5K3DA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - wt/apo - no halide
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
297
structure length
289
Chain Sequence
b'ALADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHDRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGATPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluoroacetate dehalogenase
publication title The role of dimer asymmetry and protomer dynamics in enzyme catalysis.
pubmed doi rcsb
source organism Rhodopseudomonas palustris (strain atcc baa-98 / cga009)
molecule tags Hydrolase
total genus 111
structure length 289
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k3dA00
5D6OA 1UK8A 3LP5A 4B6GA 1EINA 1LNSA 3ICWA 4RE5A 4KRYA 1SC9A 1WB6A 3BWXA 4JYMA 3WLAA 4QDZA 1K8QA 5CT9A 4X3CA 1MNAA 5AI5A 3HSSA 4EY6A 3CXUA 1WPXA 5JAHA 1JJFA 2RAUA 4HRYA 4LXHA 3STYA 2E3JA 3OPMA 3GBSA 3DLTA 3ZI7A 1HBJA 1CUBA 3V1NA 3K9BA 2ONCA 4X90A 1XZMA 2WFLB 2XUGA 4LKOA 4EY7A 2HDWA 2WQZA 3AZQA 3WIOA 3IVMA 1QIDA 4H7IA 5K3FB 1QZ3A 2B20A 4L9AA 1RP1A 2WHQA 4RE6A 4Y2XA 1IUNA 1E5TA 2QMQA 3I1YA 4LYDA 3H2HA 4UHDA 4FMPA 2OLEA 4G5XA 4W9RA 3V1KA 4DYHA 4N8SA 4QA9A 5BWBA 5JANA 3H1AA 4Q82A 4MYDA 1YR2A 4LIPD 2BUBA 1YA4A 2HFKA 3V48A 4AO8A 4BRSA 4CCYB 4CG1A 1ZIYA 1BEZA 3TEJA 2QUBA 2GBIA 1MN6A 4UHHA 4BVJA 3F8SA 4Y2JA 2AJBA 3A6ZA 4OB7A 1FFCA 2DSNA 1XKTA 3H18A 4M0MA 4ZI5A 3DL7A 4P93A 4UFPA 1VZ2A 1DTEA 4V2IA 3FSGA 1QIEA 2BKLA 3WYDA 4UBNA 3C70A 4AZ0A 1GPLA 1BU8A 1W75A 3STXA 3C5WP 5KWJA 1Q84A 5JIBA 1K6EA 1EH5A 2I78A 1LPOA 2AJDA 5K3DA 3A2LA 4M0FA 3W2TA 4WCVA 1U8EA 5LZ9A 2WJ3A 3D3NA 2VF2A 3E1GA 5AKGA 1TAHA 1UK9A 2PM8A 1Q0RA 3VVMA 4E46A 5D3ZA 4OD0A 4BAGA 1QFSA 1JJIA 1XLUA 1MNQA 1ZD3A 4Y2UA 3FWHA 1CQWA 5SYNA 1T4MA 3PDCA 4UBMA 5CH8A 5AKLA 2JGFA 2XUJA 4J3JA 5C8XA 2Y1KA 2XE4A 5FP0A 2RGUA 5JD4A 5HZGA 4CG3A 1ORVA 2X8BA 3VDXA 4UHFA 2V96A 2QXTA 2GBCA 3IBTA 4X91A 3PFBA 1XZCA 1QIKA 5AM4A 1UXOA 5CT6A 4ZV7A 1BCSA 1JI3A 2CEKA 3GELA 2OAGA 4UBLA 3BF7A 4FKBA 4UHCA 4J7AA 4TVKA 1E8DA 1CUWA 5AI6A 1HQDA 1VE7A 3SC2A 3ICVA 3AIOA 3I2JA 5DYYA 2BUCA 3QZUA 4Q3OA 2HA3A 3G0CA 2BJHA 4WDRA 2FUKA 5FUMA 5D7BA 2NW6A 5CURA 3LIPA 4F60A 3DKKA 1E8NA 4H0CA 5AK4A 2IIVA 2BAGA 3W9UA 1R9MA 3B5EA 2RI6A 3ZWQA 5BV7A 3WYNA 2GBGA 1R3DA 2VA9A 3OG9A 5JAPA 5LP1A 4PSUA 1G4HA 4J0GA 2OAEA 4Q1VA 2ACEA 2XQFA 2OQIA 3FVRA 4G4GA 3C6BA 3L1IA 5E4JA 2G63A 1CV2A 1MX5A 4YK7A 3HYSA 4N8DA 5IVDA 2O7RA 1GKLA 4C4ZA 1JU3A 2H1IA 5DYWA 2V98A 4PW0A 3DCNA 3ZLTA 2WG2A 1XRQA 1XLVA 1QO7A 1E89A 3H19A 1CUAA 2OGTA 4J0DA 4EA6A 2PSHA 3R41A 4KAAA 3I2GA 5AM5A 3FOBA 2J4CA 5I8PA 2O2GA 4DM7A 5AK6A 4G1FA 5HK8A 2XUAA 5ALFA 1VA5A 1UFOA 1N5MA 3H2IA 4B0OA 2J3QA 2XMGA 1CFJA 2XUIA 2CJPA 3OM8A 3BF8A 3ED1A 4ARAA 1F0PA 3IULA 5LKRA 1NU6A 2YH2A 1YB6A 5K3CA 1QONA 3YASA 3VJKA 4KE6A 1THTA 1ZJ4A 3WWCA 1GXSA 4C4XA 4CIAA 3QYJA 1DWPA 1XKLA 2R8BA 4W1RA 4UFNA 3OC0A 1K63A 2AJ8A 4CCWA 5AO9A 3PF8A 2Z5GA 3ESCA 1C7IA 2JGIA 3VXKA 4RPCA 3S8YA 4X93A 3G9TA 2HL6A 3BJRA 3O95A 1YS1X 1I6WA 4KJXA 4BZZA 4MQLA 1O6FA 4DGQA 3ILSA 5ALEA 1MX1A 1CUEA 2XDWA 4IH4A 3FLBA 2B9VA 2I3DA 2XQGA 2C0PA 2ZJ6A 2XMDA 2H9YA 1JKMA 1W4LA 2DR0A 2J4FA 3G7NA 2BGRA 3C8HA 2J3DA 5HF5A 2BFNA 4F0JA 2HU5A 2ZSHA 3WWOA 2GYUA 3UUFA 3EQ8A 3NOXA 4QE3A 4QDOA 4J0CA 4D9JA 5AP9A 4N8EA 2JEZA 2ZVDA 3DYVA 1OCEA 4BYMA 4H18A 2ZJ7A 1DWOA 4OB8A 1XZFA 5JD6A 3CN9A 3M83A 2WFZA 1EA5A 3PUHA 4X92A 2VAVA 2VT6A 3FLAA 3H2GA 3O4HA 4GECA 1QIJA 1WM1A 1XRRA 3CCBA 2DHCA 4WY8A 1SCQA 1LPNA 4X00A 3FCXA 3M82A 1C4XA 4HAIA 1AUOA 1CRLA 4X95A 4Z49A 5A2GA 5CT5A 3D2AA 3B3QA 3QPDA 2PUHA 3JWEA 3STTA 5C7YA 1EI9A 1SOMA 2PU7A 5JALA 2D0DA 1SFRA 2AJCA 5AIAA 3W06A 5JATA 1XZIA 2R11A 3MGAA 2PSJA 3IB3A 2BGNA 3E4DA 3STWA 1XQXA 4C4YA 4IH1A 3ZLUA 1CUZA 1GGVA 1QGED 3DJYA 1LZLA 5CT8A 3UUEA 3EIOA 1XQYA 4DSZA 2JGLA 2HA4A 5AOBA 4UHBA 3PUIA 1AQLA 1XZJA 3UMJA 1AGYA 1KU0A 1FFAA 1QIFA 1JMKC 4C88A 1KEZA 2PKYX 5A7FA 3F96A 1ODTC 3V1MA 1UOOA 4B84A 5ALOA 3KXPA 4MQMA 1RWQA 1DU4A 3KD2A 1CUUA 3PFCA 1DT3A 4FOLA 1XQVA 2PX6A 1GT6A 4S0XA 2WILA 1Q83A 4Q3KA 4J0JA 2XMSA 2HFJA 5E4TA 1BN7A 1X2BA 2PU5A 3AINA 5E4YA 4Y2YA 1QIMA 1QIHA 1C7JA 2OPHA 2BCEA 1USWA 1N1MA 3H2KA 1XRNA 3FYTA 7YASA 1IVYA 3S2ZA 5FDFA 3H04A 3Q8WA 1GQSA 1YCDA 3EQ9A 3GROA 2WHRA 1R50A 1L7QA 5FKJA 2ACKA 2G5PA 1WPRA 3T4UA 4B81A 2ZSIA 3JW8A 4H7JA 3G0GA 1CUCA 1LGYA 2DCMA 3BXPA 2I3ZA 2XUOA 1WB4A 1DWQA 4KE7A 1QIGA 4KAJA 1W76A 2PL5A 5KBYA 2VSQA 3IUQA 2HA7A 1B41A 3D7RA 4QDTA 3A2NA 2EEPA 4ZREA 3BDIA 3QITA 2QJRA 2DQYA 1VA4A 4OUKX 1HL7A 5ALDA 2WIFA 4HS9A 4N5HX 3VKFA 1F0NA 1Z68A 5AK3A 4E11A 5AM2A 2W22A 3DL4A 2QR5A 5FOQA 1HPLA 4NZZA 1XFDA 2UZ0A 4GXNA 2YYSA 2OXEA 1WB5A 1QFMA 2XQIA 2OGSA 4FFWA 1YB7A 5HQ3A 1CUDA 2D5LA 3PI6A 2GYWA 2HA5A 4GW3A 4BBZA 2ORYA 1ZOIA 1CPYA 4CIBA 3HABA 5K5EA 3ESAA 4GLBA 1MJ5A 4EUSA 1YAJA 5AOAA 4BC0A 3V1LA 5JARA 1JT2A 1H23A 2FJ0A 1FFDA 3NGMA 2OGZA 1GPNA 2C4HA 3L1JA 3ANTA 2V97A 4DMCA 2OQVA 1CUYA 2HM7A 3C8DA 3MUOA 4BE4A 5FRDA 2QKYA 1CUVA 1VE6A 3ESBA 3ZPXA 4IH9A 4UBIA 3WK6A 4N5IX 3RKSA 1UOPA 5JD5A 4XJVA 2X76A 1BRTA 1Y7HA 1EVQA 1ZJ5A 4RNCA 5AKZA 5JAOA 1JMYA 3FBWA 3HZOA 4JYPA 