3VC2A 2MSLA 4H77A 3HFSA 1Z2NX 5DLQC 1M2VA 4KXVA 1JX6A 1TYBE 4RAQA 3EGEA 2ZULA 1SK8A 4JX9A 1HEUA 4FYHA 5CT8A 2QWXA 3KZVA 3D7RA 2FKAA 3SJCA 1JR3E 2BONA 3I72A 4JDPA 3U7EB 3BHJA 4V3BA 2XCQA 1VJ1A 2BKXA 4INOA 1VP3A 2WZCA 3HU1A 4NL4H 1JMYA 3WNQA 4G5FA 2I6SA 3UV3A 5CFMA 5LDDC 5C52B 3CB2A 4EB8A 5GV8A 2E0IA 4XJSA 3EQ7A 3RGGA 5IRCD 2OUIA 5D1NA 1NN1A 4L9WA 3K0FB 2DVMA 3NHAA 5EIFA 4PN3A 3EB9A 4OIMA 3ECAA 3WFZA 4D9IA 3TNDA 2GNAA 3Q1LA 4OLAA 5AHXA 4AQ7A 1CIVA 4MWTA 5ALYA 3E1GA 4XDGA 3CZ5A 2FPWA 4WY2A 4L72A 2GSDA 2WTBA 2XE8A 3JRWA 4CVNA 1R27A 3K1ZA 5EI5A 5J63A 2GSWA 3STUA 3M4XA 2P2DA 4YRKA 3STHA 5JU6A 4CEIB 3GUZA 3TXAA 1Y7TA 3AQ4A 3VZRA 2BJHA 4W8OA 4NBVA 1N33B 4B40A 5J9FA 4U0JA 3H5LA 3EFOA 3HYNA 3PGA1 1JLRA 3LUHA 3LY8A 1X42A 4II3A 4TL7A 1F4PA 3PEWA 1BWPA 4JJ4A 4S12A 3SX4A 2FR8C 4J4TA 4RSMA 2YWRA 3UB3A 3VX4A 3KYIB 821PA 1OTYA 2ZRNA 4M1KA 3NNSA 4KTVE 1QK3A 1TU4A 4NPAA 4UBMA 4XWGA 1VBNA 1M2NA 1O94D 1D8TA 3AUJB 4Q1FA 1D4OA 1SO8A 4H31A 2VJOA 2XGOA 1PWZA 1XELA 2E4UA 2ZIEA 3KUXA 5FUXA 3OY7A 4EB0A 4KHZA 3UPTA 1OZFA 2YXBA 1V11B 5F21A 3OZFA 3LK6A 3TOCA 1BHJA 1E6UA 1EWKA 1NY6A 2M1XA 1T91A 5L45A 1YR1A 2GAIA 3FYTA 3EGCA 1DARA 5HZGA 1LRJA 2EIXA 1NUUA 4B1FA 5EIHA 4RVFA 4KXFB 2OSBA 4X60A 1O6ZA 3G3EA 4QXQA 1VHWA 2CEKA 3C6ZA 3PNPA 2VDWA 4JP8A 4IMIB 5B1EA 1ZW1A 1XD9A 1NQVA 4PSCA 3VKUA 3ZXUB 2YJ6A 2QTAA 3GVIA 5AK0A 3OCJA 1DOZA 4CDRA 2DETA 5KTTA 1H2WA 1YI8A 4QQNA 2PL3A 1NRWA 1SNYA 4O4IB 3K0BA 4Z4HA 4HMOA 4QM7A 4Z4IA 2FKNA 1W0JD 2JZNA 4CM4B 3VKWA 3BICA 1FMTA 1TVCA 2EKPA 3S1AB 4EK9A 1QDUA 4Z4QA 3GI1A 1T9GR 3VKFA 4EMSA 3AT1A 4ALKA 1GNQA 2Q1TA 4IJQA 4C0JA 3K6SA 1WZUA 2SCUA 3OPNA 1D2EA 4IDEA 4YQEA 3H1AA 4JH0A 2OBBA 4S1WA 4CQMD 1BDHA 3TNYA 3AVXA 3IUEA 1JYEA 4XARA 4E5NA 2ATVA 4J0JA 3NGMA 3RARA 4GYKA 4TLDA 2VDPB 1JIIA 2V96A 1IHXA 5FPTA 2F59A 2L18A 3FCSB 3ONVA 2BLNA 1Q0LA 4E21A 3ZJTA 3IEPA 3KKNA 5KUTA 3AVTA 1K06A 1G5RA 2NO1A 4X8MA 5JWOA 1G8GA 1KDTA 2HRQA 5CNMA 4G0UA 2ZYIA 4YRDA 5FPSA 4JKOA 2KX7A 3LX5A 2O2XA 4LF6B 3NFRA 5H5JA 2OZLB 2ZKIA 3IAS1 1FQKA 3HEMA 1Y8RB 1V8ZA 4INZA 4Q3EA 2LCIA 1XUOA 4KFTA 4ZOLA 4DDHA 4KACA 4XWWA 1QOZA 3DMTC 4JODA 3L04A 4N1AA 4P7FA 3KQHA 4CMCA 3P4YA 1K8QA 2EEZA 3WZLA 2PPVA 3QBVA 2PE5A 4KRFA 3WMGA 1N57A 1V3QE 4K9QA 4WBNF 5DSTA 3UTDA 2WIBA 4RTOA 2Q8PA 3F5FA 3CUVA 2HDOA 3KHTA 4WESB 1OR8A 1U3DA 4D45A 4UU7A 1BFKA 4BO5A 4NH4A 4KJZA 4RHUA 3T7SA 1SCNE 3AI2A 3SLKA 5H16A 5E3IA 3FZQA 4PSKA 3AEQA 2B20A 3TW6A 4Z0TA 2FOIA 2BISA 1U8FO 1L4GA 1TVMA 1W4BA 1YIOA 2OILA 2QS9A 3RVBA 4Z7NB 5HYVA 1EP1B 2QRQA 4M99A 3ROMA 4CM8B 2WINI 4ZCMA 4Y30A 4L8WB 4ENSA 2XUKA 4KE6A 3WLRA 3EVZA 3ID6C 3HUFA 1H8HD 1PHPA 2OD2A 3DVSX 1GCGA 3MFQA 2Q21A 4JS0A 2XAAA 5DM0A 5LXTB 3GFBA 3QEOA 4UTNA 2IX3A 1G7RA 3T3MB 2PFKA 2NZWA 4V38A 1HH4A 2VPPA 2WVGA 3N58A 4LFBB 1HE3A 1GA6A 1QG2A 4NDZA 1DQPA 1GRNA 1K7YA 3E3MA 3SQOA 2DBQA 3CWQA 3O03A 2MHCA 3FGZA 5CPBA 2V03A 3D3WB 3LVRE 4WZAA 2IOHA 1H4VB 3I04M 2P91A 2C57A 4PV7A 4UUMA 3O47A 2X2FA 2R0QC 1NOJA 1T8RA 5TDHA 5FX2A 2CWWA 1QRAA 1HO3A 3QSYA 1VL5A 1MGPA 4MWEA 1CUHA 5E0OA 3PHIA 4RGBA 4LYDA 3ZQKA 3GRCA 2QENA 2QNRA 3Q3CA 4KRYA 2ZTHA 3B53X 1ICEA 3LHIA 4HFJA 1FP7A 1YU6A 4FGWA 1BE0A 2E4ZA 3N86A 5TY0A 3TBFA 3L4JA 2P69A 1WCIA 4WASA 3LS2A 4KW7A 2CMHA 2QTNA 2OCDA 1U65A 3BFJA 3IA7A 3CVYA 4JJFA 4CIDA 1H3NA 2ZTMA 5KVAA 2FDXA 4MIEA 1UQTA 4ALMA 4X6YA 1DVRA 3EA5A 4MLDA 2ZBDA 3TLGB 4O8CA 4LJYA 3EIXA 3ML1A 3CINA 4ROTA 3AINA 2FN4A 4YAWA 4GMGA 3FOFC 4Z0HO 4RFSA 2L69A 5KHLB 4U00A 1N6KA 2DUUA 5FOSA 5TPZD 4BNNA 4N76A 4TYWA 2ZUTA 4MQEA 3CKLA 3GQBB 1OILA 1UADA 5HZMA 1GG5A 1E66A 3NX4A 1DOHA 1ZP6A 1WDTA 4LZZA 8GPBA 4L85A 1KFCB 4Q9LA 5DXAA 1QIHA 