5K3DA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - wt/apo - no halide
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
297
structure length
289
Chain Sequence
ALADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHDRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGATPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluoroacetate dehalogenase
publication title The role of dimer asymmetry and protomer dynamics in enzyme catalysis.
pubmed doi rcsb
source organism Rhodopseudomonas palustris (strain atcc baa-98 / cga009)
molecule tags Hydrolase
total genus 111
structure length 289
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k3dA00
2FJ0A 3C8DA 1XQYA 2Y6VA 2GYWA 4UHFA 2WU3A 3D2BA 3WL5A 1ODTC 4H7DA 2HA7A 3O95A 1DTEA 4MEAA 5IVHA 2WFMA 2XUDA 1DINA 1DX4A 2C0PA 1VA5A 1BN7A 5HF8A 5EIEA 1LBSA 3KWFA 5CT8A 2ROQA 1ETHA 5FLKA 5DTIA 2R11A 2XQFA 1XQXA 4AMYA 2Z5GA 3HRHA 1XZLA 5F4ZA 2FX5A 5JAUA 1DWPA 5IVKA 1O6FA 4DSZA 4KJXA 1CV2A 2WHQA 1CUGA 2FUKA 3ESAA 2VF2A 1BEEA 3AINA 3C6ZA 3OURA 2XUOA 2YH2A 3C43A 1CR6A 2HFJA 5AHXA 4C4ZA 1XZEA 1IUPA 4C6HA 4GXNA 4QDOA 5DTJA 3IUQA 2QMQA 3DD5A 1WB5A 2I78A 3AZQA 4NS4A 4ZWNA 4AO6A 4BAGA 3PICA 5AO9A 2XLCA 3QYJA 4IH4A 2J4FA 1K63A 2OPHA 3AZPA 3PF8A 3C87A 2I3ZA 1A7UA 1O6GA 3G0BA 1ZGCA 1JFRA 3W05A 1H2XA 4BTLA 1U65A 3QVMA 2HIHA 4OUKX 1DX6A 4NMWA 2C5FA 4UBMA 2XMQA 5AIBA 3WL6A 4K6KA 2WILA 3WYNA 3DKRA 1C7IA 2QUBA 1EH5A 1GKLA 2Y6UA 3CCBA 1CVLA 5K3FB 4KAJA 2V96A 2OCGA 5LZ5A 3ANSA 2HU8A 3C5WP 4BRZA 3RK4A 4X91A 3IA2A 4ZI5A 2BJHA 4CCYA 3FLBA 5DLPA 1Q84A 4LXIA 4KYVA 3NGMA 5ALFA 2PPLA 5CT5A 4F5ZA 5T4HA 1MX5A 4FFVA 4Y2TA 3DLTA 3FSGD 5FOQA 4FNMA 4X93A 2BCEA 1W1IA 5E4YA 2XQJA 5JARA 4GI1A 3RLIA 1A8UA 4BVJA 4EUSA 2G4LA 2YYSA 1QLWA 3TJMA 5YASA 2HA3A 3QZUA 4C89A 4F0JA 2ZYRA 5EHZA 4G4IA 1QIGA 2W6CX 1PV1A 2QXUA 1XKTA 2XMGA 5CBKA 