1FFEA 1UOQA 1CUFA 1OXMA 1VJ5A 2Z3ZA 2RHWA 3I6YA 3WK9A 1CQZA 2CZQA 4OU5A 1J07A 1SCIA 1XQWA 3P2MA 5AOCA 2RONA 1QLWA 4WDQA 1DX6A 1WHSA 4EZIA 1EK1A 4H77A 4H7DA 3R3WA 3R3UA 1ZIXA 4H7KA 4FBLA 1P0IA 5IVHA 4ITVA 2IX9A 4G4IA 3WJ2A 2PBLA 3HEAA 2GBFA 5IH7A 5LYYA 4L72A 3BE8A 5DJ5A 2VTVA 4Y9SA 3R3VA 3VISA 1WCYA 5AIBA 4X7BA 2DFPA 2CUTA 1CVLA 1WHTA 5AM0A 3RM3A 1XRMA 4MWTA 4I19A 1X2EA 5CXUA 4RGYA 3I2IA 1BE0A 5AKKA 1J2EA 1YA8A 5IVKA 3U1TA 3AIMA 2WJ6A 3WKDA 4C01A 1TQHA 1QO9A 1A88A 5HK9A 1B6GA 1G66A 5JYCA 2EDAA 4FDMA 3AJAA 1O6GA 1IZ8A 3G0DA 2XUPA 5EHNA 2PUJA 2LIPA 5A6VA 5JZ9A 5F4ZA 1IZ7A 3RLIA 3DOIA 1LLFA 4BRZA 3K2IA 4X71A 1UKBA 3V9AA 5YASA 4AN1A 1D07A 5K3EA 1SCKA 2WTMA 1GQRA 3FYUC 2HA0A 1R4ZA 1LPAB 3DYIA 4I4CA 4BATA 5AICA 1ZICA 4DNQA 4PO3X 3N0TA 4ZGBA 2JGEA 1P0QA 1EX9A 1VKHA 5LZ8A 3I6ZA 2JGKA 4AB1A 3DDUA 3H1BA 5ESRA 3WL8A 3KWFA 3NUZA 1MAAA 4YASA 4HZGA 4WY5A 3I1IA 4ZRDA 4X6XA 4LHEA 2QTBA 5DNUA 2K2QB 3GA7A 4IQ4A 2FJPA 5LLSA 4DNOA 3FLEA 2CBGA 5ALMA 1W6RA 1JJBA 2X5XA 4B80A 3VJMA 2HRRA 2DHEA 5EIEA 3IDAA 4L3WA 2G5TA 5FPPA 4BAUA 2XMRA 1IUPA 3QMWA 5AKIA 5LKAA 4OSEA 4W1SA 4YX9A 2ZYHA 3O4JA 3G0IA 4K6HA 3WK8A 5AI4A 5K3FA 3TRDA 4HXEB 1DQYA 4UPDA 2WUEA 1TCAA 1Y7IA 3LCRA 2Y2VA 3IUMA 4AMYA 4OPMA 4WFJA 3GZJA 3R3ZA 4JEIA 4TPKA 2XLCA 4X97A 4DMHA 1MAHA 2DQZA 5SYMA 1IUOA 4WFKA 4HXGA 5CXXA 4U2DA 1MU0A 1WOMA 4DNPA 1W52X 4Y2PA 4XVCA 5D3KA 4BVLA 5FLKA 5FXMA 3SX4A 2XQKA 1LPSA 5T4EA 5JZBA 4W63A 5LZ7A 4Q05A 3DS8A 1AURA 4PF1A 2XUFA 3FVTA 5ALHA 4AO6A 4MEAA 2WUFA 3HRHA 1CUHA 1CUGA 4B0PA 4ZWNA 4OU4A 1U65A 4Y2TA 3FNBA 2GZRA 5A7HA 1TCCA 4XX1A 3CN7A 3VVLA 2CMFA 3C45A 1R1DA 2VQ6A 4O08A 4ZV9A 1N8SA 4KAFA 3QMVA 1CUJA 4A5SA 3LIIA 1HDEA 3QH4A 2XUKA 4CG2A 1ZD2P 4U2EA 1DX4A 4ETWA 4BCDA 3R3YA 4AQDA 5EIHA 4BDTA 2WIKA 3O4GA 1YSCA 5K3AA 1UT6A 3GFFA 3R3XA 1ODCA 1EXWA 5AI9A 3EF3A 5CW2A 4B9AA 4UFOA 1LBSA 3H17A 3ZLVA 5T4HA 1NX9A 5EI5A 1MO2A 1UKAA 1LBTA 4TGLA 4ARBA 4G9GA 3WL5A 5ISMA 3EQ7A 1LPBB 4G4JA 4J03A 2ZYRA 3FYUA 5LZ5A 3DQZA 1X70A 5EGNA 3AIKA 4EBBA 5CMLA 3HJUA 1ZD5A 1ODSA 4U2FA 2VJDA 3ZV7A 5CT4A 2QUAA 2ECFA 4AXBA 4U2GA 3LS2A 4F5ZA 5ALSA 2ROQA 3W04A 3HI4A 4JUIA 1K4YA 1QIIA 4EB0A 4KE9A 3QVMA 3R0VA 1XZHA 4E15A 3C5VA 5AH0A 4JH0A 3WWPA 2VAXA 2Q0XA 2HRQA 2IITA 1P0MA 2WSLA 2BUAA 2Z8XA 4A16A 3TGLA 5DTIA 3O9MA 2H7CA 5HKBA 2QVBA 1H22A 1K5PA 4K5QA 3NWOA 5A71A 3JYHA 4ROTA 4A23A 1DINA 4KRXA 5A62A 2AJLI 4J0IA 5EHZA 4H7EA 3BJMA 4MEBA 3BDVA 1PFQA 4DIUA 1EDBA 4DNFA 4JNCA 2WUDA 4KYVA 3OTQA 1BROA 4KACA 4XIIA 2GYVA 2HIHA 1EK2A 1ACJA 2HA2A 5DYTA 1ZI8A 3KOOA 4QEKA 1U2EA 2AXEA 1UKCA 3MVEA 2HA6A 2WLSA 4FNGA 5CBKA 4LXGA 3K6KA 1LPPA 2WJ4A 5E2IA 4OYLA 1A8SA 5AKEA 5K3BA 4C87A 3STUA 4X94A 4EY4A 4NVRA 4PSDA 3SK0A 2WIGA 5C8VA 3FSGD 1EHYA 3QPCA 1EB8A 3W9BA 5LIPA 1H2XA 4AN0A 3I2KA 5ALJA 5CH5A 2XLBA 3F9CA 1XZEA 1ZD4A 5DNWA 3WZLA 3O9VA 3C6ZA 5HF6A 4DLNA 5AHXA 4KE8A 4OYYA 1HLGA 1CUIA 4BTVA 2Y6VA 4UUQA 2B61A 3WWDA 5ALRA 2XI4A 1ISPA 3WZMA 1CUXA 3WKBA 3F67A 3PF9A 4B9EA 2WHPA 5ALKA 5LZ4A 3MUNA 1VXOA 2C7BA 3DD5A 4QLAA 4PNZA 1H2ZA 1ACLA 2Y6UA 1BEEA 4K2AA 4P92A 3E3AA 3FCYA 3WK4A 3FAKA 2ZJFA 4ZXFA 4W1QA 1N5RA 4M0EA 5ALVA 4Y2SA 1F8UA 3X3HA 2PPLA 2VJCA 5JADA 2GZSA 1ZGBA 1GKKA 3D4LA 3OOSA 2OCLA 2JBWA 4X6YA 3WA7A 1DT5A 1ZGCA 3M81A 5CH3A 3RK4A 3G9UA 3KWJA 3E0XA 1VOTA 2XUHA 4WFIA 1P0PA 1XZLA 2PSDA 2QZPA 2W6CX 4QWMA 3I2HA 1EDEA 4AX4A 5I7UA 4I3FA 5LZ2A 1T2NA 2FX5A 1GPKA 5DLPA 5J3JA 1HKHA 4C89A 1YASA 1ORWA 3TJMA 4P08A 4G9EA 2V9ZA 1AKNA 1EVEA 1EB9A 1EDDA 3HC7A 3WI7A 5H3HA 2QM0A 4BAZA 5A7GA 4XWGA 2QOEA 1GZ7A 2QXUA 5ALUA 1TRHA 4BDSA 5FV4A 3WKEA 4GHWA 1BCRA 4H7FA 3U0VA 1H2WA 3AZPA 4BTLA 4IO0A 4FHZA 4F21A 3I2FA 5C8ZA 1S8OA 1QTIA 2VATA 3FYUB 2C5FA 3WKAA 4UHEA 3WL6A 5ALXA 2ES4A 2XMZA 2HU8A 4PV7A 2JGMA 2Y2UA 5C81A 5KWIA 2WIJA 4FFVA 4Y2QA 1CEXA 3GUUA 3PICA 1JFRA 1JU4A 3O4IA 1A8QA 3T52A 2WUGA 5EFZA 1CLEA 1TIBA 1J1IA 5AI8A 4QWWA 5AM1A 4B85A 2XT0A 3F97A 1PJAA 4Y2VA 5HF8A 4HRXA 4AO7A 4BCCA 3KSRA 5EIAA 3WA6A 2WG1A 2QRUA 3AUKA 2WM2A 1AZWA 1QE3A 4U2CA 1TK3A 4U2BA 1QTRA 2XB6A 4NS4A 2QJWA 4Q3LA 3CCCA 3C43A 4BB0A 3HACA 5CRIA 2O2HA 2YXPX 5ALZA 5ALTA 1F6WA 5T4FA 4DSAA 4QLOA 2O2IA 4FLEA 1NU8A 4X85A 4B7ZA 1OILA 3F98A 4GDMA 4P9NA 2JGJA 2PSEA 3LLCA 2ZYIA 4GBGA 5JZSA 3DNMA 1AC5A 3BIWA 2RIPA 4BP8A 1PV1A 4CFSA 1FJ2A 3G9ZA 1M33A 2G4LA 4MXDA 1E8MA 2WFMA 1XRPA 1XZKA 2QT9A 3AILA 3G0BA 2RHTA 2C5GA 4HVTA 3BL8A 4GI1A 4INZA 2JF0A 5DNVA 2VEOA 2DHDA 5AJHA 5AKYA 2OCKA 3KDAA 2XMQA 3STVA 2XUQA 5FPQA 4BCBA 1VXRA 4FTWA 1UK6A 3BIXA 3IIIA 5HCUA 1TCBA 3D0KA 3A2MA 4Q34A 6YASA 3WMRA 4EY5A 4J0KA 2WFLA 4QNNA 5ALPA 3WL7A 4WJLA 3A70A 1J06A 4BE9A 3D5EA 2OG1A 1YAHA 1R88A 2WU4A 2XMBA 4HXFB 4BZWA 4QDUA 5DTJA 1W1IA 4OCZA 4FNMA 3DKRA 2WHPB 3SWWA 1H2YA 2H7XA 4DMFA 2WTNA 4FWBA 1DQZA 4UBKA 3C6XA 1A7UA 5ALQA 5HQ3B 2H7YA 4DMKA 1XLWA 1ETHA 1MTZA 3ESDA 3B12A 5IVIA 2CB9A 4CCYA 4BP9A 1FFBA 4NMWA 1A8UA 3D2BA 1G5FA 1XZAA 1KU6A 1MX9A 2PVSA 3DOHA 3G8YA 2CKMA 1CUSA 2HHAA 5AM3A 4MWSA 3WJ1A 3WK5A 1RYYA 3RARA 3N2ZB 4W1PA 3WIBA 5BWCA 2QS9A 3PE6A 3OURA 4YPVA 5ALWA 1QJ4A 3D2CA 3ANSA 4FBMA 3VJLA 4PQEA 2WG0A 3WKCA 4AZ3A 4EY8A 3HLKA 