1DCMA 3LTNC 3VV3A 1AK2A 4CDMA 2I99A 1SQFA 1XRMA 5TEWA 5KC8A 3KYBA 5AO9A 4YRZA 2IXBA 2I7XA 3B9QA 5IH3A 2ZIZA 3UAVA 1EWRA 4AKSA 3CEHA 1AUVA 2A35A 2QRVA 4KQKA 4AS2A 4BWGA 4ENUA 4KE7A 2MYPA 3GRZA 5BUCA 5IW8A 2QB5A 2HTFA 2O4CA 1Z62A 3D4IA 1YI0A 4KQEA 4DADA 1XU4A 3A1DA 3PWSA 4TS9A 1O58A 5A3RA 4Y2TA 4U7JA 3JZDA 3KOWA 1YGYA 1NV8A 2B8NA 3S27A 5HM6A 4RD3A 2PIAA 3KZKA 1C1DA 3ADKA 3G5AA 2OHJA 5DBEX 1DFHA 4ME6A 1ZG3A 1RI5A 4QQFA 3ZHRA 3RHTA 3GYGA 1XNHA 5EJ7A 2CXNA 3HGMA 4Q7MB 4BLUA 3QUCA 2X6TA 1GGJA 4KGDA 4TRJA 5DLDA 4RPJA 3WLIA 4B6EA 1QHSA 1SIBE 1XDGA 2J41A 2Z8ZA 3HZOA 3ED1A 5AVZA 2VZ9A 4GKVA 1W75A 1BFDA 1UBCA 3RC3A 4U2KA 3TN7A 5U1PA 4O0MA 3VZDA 4XB2A 3W78A 2PWYA 5HIAA 3K09C 1E9VA 4PR3A 4WXYB 3CRVA 4MUFA 1E2FA 4CU2A 3PCRB 1BS9A 5TC4A 1YULA 2PXHA 1AKVA 3ASVA 4GO1A 2EDCA 2BGWA 4EW1A 3E7DA 1VE1A 5FBQB 4EECA 3FOWA 1RWBA 3I83A 2O2CA 1RAHA 1UK9A 3OLVA 1ZICA 3B6IA 5TRTA 2ZSEA 3JWHA 2XUDA 4TV9A 4AY5A 2ZK7A 1LK7A 3QLEA 4JUFA 3VR5H 3ZU6A 1MD9A 1Z18A 4AURA 1W34A 2PH1A 1ULSA 1VSTA 4L50A 3EGOA 4OP3A 1PWHA 3TNLA 2J3LA 4PAQA 2GJSA 2YDXA 5FNVF 3V7FA 1DNPA 2PRZA 2V8BA 5IANA 2BGGA 1NC1A 1W30A 2VP6A 3DR5A 3K73O 1M6HA 4DF3A 2JIZA 1PT5A 1RCUA 2VQSA 4FR0A 1NQWA 2Y71A 1XP8A 1RBZA 4JKYA 4WNYA 4CBVA 5AW4A 3DAGA 4MYRA 1NJSA 3DT8A 1NJGA 1M33A 2P0EA 2ZYDA 3L93A 1PW7A 4KXXA 4TKUA 5CD9A 4LY0A 1P18A 3M6UA 3BH6A 4D3SA 3GLIA 4JXKA 3D7MA 1XTJA 3WP1B 2RGCA 4Y6SA 1M10A 3DE4X 5EWJA 1F12A 1Y9EA 1Z6PA 1G66A 2A5FA 3IQEA 1QGUA 4BO3A 1NVAA 2B2XA 3GP3A 4MWCA 3HU2A 4IDGA 4CL0A 3CZAA 1K0FA 1PGOA 2J3MA 5JAOA 2AFIB 3K94A 2I1QA 1ZYUA 1XKXA 1R8XA 4FNAA 4E5SA 2VF4X 4HL6A 2X8LA 3HXTA 2H3HA 2JAHA 1GZ6A 1QXSA 1H2XA 1VRWA 1IUKA 4ZYLA 6ABPA 4K9LA 4AJ2A 4B3SB 2GK3A 3G8AA 4HP8A 1Q6ZA 3CUTA 1ST3A 2FW9A 2GJ9A 4UHEA 4JLJA 5SICE 2I87A 2AWOA 4YMUA 1UKEA 1JT9A 1F4VA 3FCOA 3EMBA 4YREA 5IX8A 2NZUG 1QP0A 3KLPX 1SOVA 1RYNA 3GZNB 3GRAA 3QKWA 1NXPA 1RWWA 4KV9A 1XWIA 1FVXA 4QPZA 4WNIA 4CTKA 3ZWKA 3CX3A 4K6GA 3EOZA 5AXBA 2BI7A 4J1TC 4Y8VA 5FULA 1F1BA 3BG5A 3LW7A 5TSDA 1PV1A 2CCJA 1C7FA 2BM1A 3L4BA 3RIGA 1CR1A 2J4CA 3BFKA 2BEKA 5C1IA 5EXSA 4WCDA 1R7RA 3R3JA 1E3LA 1RP7A 2W6PA 4AD8A 1IQRA 1XTTA 2EJBA 1C7ZA 2MSDB 5GVRA 4DR4B 2IUFA 3BXGA 1F0YA 3IJ5A 2YIVX 5DRYA 2V4MA 4NWIA 2XX3A 1RKXA 1RC1A 1POXA 2BMAA 2DRIA 1NXSA 5LOVF 1XNQB 4XWTA 3O26A 3ZQ6A 3WGJA 3WVNA 4WNCA 1JUDA 4LMBA 4D3FA 5LU9A 1OLUB 4ZJZA 2F1HA 4OGFA 5GAJA 4E2FA 4RTPA 4KUHA 4R1TA 3GBPA 1H2AS 3W5UA 4MDYA 2FXIA 5TPWA 1C1HA 4Y2HA 1M0WA 1G2IA 2Z2XA 2QOEA 4CQNA 3K6RA 3EZFA 1UJ4A 4Y1GA 2IEGA 5FUYA 1QV6A 2C0PA 2RHMA 2W4QA 4RTNA 1UMBB 2QE7A 5IT4A 2QM8A 4PHHA 3BRCA 4Z9BA 3RVMA 1NU8A 4MR7B 4LHSA 4HB3A 5DX1A 3ORRA 5KYYA 2BAGA 4P81A 5AW6A 1YB5A 3EMDA 1UBUS 4FNOA 4ZQBA 2Q41A 5IJ0A 1TT5B 4FLEA 3EPHA 4DCGA 1II8B 3Q41A 2J67A 4ZHQA 3HXOA 3ZW9A 4JFAA 3A3OA 4XM1A 2EBWA 3CSSA 5A0FA 1H0KA 4R7GA 4G3XA 4F11A 1OYOA 1CR6A 2BH9A 4G97A 2XUOA 1X7ZA 4F2GA 4MMZB 4QJBA 1I7SB 3H1PA 2CDNA 1CUXA 2IE0A 2CXRA 3D8BA 1DAOA 1JKIA 3FYUC 4MK4A 2CNBA 4G36A 5DF1A 2W4MA 4WLEA 5T3YA 2FOLA 2OOSA 4ZC8A 1YI1A 4U5XA 3HN7A 5LUBA 2O8EB 1IG0A 1L8AA 3LH5A 3A2MA 3B1KA 4DYHA 5SZHB 4US2R 3P2KA 3IXLA 3FWHA 4CEJA 4Y3UA 5BUQA 1X14A 1ZI6A 1FS6A 2E2WA 2ISSD 2Z9BA 1FFBA 4LXUA 1X7WB 1J8VA 3CV3A 3L0DA 2HPAA 2E82A 2ODPA 1MAVA 2B1QA 1T13A 1C3JA 2FZVA 4B6FA 2PRSA 1DPGA 2PAFA 1LD3A 2WF7A 4L76A 1ZKDA 4TLLB 4OK6A 1FTWA 3NBAA 5JNSA 3RUIA 1G8MA 1K08A 4TRRA 3DV0A 4X6LA 2C42A 3OJLA 4QT4A 1SK9A 1NQXA 1SD2A 3K92A 4TLCA 3TIFA 1R9NA 1RE1A 1CEYA 1YZGA 3LP5A 3NTRA 2FLWA 2Y2UA 1TM4E 2CLFB 4RD2A 3I8OA 4GM0A 1KMHA 1TU3A 5A7GA 5IAEA 3C7AA 2PUAA 5MDHA 2Z56A 1JDPA 3OT1B 4RYLA 3OIYA 3MELA 4TMZA 4I2VA 