4CG2A 3N2ZB 5HF6A 1VJ5A 3AFIA 1VLQA 2BKLA 1H22A 4J0HA 1WB4A 3WQHA 5AKLA 1ACJA 1E66A 4A16A 1C4XA 1KEZA 5CH8A 2WJ6A 4HVTA 4U2DA 5EI5A 1JJIA 5DWDA 4AQDA 4BP9A 1SCKA 1BN6A 3AUKA 1YR2A 2B61A 1CIJA 3FAKA 4UHEA 2WUGA 3FLAA 2XUKA 5C8VA 1NU8A 3O4IA 1LGYA 2WHRA 3I2JA 3FVTA 4NZZA 1G66A 3QPCA 4B83A 3O4JA 5AKZA 2XMZA 2ZYHA 2QJWA 1EI9A 5AI6A 3WYDA 2RAUA 1LPNA 3W06A 1CQWA 3QMMA 3STYA 3A70A 5AK4A 3P2MA 4I3FA 4S0XA 1PJAA 4ZREA 2C5GA 3G0GA 4G8CA 1JMKC 1R4ZA 2GBFA 3WI7A 5AKJA 1CUVA 2OCLA 1BRTA 4U2GA 3RKSA 4AO7A 2FJPA 4K5QA 4A5SA 4DMFA 4OU5A 3NUZA 1YASA 3R3WA 3O4HA 4RNCA 3G9ZA 4UHHA 4KRYA 2DHDA 3G9TA 5AKYA 4FLMA 4C4YA 1JJBA 3AIKA 5EHQA 3W9BA 4PNZA 5FV4A 3ZPXA 3DOIA 2AJDA 4W9RA 1XZDA 4K6HA 3IUJA 4H7HA 2XQKA 3G0DA 4JUIA 1BEZA 3SC2A 4FWBA 1IUNA 3WWEA 3ZLUA 4X97A 4MYSA 3I6MA 3F98A 5LZ9A 4IH1A 3STUA 2BGNA 3C45A 3C8HA 4BP8A 2G5PA 4UHCA 4BTVA 3NWOA 4IHAA 4Y9SA 2DHEA 3O4GA 1JU3A 4KE6A 1IUOA 4G9GA 3H0CA 4RPCA 5EHXA 4WFKA 1EX9A 2GZSA 4EY4A 5K3BA 5LZ8A 5E4TA 4UFOA 4FKBA 3LS2A 1Z68A 3V1MA 3DS8A 5AKEA 1EDDA 5HKBA 2XDWA 5A6VA 1UXOA 2RONA 1J2EA 5D3ZA 2HRQA 4FDMA 2PBLA 3OC0A 1G5FA 3U0VA 5AP9A 1UT6A 3W9UA 2C0QA 2OCIA 5ALYA 1SCQA 4BCDA 2I3DA 4DTCA 2VT7A 3WA6A 1GQSA 4JH0A 2OGSA 4KR0A 3WK7A 4JYMA 5D3KA 1CUEA 3V1KA 1YS2X 2PU5A 1VKHA 3WWDA 5HF9A 4FTWA 2RIPA 2ZJ7A 3A2NA 5CT9A 5ALUA 1TIBA 3OM8A 3X3HA 5KBYA 2AJCA 3TEJA 3D0KA 2QT9A 4X71A 3JWEA 2JGJA 1EB8A 3G02A 3LLCA 5JYCA 4N8EA 3FOBA 2B20A 3H2JA 1N5RA 1E89A 4LYEA 1UOQA 2WTMA 3IBTA 4Q3KA 4OD0A 4N5HX 2AJLI 3D7RA 5ALLA 3BJRA 4JNCA 1U8EA 2WM2A 5ALZA 3E1GA 3VKFA 4J0GA 4QE3A 3RM3A 3EQ8A 3OOSA 1UKBA 1UK9A 3I2KA 4U2CA 1QIKA 1QIIA 5C8XA 2HM7A 4FHZA 4C4XA 3WL8A 5HF5A 1W4LA 1ZD2P 1MAAA 1SOMA 4LXHA 5CH5A 4H35A 1J1IA 2DFPA 5KWIA 1UKAA 4K2AA 4MQMA 1XZAA 1LPOA 4RE5A 5ALSA 3UUFA 2R8BA 1GPNA 2H9YA 5DNVA 1QGED 4U2EA 3R3UA 4WY8A 4X6XA 2XUPA 2WFLA 1HBJA 3EBLA 3FYUB 