4B82A 5AKHA 1MT3A 2EDCA 5CTAA 5DWDA 4GWLA 4UBOA 3EBLA 4K6KA 4GEGA 3QMMA 2HADA 3IA2A 2VJAA 1G42A 4L0CA 4MJ3A 3H0CA 3AFIA 2OCGA 5HFNA 1E66A 5ALYA 2ZYSA 4QDXA 4E14A 1ZI9A 3I28A 5T4BA 5JASA 4G8BA 1TKRA 3HXKA 5AKJA 1BS9A 2C58A 1ZI6A 2JIDA 5BOVA 4H7HA 4PSCA 4C6HA 5ALNA 1XZDA 4J0HA 2XQJA 3G02A 3AZOA 4KR0A 4G8DA 3W05A 2VT7A 3I6MA 4FLMA 3H2JA 4BVKA 2XUDA 4BC1A 1UZAA 2HU7A 4Y7DA 4HTAA 1Q0ZA 4FLFA 4EHBA 5KREA 4CI9A 1UK7A 2B4KA 2Z8ZA 2PSFA 5IKXA 3IUJA 3WK7A 3O0DA 5HKAA 1YS2X 3QM1A 3D59A 1XZBA 5ALIA 3WQHA 4H35A 1Y37A 5I9IA 1IMJA 3C6YA 3WWEA 5AK5A 1R9NA 1LZKA 1XZGA 2YASA 4UBJA 5HF9A 4B83A 1FSSA 4K6GA 1U4NA 4AMZA 3L1HA 4DTCA 2WIDA 2WKWA 1VLQA 5AKXA 2JEYA 2VJBA 5JAUA 1XRLA 1L7AA 5AI0A 4X6UA 5ALLA 4Y2RA 1AX9A 1MPXA 2O7VA 3DEAA 4OB6A 5EHXA 2WU3A 1BN6A 1THGA 1VZ3A 5ALGA 4QZVA 1LPMA 2C0QA 2Z3WA 3Q0TA 1UWCA 2I03A 2P8SA 3IUNA 4G8CA 4LYEA 2OCIA 2XMCA 3G9XA 5HFAA 1AMNA 1XROA 4KEAA 3QBJA 4LXIA 3C87A 1E3QA 3QPAA 4IHAA 1CR6A 3R40A 1L7RA 3M3DA 1QOZA 1CIJA 5EHQA 3IURA 4MYSA
chains in the Genus database with same CATH superfamily
3QXJA 1TUEA 1FS5A 1QAOA 2J32A 3PNQA 1JFFB 4LBWA 1J1ZA 4GVPA 3TZBA 1GL9B 4HI0E 3USCS 3L4BA 2WSMA 1LWOA 2XOXA 1T5HX 3CBQA 3ICWA 4RK5A 1ODLA 2EERA 2GLXA 3QEJA 1TU4A 4RE5A 5ENDA 3ZCUA 5DP2A 3Q3IA 4FCTA 1RJ9A 3BWXA 3P9QA 1C2TA 3BX1A 5P21A 1UZLA 3V5NA 1CETA 2I2XB 4JYMA 4L4RA 4FJ1A 5BQ5A 2NM0A 1MO4A 3D4IA 3REOA 3WLAA 1K8QA 4MPDA 3K96A 4ILEA 4UREA 4CM8B 1ZD9A 2FPPB 2BTQA 2RARA 3CXUA 2A1UB 3VYSB 4DQDA 5JAHA 2P90A 3OEHD 5P8WA 1KH2A 4HLCA 1NE2A 4HDSA 4NNOA 1TM4E 1G16A 4GWGA 4FNAA 2J0EA 4ZOEA 3ADPA 3OPMA 1KPHA 2YIVX 3HVUA 3JYQA 1N2CB 3JX9A 4Q6WA 2IXFA 3KLBA 3ZI7A 1HBJA 4I81A 7GPBA 1UEXC 4L6IA 1SU6A 3NBMA 3AP1A 4M1KA 2BFCA 2ONCA 3Q10A 4A7PA 3AEKB 3BMNA 1O0CA 3HXOA 1V5EA 1S96A 2Z4TA 4BFLA 4QARA 4C78A 5JQGB 1C1DA 3P2KA 3P9YA 4FP9A 5B7PA 3OF3A 2WQZA 3AZQA 2IXDA 5K0NA 3HRIA 1S6YA 3TN7A 3G2QA 2VP3A 1D2GA 4OQZA 1Z6QA 3RVSA 1SG9A 1BE6A 4BZXA 5BW8A 4V38A 1PK9A 3LUHA 3AG5A 4RE6A 3I12A 3QFFA 4RAOA 4ZYXA 1ZMRA 4ODIA 4R16A 1KXZA 5E1MA 4G23A 2Y1FA 4UMEA 2HPVA 3FETA 1XDBA 2FZ4A 4RHFA 1D6NA 3J7TA 4X6LA 3UJ8A 7REQA 1JIVA 1PL0A 2W6MA 3ONNA 4QRDA 2FWBA 4IRXA 3MT8A 2I22A 1QRRA 1RI2A 4DYHA 2CVOA 4JJ6A 1P29A 2IFTA 3ZIAA 4NENB 1RQRA 1YNOA 3E9EA 5JANA 1L4NA 3GFPA 3H1AA 1QS0A 3GLIB 3FUWA 1CEEA 1AZSC 3EZXA 2R44A 4LGMA 1AZTA 2O8DA 4N3CA 1X1RA 3KSBC 3M7IA 3I32A 2W83A 4WEOA 1MV5A 1N3IA 3V48A 1E61A 4BRSA 2O2DA 3HA2A 4CCYB 4YT2A 5CDHA 2X0DA 5HX7A 1FE8A 3L7NA 2ONYA 3FJYA 4R2XA 4CG1A 4NATA 3MUFA 1ZIYA 3QWFA 2XRMA 2OB2A 1ZAKA 1DEXA 3ZY4A 3THWA 3BFKA 1GO2A 2QUBA 4YJ2F 2ZIFA 1QP0A 1R6UA 3CO0S 2NO1A 1IJFA 1NMQA 1IJKA 4Y2JA 3KB8A 2AJBA 4X62B 1IFXA 3COSA 4GYWA 4OB7A 5IAOA 4MPPA 2WP8J 3AY6A 4MGZR 2I6UA 2XXJA 4TRJA 1VZ2A 1I1QB 3AMVA 4HLUA 4V2IA 2Q1WA 3BWYA 3FNRA 4TL6A 3WO0A 1N5DA 1MOSA 4UBNA 1II8B 2QNBA 3C70A 5JCJD 3KVVA 4I5IA 2PX3A 1M1XB 1JPJA 1MABB 3TNYA 3IPYA 5KEIA 2Z1DA 1EGAA 4FILA 2ZB4A 1M2JA 3EULA 3R7NA 3GLFE 4GR5A 2E89A 3ME5A 3KDPA 1HT2E 1XNQB 1FTQA 1EGQA 1YS9A 1Q11A 1QFZA 2YVKA 3LUJA 3LZ6A 5KVVA 5JR3A 1SKYE 1NRIA 5GJCA 3F7NA 1VCIA 3RJ9A 5KJCA 4MWCA 4QOHA 4TYNA 1KORA 1PR3A 3OQVA 3ZNOA 3LI2A 3CLKA 4PFSA 1SIOA 5K3DA 4ZAWA 1NRWA 4F46A 5DW0A 4X8HA 3HN7A 2V7VA 3DMRA 4TQGA 3RNLA 2WJ3A 2O07A 2IU0A 1T2DA 1K3TA 3E1GA 3INNA 5AKGA 3H8VA 4QAQA 1AO0A 1JSRA 4KOEC 2C7PA 3I3SR 2ZITA 5DCYA 1Q0RA 2Q8NA 2VWGA 3WIEA 4UXJA 3D5QA 5DTQA 3QP9A 1XWWA 4YIKA 3WV4A 1U2PA 1TJYA 4OD0A 4BMOB 4BAGA 2VPZA 4EJ6A 1P6UA 3A6JA 1JBEA 2IYEA 4U0JA 2ZIUB 3UAXA 1W581 3A3YA 2PLAA 4HSEA 1IY0A 3FWHA 1O5OA 4D0RA 4U9HS 3CUKA 1T4MA 3V2HA 5JJCA 1HXHA 4LJ8A 4NYJR 2G36A 3WNZA 2R6FA 4I7EA 4JFAA 4I1OA 4WOBA 4R7GA 3AR6A 2JGFA 3HEMA 4JA0A 3JQAB 2XUJA 4S1PA 4I55B 4J29A 2OEPA 2M2IA 5EJGA 1Q1AA 5C8XA 2Y1KA 2H06A 4FR0A 1AIPA 1SG6A 1YB5A 5EE1A 2JAUA 3E82A 4CG3A 3PWZA 4PBTA 5HZGA 3URMA 1ORVA 3I9KA 1W19A 1V11A 2NUPB 3NOVA 3AK4A 4OSPA 4L27A 2E2WA 1RKXA 4XJSA 3VDXA 5KWEA 1BKYA 1EWYA 1UUFA 1UBHS 1U1IA 4NABA 4X20B 4Z4GA 2VSYA 4NY1A 2QXTA 2W48A 1QG0A 3AESB 1QDUA 5KX5B 1WMEA 4X91A 4LEIA 3PFBA 5T6BA 2AUMA 1QIKA 1QV6A 5JSUA 4UDNA 3FHCB 3KJNA 4HPXB 3T7DA 2H9IA 2HHCA 1NNLA 5FUVA 3C98A 3HCNA 5U4QA 2EL9A 3PTLA 3UO8B 1IG0A 3H5OA 3HP4A 521PA 5CLLA 3KZXA 1EEHA 1EG2A 2OAGA 3QUTA 2DTDA 4OHCA 4KR7A 2YZMA 1AS2A 4JVSB 4KRGA 4GWKA 1ISRA 1DXYA 3LKZA 4TVKA 4V0OA 1E8DA 4U7GA 1HH4A 4C9BA 4ZJUA 3P0RA 4CLEA 1XXLA 4HVAA 5BSFA 3SC2A 2IYFA 5E1DA 5C5DA 3I2JA 5EJAA 2YTZA 3HU5A 1RYZA 2VTDA 4ACBA 2FDCA 2CXQA 1M0EA 1HDCA 2X1MA 1J25A 4P80A 1UBOS 4N3BA 5AUQA 3IVCA 4IWYA 2QUKA 1KEKA 4J3NA 5JSKA 1L7DA 1CXZA 2R6CA 2BJHA 2GILA 1L4UA 3DV0B 1LSSA 3HMKA 2FUKA 3IPCA 4FEYA 5EXXA 3HKCA 1ORTA 1H85A 3QVGB 4M7PA 3EAGA 1T9GR 3O3OB 5GGYA 4C3UA 5KNBH 1BE8A 2FUNB 3DZDA 1R16A 1UC4B 2DFVA 4BFYA 4BV8A 2HF2A 3TUZC 1E8NA 1RZUA 5DBGA 2JKZA 3K9QO 3HO6A 2HY7A 4F3KA 1EHCA 1Y89A 5C9ZA 5SY4A 3H42B 1XU9A 4M0KA 2BAGA 2WRZA 3X1JA 2AG1A 3EC7A 4KZPA 3MJTA 3GGSA 3F6YA 3IO5A 4K40A 1VJ0A 2JA2A 1J09A 1D2CA 3SN6A 2QTAA 3PC8A 4MIEA 2CXPA 3G1WA 1H2HA 5CA1F 2CCGA 3OZWA 1TM3E 5I7AA 4ANFA 1AXEA 5TQ0A 4DLKA 4QGAA 2JI9A 2NO6A 4BATA 