3UXMA 2GD0A 2IS6A 2R2AA 4V1CB 2QJOA 5HE9A 2ZWIA 4UNIA 1MIOB 4RE5A 1N6IA 5EERA 3WYFA 1Y8AA 2FK7A 4F4JA 4AP6A 4YYZA 2QF7A 4YRFA 1GZUA 1OXBB 2FEPA 2XCUA 1ORVA 2KYRA 1R8QA 4GSKA 1SVUA 2G9RA 2HK6A 2JLXA 1OB2A 2PGIA 1D2NA 4GI7A 3FNQA 3K32A 4AF7A 1E94E 2SECE 1QTIA 1LVUA 4BATA 5ALVA 3UMVA 2J5XA 2CF6A 2V9CA 3WLKX 1EUCB 1GNRA 2D1RA 4BZWA 1QCZA 3WMWA 1OXVA 2DJIA 1WNTA 2ZB2A 4CG2A 1O9GA 1EVLA 2A92A 3Q12A 1VLHA 3EWSA 1ZS9A 4UBIA 1ZIPA 4Z1MA 4EO9A 3MCVA 1G3QA 4FE3A 2QE6A 5KZMB 1ADCA 3P0RA 4TV8B 5HMLA 1XF1A 5TGDA 3BQNB 3D6UA 1IHUA 4QOFA 4IZ6A 3W5DA 3ADBA 4WKNA 4DANA 1ZX1A 4H0FA 2ECOA 1BKYA 2ACKA 5AVJA 1Q19A 1WXGA 2NSDA 1V0JA 3BT7A 2X9QA 4OB6A 1KKLA 4QJ3A 3X0DA 1GRCA 2B7CA 4JEUA 4L02A 4QOSA 2ODQA 1P9RA 4YMIA 3ZLJA 2OYCA 3A7DA 1QH0A 2BMWA 5L95A 1RKVA 1Y3AA 3V1TC 3NHZA 3HGQA 3NORA 4IKOA 1HFKA 2D3TA 2O3TA 1VPEA 1LZKA 3IYLW 3OVMA 4UTZA 5AQEA 2RK6A 4XB6B 4DXDA 1EA7A 2VHCA 3MF4A 1LFDB 3TL2A 1G8SA 3R9XA 3AUFA 5TMBA 3G0HA 1CY8A 2FUG6 1I33A 1TZKA 2CUZA 3AGQA 4IXNA 2IH4A 2PGXA 3A4IA 4RLFA 3ZWNA 3A6PC 2VTDA 3T7DA 3PGXA 1N1DA 4ZYVA 3KELA 3TECE 4D8XA 5CGQB 4LKRA 4X92A 1L9KA 1ZITA 3R20A 2FSGA 1YJAA 2XODA 4JLSA 4B2PA 2PGLA 1ES9A 4TKUB 1ONBA 4Y1RB 3TLAA 3OQNA 5FEUA 2REBA 1C3OA 1MW9X 1Y1PA 4RABA 1SC1A 2GHRA 3U09A 1JH9A 3IJRA 3QHQA 2JLZA 1DFIA 4OFWA 2YCLA 2GCGA 3RIYA 3WYNA 1DJMA 4GF5A 5FA8A 1GEEA 4RHFA 3KJHA 5C5DA 4K9OA 2ACWA 2AJ8A 2CUNA 4TS4A 4GH5A 2GCNA 4XDYA 2UZ4A 3AKYA 3PFKA 4QYSA 3L5OA 2B78A 2F3SA 4RF3A 3WNBA 3JPWA 5CJPA 3UAWA 1SQ5A 1HG0A 1UBTS 1N6LA 3A9UA 3L7MA 3SKVA 1PKXA 3F3SA 1AXGA 3QG5A 4RTJA 1O9BA 1A2BA 2VP3A 4ESVA 3DYVA 4O1IA 1SBNE 3M2TA 1TLTA 1K75A 1MX9A 1ZM7A 2I7CA 2P2NA 4ZT2A 4NJMB 4DYVA 3H2ZA 1IM8A 2IC5A 3IS3A 1Z15A 4CMBA 5TF0A 1V5EA 2PJRA 1K7SN 1KH1A 1R5BA 1GL3A 2BDUA 4OB7A 1WY7A 3DWGA 4A6XA 4IIUA 5AR1A 2X13A 2Q6TA 2O9JA 3GBVA 3MCAA 1G5FA 1S4QA 4BP1A 5LSAA 1EUDA 1QM5A 4UFNA 4X1YB 4ARVA 1QZZA 2OB1A 2JGLA 3F7TA 4FYYA 2IUEA 2XUPA 3KEQA 5MFPA 2GM4A 1SIUA 3FB4A 3PHLA 3KKOA 3RFXA 1PR1A 4BLRA 5EINA 4MV1A 2O2YA 2PANA 4TMVA 3RRBA 4FFRA 2WHYA 3ROQA 1I5EA 1A5AB 5BR1A 2QL7A 2HNKA 1DBQA 1ZGCA 2JGDB 3DTTA 3NRBA 1R6DA 2ZEJA 3ZGYA 3OHMA 2AA3A 3KE8A 4L08A 3R3VA 4RZXA 2C8LA 5ESRA 3T9EA 3AW9A 3FETA 3G6WA 5DVZA 3RE1A 4GUDA 5BN1A 1CS0A 4M36A 2QNIA 3ZDEA 1MAWA 1NT4A 3GLHB 6YASA 3QLVC 2H16A 2A9PA 4QVKA 3F7OA 1U9YA 3OPMA 1LZLA 3IQIX 4H1WA 5YASA 4LWZA 2WIDA 2Y93A 4DDUA 2D1SA 3WGOA 3RS4A 2PUDA 3RAFC 1DWPA 3PUXA 4O4IA 1OQAA 1C9DB 3EF1A 2V1XA 3HHPA 4QUEA 1Z2DA 4WACA 5A6SB 4YQYA 4COOA 2DQKA 1U9JA 2PRIA 4WXMA 1UPUA 3DXXA 2ZRHA 2VUSA 3TUIC 1NPTO 2W9XA 5JMWA 4LYEA 3PX3A 3U9TA 3KJGA 2YNMA 3GLIE 3HUDA 3U80A 3AKZA 4KXQA 3GLSA 5D6NA 4MW9A 4ZV9A 3T95A 1LA2A 5CA1B 5DEOA 4Q6BA 3CGGA 1AGXA 3R3HA 1RM5A 1S8NA 2NUTB 4HRXA 4UMVA 4X9XA 3UUFA 4OG2A 4E5VA 4LJRA 5A4JA 2HQSA 3NAMA 1O03A 3BMCA 4XUEA 1A7AA 3TGWA 5KB3A 5CDYA 4R1QA 3EASA 4LC1A 1Z3IX 3L1KA 4BLOA 2MTBA 1W6RA 1DB3A 5B1YA 3A6FA 4N0MA 4X8OA 1UK8A 3ZQJA 5HW0A 5JSZB 4PGMA 3V8BA 2P0AA 4MQMA 3YASA 2ZJ3A 3RUAA 5JYEA 5HBRA 3S6JA 1G21B 5JH7B 3GEBA 3S2IA 1M54A 2C99A 3GDOA 2W70A 1PR0A 1MPXA 5H9WA 1UBRS 2AEEA 4ZI5A 4EDFA 3ASYA 3HVHA 3ZDDA 4ENRA 2BIFA 3KFXA 4YDHB 3GZTB 4RH0A 1OA1A 3V6MA 3WC4A 2QTFA 5CYPA 4AJLA 4ER5A 5LJIA 4R1LA 4BGDA 5D3MB 3HPQA 3JVVA 1UOOA 2VWGA 5FUWA 4DMCA 1F2TA 1N9GB 4YP6A 2A6PA 1N2BA 1II0A 3HP7A 5ALNA 3I6BA 5HCUA 1T2FA 3CG0A 3NTLA 3CZPA 2JAXA 1IWPB 5EJ5A 4GYYA 2LR0A 1Y89A 4LJSA 1UZUA 1YZNA 4TUYF 5E8JA 2C94A 3Q9LA 2BDEA 5JAIA 1QHIA 2CXUA 2Q9UA 1C9NA 1N8TA 3IVGA 5AT1A 4ZVMA 1XN1A 3KTDA 2UUCB 4H1VA 1XCLA 4X3OA 3UPDA 4OV6B 4V2UA 3IT0A 5DOZA 1W48A 3NOQA 4IILA 2AZ4A 2WTNA 4K1XA 1JEYB 3CVXA 2GBCA 