5K22B

Crystal structure of the complex between human prl-2 phosphatase in reduced state and bateman domain of human cnnm3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
149
structure length
149
Chain Sequence
GPLNMIQGVLELRCRTVEDVLTPLEDCFMLDASTVLDFGVLASIMQSGHTRIPVYEEERSNIVDMLYLKDLAFVDPEDCTPLSTITRFYNHPLHFVFNDTKLDAVLEEFKRGKSHLAIVQKVNNEGEGDPFYEVLGLVTLEDVIEEIIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Phosphocysteine in the PRL-CNNM pathway mediates magnesium homeostasis.
pubmed doi rcsb
molecule keywords Protein tyrosine phosphatase type IVA 2
molecule tags Transport protein/protein binding
source organism Homo sapiens
total genus 36
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 5k22B00
2RIHA 4GQWA 2QH1A 5K25C 4IY0A 4L27A 3KPDA 3LQNA 2OOXE 4ESYA 3LV9A 5LXQA 5MMZA 2UV7A 2ZY9A 4L28A 2YZIA 3L2BA 2UV5A 2QLVC 3K6EA 2RC3A 3OI8A 4PCUA 3T4NC 3FWSA 3KPBA 4O9KA 3KH5A 3KPCA 2OOYE 2QR1E 2YVXA 4GQVA 4COOA 3LFZA 2D4ZA 4DQWA 2RIFA 2NYCA 1YAVA 5K22B 1PVMA 3ORGA 3K2VA 4IY4A 5IIPA 3FV6A 3DDJA 3I8NA 3SL7A 2O16A 1Y5HA 2QREE 3FHMA 2EMQA 3FNAA 4P1GA 5K24C 2YVZA 2PFIA 4IY2A 1XKFA 2OUXA 4UUUA 2EF7A 1O50A 4L3VA 5KS7A 3PC4A 4NOCA 1PBJA 3L31A 3HF7A 2YZQA 4IYSA 2UV6A 3PC3A 5K23C 4GQYA 3KXRA 3OCMA 3PC2A 3OCOA 3TE5C 4ESYB 2P9MA 2QRDE 2YVYA 3FWRA 3GBYA 2UV4A 3TDHC 4HG0A 2QRCE 4P1OA 4FRYA 2NYEA 4IY3A 4FXSA 3LHHA 4L0DA
chains in the Genus database with same CATH superfamily
2RIHA 4GQWA 2QH1A 5K25C 4IY0A 4L27A 3KPDA 3LQNA 2OOXE 4ESYA 3LV9A 5LXQA 5MMZA 2UV7A 2ZY9A 4L28A 2YZIA 3L2BA 2UV5A 2QLVC 3K6EA 2RC3A 3OI8A 4PCUA 3T4NC 3FWSA 2JA3A 3KPBA 4O9KA 3KH5A 3KPCA 2OOYE 2QR1E 2YVXA 4GQVA 4COOA 3LFZA 2D4ZA 4DQWA 2RIFA 2NYCA 1YAVA 5K22B 1PVMA 3ORGA 3K2VA 4IY4A 5IIPA 3FV6A 2J9LA 3DDJA 3I8NA 3SL7A 2O16A 1Y5HA 2QREE 3FHMA 2EMQA 3FNAA 4P1GA 5K24C 2YVZA 2PFIA 4IY2A 1XKFA 2OUXA 4UUUA 2EF7A 1O50A 4L3VA 5KS7A 3PC4A 4NOCA 1PBJA 3L31A 3HF7A 2YZQA 4IYSA 2UV6A 3PC3A 5K23C 4GQYA 3KXRA 3OCMA 3PC2A 3OCOA 3TE5C 4ESYB 2P9MA 2QRDE 2YVYA 3FWRA 3GBYA 2UV4A 3TDHC 4HG0A 2QRCE 4P1OA 4FRYA 2NYEA 4IY3A 4FXSA 3LHHA 4L0DA
chains in the Genus database with same CATH topology
2RIHA 4GQWA 2QH1A 5K25C 4IY0A 4L27A 3KPDA 3LQNA 2OOXE 4ESYA 3LV9A 5LXQA 5MMZA 2UV7A 2ZY9A 4L28A 2YZIA 3L2BA 2UV5A 2QLVC 3K6EA 2RC3A 3OI8A 4PCUA 3T4NC 3FWSA 2JA3A 3KPBA 4O9KA 3KH5A 3KPCA 2OOYE 2QR1E 2YVXA 4GQVA 4COOA 3LFZA 2D4ZA 4DQWA 2RIFA 2NYCA 1YAVA 5K22B 1PVMA 3ORGA 3K2VA 4IY4A 5IIPA 3FV6A 2J9LA 3DDJA 3I8NA 3SL7A 2O16A 1Y5HA 2QREE 3FHMA 2EMQA 3FNAA 4P1GA 5K24C 2YVZA 2PFIA 4IY2A 1XKFA 2OUXA 4UUUA 2EF7A 1O50A 4L3VA 5KS7A 3PC4A 4NOCA 1PBJA 3L31A 3HF7A 2YZQA 4IYSA 2UV6A 3PC3A 5K23C 4GQYA 3KXRA 3OCMA 3PC2A 3OCOA 3TE5C 4ESYB 2P9MA 2QRDE 2YVYA 3FWRA 3GBYA 2UV4A 3TDHC 4HG0A 2QRCE 4P1OA 4FRYA 2NYEA 4IY3A 4FXSA 3LHHA 4L0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RIH A;  4GQW A;  2QH1 A;  5K25 C;  4IY0 A;  4L27 A;  3KPD A;  3LQN A;  2OOX E;  4ESY A;  3LV9 A;  5LXQ A;  