5LP1A 1AJEA 4P4TA 1CR4A 4DBZA 3EA5A 3FROA 4AVYA 1G4HA 3HTXA 4V0SA 3OIYA 5D84A 3S5JA 4MS1B 4AN4A 1XN1A 1H3NA 2OQIA 3FKQA 4IX9A 4JHXA 3VKUA 8AT1A 5FUYA 5CPBA 1M1NA 1OAAA 1PO7A 3FVRA 3AR3A 1LTQA 4LS3A 2FPIA 3AF1A 4A03A 5EVJA 4AUMA 3ZW9A 3T3EA 5IJ9A 1I7PA 2F9MA 3MPUA 1C2YA 1ANKA 3L41A 4LFCB 1NVFA 3TIVA 1OH7A 5FI5A 5EE3A 3HNOA 3PGXA 1E6MA 3DO8A 1IZYA 2W58A 2JCXA 1XF9A 3IP5A 4AIRA 2BKAA 2R6GA 3QBEA 4N8DA 2C2YA 4L50A 2I2BA 5LLDA 2IL1A 4XSGA 4B6FA 4YECA 3WLQA 3K20A 1UOEA 2UVDA 1J2RA 2K6GA 4D25A 2IHNA 1JSXA 3RRXA 1PSZA 4HX9A 4A5OA 5DYWA 4F06A 4HDOB 4EUFA 2YJGA 1HSOA 3ISVA 3JQQA 2WMYA 4JFRA 3MXOA 1IPFA 1G21E 3TW8B 1JQBA 2BFEA 4FFDA 3ZLTA 4ML3A 4XB2A 3DGFC 3K1AB 5TVGA 3H19A 3WLTA 4GYKA 1EFRD 3IP6A 3EX7C 3CVOA 4Q4AB 2OGTA 3NG1A 4KGVA 4BWVA 2Q45A 2PBRA 4ITUA 1FFXA 2QA5A 1HZJA 5EJFA 4EA6A 3TINA 3A0UA 3FMGA 3O84A 3GEPA 4B44A 4RV9A 2EZ4A 2REQA 3LRXA 5AW8A 5KVQA 4RZXA 1V35A 4PICA 4ARIA 1NW4A 1Q0HA 5E7QA 4F8YA 3ZHCA 2VUSA 3TTTA 5HJEA 4ZT2A 4PRYA 4V3BA 5FTWA 3RSFA 1NLFA 5TE9A 1QH9A 4F4JA 1E1LA 4HR7A 5A5VA 2PUVA 2F8LA 2VUTA 3ORRA 1NW5A 1PVVA 1VA5A 4WNIA 3JPYA 4HRAA 3H2IA 4B4WA 4J75A 3GRRA 2ZBDA 3LDGA 3EZFA 3GLGB 4B0OA 3LTEA 1W34A 3WDSA 3K16A 2Q3HA 2Y68A 2VPYA 3IJ5A 3PRHA 4NESA 2IEYA 4U9UA 2MDTA 2J9ZB 3T1HB 4YP7A 4L8LA 2OL4A 2GBPA 2UZIR 4JIMA 1KJZA 3GVIA 3P26A 1NYQA 1KYVA 2PLFA 3AEUA 1JYFA 2ZOSA 4EYQA 2EZTA 2YXLA 3M4ZA 4FNOA 4IQ8A 2K5UA 1KSHA 3DH0A 1O03A 2BEWA 3MC1A 3SVZA 2FSVA 4ICIA 4FMCB 3IULA 1NMSA 1NUTA 5FHRA 3T7KA 4GNKA 5BV1A 1MEOA 3R3SA 5BN5A 2A59A 2R47A 4I1IA 5KSOA 2GGSA 2YWRA 4UVEA 5K0EA 5KOHB 5EIBD 2DZDA 2IXGA 2YH2A 2NUTA 5CB0A 5A0VA 4JI6B 4HWPA 5E8RA 4MMXB 1RBYA 3H1PA 2F1HA 3BEDA 2FMUA 4KQHA 1X92A 3AFNA 3UAOA 3WZ2A 5CD9A 4KYUA 3BHMA 4R8SA 1RMYA 3VJKA 2YWJA 3N74A 4KE6A 5DNCA 2I3AA 3EXG1 1IWOA 1THTA 4D57A 1GXSA 1M2EA 2GN8A 3L8FA 3GFOA 3NAZA 5EQTA 1PJTA 5EMJA 1C3XA 3QYJA 1E4EA 4IKOA 5H02A 4OHFA 2ZK7A 3KYIB 2C5EA 3DBHA 5DASA 2EP8A 1I7SB 1QYCA 2O50A 3ZU5A 2Q99A 3OC0A 1S89A 3M5DA 1IXRC 4GH5A 2ZEJA 1T2VA 1II9A 4YRNA 3AUUA 3AVQA 1ENOA 1QTQA 3THXA 4MP6A 4AYWA 1F2DA 3IVRA 3B60A 1NXXA 1LQTA 2XBLA 3G7UA 1OFGA 5HKKA 1OYVA 5LYJA 3EVEA 3RODA 3IPXA 5ED0A 3WIDA 1YK1A 4LF5B 1S5PA 3EMBA 4AJNA 3ETNA 2HPZA 5JJKA 1J9GA 2VCHA 5D85A 1QOPB 2NU9A 4LPSA 1SUCA 2O05A 1K6XA 2ZU6A 5L7WA 1I6KA 3I8XA 1FDVA 1ZGHA 2Q8PA 3BE4A 3EG9B 2HXSA 1YS1X 3HBFA 1U1FA 3OFKA 1F2UB 2XHZA 4QPJC 1GNSA 4MKRA 3K70C 3TL2A 4BZZA 1TPZA 3CZRA 3GFBA 4RADA 2I4MA 1RW4A 1JEYB 3CRW1 3A9TA 4AKEA 4RM2A 4P3YA 2XZDA 4F4IA 1ZCZA 1G9TA 4NZ9A 1ORHA 1S8NA 4LE0A 1FNNA 1O8CA 5ALEA 3O7MA 2VDUE 4NAUA 2YJ5A 3RO7A 1JHRA 1KI7A 2XDWA 5E6UA 4IH4A 3FLBA 5CHYA 5IC4A 3O0TA 4F92B 4XGIA 1Z12A 4M0LA 4KPYA 3S81A 2ZJ6A 4LJ6A 4OG2A 3P8ZA 2AG8A 1JKMA 4XRGA 3IOYA 3C6MA 3PNLA 4YV0A 5CFRA 3TLJA 3PLRA 1OT5A 1U8XX 4I5DA 1UBJS 4YY3B 4RVSA 4Y0NA 2FMKA 4EPVA 1OX5A 4WECA 1USGA 2XAUA 2FR8A 4J4HA 4ZI7F 4WZAE 5NLLA 2V74B 2HEIA 5L51A 1E79A 3ADDA 2HSZA 4L78A 2NYAA 4EPWA 4HH1A 2X4GA 4JLJA 4LDAA 4RPIA 4OIMA 3VU9B 1E7RA 3A37A 4XA8A 5F4BA 4DC0A 5GWXA 2C88A 5DFAA 1KO4A 5AP9A 3L5OA 1WVGA 2JEZA 4BLUA 3ZWAA 6NULA 3TOZA 1AN0A 2NTVA 3E3OA 3IHKA 4I50A 3I4CA 2DSTA 3X1ZA 3DBOB 3TQOA 4CL0A 2PGOA 1SO8A 4LAFA 2VC2B 4PU0A 5BYKA 1R8QA 2XQVA 4WCFB 2PL9A 1PNTA 3ZJYA 1Z0UA 1JAXA 1OXKB 3Q3CA 2Q1YA 4DV7B 4OB8A 1J8FA 2WU1A 4ZVTA 4DW8A 3RU7A 3ZE2B 3MCVA 5K0TA 1AUQA 3CN9A 4UVHA 2FOLA 2WFZA 1AQIA 4HFRA 1D4AA 1II0A 3AR2A 1V3TA 3IR6A 4X92A 1XVIA 2P3SA 1AQNA 2ISCA 2NTNA 2W4MA 2EBUA 4B3DA 2G71A 2X0KA 2M6SA 4P0TA 4F5WA 1OX4B 2M1XA 4KXFB 4ZK2A 1QGAA 1COWA 3L02A 1I30A 4EG3A 5B4TA 3ADBA 1HNXB 4L5CA 5HXAA 4Q4CA 1PJCA 5CFOA 3EOZA 1OLUA 4J9UE 3WSVA 2DHCA 3HBJA 2OM6A 5IM4F 4QRIA 1SCQA 3K15A 4R84A 2VQEB 4DJEC 4UDYX 2OORA 3AF0A 1CZLA 1TTQB 2RK3A 3LYHA 3PVCA 3M82A 1PT6A 3VNSA 3GL9A 1RMQA 3GRKA 3MOSA 5A02A 4AS3A 4U5QA 4GE3A 2H85A 4X95A 5LN1A 2QLFA 3DR3A 4F3NA 4E2ZA 5BXYA 4KWHA 2Y76A 2XB2A 1W0CA 1YS6A 2VDKB 3KR2A 1JAIA 4TV9B 3EIXA 3MJEA 1Y7LA 5E3IA 4HGPA 1SC4A 3NFRA 3B1JA 1FCJA 1TK9A 2XTZA 3T61A 1KFBB 2GCEA 2HHLA 2PUHA 4ZAZA 3R2JA 3STTA 4BMDA 4M9QA 5BT8A 5I6DA 3QHQA 1EUQA 2JFHA 2PZFA 3IA7A 2VP5A 2GM9A 1RRGA 3ZY3A 1IXYA 4QHYA 2IUSA 4EA7A 3JRXA 5JALA 1OT3A 3F46A 3K5WA 3AUXA 3GUHA 1XKQA 1SUDA 1O1YA 2X5NA 1FDRA 1QQTA 2A92A 1TF7A 4MRSA 4ZTBA 2DCUA 5CM8B 3LXXA 3ZQJA 2CCKA 3U44B 2D8MA 3M8KA 3O91A 1KVRA 2FFJA 2IK8A 3IE2A 4JB8A 4DIMA 3T3GA 3W06A 3CURA 1XZIA 3FXAA 2BFDA 3FNFA 1ORDA 3L06A 1B4DA 2VDOB 4HK4A 3ZCRA 4PCAA 4TTQA 2XOKA 2B0JA 2P3LA 4XD7D 1O9HA 3VPDA 5PGMA 2E4WA 5HUJA 4M53A 3NTXA 2IWHA 4W5QA 1SBCA 3UHOA 1NR5A 2D2VA 1YMUA 5K0FA 2IPNA 4P7JA 2PQ0A 2VWQA 1CUZA 1DUSA 2O6LA 1S2OA 3LGAA 4F04A 1KERA 2AL7A 2KMLA 1R8SA 1TZKA 1QGED 3DJYA 2ZWPA 2AJTA 3OE7A 2NSJA 1F4VA 3C8UA 1C9YA 1OZGA 2Z04A 4RQAA 4TRNA 1K0FA 2NUAA 3P4YA 3TNDA 4AY6A 3EEQA 4MVJP 3QVTA 5TMEA 1TYEB 2QTLA 4UHBA 3L4EA 1C30B 2PUAA 4TMYA 1AGYA 1EJ6A 1AGNA 2QLLA 1J7JA 1O58A 1QIFA 3UUGA 3H87A 3STHA 1KEEA 1Q7CA 3I4FA 4EITA 1FXSA 2C97A 4B7CA 3LUFA 3ABRB 3MYYA 2PKYX 5JS8A 2VWHA 2XCTB 2COKA 4I2VA 5DT9A 1NMZA 2A5DA 1U2DA 3NYWA 3V1MA 4GM1A 5FYDA 4DCSA 4EEXA 