2ICAA 3R7NA 3HB7A 1IEWA 1D4AA 3BWDD 3I4FA 3KC2A 3NYRA 4OK3A 4FYJA 3ND9A 5AOVA 4XSGA 1AE1A 2Z2YA 7ADHA 3DDZX 1ZNZA 2NTYC 1IB6A 1TZCA 3ORHA 4DJJA 5LVAA 3K70D 2WT8A 3N8NA 3CKYA 3UYLA 1DBVO 3T9BA 3FA2A 1JFLA 3QY0A 1V4BA 2YBDA 1VP9A 1XFDA 1K98A 1Z74A 4CU5A 2A1UB 2PXXA 2H2GA 2VTKA 3H7IA 5FI5A 5ALQA 2EX0A 4FOSA 4AO7A 2GNPA 2GTIA 2DPGA 2DT8A 1YTLA 3CLRD 2CFTA 1T9AA 4XCVA 5CLIA 4EF4A 2M6RA 2YUTA 3BWCA 3WNDA 1YCHA 3LHDA 3ZEAA 1XD8A 2M2IA 3A06A 4JBGA 4B4KA 2CK3D 3TINA 3QXSA 1SC6A 2G1AA 4C05A 3J7AC 3BWVA 1P61B 1LS6A 3KT3A 4XQEA 1VL2A 5CYGA 5CIQA 2XNSA 3ACBA 3JQAB 2O2HA 2RARA 4KXYA 2BMVA 4W63A 1Y80A 2P77A 3RHFA 4KLCA 2FMFA 3MB8A 3AI3A 1AGYA 2H1IA 3L0BA 3CEMA 4XIYA 3N0VA 1R00A 3A14A 5FORA 3SICE 1SM4A 2OHXA 4WL0A 1AHNA 1N6RA 2RHWA 3OUTA 3RYIA 121PA 1UT5A 2DJ5A 4HUJA 4DDMA 4Z6KA 5A9SA 3CONA 5GQSA 1KYVA 1WXEA 2ZCUA 2ZTUA 1Y4AE 3PYXA 4RQTA 1AQUA 1AQLA 4JL5A 2C2WA 3SSNA 1KKMA 1ODCA 4OQZA 1BGVA 1M1NB 1DU4A 2EGHA 1BRTA 1SA0B 4JLMA 2ZAGA 1KNQA 2WJ6A 2X0KA 3OU7A 3I9V6 3K7EA 4QOGA 5FPYA 4BGIA 2HU7A 2Y76A 4ZOQI 4IW3B 3UB2A 1SVOA 2CD7A 1ZCBA 1YDWA 3DGEC 3F46A 1SXGA 2QYHA 1BMDA 2WJ3A 4Q24A 4U39A 4JJIA 5GONB 5C81A 1OH5A 3ZCTA 5JD5A 1K7EB 4GBGA 1DRJA 4RWEA 5BSUA 4AB1A 2BGJA 1QRUA 3R5JA 2WF6A 2DHCA 2GRUA 3OF2A 1DKNA 4RCZA 5FFNA 5JSKA 2AW5A 1GLNA 2Y4NA 1QC5A 3C5VA 1MJ5A 3DL7A 4XGIA 3WGHA 3EXFB 4RMGA 3ZD8A 1RADA 4CCYB 4ZZ3A 7GPBA 4GMXA 1QRDA 2GUWA 4ZYWA 2ERXA 4IO1A 4QOHA 2PJUA 2ID8A 3G0CA 4DG8A 3NYQA 2AFHB 2BZGA 5JVDF 4RY0A 4N18A 4OIFA 4E5MA 3AL3A 4F93B 4L6CA 4XCXA 5K3BA 3EEIA 1GPH1 1OT5A 1Y48E 3SMQA 1CP3A 1L7PA 4LEIA 5KYYB 2P9EA 5C1OA 3ZR4B 2IHKA 3NHFA 3BXFA 3N76A 2VJDA 4L74A 1W52X 2I6XA 3ZVRA 3FOEC 1W0CA 2GEFA 1ZSYA 1UMBA 3JYHA 3U4AA 2CB9A 1NM5A 2HADA 2JCGA 2VSNA 4M22A 3WJ7A 1OGIA 3MTQA 4H3HB 4Q1EA 1N1GA 3JQAD 3CPSA 5H1YA 3LDAA 4ER7A 4JZKA 2P2YA 4EG7A 2UAGA 1YQUA 5DM2A 2EP5A 1A88A 4DQUA 2GF9A 3E82A 4HAYA 2WQZA 2R9VA 3BTVA 4OEHA 5BRJA 2F64A 1FZQA 3E2IA 4JP5A 1ISMA 4LZLA 4N0PA 1Z2CA 3ADPA 2XTMA 3DKIA 4QGGA 3UKDA 4CTMA 4BY9E 3RR2A 3VR6A 4IIBA 3IJPA 4UJ5A 1N78A 1RJDA 5BV7A 4GRIA 2VYQA 2VT7A 3ISJA 3K35A 2VYND 4LZNA 5EMJA 1XK6A 2AV6A 4OA8A 5G1NA 3AK4A 4BFXA 4NZMA 5IFKA 1T1IA 4IX1A 3ZWWA 1AHHA 1MR3F 1WTAA 2YJZA 2CJPA 4ASUA 4EG6A 1KWGA 1EE1A 2IKQA 3BRSA 1G55A 1NP3A 4M87A 2D2VA 3O8QB 4LNAA 3M9LA 2CXPA 3LTEA 4AJKA 4BRUA 3KQQA 3AOEC 3DLAA 3O9VA 4U0KA 3RIHA 3HJAA 5B4TA 1H6AA 1TEVA 2Y67A 2P7IA 4MCIA 4QG3A 1SUFA 2LGJA 3ELWA 2IHJA 1SPXA 1E2BA 4RPGA 1N2IA 4EKNB 2WQ6A 2AW3A 4EG8A 3H11B 3RG2A 4IJUA 1KDPA 1RJEA 3CRZA 3BB1A 2HJGA 2NP6A 5IDVA 2ZUBA 5DCUA 1TM1E 4AUMA 3I58A 3EDCA 4Q66C 3PEYA 4YJ2B 2IZOA 5IEBA 4CG3A 4I5DA 1YF3A 1TCAA 4P22A 4WCFC 1VDMA 3C3CA 5HF9A 5HWSA 3T3EA 4BO7A 1BMTA 1SU8A 3N6RA 4BRWA 2R1TA 1EX6A 1B15A 1JGTA 3E35A 1FC0A 1YGPA 4ONEA 2JJYA 1ZVMA 4N8SA 1PCXA 3O5AA 1OGYA 2J87A 3BAFA 4TMXA 4L7QA 1VSVA 2FLVA 4BP8A 2DUMA 4O4IF 2XCOA 3QZUA 5AJVB 3UJAA 5C8YF 2WTUA 2KW5A 1MHTA 4H4EA 4YO8A 5LYJF 2PVCA 1H8ED 1KU0A 1L5HA 3TR6A 2QTWB 4F8EA 3DMNA 1I2MA 4M1EA 4F60A 4F9TA 1SU4A 2GF2A 1GYPA 2WTAA 2O0HA 3PJFA 1GU1A 1ZJ5A 4EZEA 3JZIA 3L8YA 2OAP1 4IQ8A 4AM8A 5LIPA 2WUGA 3OEHA 4R6WA 5MHTA 5JSQA 3CLRC 3OEHD 4I9HA 4LC0A 4MKIA 4DM3A 4XWKA 1P5HA 2GJAA 2QUJA 1EPUA 1NONA 3NASA 5DXFA 2AK2A 3EVNA 4HX2A 4NYIR 3VZSA 1T4CA 3TW4A 3VTZA 4FFBA 3IPYA 2HJVA 1WBDA 3NI2A 2C00A 2VNIA 4CKCA 3FLEA 2VCEA 3BAZA 2WG0A 2BGLA 2P11A 4Y6RA 5E6SA 3K70C 2E3JA 3HWSA 3BB4A 2AFRA 1H5QA 4Q21A 4U2FA 1GQYA 5IVDA 1RYMA 4CQMA 4IXDA 1K2WA 4ZI7B 1P77A 1QHFA 2AEMA 2P27A 4G8JA 1VYVA 1Z08A 2GAOA 2XXBA 2YICA 3FPCA 3MUNA 1XJQA 5THKA 4LDAA 3I8XA 1CUWA 2Q49A 1TXGA 4MCAA 3L3BA 1EEXB 2NYVA 