5MMZ A;  2UV7 A;  2ZY9 A;  4L28 A;  2YZI A;  3L2B A;  2UV5 A;  2QLV C;  3K6E A;  2RC3 A;  3OI8 A;  4PCU A;  3T4N C;  3FWS A;  3KPB A;  4O9K A;  3KH5 A;  3KPC A;  2OOY E;  2QR1 E;  2YVX A;  4GQV A;  4COO A;  3LFZ A;  2D4Z A;  4DQW A;  2RIF A;  2NYC A;  1YAV A;  5K22 B;  1PVM A;  3ORG A;  3K2V A;  4IY4 A;  5IIP A;  3FV6 A;  3DDJ A;  3I8N A;  3SL7 A;  2O16 A;  1Y5H A;  2QRE E;  3FHM A;  2EMQ A;  3FNA A;  4P1G A;  5K24 C;  2YVZ A;  2PFI A;  4IY2 A;  1XKF A;  2OUX A;  4UUU A;  2EF7 A;  1O50 A;  4L3V A;  5KS7 A;  3PC4 A;  4NOC A;  1PBJ A;  3L31 A;  3HF7 A;  2YZQ A;  4IYS A;  2UV6 A;  3PC3 A;  5K23 C;  4GQY A;  3KXR A;  3OCM A;  3PC2 A;  3OCO A;  3TE5 C;  4ESY B;  2P9M A;  2QRD E;  2YVY A;  3FWR A;  3GBY A;  2UV4 A;  3TDH C;  4HG0 A;  2QRC E;  4P1O A;  4FRY A;  2NYE A;  4IY3 A;  4FXS A;  3LHH A;  4L0D A; 
#chains in the Genus database with same CATH topology
 2RIH A;  4GQW A;  2QH1 A;  5K25 C;  4IY0 A;  4L27 A;  3KPD A;  3LQN A;  2OOX E;  4ESY A;  3LV9 A;  5LXQ A;  5MMZ A;  2UV7 A;  2ZY9 A;  4L28 A;  2YZI A;  3L2B A;  2UV5 A;  2QLV C;  3K6E A;  2RC3 A;  3OI8 A;  4PCU A;  3T4N C;  3FWS A;  2JA3 A;  3KPB A;  4O9K A;  3KH5 A;  3KPC A;  2OOY E;  2QR1 E;  2YVX A;  4GQV A;  4COO A;  3LFZ A;  2D4Z A;  4DQW A;  2RIF A;  2NYC A;  1YAV A;  5K22 B;  1PVM A;  3ORG A;  3K2V A;  4IY4 A;  5IIP A;  3FV6 A;  2J9L A;  3DDJ A;  3I8N A;  3SL7 A;  2O16 A;  1Y5H A;  2QRE E;  3FHM A;  2EMQ A;  3FNA A;  4P1G A;  5K24 C;  2YVZ A;  2PFI A;  4IY2 A;  1XKF A;  2OUX A;  4UUU A;  2EF7 A;  1O50 A;  4L3V A;  5KS7 A;  3PC4 A;  4NOC A;  1PBJ A;  3L31 A;  3HF7 A;  2YZQ A;  4IYS A;  2UV6 A;  3PC3 A;  5K23 C;  4GQY A;  3KXR A;  3OCM A;  3PC2 A;  3OCO A;  3TE5 C;  4ESY B;  2P9M A;  2QRD E;  2YVY A;  3FWR A;  3GBY A;  2UV4 A;  3TDH C;  4HG0 A;  2QRC E;  4P1O A;  4FRY A;  2NYE A;  4IY3 A;  4FXS A;  3LHH A;  4L0D A; 
#chains in the Genus database with same CATH homology
 2RIH A;  4GQW A;  2QH1 A;  5K25 C;  4IY0 A;  4L27 A;  3KPD A;  3LQN A;  2OOX E;  4ESY A;  3LV9 A;  5LXQ A;  5MMZ A;  2UV7 A;  2ZY9 A;  4L28 A;  2YZI A;  3L2B A;  2UV5 A;  2QLV C;  3K6E A;  2RC3 A;  3OI8 A;  4PCU A;  3T4N C;  3FWS A;  2JA3 A;  3KPB A;  4O9K A;  3KH5 A;  3KPC A;  2OOY E;  2QR1 E;  2YVX A;  4GQV A;  4COO A;  3LFZ A;  2D4Z A;  4DQW A;  2RIF A;  2NYC A;  1YAV A;  5K22 B;  1PVM A;  3ORG A;  3K2V A;  4IY4 A;  5IIP A;  3FV6 A;  2J9L A;  3DDJ A;  3I8N A;  3SL7 A;  2O16 A;  1Y5H A;  2QRE E;  3FHM A;  2EMQ A;  3FNA A;  4P1G A;  5K24 C;  2YVZ A;  2PFI A;  4IY2 A;  1XKF A;  2OUX A;  4UUU A;  2EF7 A;  1O50 A;  4L3V A;  5KS7 A;  3PC4 A;  4NOC A;  1PBJ A;  3L31 A;  3HF7 A;  2YZQ A;  4IYS A;  2UV6 A;  3PC3 A;  5K23 C;  4GQY A;  3KXR A;  3OCM A;  3PC2 A;  3OCO A;  3TE5 C;  4ESY B;  2P9M A;  2QRD E;  2YVY A;  3FWR A;  3GBY A;  2UV4 A;  3TDH C;  4HG0 A;  2QRC E;  4P1O A;  4FRY A;  2NYE A;  4IY3 A;  4FXS A;  3LHH A;  4L0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...