4MW7A 1T4GA 2O5VA 2D0OB 2DQSA 4A2QA 4QJ5A 3E35A 3GGOA 3NEYA 1EP1B 2RHDA 2CHQA 3TLYA 2BMDA 4ZAXA 4HGQA 2QY6A 2C96A 2YCLA 4A8PA 1FIUA 1E2FA 1T1SA 2JCYA 5I7FA 4Z0TA 4E33A 5EJ9A 2FCRA 4AI6A 1DT3A 2YXDA 1J2YA 2WZCA 3RUPA 5MGBA 1YDMA 4DR2B 3EMKA 2JCBA 4CW7A 1IQUA 5HBRA 2MSWA 1U1DA 2PX6A 1GT6A 1UXIA 2ZTHA 3UGQA 2OESA 3N8GA 1QQ7A 4WK4B 4CKBA 2CMKA 3W3AH 3T54A 3VR5D 4TMVA 2OC4A 3EVAA 1DQNA 3MD0A 3Q0IA 4MR7B 1X2BA 2VUHB 1ISSA 1UMBA 3AINA 3CTMA 3NYRA 4NJOA 2PGIA 3MS2A 3T7JA 1R37A 3UHPA 1HFEL 1KIFA 4OEHA 1QIHA 1C7JA 1HUQA 3NNDA 2IYPA 3R4CA 4NULA 4WK2B 4B48A 2ZJZA 4US2R 3B52X 2NACA 3DAGA 4GIBA 1PD0A 3F6SA 1I3MA 1NZDA 1USWA 2OCDA 3HQ4O 1ZM9A 3V8RA 2WTBA 7YASA 2QUHA 1IVYA 1FRVA 1FPMA 2G09A 1JYSA 3N2EA 1GDDA 1FP7A 2VJYA 1BGXT 3C3DA 3K9LA 2Q46A 5CVDA 1G6Q1 1E1KA 1GQSA 1Q7EA 1YCDA 3IMKA 4TM7A 2OXFA 2Q5FA 1ZH8A 4AT1A 4Q4JB 3BMOA 1SD1A 3N8NA 2QTFA 3A4TA 3TX2A 9LDTA 3RQIA 4CMEA 3LQFA 1X1BA 2Q3JA 2QE7D 3GPCA 4FPXA 4J1QA 4KX3A 1VL0A 1HYBA 5FKJA 2P3QA 4FFBB 4YV2A 1APBA 1DCTA 2OT3B 4EW2A 4KYIB 1G1AA 1A9OA 3EG5A 4EFNA 4F8JA 2DERA 3AX6A 1AMOA 2P2GA 4AC9A 5CU7A 1Z16A 3SEQA 1CUCA 1A3CA 1A7JA 3BXPA 1ZLXA 3G3EA 2I3ZA 2C84A 2YFKA 4PHHA 1ZGAA 4JUBA 3KL4A 3TCXB 4DDUA 3A8TA 3DL0A 1DWQA 3VNRA 4H6XA 3BTUA 4UOZA 1QIGA 4KDEA 1YJCA 3HYNA 3WRXA 2QE6A 3IKTA 4HDQB 1G17A 1WSBA 3W9YA 2BLNA 3EIFA 4KDFA 4UJ3A 2DFTA 2AR7A 1CJUC 1SCDA 4KIGA 2VSQA 4A73A 4LXUA 3VR6H 4DDMA 4DJAA 1WDMA 4GM0A 1B41A 2D2FA 3G5MA 4CLDA 5JISA 1W4RA 1QVAA 8LDHA 2EBWA 4MHSA 1E2EA 2BGWA 5LXTA 3C5CA 3FFAA 3UMBA 3O8QB 1Y3AA 4LRQA 2QJRA 2WSYB 4OUKX 2B83A 4L5AA 4JITA 4LWZA 4YRQA 5DGIA 3WSTA 1ESDA 4TS3A 3SVLA 4AQYB 3BB1A 3T7SA 1SHTX 2VUIB 2CSXA 5EHIA 1D5CA 2IT1A 4DNXA 1QORA 3A58B 1ODIA 1Z2PX 2P65A 5ES3A 5BSTA 3ZWDA 3V3KA 1G7TA 4GOND 2AUNA 2BM0A 4ZEOA 2QR5A 2D1QA 4XQCA 2XXAA 4I4TF 3AU8A 4RY9A 3UM9A 2IXAA 3DMGA 3FGPA 1W25A 1VLHA 2Z2ZA 2PKQO 2SKEA 3BAFA 2FKAA 4QXAA 4WV3A 3WB2A 1QFMA 1AQJA 2XQIA 4DXHA 1TL7C 1C81A 2F1IA 4P7BA 3CEHA 3QE0A 1QX3A 2ZYUX 2B1GA 1DAMA 1RCTE 1BX3A 2C31A 3A1UA 1ZQ1A 1S3GA 2YHSA 1QPZA 2F1RA 3JQ7B 4IUDS 4IZHA 5IBCA 4KLCA 1NN0A 1UMCA 3UFXB 1N33B 3RUAA 3PI6A 4QQ8A 4UHJA 1GTJ1 3GZNB 3RJ5A 2ZIGA 1QHNA 3ZE6A 4CMGA 1U5BA 4HSGA 3PLAE 1ADBA 1F4LA 1PK7A 4UQLA 3DKVA 2QVYX 1NI4A 1WXEA 3OUZA 4ME6A 2FP4B 4LJYA 4EHIA 2NPIA 5EJMA 3JR3A 3DT8A 4MX8A 3TQRA 4YNBA 4EHHA 1EFDN 4GLJA 3WSWA 2RB4A 1FP2A 3LGSA 4E12A 4FDTA 5C2JB 4L0MA 3KQLA 5IM5A 3JARB 3ZZ0A 1F12A 4A6EA 4OQYA 1JI0A 1TEHA 2AOUA 5E2AA 4JT8A 3F47A 2QVZX 2FN7A 3PNPA 4C6TA 8OHMA 4JYZA 1W2GA 4KFCA 2C4HA 4NYJQ 4O4HF 3N2YA 3PSAA 1WF6A 4QGGA 2G8NA 2V97A 4UE2A 1NONA 1WXIA 3GB9A 5JS6A 4CEIA 4IPTA 2OQVA 1UWKA 3I05A 1NY6A 5LBIA 3ETDA 2H1OA 4QFMA 4XB6B 1NTOA 4QTTB 5E7MA 5G02A 3MRTA 2Z6AA 1UZUA 4HWKA 2ZB8A 3R5TA 3P4UA 4MPJA 3ICQB 3HE3A 1PF7E 2E7ZA 5KQSA 1EX7A 1OGYA 4BNMA 4NU0A 1C8LA 2QKYA 2PRZA 3LZCA 4ND5A 4I4IA 5IW8A 3ESBA 4NARA 3R76A 3ZPXA 3AKZA 3WLLA 4TKUA 4QO7A 4NYIQ 2VSNA 3GJ6A 4UBIA 3WLEA 4N5IX 2UV8A 1LDMA 2MSDB 2KLBA 1UOPA 2GRJA 3TCNA 1LUAA 1G8JA 1WXHA 5JD5A 4KR2A 4C2UA 2IPXA 1OGJA 4H4CA 4MAAA 2JCVA 3M89A 2DWPA 5F3DA 2ARKA 3IAM1 5DISB 4ENPA 2DRIA 2OSBA 1T36B 4JU8A 3Q6IA 4EECA 2H5EA 1SWVA 5CLJA 3GCGA 3Q4GA 1EPUA 1FFEA 2IHYA 4JBNA 4JMLA 1RQGA 3L7CA 1YQGA 3SR3A 2DT5A 4UARA 4EYGA 1W85B 3ZQ4A 1SXPA 1JG2A 1XCLA 2GEUA 4JI3B 2OPBA 1ZH2A 2GJSA 2RHWA 5KYXA 3WK9A 1REQB 1EMDA 3HVKA 3SNHA 1CQZA 1DRVA 4LY9A 3B1YA 4MHTA 3L05A 2A86A 1YRHA 3QQ5A 3Q7PA 4OATA 1XCBA 1QVVA 5IAAA 2IF2A 2VR1A 2YN2A 4P32A 4JJ8A 5FIUA 9ABPA 1YFKA 1OBVA 5EXEA 4YRFA 1YC5A 2IYSA 3LPDA 4KO8A 4RVDA 2I29A 2RONA 5D3MA 3P97A 4EMUA 3LF2A 1X7YB 2DYKA 4NG4A 1DX6A 2Y1XA 1VTKA 1YIAA 3WLRA 1OX6A 1EK1A 4HPJB 2DAPA 1NHWA 3FM9A 4H7DA 2Z58A 2QD2A 3I76A 2FZ5A 4DDTA 4L9RA 1JXOA 1PW5A 5H0IA 5BR1A 1DUIA 4G5SA 4JDPA 4D3YA 4JYAB 4UTVA 4DDWA 4FN5A 1RKQA 3R5KA 5DGDA 5A4AA 3C5EA 4PM4A 4D8YA 2ZBFA 5JQGF 3DLBA 1RQLA 2VPQA 2PLNA 3LKBA 4ITVA 4C07A 4OL9A 1Y6JA 3WJ2A 1Y6ZA 2RSLA 1E3SA 3BTOA 4ZZ2A 3FN4A 2GBFA 2F17A 1DIHA 3DA8A 3HP1A 3JAWB 4JC5A 2CXUA 3ITNA 4GI3A 4R1PA 1QHSA 2WUWE 3B85A 5IH7A 1XPJA 5FEMA 1RLTA 1RRPA 4O3FA 5WRFA 2YJNA 1V16B 2A9OA 2YYZA 1SUEA 3HU1A 2OWDA 5AHOA 4BMXA 3DVQX 4R1OA 3LVBA 2VTVA 4RA6B 4EPYA 2ZWMA 2ZSJA 5TPZD 4LMPA 4M7WA 1X86B 4WOPA 3VR4A 3R3VA 2OV6A 1RXSA 2SCUA 3DTNA 1WCYA 2XTAA 2D59A 1JQJC 1GNTA 4YDHB 3JQFC 1CP2A 3PPVA 4JBHA 1FNBA 1GPAA 3R7SA 5CNMA 3HUEA 3TLMA 3E81A 3RM3A 1OC2A 1PDVA 1P2GA 1XRMA 2L19A 1JQ3A 4MWTA 4YO8A 3LOQA 3RG2A 4H1VA 3FTQA 3GG2A 5LP6F 1R6DA 4UNNA 3S2YA 3KQMA 3V8BA 2WQ6A 2V58A 3ZJVA 2FGJA 3DKPA 4A1FA 4DOMA 1QP8A 4ZAFA 2XGJA 4DLYA 1I7NA 4NCNA 4IUBS 5AKKA 1YA8A 2CGEA 1KMIY 1D2EA 2Q6VA 3FB1A 3NCHA 3QWAA 3NDIA 3V8MA 3H86A 2YYAA 2Z4RA 4YJ2A 1QVRA 1JQAA 1KFKB 1R6AA 1P73A 2NO5A 4X45A 3GGPA 1HLFA 4WLUA 4DUYB 1RIFA 4XARA 2X9VA 4LRSB 3GRVA 1G66A 4Q39A 4K81B 3KQPA 2HXYA 1C9EA 5E9WA 3Q7RA 4FDMA 2XJ4A 3AJAA 2WWFA 3O75A 1Z3CA 2OO5C 2X1LA 4A8JC 4QKQA 3UV6A 1HURA 1T9AA 1IZ8A 1CY2A 2NAPA 2XNSA 4OQPA 4EJFA 3MFQA 5F12A 2D2EA 5FEUA 4REQA 2PUJA 3O47A 2LIPA 1TIPA 3OQ6A 4OGFA 2WT8A 5DGXA 1PTJA 1SXJB 5JOQA 3L6UA 1DO0A 1QVZA 