2YWFA 5DFAA 1U8EA 4MHSA 4QPCA 1HYHA 5LQDA 4XR9A 3SEQA 2F8TA 4PTZA 2CXXA 1BNCA 4MRMB 2GD2A 3NNDA 4WVLA 3U4QA 2FZWA 3V55A 3ANMA 4DMRA 4WN3A 1SUWA 3PDCA 4CKEA 4JXJA 2YY6A 3O6VA 1PGNA 4NK4A 5A2QA 5EXPA 4LJ5A 2JI9A 3CE9A 1H0RA 4LECA 5BSFA 1U5BA 4EGAA 2KE5A 2GEDA 2IUSA 2P9BA 1WETA 1M5UA 4ZEMA 1HT3A 2OBFA 3JASB 4L4YA 1F0NA 2OZVA 4UFOA 1Q21A 3MC1A 2XBUA 4NULA 2MR6A 3OZAA 1F4LA 2G0NA 5BSMA 1OFIA 3F6CA 4LJ8A 3ACDA 2VK8A 3C6YA 3DNFA 4F86A 3TEFA 4I3HA 1RHKA 3E05A 5FPKA 4CKBB 2R1VB 1YJQA 2H1WA 3CZCA 3DUFA 3QF7A 3W6OA 1BDBA 2YS6A 4K8OA 4CTOA 1E64A 4WMLA 4MRMA 2QN7A 3UH0A 4JR0A 2ZJZA 5CEJA 2B8WA 1X86B 3JWJA 4GZ3A 4MZDA 4Q3LA 1V48A 5AM4A 5K0NA 4GDFA 5IYZA 3L84A 1BHQ1 1T2UA 1G4HA 2WNSA 1RYDA 4P5EA 2ZE5A 2ZCVA 2ZREA 3KKLA 3PQ6A 1KEVA 4UAVA 3R7FA 1X8JA 4EMBA 3F9CA 1FP1D 4RHYA 1GQOA 2JLVA 3Q6MA 3LIIA 1NG9A 5B3AA 1ZCAA 5I7HA 5JH7F 1HX7A 1UXHA 2XVMA 1HL7A 1SHKA 2VCHA 3AERA 1GAJA 2H1CA 4C7KA 3GJZA 3NTVA 2KQUA 2FN9A 2BKLA 3CLSC 2HA4A 4J2HA 1M1ZA 2IIBA 1MB9A 2Q3DA 4NBSA 4XX0A 4TZTA 1HLFA 1Y33E 3BXXA 4FOOA 4N7MA 3GGJA 1FF9A 2W2KA 5HQTA 2FZ5A 1TAGA 3DHVA 3KXKA 3S55A 4AXXA 3ZHYA 3AGPA 3NC1C 5KPJA 3K4QA 1O0BA 2RCNA 4UE6A 3OCYA 4RGYA 3O7MA 3GF4A 2YV5A 2VRWA 1VMKA 5LYJA 1G98A 4ACBA 2XJ9A 4M88A 3ZCPA 1AXRA 4TUYB 5KTKA 1PZMA 2Z04A 1Y34E 3L43A 4OP1A 5KIAA 1QQBA 2RK3A 1GY8A 4M9QA 4Z99A 1IY1A 2RJNA 3C87A 2Q28A 1XD2A 2AN3A 4IV5A 4RQAA 1R37A 3OE7D 5E9JA 3PGKA 2WYUA 2FSSA 3C6MA 3IUPA 3EAQA 1GKUB 1SURA 5LWHA 1SBYA 3LQ4A 2WWXA 1WXIA 4W9RA 1X15A 1OE0A 3AIKA 4QT0A 4NQRA 1QRRA 2H3EA 1G4UR 4FOTA 3LVBA 2WM3A 2B36A 2F6RA 2WP0A 3GLKA 3H6GA 4JU9A 3T3HA 4D4LA 2Q2VA 2IXGA 2H65A 3LQFA 3IUYA 4ZOLF 4PCVA 2C78A 5HIKA 4WK4B 1JIUA 3QX7A 3GGGA 4PBRA 1L5MA 4M3NA 3R5TA 3ETNA 1USWA 4RCVA 3B2EA 1ZD9A 5G3YA 5C32A 1VECA 4L8YA 5AOCA 5EWLB 3WWOA 3AM3A 1ZM4A 3JQPA 3WGMA 2PV0A 3L1JA 1NBMA 4XLZA 1YUMA 4RNCA 3LCRA 1Z5WA 1FFWA 3WK5A 3ILHA 1ZL2A 3JD1A 5FUVA 5CA0B 1F8GA 2Q5EA 4EQ6A 1NQAO 1UZLA 2WA2A 4ABYA 1MUUA 5JROA 2G4LA 4KO2S 1N0VC 1YRBA 1RM3A 4HBZA 4UNPA 2JBHA 1MB3A 3A9RA 5EUBA 3UICA 2WNHA 1OI7A 2ZT8A 1ESZA 3BYZA 4HK4A 1QS0B 4OTZA 4TS1A 2IHTA 3NANA 1GSAA 1UBGA 3B1FA 1Q22A 1EYZA 1ZGZA 5DNDA 3SYMA 3AEQB 2O0LA 4IS2A 1VJTA 2OCBA 1E3QA 5AKGA 1RKQA 1I2AA 3T1OA 4QZVA 2YDYA 4K9PA 2PSSA 1XMIA 1DIRA 2REQB 5JWHA 3AF3A 3BH7A 5IC4A 4G63A 3BHNA 2GJKA 3I45A 3P9XA 1DTWA 3KO8A 1HG1A 1TJ4A 4UVHA 3MFYA 2GKOA 5DT9A 5SZIA 2FHPA 4GPEA 3R6TA 5K0TA 4EEXA 4AX4A 4NYMR 3DO6A 3QWBA 3HKCA 5EJMA 3LDGA 1DSSG 2IZ6A 3WLEA 2RGWA 5M2QA 2DP4E 1KVUA 2FGKA 4F8YA 1Y4ZA 5JI3E 2MSEB 5LMUB 3CISA 4G24A 2AG5A 1IE3A 5JI2E 4CIBA 1GA1A 4H7JA 4P35A 4OUKX 2HR1A 2FPSA 3VPDA 2Q7DA 4DPMA 3QA3E 1HEYA 3K0KA 2PMEA 2W0MA 3T3DA 4L8LA 5A1JA 4N0QA 1T2CA 5JVDA 3C6QA 5I7RA 3NOVA 4WFQA 3WLAA 1MTZA 1N1MA 5ALOA 3LUPA 4OQQA 4MUYA 3SE0A 3N3BC 1JQ5A 1P2VA 1R0LA 1N2GA 2PMKA 4RPIA 1P9NA 2J30A 1ISSA 2O0MA 2HXGA 2QN2A 2BBTA 5E4JA 4QTYA 1KEPA 4YJGA 4IF4A 4JJAA 3DZFA 3VKGA 4PIVA 1ZH2A 4UATA 5J5AA 1ISJA 1O4WA 3MILA 2X40A 3T0GA 1ZBQA 1K27A 4PXAA 1OPXA 1EXNA 3H5IA 5LC1A 5DTRA 3OTGA 1PJ3A 1UKCA 2J7KA 5JDCA 4RK6A 3BREA 5MN6A 1MIHA 2CXQA 3G1TA 2H8KA 1YT5A 3G6KA 2WWGA 4M8LA 4OJYA 3N9IA 5K8IA 2VTBB 3JTMA 1OMOA 1YB4A 4KIJA 1L5VA 3U4IA 1UP4A 1Z5UA 3DAPA 3FWYA 4I81A 3KTAB 3WIDA 1ZN2A 3ZZMA 4AYXA 4C4YA 1KYYA 1OTXA 3CVJA 4I1YA 3O1IC 4TWAA 1GFIA 3EA4A 2I62A 2JAPA 3FMOB 4IFIA 4IVQA 1EUCA 4ECEA 3U5TA 1L8XA 4IDDA 3LYAA 1UJBA 1PL7A 1YKGA 1H93A 3BMQA 1BOFA 4BMNA 4R1MA 3FNHA 3UMJA 3L06A 3OPVA 3H1GA 1O96A 4HF7A 5FDFA 4RK5A 3X1MA 2CW5A 3E61A 5GOTA 1JG2A 1T4MA 3IPLA 1NMXA 2RGNC 1GAQA 1SH7A 1YMVA 4PX2A 4E5YA 3QE4A 3I34X 3I32A 1G17A 5C4MA 3CIOA 4PRZA 