5K23C

Crystal structure of the complex between human phosphatase prl-2 in the oxidized state with the bateman domain of human magnesium transporter cnnm3
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
GPLNMIQGVLELRCRTVEDVLTPLEDCFMLDASTVLDFGVLASIMQSGHTRIPVYEEERSNIVDMLYLKDLAFVDPEDCTPLSTITRFYNHPLHFVFNDTKLDAVLEEFKRGKSHLAIVQKVNNEGEGDPFYEVLGLVTLEDVIEEIIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title PRL3 phosphatase active site is required for binding the putative magnesium transporter CNNM3.
pubmed doi rcsb
molecule keywords Protein tyrosine phosphatase type IVA 2
molecule tags Hydrolase/transporter protein/protein binding
source organism Homo sapiens
total genus 38
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 5k23C00
4GQVA 3K6EA 2QREE 2QRCE 4NOCA 4L0DA 4IY3A 2QRDE 3KXRA 4P1OA 3KPBA 5K22B 3PC4A 4ESYA 3OCMA 4ESYB 1XKFA 4GQYA 4DQWA 4GQWA 3LHHA 2RIHA 3K2VA 2P9MA 2UV7A 2OUXA 2QR1E 4L27A 3T4NC 2D4ZA 3LV9A 4FRYA 4HG0A 2QH1A 2ZY9A 4O9KA 2RC3A 3OCOA 3TDHC 3KPDA 3I8NA 2UV5A 3LFZA 2YZIA 3PC3A 5K25C 5K23C 3OI8A 3PC2A 3TE5C 5KS7A 2OOXE 2NYEA 3FV6A 3KH5A 4PCUA 3FHMA 1O50A 2O16A 2EF7A 2YVYA 2NYCA 4FXSA 3LQNA 3FWSA 3L31A 2UV4A 3ORGA 2OOYE 3FWRA 5MMZA 3GBYA 3L2BA 4IYSA 2YZQA 4IY2A 4L3VA 4UUUA 3DDJA 4L28A 2PFIA 3KPCA 4COOA 1PBJA 1Y5HA 2UV6A 3HF7A 3FNAA 2QLVC 1PVMA 2YVZA 2YVXA 5IIPA 5LXQA 4IY0A 1YAVA 4IY4A 3SL7A 5K24C 2RIFA 2EMQA 4P1GA
chains in the Genus database with same CATH superfamily
4GQVA 3K6EA 2QREE 2QRCE 4NOCA 4L0DA 4IY3A 2QRDE 3KXRA 4P1OA 3KPBA 5K22B 3PC4A 4ESYA 3OCMA 4ESYB 1XKFA 4GQYA 4DQWA 4GQWA 3LHHA 2RIHA 3K2VA 2P9MA 2UV7A 2OUXA 2QR1E 4L27A 3T4NC 2D4ZA 3LV9A 4FRYA 4HG0A 2QH1A 2ZY9A 4O9KA 2RC3A 3OCOA 3TDHC 3KPDA 3I8NA 2UV5A 3LFZA 2YZIA 3PC3A 5K25C 5K23C 3OI8A 2J9LA 2JA3A 3PC2A 3TE5C 5KS7A 2OOXE 2NYEA 3FV6A 3KH5A 4PCUA 3FHMA 1O50A 2O16A 2EF7A 2YVYA 2NYCA 4FXSA 3LQNA 3FWSA 3L31A 2UV4A 3ORGA 2OOYE 3FWRA 5MMZA 3GBYA 3L2BA 4IYSA 2YZQA 4IY2A 4L3VA 4UUUA 3DDJA 4L28A 2PFIA 3KPCA 4COOA 1PBJA 1Y5HA 2UV6A 3HF7A 3FNAA 2QLVC 1PVMA 2YVZA 2YVXA 5IIPA 5LXQA 4IY0A 1YAVA 4IY4A 3SL7A 5K24C 2RIFA 2EMQA 4P1GA
chains in the Genus database with same CATH topology
4GQVA 3K6EA 2QREE 2QRCE 4NOCA 4L0DA 4IY3A 2QRDE 3KXRA 4P1OA 3KPBA 5K22B 3PC4A 4ESYA 3OCMA 4ESYB 1XKFA 4GQYA 4DQWA 4GQWA 3LHHA 2RIHA 3K2VA 2P9MA 2UV7A 2OUXA 2QR1E 4L27A 3T4NC 2D4ZA 3LV9A 4FRYA 4HG0A 2QH1A 2ZY9A 4O9KA 2RC3A 3OCOA 3TDHC 3KPDA 3I8NA 2UV5A 3LFZA 2YZIA 3PC3A 5K25C 5K23C 3OI8A 2J9LA 2JA3A 3PC2A 3TE5C 5KS7A 2OOXE 2NYEA 3FV6A 3KH5A 4PCUA 3FHMA 1O50A 2O16A 2EF7A 2YVYA 2NYCA 4FXSA 3LQNA 3FWSA 3L31A 2UV4A 3ORGA 2OOYE 3FWRA 5MMZA 3GBYA 3L2BA 4IYSA 2YZQA 4IY2A 4L3VA 4UUUA 3DDJA 4L28A 2PFIA 3KPCA 4COOA 1PBJA 1Y5HA 2UV6A 3HF7A 3FNAA 2QLVC 1PVMA 2YVZA 2YVXA 5IIPA 5LXQA 4IY0A 1YAVA 4IY4A 3SL7A 5K24C 2RIFA 2EMQA 4P1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GQV A;  3K6E A;  2QRE E;  2QRC E;  4NOC A;  4L0D A;  4IY3 A;  2QRD E;  3KXR A;  4P1O A;  