3TI9A 1HMYA 1LTKA 2WPDA 3CIFA 3LF1A 1XMOB 2OHHA 4KPFC 1LLFA 1I7LA 2ZJ2A 2ZUDA 5ARDA 3K2IA 1BW9B 1RRCA 3BXFA 1UKBA 4AKIA 1XLTC 1US8B 1Q7GA 2Q49A 2W2LD 2BJVA 1D07A 3E1SA 4LNUA 6Q21A 4DB4A 5F1YA 2W0SA 5D86A 3RHSA 3IQGX 1VQ1A 3AUTA 1LPAB 4HBGA 1C4KA 1H05A 4YRBA 4UEWA 2P2NA 1ADCA 5BNFA 4E2XA 4BNUA 3BIJA 3WTBA 1E2GA 1V3VA 4ILKA 1J21A 5JMOA 2CV1A 1Y1TA 2VL7A 3JALA 5FWXA 2PXHA 4NV1A 2JGEA 1EX9A 2ZE7A 3ODGA 5EUBA 3IMCA 5LZ8A 4DABA 3KJQA 2CYAA 4EJSA 2PRKA 3K53A 2V4MA 2JGKA 3FDZB 3LPNA 4AB1A 2V59A 5AT1A 5CDTA 2JARA 2VXYA 1CJVC 1L5KA 3GJ7A 2CSUA 3OCWA 4IHKA 1N2GA 4YMIA 5ESRA 1GTG1 3K73O 2WVAA 1L5YA 4ENVA 1GG8A 2OBXA 2P9TA 3PWKA 5H70A 2OAP1 5CEFA 2A1TR 4N39A 5K0ZA 5DNAA 4CLRB 1KEVA 1IC6A 1Z4JA 2HMSA 2KQUA 2XNDD 2ZR9A 3ELDA 4MRMB 4PZEA 3ZWVA 2Q5QA 3SDSA 2FN9A 2QR2A 4KFTA 4URVR 1T2CA 2Y92A 2IP1A 2XKJE 4YTEA 3SP1A 2VO1A 1D6JA 2R4UA 3DHEA 3K35A 3S99A 4IQ4A 2KW5A 3OZEA 3R7DA 1CR1A 1J2TA 1S8AA 2IYQA 5CDYA 5D00A 5D2CA 4YLEA 4ID9A 4LCJA 2ZZNA 3EMDA 2G83A 3HBLA 4HMQA 4QNRA 1LW6E 1W6RA 3D8RA 3KJGA 2FA9A 4IEEA 1FMFA 1JJBA 3MWGA 1MPTA 2OUIA 4EUKA 2NV2B 3EGEA 2ZUWA 3LLMA 5KYTA 2C29D 1U5CA 2H51A 2HRRA 3IAXA 1SUAA 1HI9A 2DHEA 4F56A 4EB6A 1UH5A 1E96A 1ZIOA 2Q1XA 2PAFA 3PB3A 3RV4A 5I01A 1AKWA 3BRCA 3AEYA 3OPVA 1KDYA 2WQ7A 1K1EA 2QMEA 4NJMA 4JXKA 4RSRA 4Y1EA 1IUKA 1XL1A 3C14C 3H4VA 3NV7A 1T0IA 5FPPA 3KLNA 3LT4A 2NSDA 4RW0A 2QN3A 3QMWA 3RVJA 2IP2A 5CA0A 3OMWA 2O20A 2QNIA 4QXMA 1QPBA 1X7HA 1L4FA 2ZYHA 5TPWA 4B6JA 3G0IA 1SVMA 4FYVA 5DMXA 1PZMA 4CTNA 2RJOA 4FR5A 3A4IA 3QXXA 5BYJA 3FNHA 4JJGA 2DT8A 2AKAB 3LQYA 3MGKA 3MM4A 2DE0X 1NATA 3LXRA 2P78A 3NEPX 4NMHA 2DPLA 4WXRA 5EAIA 3TRDA 1DQYA 4QULA 2X4IA 1SUSA 5SICE 2GZHA 1RYEA 2XGGA 1Y7IA 5BNZA 2EF1A 3RIYA 1ID8A 3REGA 3GRFA 1YZLA 2Y2VA 4ZKDA 3TL6A 3S7TA 3IUMA 4AMYA 4OPMA 4RBNA 2RFLA 3GZJA 3MWDB 4RXMA 3IMFA 1A9XB 2DECA 5T41A 3EIEA 2B4YA 1N32B 2ODWA 3N9IA 4D56A 2W6PA 2X2EA 2DB3A 2ZKLA 4JJAA 5F73A 1PFGA 2NVWA 3FVQA 4DMHA 5CFPA 2J30A 4ZI2A 5I7RA 1R3UA 2GCGA 1ATZA 3GXBA 5KKNB 1M2HA 2OHIA 1OLXB 3LHKA 4PC6A 2R8XA 3SOZA 2BMJA 4BNYA 1EFRA 2RGNA 1MU0A 3FHLA 2VHCA 2P7HA 2XW6A 3H9UA 4IP0A 3LECA 4AM8A 2PKCA 3PQ2A 1R9GA 4DEYA 5IG2A 1H8HA 1DQRA 2RHHA 4I0WB 3KFLA 4XYMA 5D3KA 3UFBA 4BVLA 2EX4A 5HYVA 4B40A 1G2PA 1KAEA 2YQZA 5FLKA 4D0NA 2DBYA 5FXMA 1OFHA 1Q57A 3SYKA 1S7CA 2QRZA 4C4TA 4ARVA 1Z6ZA 3HCFA 2F9LA 1CDDA 4HDAA 5IC6A 5CA1A 3LVQE 3DE5X 3CFYA 3DULA 1AV7A 1PJZA 3I58A 3KG2A 5LZ7A 3OQPA 1JB9A 4KR3A 2FPSA 3A3KA 4BLPA 4Q05A 2LGJA 2EKDA 3PUXA 4KC0A 1J1UA 1AURA 4PF1A 4PZDA 4PY2A 1Y4SA 4S1WA 5I7WA 4TXLA 1IY1A 3FVTA 3GJYA 5L4SA 1NVKA 4B73A 1M1UA 4LPKA 4QOEA 5B3KA 2FGKA 1BWSA 1OXVA 3TXXA 4MEAA 3HRHA 4ZYWA 3CISA 4MV3A 4D41A 2ISSD 4Q9HA 4K9QA 1GUDA 1LU9A 2OBNA 2PTHA 2XDYA 1CUHA 1XCMA 2AF3C 1N5IA 3JD3A 3K6JA 4FDVA 4QYMA 5EERA 2XKBA 3GLQA 3RG8A 3W6NA 2ZBQA 4EVRA 5A3JA 6AT1A 5F3WB 4D79A 2AOTB 3WQQA 3BFXA 1GYRA 2JBAB 3VZPA 4Y2TA 1P1FA 2IHKA 3MW8A 1LI5A 1BXGA 2QUJA 1M8JA 3V46A 4LX0A 1J0BA 1E7QA 3NDPA 3WLFA 2C4KA 4DUGA 1TCCA 2Q3FA 2CLHB 2EARA 4L22A 2HCBA 2VQ6A 1M83A 2W2XA 1GZVA 4UAVA 4ZAYA 2NU6B 3T5CA 3UXHA 1N8SA 2HAEA 3T41A 1G60A 1N9KA 4E31A 1E2HA 3BK1A 4MB0A 3CVUA 1YVEI 3VI4B 1V48A 5LU9A 3BBPA 2UUCB 2FSFA 3UN1A 3ZWKA 4W5NA 3DL2A 4RHYA 3K9FC 4B87A 3EVBA 4QHSA 5JO9A 3KS9A 5CR9A 1DX4A 3TFWA 2ZXUA 3ZDBA 3PG5A 3R3YA 3GAMA 3FCOA 3DXXA 4WJKB 5EIHA 1CF2O 4PFKA 4DA4A 4IIXA 5M5BA 2I0FA 3O4GA 3MJFA 4HJXA 1CFZA 2IOFK 4FE4A 3T0FA 1YFLA 5DCUA 5LMUB 1IQ0A 4UZSA 3EDMA 3BXOA 5HOQA 4S1NA 5KQPA 1Z28A 3EF3A 4D9IA 1RNLA 2R7LA 4G81A 4LUCA 3QYFA 3JD1A 1A27A 1ENZA 3T5GA 2HREA 2JLYA 2XF8A 1ICEA 5FQOA 1Z06A 3OJWA 3IAM6 1LBSA 2VDLB 3DUFA 3MMZA 2CLMB 3IQHX 1NX9A 3P45A 5DHAA 2DPYA 5M04A 2F59A 2I3GA 4Q3CA 3SQMA 1JG7A 1UKAA 2ZI4A 4JP5A 1KSJA 1YULA 4RL4A 4YRIA 4ND8B 4IDAA 4HWGA 3R6GA 4KQ1A 2FF5A 1E0KA 1NUSA 1NXVA 5ISMA 4F3CA 5L3QA 3EQ7A 2AZTA 4BO7A 4G4JA 1FQKA 3EGOA 2Y0CA 2HSJA 1B3BA 4X1YA 5LZ5A 3DQZA 4XYLA 1V8ZA 1VDZA 3FI9A 4FMCF 4IXTA 3H1EA 1D2RA 3STYA 2GYYA 3TBKA 2H4FA 4GOMD 1QRSA 1DZ3A 1DBQA 2XYPA 4BQNA 4EMBA 1NF8A 3ZLBA 1C3JA 1WVMA 4R2WA 4WKGA 3ABZA 4C0XA 2AQ8A 4BLRA 5DYGA 1H9CA 2BP7B 1OTHA 2BR3A 4P4SA 2X2OA 5T64A 2NNWB 5AESA 1U0FA 3RTCA 2ZTLA 4YJFB 4AMGA 3AWIA 5H7XA 3HMQA 3NXSA 1V37A 3ZH9B 4U2FA 3S8EA 2HEGA 3T7EA 2GZDA 2VJDA 1AS0A 1JPVA 2OTCA 3WHPA 4BJ3A 4ZIRB 5CT4A 3UOAB 3OD1A 2ZIVB 2FAXA 4G0WA 4OTZA 4B43A 4R1TA 5T4BA 2Z95A 3KQWA 4PIPA 4LZOA 3K70D 4O25A 2PH7A 3IKJA 2G9VA 3HR4A 1ISMA 5LDGA 3NDBB 2QF7A 3AF4A 4WOJA 4YQZA 1KFJB 2EZUA 4URUR 2G5GX 2FETA 1FRNA 3COVA 3QSGA 5GV7A 4LVCA 1MO6A 1K08A 4LY3A 4OBXA 1W46A 3ZHVA 2GF2A 2J0QA 1W36C 3CUEF 4BNTA 1Z82A 1DIRA 1XDWA 1YCGA 2D00A 1VYUA 3B82A 4KE9A 1WZUA 1VSVA 1D1QA 2ZIWB 3KLPX 3BTVA 2QHXA 1OIWA 3OPXA 1J2JA 1Y63A 2WTXA 1Z0KA 3NGXA 3R0VA 5IDYA 3L8MA 3DAPA 3KXIA 4N9WA 3FMPB 1HQYE 4DA0A 4GKBA 5B7GA 2IBMA 3S27A 5KCZA 2V3VA 3HU2A 4NG5A 4XR4A 3PR2B 3EPKA 5KWSA 1E6WA 2HRQA 2Q0XA 1GGEA 3PGLA 1P7YA 4CBVA 2BN4A 1COZA 2WSLA 4QU9A 2CMHA 3OA2A 4AG6A 3JQ9A 3EDCA 3RC9A 2Z8XA 1A9TA 1QB8A 1NLUA 3N2KB 2FQ1A 4IDFA 3FSJX 4AJOA 4BX8A 1TQ8A 4A16A 2HSWA 2B1IA 4MUNA 