4DSAA 5LYYA 4F60A 5EFZA 1THTA 3ZV7A 1VZ3A 1XFDA 1ODSA 3IIIA 4GBGA 4OB6A 3AIMA 5CH3A 5FP0A 2YXPX 1W76A 2QOEA 1AURA 2JEYA 4QA9A 3BF7A 2PSHA 4G4JA 2Y2UA 3SK0A 3BJMA 5BWBA 1USWA 4KE8A 3G0CA 5FXMA 1VE7A 1EA5A 1R9NA 2EEPA 3F97A 1QOZA 3V48A 4K6GA 1M33A 3AZOA 3RARA 1MJ5A 1FFAA 3KWJA 4EA6A 5JAOA 4BVKA 1YB6A 4BRSA 1H2YA 5K3AA 3VDXA 4L3WA 5HQ3B 3HXKA 5CXUA 1H2WA 3QM1A 3V9AA 3IUMA 4L0CA 5J3JA 4PO3X 3Q0TA 1CUZA 3H04A 5HK8A 4ARBA 1B6GA 3BXPA 2QR5A 4BE4A 3H1BA 5D7BA 5I8PA 3WKBA 5ALQA 4B84A 3PUIA 1CUUA 4PF1A 4KEAA 5CTAA 4E14A 3I2IA 1ZI9A 4B85A 1AGYA 1MO2A 3MUNA 4CFSA 3WWCA 1QFMA 3S2ZA 4EY7A 5JASA 4CI9A 4HXEB 3WK4A 4GHWA 1ZI6A 5BV7A 4J0IA 5EIAA 1EK1A 2P8SA 4B0PA 1XZIA 3LP5A 4AO8A 1U2EA 5JZ9A 1TK3A 3IURA 2WHPB 2PSDA 3PFCA 5CRIA 3EQ9A 1BROA 3STTA 4GLBA 4DIUA 4M0FA 5SYNA 1MNQA 3LCRA 1XZJA 5ALHA 1XQVA 4E46A 4DYHA 4U2BA 3IB3A 1Y7IA 5JD4A 2WFZA 4HRXA 4H7KA 3WJ2A 4P93A 4CCWA 4OYYA 2B9VA 5LIPA 2Z8ZA 4X95A 2OXEA 4X3CA 3BIXA 2K2QB 5AK6A 1WHTA 5ALXA 3WJ1A 2WIFA 1DT5A 3NOXA 4MWTA 1XZFA 1JMYA 1R1DA 3W04A 5AKKA 2JGFA 2IX9A 4MXDA 4UFNA 3FWHA 3DL7A 2ORYA 3G0IA 2QKYA 5C8ZA 3SWWA 2NW6A 1VA4A 3R40A 2HHAA 2XQGA 1YCDA 5K5EA 5DYWA 5ALVA 4Q3OA 4M0EA 5C81A 4Q34A 4GW3A 4UBJA 4KAAA 2H7YA 4EY6A 3HYSA 1CUYA 1LPBB 1E8NA 2WG2A 2JGLA 1BCSA 2O2GA 4H7IA 3BL8A 2WUFA 5A7HA 2XI4A 1ZD4A 1UWCA 3TGLA 2GBIA 2VT6A 3L1JA 5AOBA 1UFOA 4GWLA 3WL7A 4WY5A 5EHNA 5I7UA 4AB1A 3Q8WA 5ALDA 5SYMA 3D3NA 1EVEA 2IITA 5E4JA 3CN9A 5JD6A 5K3FA 1EB9A 1LNSA 4OB7A 1SCIA 2WKWA 3D4LA 5CW2A 4N8SA 4AX4A 4B9AA 1IVYA 2HFKA 2JGKA 2E3JA 5AH0A 2IIVA 4G8DA 3T4UA 3HZOA 5AKGA 4E15A 1Y37A 4FLEA 4Q82A 4B0OA 1K6EA 4J3JA 2V98A 4PQEA 3QBJA 2WU4A 4UBNA 2GYVA 2QZPA 1HKHA 1LLFA 4KRXA 4HRYA 3DJYA 5T4FA 3DL4A 4CIBA 4A23A 4EY8A 2QXTA 5AK3A 1XRMA 2VAVA 1HL7A 1TCBA 5T4BA 2X76A 4BE9A 1Q83A 3ICVA 1XZMA 4MWSA 1TQHA 4EY5A 3D2AA 2J3QA 4W1SA 3UMJA 3PDCA 3EF3A 