3KPB A;  5K22 B;  3PC4 A;  4ESY A;  3OCM A;  4ESY B;  1XKF A;  4GQY A;  4DQW A;  4GQW A;  3LHH A;  2RIH A;  3K2V A;  2P9M A;  2UV7 A;  2OUX A;  2QR1 E;  4L27 A;  3T4N C;  2D4Z A;  3LV9 A;  4FRY A;  4HG0 A;  2QH1 A;  2ZY9 A;  4O9K A;  2RC3 A;  3OCO A;  3TDH C;  3KPD A;  3I8N A;  2UV5 A;  3LFZ A;  2YZI A;  3PC3 A;  5K25 C;  5K23 C;  3OI8 A;  3PC2 A;  3TE5 C;  5KS7 A;  2OOX E;  2NYE A;  3FV6 A;  3KH5 A;  4PCU A;  3FHM A;  1O50 A;  2O16 A;  2EF7 A;  2YVY A;  2NYC A;  4FXS A;  3LQN A;  3FWS A;  3L31 A;  2UV4 A;  3ORG A;  2OOY E;  3FWR A;  5MMZ A;  3GBY A;  3L2B A;  4IYS A;  2YZQ A;  4IY2 A;  4L3V A;  4UUU A;  3DDJ A;  4L28 A;  2PFI A;  3KPC A;  4COO A;  1PBJ A;  1Y5H A;  2UV6 A;  3HF7 A;  3FNA A;  2QLV C;  1PVM A;  2YVZ A;  2YVX A;  5IIP A;  5LXQ A;  4IY0 A;  1YAV A;  4IY4 A;  3SL7 A;  5K24 C;  2RIF A;  2EMQ A;  4P1G A; 
#chains in the Genus database with same CATH topology
 4GQV A;  3K6E A;  2QRE E;  2QRC E;  4NOC A;  4L0D A;  4IY3 A;  2QRD E;  3KXR A;  4P1O A;  3KPB A;  5K22 B;  3PC4 A;  4ESY A;  3OCM A;  4ESY B;  1XKF A;  4GQY A;  4DQW A;  4GQW A;  3LHH A;  2RIH A;  3K2V A;  2P9M A;  2UV7 A;  2OUX A;  2QR1 E;  4L27 A;  3T4N C;  2D4Z A;  3LV9 A;  4FRY A;  4HG0 A;  2QH1 A;  2ZY9 A;  4O9K A;  2RC3 A;  3OCO A;  3TDH C;  3KPD A;  3I8N A;  2UV5 A;  3LFZ A;  2YZI A;  3PC3 A;  5K25 C;  5K23 C;  3OI8 A;  2J9L A;  2JA3 A;  3PC2 A;  3TE5 C;  5KS7 A;  2OOX E;  2NYE A;  3FV6 A;  3KH5 A;  4PCU A;  3FHM A;  1O50 A;  2O16 A;  2EF7 A;  2YVY A;  2NYC A;  4FXS A;  3LQN A;  3FWS A;  3L31 A;  2UV4 A;  3ORG A;  2OOY E;  3FWR A;  5MMZ A;  3GBY A;  3L2B A;  4IYS A;  2YZQ A;  4IY2 A;  4L3V A;  4UUU A;  3DDJ A;  4L28 A;  2PFI A;  3KPC A;  4COO A;  1PBJ A;  1Y5H A;  2UV6 A;  3HF7 A;  3FNA A;  2QLV C;  1PVM A;  2YVZ A;  2YVX A;  5IIP A;  5LXQ A;  4IY0 A;  1YAV A;  4IY4 A;  3SL7 A;  5K24 C;  2RIF A;  2EMQ A;  4P1G A; 
#chains in the Genus database with same CATH homology
 4GQV A;  3K6E A;  2QRE E;  2QRC E;  4NOC A;  4L0D A;  4IY3 A;  2QRD E;  3KXR A;  4P1O A;  3KPB A;  5K22 B;  3PC4 A;  4ESY A;  3OCM A;  4ESY B;  1XKF A;  4GQY A;  4DQW A;  4GQW A;  3LHH A;  2RIH A;  3K2V A;  2P9M A;  2UV7 A;  2OUX A;  2QR1 E;  4L27 A;  3T4N C;  2D4Z A;  3LV9 A;  4FRY A;  4HG0 A;  2QH1 A;  2ZY9 A;  4O9K A;  2RC3 A;  3OCO A;  3TDH C;  3KPD A;  3I8N A;  2UV5 A;  3LFZ A;  2YZI A;  3PC3 A;  5K25 C;  5K23 C;  3OI8 A;  2J9L A;  2JA3 A;  3PC2 A;  3TE5 C;  5KS7 A;  2OOX E;  2NYE A;  3FV6 A;  3KH5 A;  4PCU A;  3FHM A;  1O50 A;  2O16 A;  2EF7 A;  2YVY A;  2NYC A;  4FXS A;  3LQN A;  3FWS A;  3L31 A;  2UV4 A;  3ORG A;  2OOY E;  3FWR A;  5MMZ A;  3GBY A;  3L2B A;  4IYS A;  2YZQ A;  4IY2 A;  4L3V A;  4UUU A;  3DDJ A;  4L28 A;  2PFI A;  3KPC A;  4COO A;  1PBJ A;  1Y5H A;  2UV6 A;  3HF7 A;  3FNA A;  2QLV C;  1PVM A;  2YVZ A;  2YVX A;  5IIP A;  5LXQ A;  4IY0 A;  1YAV A;  4IY4 A;  3SL7 A;  5K24 C;  2RIF A;  2EMQ A;  4P1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...