1PO7A 5IKXA 2FPMA 3VXKA 4D42A 1OF1A 3DD1A 2J9XB 2AVNA 1E1RA 2HNBA 3ER9A 3VNSA 1PT6A 2YOHA 3QKSA 3OESA 3MJRA 1IWBB 2IYZA 1T5HX 4JBHA 4M76B 4ATNA 1Q7BA 3RVNA 3QIVA 5F98A 2DC1A 3X2SA 5I8ZA 2PM8A 3WDKA 5BNIA 1SUCA 4I8XA 2PBFA 2B5WA 1Q91A 3IE2A 1MKYA 4QJIA 4RLQA 3QVGB 3I92A 4FUTA 3RANA 2MSCB 2NOAA 4BO1A 2PHZA 4C0BA 1SKMA 3NFYA 2LDXA 3G88A 2MR5A 3L7YA 4Z8XA 3AV3A 5CUQA 3OC0A 3SVTA 3KL2A 1IZ9A 5DOVA 1KMIY 5E2BA 4LN1A 2WWVD 4CT0A 4ZDWA 2CHQA 4JT8A 3JCZA 3PDWA 3S2EA 1E0AA 5TQVA 5L53A 2O5EA 3EAGA 4EJSB 4CDGA 4D96A 1NDUA 1O3YA 1ST2A 1TPZA 4BFVA 2BFOA 3MW8A 3WGNA 2OUKA 4GX5A 1QS0A 2XUZA 5CEEA 2P79A 2LPMA 2WV7A 3HU3A 3R0VA 2X0RA 1UBEA 4FU0A 1W87A 2OAQ1 4OL9A 2XZTA 1MO4A 5C5CA 4ZAZA 2QD3A 1FLVA 1HFWA 2PY6A 3JAKA 2M1ZA 4KAAA 4YJ3F 3V7NA 2QZJA 3RO7A 1KJJA 3ZEIA 1CEQA 1MO3A 2BKEA 4B0PA 1UT8A 4V39A 2ROQA 3P94A 3NIBA 4CMIA 2VJQA 1U0OC 2JGKA 4GQAA 4EVRA 5J4VA 1TJ3A 3FNBA 4PC6A 4WT7A 5G0WA 2O3UA 4C30A 1W5FA 4B46A 1LV7A 2RKBA 2PGJA 4Z53A 4NABA 2J85A 2BEWB 4IJVA 4RETA 1AKTA 5DYNA 4V0QA 5KHAA 2QX7A 3R5FA 2YWJA 1K4YA 3AF2A 4KQ6A 2ZBPA 2OQ2A 3AR2A 3KQWA 2ZZNA 2W2VA 2GJ8A 2H4WA 2XNKA 3QVGA 1JMVA 2ACVA 3HUTA 4WINA 3W8EA 4EKYA 1FLAA 3QBDA 3CH4B 1AH2A 2J3KA 1QV9A 5LB2A 5AVUA 4BVLA 1AN9A 2PR7A 2OZKA 3DEFA 1JLLA 1P91A 1ZUD1 4K26A 5JBIA 2WHPA 3NONA 1KIMA 3PB3A 5JOQA 4YCMA 1QU2A 4KXLA 3F1LA 3O38A 1T26A 2ZATA 3DDHA 3K0CA 3S2FA 2FRVA 2GERA 1GTG1 2AG0A 5DHTA 5JSZA 3GLTA 3M5PA 3HTXA 1P5JA 2NSJA 2BMJA 3EPRA 1W5EA 3C8DA 4CI0B 3W6UA 4E22A 3SM3A 3BMCB 5ILOA 3ESQA 3C8UA 2ZYRA 4YCAA 3WKCA 1YK1A 3H9EO 4NBKA 3CRNA 3SXJA 3W1EA 2QV7A 2H2DA 2MYNA 1USIA 1VIVA 4QDUA 3CZQA 3UXYA 5FOQA 4NFYA 3VAZA 3P52A 2I2BA 4MVJM 4MYDA 3TW8A 4D8YA 3H5AA 4ZAVA 1VC2A 3P96A 2ETXA 3QVLA 4BRZA 4EI2A 2QMOA 3AIOA 3TL3A 1Q7TA 1Y1TA 3E9EA 3GEHA 4LQCA 3RREA 1RBQA 2C7OA 1LTKA 3JWEA 3SU8A 5L3ZA 2FPGB 3KV1A 1RKUA 1VLZA 2FN7A 4KHPB 4BQPA 4N6NA 1ZGJA 1GHTA 2RBEA 4DJEC 1W5BA 4YDSA 4DQVA 4X00A 4JL6A 4P4UA 2JHCA 1NN0A 1YAHA 3OIUA 3OZWA 4Q01A 3U7QB 4TSKA 3TQTA 2PKYX 1MRNA 4RK7A 2FQ1A 2HQRA 2VF5X 4LZAA 4JIMA 2GB4A 5E1DA 3B6EA 1G8KA 4OXIA 3M1IA 3ZHUA 2HJSA 2V7WA 4PXSA 2OBYA 2VF7A 4DM7A 1X19A 4C5CA 1HNXB 3QYFA 1M1YA 3EFEA 2B8JA 2JJMA 2GTPA 3I9MA 1U2GC 4PYQA 4OO3A 5EP1A 4A26A 2Q5OA 2PAAA 3OX4A 5CEFA 3K9FC 2CHUA 2P4EA 4X61A 3E0QA 1OYYA 3I9KA 2DSTA 4QRDA 4HT3B 4CF7A 3TZLA 1XZLA 5IVPA 3CKMA 5LNK1 4B6GA 2C95A 1NMSA 1DIHA 1SJ9A 4RF2A 1QVWA 1L7VC 3GN1A 4Z8YA 5JANA 3UJNA 1VDZA 4MR8B 4RIGA 4UNQA 4E5UA 1AZWA 2I2CA 3B85A 2JJ2D 1Z45A 4N3CA 4QBIA 2ZYSA 1UZNA 1T1JA 3FTNA 4H3VA 1ECBA 1R4MA 1U11A 4DEVA 1QGUB 4RSGA 5ITVA 4PO9A 5CIYA 1NDQA 3KAQA 4AJOA 3PPVA 4DT1B 5JY1A 2AR0A 4F56A 3GO4A 5A7FA 5KSOA 3TLXA 2JAQA 1YJXA 2GHIA 4PINA 3QF4A 1ZBDA 4I4TA 4ALLA 3T5BA 2I4IA 4Z7OB 1CBUA 1JU4A 4C04A 2XZPA 5LP6A 1V37A 5CDUA 1TO6A 2FAXA 2ZRCA 1MABA 3KQYA 2A9KA 5IJXA 1TC1A 4Y9SA 1ZINA 2E1RA 3H2SA 2B4AA 3WS7A 3O4VA 4E6PA 2DHRA 2UYCA 1BDJA 2P41A 3OIGA 2WW8A 3Q1KA 4HDMB 1PTJC 3D0OA 1VM6A 5HTKA 1CY1A 3GT7A 5ETJA 4RDCA 2EKZA 4ZVTA 4D7AA 1GPNA 1Q83A 2IY7A 2WVHA 1VMAA 3DWIA 3HKEA 3AJ9A 5DO9A 1PL6A 4M60A 5CLGA 5UKDA 3G2LA 5GV7A 2QAGC 2EC5A 4Y1FA 4CQJA 2J32A 5LNK6 1E7SA 3FVRA 4H9GA 3B1YA 1W8DA 4O02B 3ORSA 4AG5A 3EIUA 3ENWA 3KSRA 1QF9A 3VR0A 2XWJI 3AESA 2J33A 2UZ3A 4YC7A 1Z29A 2YIDA 3SBDA 1N9KA 3IPAA 3PGVA 3SLGA 2HA2A 3X43A 4FINA 3FH0A 4I3GA 3ZPXA 2P4UA 4QOIA 4KR2A 1C0PA 1HT1E 2ET6A 3LFHA 1ZJJA 3U3JA 5DWQA 3PIDA 1FTYA 5U9CA 1DDOA 1K6MA 1SB8A 1TUBB 4RDXA 4RKWA 3WDMA 2WLSA 2CNLA 5F33A 3EYAA 4IIXA 5CH5A 3WXBA 4LGCA 2OGWA 2C77A 5JDCC 2O0KA 1MQ8B 3GFOA 1N36B 5LP6F 2Y27A 1Y6QA 2EBFX 2BTOA 4FK8A 2QM0A 3FNGA 1QX4A 1JT2A 2IPAB 