1XZGA 3D5EA 2WIKA 1QE3A 1LPSA 3QH4A 1QIFA 5CURA 1MNAA 4DNPA 2CB9A 5HFAA 2WTNA 4UBKA 1JU4A 1N5MA 2ZYSA 3KD2A 1ZICA 5ALTA 3I2GA 1QO7A 3CCCA 2VJCA 5IVIA 3KDAA 3DYVA 1MAHA 1ZOIA 3ESCA 1CUIA 3WZLA 4DNFA 2XMRA 1K5PA 5CT4A 4YPVA 5ALEA 2V9ZA 1EINA 3E4DA 4ZRDA 1YS1X 4GECA 2G5TA 1DQZA 1TAHA 3FYTA 2WIGA 4J03A 3DCNA 3JW8A 1A88A 5AKIA 1WPXA 2VA9A 4W1RA 2CJPA 1L7AA 1Q0ZA 1MTZA 4BVLA 3L1HA 5CXXA 3V1LA 4X85A 4B80A 1TCCA 4Y2YA 5A71A 3QMWA 3WMRA 4Q3LA 4W63A 5HKAA 1CUDA 5EIHA 5ALRA 2CMFA 2DQZA 1UK6A 3R3ZA 1GKKA 1CUCA 4EB0A 4IQ4A 3VJKA 1CQZA 1OXMA 1CUBA 4Q1VA 3B3QA 1VOTA 4Y2QA 4ITVA 4HS9A 4Y2RA 2WG1A 3S8YA 3IDAA 4ARAA 2C58A 3JYHA 2XUJA 1LPAB 1BCRA 3C6XA 3WIBA 2H7XA 1E3QA 1DWQA 4DMCA 4WFJA 3HEAA 3UUEA 1CUSA 4C88A 4ZV7A 3WK8A 5ALIA 2VJBA 3GZJA 3WKEA 1VE6A 3VXKA 4XJVA 1UK8A 4UHDA 4BAUA 3STWA 4J0CA 3WWOA 5EGNA 5AM5A 1P0IA 1H2ZA 4ZV9A 5C7YA 4Y7DA 1QIDA 2J4CA 1ZJ5A 4WCVA 4WJLA 4B6GA 1R3DA 4J0JA 4BC1A 4FOLA 1TRHA 4HXGA 1CUAA 1G42A 5CMLA 2CUTA 2RI6A 5AI0A 3IULA 1SC9A 3U1TA 1VXOA 3A6ZA 1MPXA 1BU8A 5ALKA 3T52A 2OGZA 3KXPA 5IVDA 4QLOA 1QZ3A 4Y2VA 5ALWA 4CG1A 2O2HA 2PSJA 2XQIA 1WCYA 3I28A 3VJLA 5HK9A 4Y2SA 4M0MA 5LZ4A 1XROA 4KE7A 4P9NA 3YASA 5K3CA 3WIOA 3WLAA 1ZIXA 4LKOA 3EIOA 3WA7A 4H77A 2XMBA 2ZSIA 1IMJA 1GQRA 4H18A 3VVLA 3C6BA 3ZLVA 4GEGA 1HLGA 2DHCA 1DT3A 1HQDA 1CUFA 1CRLA 5DJ5A 2XLBA 3F9CA 2XUQA 2OAGA 3HLKA 4G1FA 1AKNA 3KSRA 3M83A 1MU0A 2ACKA 2ECFA 1THGA 1AC5A 4P08A 4QEKA 1GGVA 2BAGA 3HSSA 5FKJA 4BCCA 4DLNA 1YSCA 5BWCA 1CUHA 3STVA 5JZSA 3I1YA 1XKLA 3E3AA 2XUHA 3HABA 2RHTA 1RWQA 2WSLA 1MX1A 4BZZA 1ZJ4A 1BE0A 4TGLA 4CIAA 1CUJA 1AQLA 1XQWA 2RGUA 4BZWA 5AKHA 4OB8A 4B7ZA 1T2NA 2H7CA 4BC0A 3M82A 1RP1A 2PKYX 3AJAA 2VJDA 4XX1A 1XLVA 2HRRA 4ZGBA 1A8SA 5KREA 2XMSA 1XZBA 4YASA 4G5XA 3FYUA 3G9UA 3HC7A 1XZCA 2XT0A 4DNQA 2HDWA 2HA5A 2XUGA 4OCZA 5ALMA 1AX9A 1EXWA 4HTAA 2W22A 4INZA 4QWMA 