1M2NA 2DUJA 3V6LA 3ZKWA 2O23A 3NHAA 1J56A 3D5TA 1DC8A 3D8UA 4MARA 3JCZA 4ZYUA 5A4KA 2Y1GA 1H22A 1K5PA 4K5QA 3SR4A 2VRCA 2BW0A 2IEAA 4HAVA 3K31A 1T9KA 5A71A 1T1EA 4ROTA 1P5HA 5EWLA 4HN4B 1HE5A 2ZRKA 4Q3BA 5I7SA 1V1MB 2FPXA 1DINA 3AKEA 4ETNA 4MV7A 1LBEA 1Q77A 1W73A 2AJLI 4Q3EA 1HDZA 3HCPA 2G06A 1H2RS 2Q6TA 5J5CA 1LLDA 1NQWA 2AFHB 3PXUA 4GO1A 4KSBA 2AQHA 1SBNE 3I37X 1UDBA 4GVLA 5FTNA 3O3MB 5G0SA 4LJLA 1IE3A 3OTQA 4KACA 2CL6X 1UBLS 3OC6A 4YB8A 4C0LA 5DX8A 1XZNA 3M9XA 1FDIA 3IHLA 1P1BA 3M5PA 3HL0A 1DKQA 4C7VA 1LBHA 3PXBA 2H31A 2I1WA 3HCBA 1FTSA 3CEJA 3RFTA 2J87A 4GP7A 4BVGA 2I1VB 4EI7A 1ZI8A 4P0QB 1X7ZA 4WI1A 1RYNA 3THRA 4Z3DA 2AXEA 1WZCA 1UKCA 3D6FA 1OD6A 4G09A 2NZ2A 5JC8A 3X1XA 3ZVKA 5LNK1 4IG4A 1TQ4A 1LPPA 2WJ4A 3PQFA 1T43A 4CF4A 3A4LA 4KQGA 1XJCA 2I7XA 2FEWB 4U1RA 1YD7A 2HOQA 2IYLD 4J7UA 5AKEA 1RJFA 1QXSA 1KYWA 1TMGE 1ZGZA 2EGUA 4PX2A 5LA6F 3STUA 3VSBA 1EBFA 1O8BA 2JAWA 1C9NA 4PSDA 5ERXA 2WIGA 3QY9A 4XD7A 3SC6A 3MINA 3A1NA 4B8YA 2YV5A 3K0AA 2VYND 4HDMB 2QG9A 5CLIA 2AD1A 3FSGD 4IRUB 4C0SA 4LTMA 3IEIA 4HWOA 3A6DA 3ZDFA 1DO2A 3GPDG 4TKMA 1GZ4A 3QPCA 1EB8A 3DYBA 3L6RA 1IAQA 4EPRA 2AOVA 2EATA 4OGKA 4G0VA 2DPXA 5IM4A 4CR7A 5GP1A 4I5GA 3I2KA 5ALJA 5DEIA 1VSUA 5CH5A 4II7A 3OTHA 4RA9A 5FPHA 3HJRA 1NQUA 4YFVA 5BURA 3AKCA 1ML3A 4DB2A 4DV0B 2ISQA 1NM5C 2LPMA 4R54A 4JOCA 1CE8A 4R2LA 2W2KA 1PT8A 4F4UA 4HEJA 5ECDA 3C6ZA 1T15A 4KMRA 5HF6A 5A0TA 4XM0A 4W5JA 2W93A 5BXQC 2FN3A 4KE8A 4N3NA 4OYYA 3WB1A 1AK1A 2VDVE 2ABWA 1NYRA 5L4NA 4PYJA 1QP7A 4TVBA 3QIVA 2RJNA 1R4NB 1CUIA 1GPUA 4NMXB 8ABPA 1UC5B 1WMAA 3GRPA 4DR6B 2TMKA 2JLAA 3NTLA 2NZUG 4F2DA 3LUPA 1N9ZA 3HWWA 3QU7A 3UT6A 3OCVA 2A78A 5BSRA 1RHJA 4BEBA 5JEEA 1MG0A 4G2TA 3H0KA 1RWOA 1M73E 3NAMA 5ALRA 1JG1A 4K9PA 3WB0A 4CM9A 2BL4A 3F6EX 4KR6A 1R5BA 4AURA 1CUXA 4QBTA 3CNEA 3T3HA 5C7IO 3RVLA 3GYGA 2WHPA 4KK3A 3PFGA 2YMQA 5LZ4A 2Z2IA 2H1VA 3VR5A 4JXJA 1O3YA 4QLAA 3BD9A 4REOA 4WPGA 1ACLA 1L1QA 4QUBA 2PUDA 2C9BA 1K89A 3BXGA 5BQXA 1K3FA 2AF4C 2VG8A 3E5RA 3PQ6A 3QOFA 2EZ9A 2NOAA 4P92A 3OE5A 4Q4HB 5KDLA 4ED9A 1OB5A 1T3LA 3EY9A 1P4GA 1DARA 1E3WB 1R5NA 1SKUA 3EC1A 4JEHA 1SVNA 1Q95A 2PD6A 3CZ9A 5K4GA 4HAYA 1XTPA 2CVZA 5HIJA 1ENPA 1XNGA 4ZXFA 5JD3A 4HAXA 4BVAA 2EIXA 2Q3MA 2AXQA 5GTDA 1N5RA 3CZAA 1YBVA 4F72A 2NAFA 4CDRA 4Y2SA 2WF9A 1F8UA 2EFEB 3FZQA 3TRJA 3X3HA 1U9IA 5IZCA 5F5XA 1FNCA 3BYZA 4KQJA 4C3VA 1EZ1A 2JVKA 2WAMA 4TZKA 5IKOA 4FS3A 2QE7A 3RTEA 5IABA 2E5LB 1U0GA 5JADA 3AL0C 4HNVA 2AYZA 4KPUB 5IU6A 4IGFA 1GKKA 2GZ3A 1CIPA 1FRZA 4QGSA 1J00A 4CT4B 2DY1A 1ZGCA 1YXMA 2NSHA 2OQRA 2H3EA 3M81A 4K9RA 4RD6A 3MYRA 3V1TC 4DV2B 1U5AA 1WA5A 3FNGA 2F43B 4XEHA 3QFRA 3CUVA 4J0FA 1MG5A 1ZS9A 2J0UB 1VOTA 4DG9A 5F7OA 3EH2A 5CYFA 3QF4B 1UODA 2Q1UA 3M49A 4GGPA 4EKNB 1CJSA 3F74A 3F0TA 4XUCA 2BD0A 3I2HA 1W5EA 4EEZA 1BHO1 5FNVB 3TEFA 4ZYYA 2BYTA 3U3DA 1GLGA 4PYRA 3P9XA 5LZ2A 1NDHA 2FX5A 2I2FA 3U4CA 4IIGA 5REQB 3ADOA 3OFVA 2WJZB 1HKHA 1QGDA 4LTDA 1S3SA 5FJIA 3U3RA 4RZIA 2V6BA 1S01A 1TGVA 1MZVA 4IIEA 1ESCA 3AFMA 4NYMR 2AZMA 4P82A 4XWOA 4CHTA 1TB4A 1ZL2A 4P08A 3K72B 3OWHA 5K8CA 2V9ZA 4PN3A 5LQMA 2CNWD 4AF7A 1AKNA 3ENZA 4WXHA 1EVEA 3NPAA 3QPWA 4CU5A 1NW6A 4PC3A 1FQWA 3KUKA 2W98A 2BI4A 4EOGA 1OWMA 3CONA 1KMHB 3R5JA 5K05A 1YKGA 3IIKA 5DM4A 5CPFA 2W2OA 3VAYA 1G8AA 2FPKA 2QM0A 3COWA 3WK5A 4KXMA 2A58A 2AFIE 2ODQA 4FDAA 1E2KA 3N7TA 5FWNA 4IF4A 4CM4B 1WCIA 3T3MB 4LBYA 5LVAA 4WW0A 2OK7A 4WX2B 4ZHQF 5KTPA 4NHOA 1T5DX 3IV9A 4O2BF 5ALUA 1PNRA 4HNUA 1KWGA 1ZM2A 2E4VA 3SYNA 4J07A 4JYBA 3T34A 4GHWA 1BCRA 4G24A 4WKOA 5EMKA 3RRZA 1Y5LA 1A04A 3N3AC 4BIMA 1AHNA 1ZOOA 5T6MA 4NU8X 2O8BA 4BJ6A 4TSRA 4IR7A 1N6PA 3PGMA 3V4LA 3RYFA 4H59A 1GUAA 3MB5A 5I9SA 1H2WA 1BDIA 1A50B 1E5DA 3MTIA 2W2VA 2J48A 3GCDA 1Q6YA 3MG9A 1D2NA 4RD1A 3Q5DA 3D54D 5JSZA 5K8JB 3VR3D 2PAAA 3NIFB 3EZYA 3I2FA 4MKGA 4R3UC 1GGKA 1SEPA 4R81A 4OP1A 1NKVA 4E4TA 4EW6A 5C8ZA 1KDOA 3TQIA 3IEPA 1PNOA 1E1QD 3P96A 3UTCA 4E3ZA 2B6HA 1QTIA 3FYUB 3V4SA 2C5FA 1JZTA 1ND5A 1YB1A 5TQVA 3HM9A 1YR6A 4E5PA 4PSVA 4UCWA 2B30A 4UXIA 3L9XA 3RS4A 4R8VA 2Q3EA 4EF6A 3KKQA 1TLFA 1PJ3A 1CY0A 2R68A 1H6AA 1OLSB 3S68A 2HU8A 1LLUA 2QM3A 4MUXA 1L4HA 1N9GA 1NVGA 1OJ7A 3OZ7A 4B6RA 5JRDS 1N4DA 1UZMA 1OAOA 1A8HA 2ZRJA 1X74A 1B7GO 2PKXA 3GUUA 3PICA 5LIRA 5F98A 4AKHA 1T6ZA 3D1LA 5KIAA 1U0SY 4PAWA 1QAMA 3LW7A 1VKZA 2I62A 5DU2A 5BN3A 1CQIB 1EG7A 3QW4B 3TBFA 1WQ1R 4IDCA 3VDRA 4WSOA 5C0OE 3EH1A 2ZJYA 5FPYA 4Q4DA 1J1IA 4XSHA 1N25A 2FTKE 1Y34E 3QXSA 3BSSA 1L5VA 2GJ9A 1J8VA 4B85A 5J43A 1T8PA 4LRUA 4I4TA 3A04A 1PJAA 4GUAA 2ID8A 2I2WA 4H16A 2C3PA 3G9QA 2BMFA 3EYWA 3ZKAA 3RS2A 4ALNA 4Z99A 3UOGA 1WUJS 1N2OA 3EVTA 4HRXA 1NF3A 4Z3KA 3BS4A 1G8SA 1G6OA 1FX1A 4OV6B 4AO7A 3SBOA 1X8KA 5ERGB 2CFSA 4W9NA 2W4IA 4ZVKA 2G9ZA 2CB0A 2PA3A 2QRUA 3FG9A 3SX2A 3IC5A 4L2IA 4NS4A 2DH5A 5DBIA 2AUTA 2B36A 3EWAA 3W5DA 2QJWA 4N82A 1LDNA 4HAOA 4Q3LA 2IRWA 4ROSA 1PQYA 4BX0A 1T6BY 2OE2A 3AHFA 5CAEA 3DAFA 1L5MA 4KZKA 4C3OB 721PA 2JLWA 3OSZA 3HACA 4PZZA 2XIQA 3NBXX 3LUKA 3FHJA 1C1YA 5FUWA 4AJIA 5ALTA 4JI0B 1SC6A 3TTSA 4DSAA 3BMCB 4G3XA 3V6MA 4FLEA 1NSFA 1H5NA 2BDEA 2PZGA 4PEVA 3T35A 1JPUA 