1E7QA 3RQSA 3VR5D 5I4KA 2G72A 1HYGA 1HQDA 3RVKA 3OOWA 1UDCA 4XPIB 4EHNA 4H0CA 2B21A 4MUAA 2C54A 2OM2A 1PEDA 5H7XA 2DULA 6AT1A 4V24A 1I6WA 2Y1EA 3LC2O 5MFZA 4AMUA 3HXPA 2A0YA 3T35A 4M7PA 3IUSA 3QLTA 4FGUA 1SCJA 1RWMA 2PUGA 2VDWB 4FHGA 3OQIB 1ONSA 3OE7A 3Q88A 5F4ZA 1AQJA 4EGSA 1ECJA 3BULA 1SQ6A 3OX2A 1VLLA 4NH0A 4FMDB 3U0BA 5FA5A 2VA9A 1VPWA 2ZCJA 3W2GA 1U80A 3FW1A 4EDHA 3HGTA 1EB9A 1Z7EA 3RJ5A 1AK9A 3ES9A 5JQGA 3R5HA 1MBZA 4DTIA 4KBFA 3IKMB 2LVBA 2AQIA 4L16A 4FEEA 3E9DA 4E5PA 4F6CA 3SMVA 5FWYA 5EQFA 1Q0TA 5CLFA 5IJWA 1G59A 3R9KA 3WGYA 2MSWA 4YV7A 2EZ9A 3MAAC 3N2NA 1KMHB 1H42A 2IZ7A 2FPLA 4R3UC 3VAYA 2WHPB 1B3RA 5HEKA 4YASA 1Q20A 9LDBA 3SM9A 1D09A 1XLWA 4NECA 3NVKI 4UEWA 4OHBA 2ZUSA 1U1FA 2VKTA 2C3MA 2PPLA 3B5EA 1I6KA 3H9BA 3PX2A 1DQYA 1P5ZB 5FJIA 4Y9DA 3WLFA 2GM3A 1BTOA 1CUYA 4QELA 3ZUPA 4HNSA 3VHLB 2RK4A 2DU8A 4IH1A 5KWVA 1KI3A 2VP2A 3L0YA 4TLEA 4Y9RA 2QE7D 1XT6A 3WLNA 3R2JA 3E1KA 2C0QA 4OI2A 1J8FA 1X7XB 1R6AA 3B9PA 1N8NA 4O2AA 4PSVA 5HF6A 3P0IA 5HM8A 4DDVA 2IYLD 4YR7A 1YDMA 1PFYA 2IEYA 5MF6A 3L7LA 1K7XB 3WI7A 2G63A 4NMWA 1DBIA 2A4MA 3GRFA 3QUQA 4BFYA 3V34A 4OCZA 3K09A 4CEJB 5CVJA 3IQZA 2WTEA 4BQSA 4DA9A 4PG7A 3MA0A 1TKAA 2EHJA 2ZUWA 3MJSA 4AN4A 1N25A 2YQZA 1IQPA 1ZUNB 4AZTA 4FB4A 2RG1A 2VA8A 4JK3A 1XHEA 3EFBA 2WC1A 4PX3A 4O3FA 3J80A 3P9SA 5DN9A 2JL1A 4YRAA 3U4MA 3P9IA 4C0HA 2ZYHA 4AJEA 4R1SA 4RVNA 1NI5A 1SUDA 1CFZA 3AY6A 2X2EA 3RI3A 2NUBA 5CURA 1RIFA 4WOPA 3LWDA 1CUEA 1Y81A 5AM5A 2WFZA 4WFKA 1U99A 3KBBA 3HKDB 3ZNQA 4E14A 1PZXA 2Z9DA 2ZU6A 4UPVA 2NYRA 5AW8A 4MQ5A 4WAUA 1CUFA 3PTLA 1QYCA 1CB7A 4H59A 5CDHA 1FU4A 1XMOB 4N39A 2G36A 2JS7A 1SKYB 5AK4A 4LX0A 1EGVB 4YY3B 2FK8A 3ABZA 1Y5RA 4GR4A 2C2GA 3TE7A 4ZVLA 4C87A 1EJBA 3A0RB 4DSOA 1DCFA 4G23A 1C9MA 5CX4A 2I9KA 1T0HB 2JIZD 3T3PB 1H6DA 4MWGA 3JD0A 1A97A 1PAUA 4DSZA 4W82A 4JI7B 3R44A 1HGXA 2ATIA 4TOIA 4YLYA 4IO0A 2O8BB 2V59A 2OZLA 4Q12A 3TKLA 3GGSA 1FU7A 4JXZA 1B74A 1XTIA 1IBRA 4B4DA 2OQIA 2PKQO 1PLKA 1Q0SA 2X0IA 1WP4A 2AF4C 4J7UA 5E1BA 4G4JA 5AW0A 1RAGA 1RHQA 4IIHA 3WB2A 4YT2A 3O8RA 2ERYA 1FSSA 4KPGA 4J7AA 4LJ9A 4BEVA 3EPKA 3H0KA 2QRNA 4BQEA 1XTSA 1RQRA 3ETDA 5F2OA 3KDSE 2BELA 2J9YB 3T15A 4C3UA 2CHEA 3NHWA 3BZWA 2Q8NA 3V2IA 3QYAA 1TCBA 1G2PA 4RA9B 4DIMA 3EW9A 3RCBA 3PUWA 2QTZA 5DXJA 1XNGA 2F62A 5TT0A 2WIKA 4KVGA 4WK2B 5COAA 2C9YA 3ZXYA 1RXYA 1XMQB 5GY7A 3T0FA 2J0UA 3KM0A 2BPOA 4NTZA 5H3HA 4JBWA 4BQQA 3VSBA 1SU7A 2A9VA 2YXDA 5EZYF 4DARA 5FADA 5AUQA 3SS9X 5JXIA 3VPGA 2IIPA 2OXIA 5D51S 1ZR4A 2JFUA 5A4DA 3QBEA 2BUBA 1U98A 1A8HA 1BZYA 3FM9A 2JFYA 4DYDA 3D2BA 4HNAB 5I7OA 2OD9A 2WSSA 4NDAA 3FTQA 3EGXB 4CV0A 1E3TA 4RIEA 4WXHA 3EGDA 5F1OA 3FXAA 5JS2A 3WGZA 1BCSA 1PG0A 4CM6A 3M3DA 2GASA 2OCAA 3CB4A 4FP9A 2EP7A 1K92A 2QVZX 2QTTA 3AP1A 1XZQA 4IDNA 4J6FA 1UKAA 4K3VA 2DWPA 2EG5A 2PMFA 3L7DA 4UHBA 1WHSA 3EYWA 1U04A 4I5GA 5LZ8A 4HUTA 1JLSA 3AFOA 3WO0A 1C5KA 1BU8A 1E69A 1YS9A 3FROA 4AP5A 3COSA 3PGLA 5IVKA 1P5RA 3K30A 3OPYA 5ICFA 4C4TA 2HHJA 1U9IC 2OOKA 1HE8B 3AUYA 2X86A 3P9PA 2BFFA 4UUNA 5JH7A 4KXWA 4LV5B 1YE3A 2J9FA 3PRHA 4NHEA 3RYCA 1JIQA 4KFCA 3DOIA 2B8EA 5CJJA 3CR3C 2IF0A 1W4LA 3PGJA 5C31A 5THQA 3LUGA 3PRKE 4DSTA 4AF6A 1IBLB 4EHDA 1Y8QB 3I76A 2R79A 2XKAA 4R0MA 3BJMA 1ZL0A 2DH5A 2LE0A 4HHEA 1YV9A 3EIWA 1XZCA 3GXOA 5E7QA 3PV0A 2YASA 1YHYA 2IPXA 4IVNA 1BA2A 1VKHA 2NXEA 4BLSA 1N5DA 2GCPA 1ETHA 1THMA 1BN6A 3ZV7A 1TM3E 4EUFA 1CUBA 4TTAA 3HBNA 3UQZA 3R9IA 4TV9B 2OCGA 3KT6A 8ADHA 1DJNA 1IAVA 2D5AA 2FN3A 2PA3A 4FKBA 4MP3A 3MTIA 4X1IA 4ZQIA 3SZMA 1XVAA 2Z1MA 3SHFA 2VBCA 1MAAA 2X7HA 5TPZA 4C14A 4RPKA 3ZHOA 2DG2A 1DKQA 4MUBA 1X9HA 1J24A 4HTAA 3X1KA 1DBSA 2F1KA 5LP1A 1L8OA 