2QS9A 3ZWQA 4B82A 1F0NA 2O7VA 3A2LA 4XIIA 4LIPD 3IUNA 2BFNA 3H2GA 4FBMA 4KE9A 1CLEA 1W75A 1X2BA 3CXUA 4C01A 3M81A 2PUJA 6YASA 1YAHA 4Y2XA 5ESRA 3ILSA 2G63A 4ROTA 3BE8A 1CPYA 3FCXA 1EK2A 5FUMA 3WZMA 2VQ6A 1FFCA 2GYUA 1AUOA 1YB7A 2AXEA 4AN0A 2BGRA 4BDTA 2V97A 4E11A 2WJ4A 1SFRA 1LPMA 2QVBA 4L72A 5HCUA 5HQ3A 5JAPA 2GBCA 3VJMA 3PI6A 2WUDA 3WK5A 1R88A 1P0MA 5AIAA 1JJFA 1VZ2A 2DCMA 1C7JA 3BWXA 3G8YA 4HXFB 3DDUA 1ZI8A 3OG9A 2B4KA 5A7FA 4OSEA 3H2HA 4FMPA 3FCYA 4X90A 4QDZA 2HU7A 2OQIA 2EDCA 1E8DA 4AXBA 1I6WA 4PW0A 1RYYA 4O08A 2ES4A 3N0TA 4B9EA 1QIHA 1JKMA 5ALPA 1ORWA 4FLFA 5JANA 1KU6A 3SX4A 5AOAA 1JI3A 3PF9A 1XRPA 4Y2JA 2H1IA 1HPLA 1ZIYA 5AOCA 5BOVA 3W2TA 2CZQA 2WHPA 3DYIA 5IH7A 2D5LA 1QO9A 1YA8A 5LZ2A 2PX6A 1TKRA 1FSSA 2JGIA 3GELA 5ALGA 2ONCA 2RHWA 1J07A 1LPPA 1ACLA 3HI4A 5DYTA 1FFBA 1P0PA 3STXA 4RGYA 3DNMA 1XLWA 4X7BA 1L7QA 2WLSA 1XRRA 3GUUA 2WIJA 2JIDA 2BUAA 2WIDA 5AJHA 1MN6A 2Y1KA 3F8SA 7YASA 1Q0RA 2JEZA 3QITA 4MYDA 5DNUA 4F21A 2VAXA 2D0DA 4TVKA 1NU6A 3BDVA 4EBBA 4ETWA 1WOMA 1B41A 1QTIA 4UPDA 3WWPA 3MGAA 5AM1A 4GDMA 1N1MA 3ICWA 4QNNA 1OCEA 2XB6A 4CCYB 4RE6A 4BATA 1H23A 5FPQA 1QJ4A 4BAZA 2WQZA 4FBLA 3D2CA 2JGEA 2CBGA 4UUQA 2Q0XA 4BYMA 1MT3A 2DSNA 3WKCA 2CKMA 5JATA 1UKCA 2PSEA 1F6WA 2JF0A 4PSUA 3PUHA 4G8BA 4X94A 4DM7A 2WG0A 1QIEA 1LZKA 4DMKA 3OTQA 3O0DA 3EQ7A 4QLAA 2HADA 3I2FA 2Y2VA 4QDTA 5JALA 1YA4A 2OCKA 3E0XA 3AILA 2O2IA 4BCBA 1S8OA 2O7RA 4BB0A 2ZSHA 3FBWA 2XUIA 3FNBA 5A2GA 2HA0A 1XRNA 5HZGA 3R0VA 5AM0A 3VISA 2QRUA 4MQLA 5FPPA 2Z3WA 4BBZA 5LLSA 2GBGA 2XE4A 1WPRA 1W52X 3H2IA 3G9XA 1N8SA 1HDEA 4LYDA 5FRDA 3H19A 2I03A 3C5VA 3FLEA 2J3DA 4YK7A 5LKRA 4X6YA 1KU0A 1AZWA 3I1IA 4WDQA 5ALJA 5AI9A 4JEIA 1UOOA 3V1NA 3BDIA 2JGMA 1WHSA 4H0CA 3R3XA 1L7RA 3R3VA 2OLEA 1GPLA 4JYPA 4OU4A 3B12A 2HA4A 3MVEA 4AN1A 4J0DA 2YASA 1WB6A 2PL5A 2BUBA 2QUAA 2HL6A 2ZVDA 3R41A 2PU7A 2XUAA 