4ECEA 3U7GA 1IHDA 2IHVA 5IDXA 3H6GA 4ASUD 2G7ZA 4F11A 5G4KA 1DDOA 3OLXA 9ATCA 5K6TA 3WS7A 3F98A 4MDEA 2D62A 5JTTA 1BVHA 1TQDA 1GGNA 4I1PA 4YAWA 5F35A 3RVMA 1UANA 4MS4A 4GBGA 3N2GB 4O4HA 1Z6XA 1ZIPA 5AXDA 4DADA 2HGSA 4NCAA 4BPBA 3HGTA 4HZUA 1GAXA 4XM1A 1XF1A 3LUBA 3E58A 1SBIA 5IX8A 3CH6A 4B35A 4CKZA 1DZIA 4D9EA 4GKVA 1FJ2A 2GD6A 3G9ZA 3OPYB 3FOEC 1LDEA 4YQEA 3P2EA 2ODBA 2UZ1A 1V5WA 2Q2WA 4NNPA 4D0GA 5L40A 2BSQA 4TUYF 1CP3A 4X0EA 4XQEA 3DZGA 4IRMA 4KKVA 1OA0A 1IN8A 2WFMA 3AVUA 1IN1A 1HL3A 1Q0PA 3KO8A 4HDNB 3RS3A 1TVMA 3K70B 1ZVJA 2JGDB 3DFKA 2VHWA 2EFDB 1S2LA 2I6QA 1NLYA 3PCRB 3PIDA 4JZKA 3I9OA 1IYZA 4Z6KA 1B0ZA 2Z4SA 1ESMA 2RHTA 2C5GA 3LQQA 1HFWA 2DQKA 3OLQA 3IBYA 3QOWA 4HVTA 3OHSX 4S35A 4MIKA 5E9AA 2TMDA 3CF4A 4DRXB 5FBVB 3DCIA 4INZA 1A95A 4MKFA 3SFZA 1G20A 1PJ8A 4URWR 1RWNA 3KSDO 2V0GA 4GR4A 1WXGA 2CFCA 2IZ6A 2E55A 3A1EA 3F7TA 3GOQA 4M1EA 4PFQA 4XGKA 1IAVA 1Z8HA 1UT5A 2C1EA 3OFSA 1IOLA 4CMCA 1QH1A 3S2GA 3H2BA 5BSWA 4UAJA 3NYIA 2CLCX 3GJ0A 2HLHA 3G5AA 3K0CA 4YGYA 3RGWS 3ORSA 5JSHA 3A14A 2GEJA 3ZOKA 5AJHA 3ZV5A 1YKFA 5GZ1A 3AUSA 3CRZA 2OZKA 3INYA 2VXCA 4P58A 4QFCA 2C3UA 3AKYA 3GEGA 4NZYA 3GGCA 2G88A 1XMVA 2HCRA 5JXJA 1VL8A 2WV7A 4RCYA 3STVA 4J8PA 2WAOA 2A1UA 2O19A 1XZPA 4OQ4A 3F7MA 1JSLA 2X6QA 4XXHA 4YI3A 2YFYA 5K45A 4CM7A 3ROPA 4GZLA 3OZAA 1EHIA 4UAGA 3GGDA 4UNRA 5CB6A 2IPOA 3IIIA 2VAPA 5M2QA 1SD5A 1TCBA 1PZNA 4ZO8A 1ACMA 1N2CA 3DO5A 2ZZKA 1O9BA 3EHEA 2WBLC 1DIGA 4IGAA 1AQUA 4PHGA 3L82B 3AEKA 2ZT7A 3LCMA 4G85A 4WN9B 4Z4HA 3K5PA 3IS3A 5J4LA 2FLKA 3GRYA 3BULA 1DAKA 3NTRA 3LLSA 5ITVA 1HSZA 3TG8A 3GLFB 3D6MA 4MPTA 5JQGA 4QNNA 4MINA 3A70A 4JLKA 1PZFA 4QBFA 3C6KA 3QE3A 2OG2A 3D5EA 1R0KA 3DEIA 4EEKA 2OGWA 3KVOA 2WU4A 1XEWX 1N6HA 1XZ8A 3AM4A 3FZNA 1KBQA 3Q9UA 2XMBA 1OYWA 4IJVA 3N2IA 4KLAA 2GARA 5GOTA 4C5AA 4HXFB 4BZWA 4L28A 4G84A 4YROA 5J2UB 3SJ7A 5HKLA 1OTYA 2JI7A 4OAPA 1T0JB 2DTXA 2CZGA 5AQEA 1GQFA 3A2KA 4M21A 1RYMA 4FNMA 1O6CA 1QFJA 3P5SA 2XR1A 3QFCA 3NP7A 1H2YA 4DAOA 3ER6A 2KX7A 3X0DA 3SS9X 1PS8A 1DKOA 1ID1A 1KKLA 2FPRA 3SQOA 3VFDA 4NENA 5CB4B 3TKLA 3U9TA 3M4NA 2IE0A 2BONA 2R84A 1M2VB 2Y93A 3C6XA 3M6WA 3LPCA 1NQTA 4DMKA 1ETHA 4XIYA 5LP6A 2VPTA 1P77A 3LCUA 5IVIA 4B3HA 1D2AA 2R8RA 2YOGA 4UEKA 2CB9A 4CCYA 4G6ZA 1EK0A 3A32A 4G5OA 2E1PA 4NMWA 1A8UA 4LMRA 4V39A 1N0WA 3KV1A 3WAKA 3E9CA 5KSZA 2I8CA 1DOHA 3LY5A 4F2GA 2R9VA 4GPBA 2BEKA 1JPNA 4NBKA 4BLVA 3ZJ4A 3HDYA 2A5LA 2DX7A 1HETA 4HATA 4IY1A 1MX9A 4BFTA 5C8YB 5CDFE 1WW3A 1SIBE 3DCJA 2I9KA 3I5AA 1EFHA 2R62A 4EL5A 3L4BC 1XTIA 5E9QA 2YJZA 1RYYA 1FNSA 2P5UA 1B14A 1YZ3A 1LI4A 3WIBA 1C3VA 1M6VA 3ENWA 3P19A 1ZOLA 2UUOA 3ECSA 2G28A 4M36A 4KQXA 4LC1A 3IE1A 1II8A 3AW9A 4KVFA 3OURA 1JSZA 3FYCA 3H8JA 4D7AA 1Z6TA 5IT4A 821PA 4FE3A 1QJ4A 3D2CA 4EFMA 3U4MA 1XRSB 1SVKA 4MV1A 2PD4A 3TH5A 2BR5A 3B9BA 3O1JC 4WBNB 4RD2A 3DOUA 3WYBA 2IS2A 2M1ZA 3VQTA 4CHGA 4ER0A 1VCNA 1BH2A 4CE6A 1IATA 2EW2A 4GL2A 1NKTA 4QBKA 2PV0A 1NJ5A 3ZU4A 3I6QA 5JV5A 2GPBA 3M5CA 1KAOA 4B82A 2A9FA 2AYYA 1PWYE 2YMMA 3U7FB 1AV6A 1JGTA 1U0JA 4C2AA 5E8JA 1JNXX 1TPYA 3IMEA 2NLOA 5LM3A 4K6KA 3RKUA 1H4TA 5E38A 3TYXA 5LMCA 5FLXA 1UQUA 3VNBA 2HADA 1P6QA 4C20A 1I2AA 3GLKA 1LRKA 3LL4A 2TYSB 4YRTA 3K94A 2OCGA 3KM0A 1WMSA 2CLKB 1CWUA 1WV1A 2VK8A 3ACCA 1P6XA 3PXXA 1FP6A 3ZYCA 1TMKA 3GLIE 4YJ3B 1GA1A 3GP8A 3JYOA 1NR1A 5C7LO 4AMBA 4DMUB 1SMKA 3OP1A 1X42A 1ZI9A 3PCXA 1P19A 2PO5A 1RLJA 3KPVA 1OWPA 1ZMTA 2C8KA 1E58A 1T1RA 3QE4A 5DRTA 3ZDQA 4RIIA 5FBKA 3IUBA 4MQEB 4Z9FA 1TKRA 5LB2A 2CFTA 1U9YA 4IKPA 4HB4A 3HXKA 4I55A 2HRCA 4OHBA 5C4GB 4FFSA 2JIDA 5G0UA 5DOZA 2GK3A 4YCBA 2I2CA 1Z0JA 1YZQA 4EF4A 1U7HA 4YAEA 4EHFA 6ABPA 1Y4UA 4B6QA 1G1MA 3IP8A 3OQNA 4GPIB 4FDUA 3D6JA 3W7VA 1D4OA 2QENA 2YY7A 5A4MS 4I4LA 5I7EA 3CKMA 3AZOA 4ZHSA 4KR0A 2NUPA 2L42A 5HEKA 3SC3A 3KPJA 4GBED 4GI7A 5TJ9A 2PRSA 4G8DA 2XY4A 4RKRA 4K1XA 3W05A 3RVQA 1BIFA 4MEJA 3I6MA 4MGHA 1Z4MA 3H11B 4FLMA 5E2BA 4HS4A 4L16A 2FEXA 3DEZA 1ML4A 4M1YA 3TSAA 3C4VA 1OFIA 1EDOA 3KLMX 5AJYA 3AG6A 4EHBA 2PVCA 5KREA 3ZDDA 1OSNA 3JRNA 5DMHA 4B3RB 1ZK2A 3PNOA 4HLUC 1V9CA 2P8JA 3GJZA 1BMFD 1PBNA 4RFSA 4ENSA 5JSFA 3ZQKA 5ICSA 2I9PA 1EGVB 2O4UX 3MILA 4YP6A 4GQBA 1NAHA 5KTNA 1G7SA 3BERA 2CVFA 3X2FA 1U3GA 2BTEA 4D45A 1XZBA 3IP3A 3AF3A 1T0HB 4XDZA 3R9KA 1JHOA 2ORWA 2JAXA 2JIRA 1NYLA 3E7XA 5ALIA 5CVJA 1GLNA 1I3CA 3RYCB 2O2EA 2AMFA 4H35A 4OM7A 3G79A 5HQJA 3H4IA 4WOKA 1GUFA 3FHTA 3DAHA 4MRPA 1KJNA 1YHYA 4FFNA 1BX0A 1HQKA 2FEAA 3DB2A 4FZ3A 2PH1A 4KCGA 1PYGA 4I9HA 4JS0A 3EWNA 3C3MA 5AVQA 3VM6A 2W90A 1M34B 1ULUA 1LZKA 1P7ZA 3QVGA 3R5HA 3QEOA 3KELA 3PE3A 3AFOA 4PS0A 3V97A 1E77A 4DV4B 1HTWA 4NS1A 4X7MA 2C00A 3RS7A 1XRJA 1Y82A 1JSCA 3QX7A 4A9AA 2WSIA 1YNSA 3T0IA 2YINC 3HDGA 4N7RA 3JWIA 4M22A 3MHTA 1D6SA 1LJ8A 3GRZA 3NASA 1BXRA 1G3UA 4I6JA 4B74A 4XUEA 4H0NA 4ZP1A 4NOMA 4N12A 3VC1A 1STOA 4WERA 1XRLA 1UMDA 3H5VA 1E2PA 1RE0A 1TT5B 2DLNA 3KJXA 2BELA 4FYJA 5AI0A 1BRMA 1XXHE 4Y2RA 5JDIA 1MPXA 2O7VA 3DM9B 1M67A 4HB3A 4O1HA 3CT6A 3ESXA 1Z6GA 1FJHA 2WWVD 3IXLA 1KP3A 4BLSA 5FULA 2FXVA 4OB6A 1VG9B 4EGQA 1J2UA 3BCHA 1Q1EA 1THGA 3OPQA 4RQTA 4ZVUA 5JJBA 4KJZA