5A5VA 2IV2X 2QN3A 1Y9AA 4BLWA 3BL6A 1L5FA 2FEAA 5KYXB 2RI6A 3CQ9A 1I80A 1Z26A 4RZ2A 4DZZA 1E1QA 1RC8A 4HNHA 4Q3OA 2HGSA 2OXCA 2GCOB 4EG4A 2BHTA 2R5FA 3DFZA 3PD7A 1FE8A 1W5AA 3RSSA 3PXBA 4JI2B 1F3OA 1PEYA 5C7YA 4PHTA 1MB4A 5HTOA 1JF8A 1X7HA 3B12A 2X0FA 4AY2A 4B34A 2W2TA 1QYIA 2PSDA 4YIHA 3HR7A 2GN1A 2VHTA 3ZN2A 3GC6A 1DJLA 1JTEA 4EPYA 2J5KA 1XMVA 2JW5A 3SYLA 3SEAA 5J4KA 4CM5A 1JB1A 4FHDA 1XNJA 5IUNC 3A6GA 4IWYA 1VG0B 1R0XA 2A1TR 1DINA 3T41A 3ZQ4A 4BOYA 4LRQA 5LQNA 2E37A 1DWOA 2WUFA 2NZJA 2HYIC 4I5IA 3LBHA 4RZ3A 1EK1A 3N74A 4ZFNA 1SZPA 4RMNA 1MXHA 5A5GA 1EQAA 5HJEA 5I45A 3ETCA 5L7YA 1G8AA 4NATA 1VPLA 4U7PB 3KU1A 4X7PA 2XUAA 3F73A 4ZPJA 4RKYA 1T24A 3Q7RA 4JYZA 1A69A 4HKTA 2HQ1A 4ID3A 2DPXA 2V3VA 4UE2A 4UQLA 1MNQA 4BUCA 4FGKA 1RVV1 2QZZA 4B32A 2LIVA 4IHJF 3NWJA 4RKQA 3RJTA 3QMMA 5H83A 2EX1A 3GJ6A 2A5GA 2EWVA 1EE9A 4K6MA 3KTAA 5FWNA 1GLVA 2CN1A 3HJHA 4U6SA 4M1YA 2J6BA 3V1KA 5HCIA 4IINA 2VK2A 4KQMA 3M4YA 3KAJA 3HEAA 1QCCA 4EA8A 4BV3A 1JLMA 2AMFA 4XSHA 1V3UA 3UHPA 5L6MB 1WCYA 1A2QA 3T3NA 3B82A 2W98A 4FBLA 2COUA 1Z5NA 2DFTA 2W8ZA 1ONPA 4YCJA 4EKDA 1PWXA 3ORFA 1FFSA 2JKVA 1QE3A 3NP9A 1AUQA 2WJJA 2YWEA 3RB8A 1MB2A 3A1TA 3AL2A 2YMLA 4WJZA 4N40A 5ECGC 3E3LA 1O08A 3DMRA 1M7BA 1DZIA 3EPPA 1MFZA 1Y0BA 3RS7A 3EFHA 1OXUA 1UQRA 1TYDE 2P9JA 4JYBA 3THRA 4ZI3A 1GCIA 3K8QA 2R5NA 4ER6A 3LPAA 2GMWA 4QXRA 1U1IA 3S8MA 4ZI7F 2Q9CA 4PZYA 2OECA 2YHSA 2ANBA 3ABSB 1R0KA 4N41A 3BRQA 3Q9SA 5T7BA 2G5CA 1V9LA 2GS9A 1OD6A 3RABA 2I6TA 1S89A 2FG7C 3REQA 4D82A 3GN2A 1BAPA 3FMVA 2WAYA 1G64A 2B7BA 1ODFA 3B1ZA 1P4SA 2IUUA 2XADA 3PPXA 3R6GA 5HKBA 4IRUB 3R4VA 3UV7A 5J23A 1DHTA 3IOYA 2WMYA 4GVPA 3H8WA 2Y1GA 2ZPUA 2YZNA 4QJ4A 1P3DA 3N59A 5JQWA 3QK7A 4J91A 4DCMA 4CLRA 8ATCA 5DGHA 1ZMRA 2QRGA 4KE9A 1NZJA 1ZO8A 4RW0A 3N07A 3MCWA 5DK4A 3LKZA 4JNKA 4UBLA 3F5QA 5CA1A 5C46F 4KXNA 1QBKC 1QBGA 3EDMA 3PPYA 4I4TF 1N77A 1IOVA 1FJHA 3U44A 3W77A 1KBQA 4G0VA 4MI1A 5K6TA 1GRVA 721PA 3GHYA 3IIKA 3NAQA 2WM8A 4XE5A 4P38A 2Z2KA 3JQ8B 4R1PA 5ARCA 2ZVJA 1CUZA 5FI1B 3S44A 3SQLA 1PLLA 4N03A 1EGMB 3T7CA 4E2WA 4DV2B 2DUJA 3M9WA 4RDHA 4EL0A 3F98A 4GOKA 1W35A 4JEHA 3V8MA 7REQA 1CVIA 1FUIA 4FEYA 3USES 6Q21A 1GSHA 3ITEA 4YAUA 5AVTA 2VDQB 3MBOA 3A28A 1LRLA 4BVAA 3AILA 2D74A 1HQCA 4IHQA 3L6UA 3PUJA 4IGEA 4AJHA 1F8FA 3OQJA 1UBKS 2HI0A 3CLVA 1W4CA 2IHZA 4YN3A 4LWOA 5LZ5A 2QLLA 3L07A 5EJEA 1M75A 3IDQA 4LGYA 1UIMA 4PQFA 3ZCXA 3GCWA 5IEJA 2AOUB 2ISCA 1FW8A 2GOYA 1XK7A 3UA4A 1Z5OA 4DLZA 5JECA 4PXYA 2ZE8A 4ENVA 2AH5A 5DBHX 2WU8A 4DHEA 1GFWA 3NCTA 4F91B 2L2QA 3I2KA 1HQYE 1NSYA 4P4SA 4I55B 4PLCA 2QR2A 3W79A 3QLUA 3V9PA 1KJ8A 4N7JA 3JYPA 4TX1A 5BWOA 5KOHB 4NPHA 1LWOA 3D6VA 2XKJE 3VSDA 1X92A 3TLKA 4MR9B 4EAAA 4WCVA 1RRGA 4V0MA 2XOKA 3GCZA 1KL7A 5BWCA 1RMYA 1BO6A 3OETA 1VJ0A 4F9EA 3JQ7A 4MAFA 1YRAA 2EJUA 3HA7A 4L6IA 1CZRA 2R00C 2UV8A 5DASA 5DT2A 5EP4A 1L3BA 4DL9A 3BL8A 3A4NA 3NXKA 3SYKA 2WSBA 1CSEE 4MTCA 4MVCA 5CNJA 4BO2A 4CLHA 7REQB 2ZUFA 3LO5A 4A0SA 1Y6FA 1SOMA 2CYCA 4PQGA 3GQVA 1SCKA 3OIFA 1YUNA 3TZKA 3LXMA 3C16C 3ESZA 1DC7A 4ZT3A 3SHWA 2X3FA 4ISBA 4PYOA 2G06A 3NHRA 4GE3A 5F7ZA 2W0SA 3UJPA 1A0OA 1XEAA 2IQ5A 4AIIA 1GWNA 2NO6A 3GJXC 5BYBA 2GBIA 2NZ2A 3GB9A 2IPMA 1G16A 2VUUA 1T1GA 4H6XA 4Q15A 3L7IA 3Q7PA 4K0KB 5JC1A 3KYJB 1LI4A 3IMCA 1T9BA 1AV6A 4KGXA 2ZRPA 3KD3A 2ALJA 2ZUCA 1F1JA 4BZQA 1M3SA 4OLBA 1IRXA 2IOQA 3KG2A 1U2DA 1KS9A 3C3YA 3E23A 4HXFB 2QUAA 5A62A 4ZEVA 2ZLBA 4IRXA 2AB0A 3T99A 3W90A 5IJAA 1WHTA 1QLHA 4P08A 4Q9KA 2M98A 6PFKA 1LU9A 1M8KA 2AOXA 2OWDA 3RV4A 3EZXA 4DMMA 4N12A 1KK1A 1GXSA 2XDQB 5U4QA 4XTCS 3UWKA 2FUKA 4PLWA 2VRBA 2XUGA 3DPSA 4BCDA 1E5DA 5C18A 1QG4A 1WCWA