5CT6A 5JZBA 4X00A 4QZVA 5AK5A 1XRQA 5JADA 2QTBA 3WKDA 5FDFA 4G9EA 3GFFA 4X6UA 2UZ0A 5AI4A 1QFSA 5DYYA 2BUCA 1VXRA 4I19A 4N8DA 4IO0A 4FFWA 1FJ2A 2ZJFA 1QIJA 5JD5A 2VEOA 1EHYA 1D07A 1UOPA 3FVRA 3HJUA 5A62A 3WKAA 1QTRA 4DMHA 2OAEA 1GZ7A 2PM8A 4L9AA 5ISMA 4X92A 3C6YA 3ZI7A 4DNOA 4FNGA 3I2HA 2XMDA 4KACA 4N5IX 4UBIA 2EDAA 1P0QA 3FSGA 5LKAA 1CFJA 4C87A 1X2EA 4UFPA 2OQVA 1EDEA 4W1PA 1YAJA 4UBOA 1LZLA 4AMZA 2DR0A 1GXSA 2OG1A 4OPMA 5LZ7A 3OPMA 1X70A 3M3DA 1UZAA 1E8MA 2VATA 2VTVA 3DKKA 3KOOA 4G4GA 4PV7A 4H7JA 3LIIA 3CN7A 4MEBA 1QIMA 1K8QA 1A8QA 1NX9A 5T4EA 1UK7A 1CUWA 4J7AA 3GBSA 3MUOA 3C70A 2JBWA 2HA2A 3ED1A 3ANTA 4CG3A 5K3EA 4QDUA 2DQYA 4DGQA 2PSFA 5IKXA 3D59A 1R50A 1CUXA 3DQZA 4ZXFA 1J06A 2HU5A 2X8BA 5ALOA 3ESBA 2ACEA 4EZIA 1F8UA 4QDXA 3VVMA 5AKXA 1ZGBA 2QM0A 1ISPA 5A7GA 3FYUC 3O9VA 4TPKA 4EHBA 3K2IA 1Y7HA 4P92A 2WUEA 3BF8A 1E5TA 4WFIA 5HFNA 4D9JA 4UHBA 2Z3ZA 1FFDA 4WDRA 3WK6A 1WM1A 1XRLA 3DOHA 3GA7A 3H2KA 2QJRA 1W6RA 3F67A 4Y2PA 5D6OA 3PFBA 2VJAA 4IH9A 3QMVA 3K9BA 1EDBA 4V2IA 4XVCA 1G4HA 2C4HA 4PSDA 4HZGA 5AM3A 4HAIA 2HA6A 1XLUA 3BIWA 5H3HA 2XMCA 2Z8XA 2X5XA 5AI5A 4AZ3A 4B81A 5KWJA 1OILA 1QONA 1T4MA 3DEAA 2C7BA 1EVQA 1R9MA 3I6YA 2WFLB 1AMNA 1PFQA 2WJ3A 1U4NA 1DU4A 5AI8A 4Z49A 4XWGA 5E2IA 3GROA 3QPAA 3K6KA 3A2MA 4YX9A 1BS9A 4LXGA 3QPDA 3F96A 3PE6A 1FFEA 4Q05A 4I4CA 4Y2UA 4H7FA 4KAFA 5I9IA 1CEXA 3IVMA 2LIPA 1TCAA 1IZ8A 2CEKA 2ZYIA 5AICA 4U2FA 4OYLA 2PVSA 3I6ZA 4BDSA 5JAHA 1XZHA 3H17A 5JIBA 3L1IA 2OGTA 1F0PA 1MX9A 3H18A 1DWOA 1ODCA 1ZD3A 2AJ8A 5AM2A 4PSCA 3G7NA 1GT6A 4NVRA 1ORVA 2AJBA 1ZD5A 2VSQA 4LHEA 4H7EA 3ESDA 2GZRA 4J0KA 4QWWA 3ZLTA 5ALNA 1XZKA 1JT2A 3AIOA 1LBTA 3HACA 1IZ7A 3B5EA 2XUFA 3WK9A 1DQYA 1GPKA 3LIPA 5DNWA 3TRDA 5K3DA 2PUHA 4W1QA 4UBLA 2ZJ6A 5AM4A 5LP1A 4AZ0A 3H1AA 4MJ3A 3O9MA 3R3YA 1K4YA
chains in the Genus database with same CATH superfamily
5FI1B 2KJQA 2LIVA 3K8ZA 3NR2A 4A15A 1SHZA 2WWVD 4WERA 4FKZA 3W7VA 4C0LA 2W93A 2LGJA 3RVMA 5B3AA 3GJYA 3L07A 1X1CA 4M53A 1R5NA 1I01A 3ISTA 5EJ6A 1JHUA 3UV7A 1Z7BA 1ZOLA 3D2BA 2H1OA 1OU4A 2NIPA 2YOGA 3AHDA 2UYQA 2W6OA 3NGLA 3OCXA 1V6CA 3O95A 5F7ZA 3TD6A 4C2UA 5F9FA 5JLAA 3Q2KA 2PKQO 2NO0A 3D9QX 2R8RA 4LDJA 2WB4A 1NNI1 5CNMA 1WPQA 1YJQA 2X6QA 2XUDA 4L2IA 1JLRA 4DHWA 5EIEA 2C0PA 3JQFA 3KQNA 5HF8A 4NJEB 4GZLA 2G3YA 1UZNA 5DEOA 4QYXA 4E2YA 5REQB 1KO5A 5CT8A 3IBGA 1OE0A 2CJWA 2ROQA 2SKEA 1DBPA 5HJ7A 3VMMA 4IDGA 4NAUA 1I36A 4LZJA 2JHCA 5DTIA 4DT1A 5K8TA 2R11A 2R79A 5DWQA 3RTAA 1H0SA 3HRHA 3ZCQA 1AXRA 4DC0A 2PEYA 3IKMB 2CXOA 2NUAA 4MVWA 2V45A 3G8BA 1Y6GA 3RYCB 2QW1A 3W3AD 2AOVA 3HMKA 3DDNA 2OYRA 5JRJA 2ORVA 1DWPA 2GUGA 4NAHA 3W6NA 4DSZA 5IDQA 4KPEC 1GLGA 1GL3A 3T4XA 5B30A 4E07A 4F56A 3CH4B 2WHQA 1KIAA 2OCPA 4YO8A 4K9SA 1X1AA 2ACVA 4QQFA 2QGFA 3RS0A 1JSZA 4D8YA 1G3UA 1FP7A 1NI3A 5HF9A 1V2GA 4UQOA 2FUKA 5DP2A 4RK4A 2QLNA 4A5OA 1KQGA 1I24A 1VI5A 1FJGB 1Z6XA 3QGMA 1S9DA 1TEXA 4RCZA 4TLCA 3GA5A 1ZK4A 1RW4A 5T6BA 2QDXA 2ONJA 3ENZA 2P77A 3C6ZA 2CBXA 3NC4A 1BWPA 2XUOA 3ZHBA 2WJJA 1WHTB 3B5IA 1EXMA 1IB6A 3IB6A 2NO5A 4KDCA 3GPIA 4DDWA 1WXGA 1FVHA 3CT6A 3Q1KA 3C43A 2GZHA 1G7RA 1MEOA 1CR6A 1KR2A 5BNIA 3KKPA 3VPHA 3GRRA 1QHHB 1Q95A 4JENA 4P31A 1IUPA 4RVHA 3TXAA 1CX9B 3WK7A 2VT2A 4C6HA 1U0GA 3I9NA 1YJCA 1RZRD 4UCQA 1HZZA 1QU3A 4D3XA 5IBRA 4FZJA 1YFLA 1OGYA 3DD5A 2I78A 1V71A 3KQWA 1BJRE 3QSYA 4JX9A 3B7GA 1ZGZA 3A3YA 1K6XA 4RDIA 2VOJA 4BAGA 2H7VA 1KHHA 5A5GA 3PICA 3DZFA 2RHOA 5HP4A 1YCGA 2XLCA 3MCVA 2YRFA 4IH4A 2J4FA 1SWWA 3NJRA 4C2TA 4K6MA 4ZV4A 1UBMS 1UJ4A 2JLAA 4CKXA 3ZD7A 2CF6A 4WK0B 2UAGA 3KYCB 4P7FA 4S2UA 4JELA 2GK6A 5DHAA 4ZA2A 3F6SA 4A6DA 4MA0A 5JH7B 4B6PA 2G9RA 1J42A 3DBRB 1ZGCA 1O9GA 2QL9A 3FUVA 4R2KA 3TMKA 3W05A 1RBZA 2IHTA 4NKRA 1JEYA 4EGSA 1IY0A 4JP3A 2P3LA 4IOMA 4RK0A 1GFIA 1R0KA 1U65A 1SEVA 3QVMA 2HIHA 2KWIA 3PE3A 1OXTA 1T3ZA 1NAHA 2QGZA 3PCRB 4QAJA 1LWOA 3MWDB 3BL5A 1FDWA 3VX3A 3V55A 2C2OA 3FR7A 3O6VA 1SCNE 5CCXA 4DL9A 1NVMB 5JHHB 3S29A 3DOJA 2WILA 3WYNA 3G59A 3E22A 2NYVA 3UICA 1O4VA 2DBRA 3OIVA 4EA9A 5KUTA 1HFEL 1I9GA 2HMWA 2A6PA 2XB8A 5HMMA 3PLNA 5IFLA 5KNBH 1CZRA 2Y6UA 3CCBA 1P72A 1CVLA 2V8BA 3LHIA 1RHKA 2H16A 1TCVA 4JVMA 5K8VA 4KAJA 5LYJA 3VNQA 3WBBA 4V39A 2GHIA 3A32A 2G5CA 4TRMA 2VRWA 1WV1A 2HU8A 1X19A 2AFIA 4O1IA 3CA8A 2IZ6A 5IKOA 3R1IA 1MGPA 5FUYA 2CJXA 2W0SA 3ZUPA 3DGFC 1KYXA 2N42A 4IKPA 4XUCA 5HZHA 1C0KA 3JZMA 1U4OA 4Y6GB 5DT2A 2XTJA 3EN0A 3IP7A 4N3BA 1CS0A 3CO5A 5EXXA 1PW7A 3QLUA 3QLEA 2RHGB 4YPFA 1MIOB 3GZTB 5IK2A 2FSVC 4WKNA 4JLWA 2ZIWB 4DQUA 5LD2C 1SBTA 5IYZB 3OJFA 3SR0A 3ZWDA 1FSGA 1DKNA 1WF6A 2PPLA 1N7IA 3LK7A 4KXYA 5F1YA 3JAMA 4L6IA 4HVAA 2ZU6A 5CYPA 5IAEA 3EW9A 1MX5A 1TUIA 2QX6A 2PWBA 1E4VA 3CXRA 3GGSA 4M0KA 4M8SA 4MJXA 1IL0A 4Y2TA 1PR6A 3S5JA 5LUBA 1G63A 1Z2AA 1ZS9A 1SIOA 3E53A 1LK7A 1MDFA 1XVAA 3DLTA 1X74A 1RXCA 1Y7PA 2BFFB 3ENNA 3FSGD 3GRZA 3QNWA 4YT2A 1ZGJA 5FOQA 2CHFA 5EFOA 4MUIA 4UVIA 4ZHQF 3ZY2A 1KRWA 4HSEA 4QJ5A 4S24A 3VU0A 1GTSA 2ZJOA 2MSNA 3IE0A 3GOQA 2QV7A 3ZHCA 4AM8A 1VBNA 3CRQA 4YAUA 1C14A 2ZKIA 5KQGA 2X40A 1RLMA 2QT1A 4G2TA 2FTKE 3CJTA 3ZVLA 5JPDA 3RLIA 4LHYA 4C0AC 3TOSA 3CLTD 3L77A 2YQZA 4KX3A 4OO3A 5KQLA 1QKJA 5ITZA 4BQOA 1IJFA 3LDAA 3QZUA 2C95A 3T7CA 4WV3A 1MO4A 2VRBA 4DILA 3JQCA 1NR7A 3PWTA 6Q21A 1JDNA 3I9OA 4JLNA 1T5DX 3EFOB 2Q1XA 4N76A 5EHZA 1GADO 4WTOA 3WG9A 1W2GA 3NYRA 4BO4A 5EQDA 1KXZA 1DRUA 1E64A 4PU0A 3WLLA 5DH9A 4YT4A 1NLMA 1PV1A 3MMZA 4NZ9A 1KMHA 4TRNA 1JQJC 4HMPA 4LTNA 4M1ZA 2ZUTA 5HF6A 3C48A 4IIVA 4CCAA 2VHZA 3NCTA 4B6FA 1YI0A 2BKLA 2XOKA 2Z2YA 3GLUA 2C7VA 5D3MB 3V1UA 1V37A 4KZKA 1EVYA 1WB4A 1P1RA 4EKYA 3AHEA 4RW0A 4ZOEA 1TUBA 3AUUA 3HDYA 2V59A 3UAGA 5K0BA 1ACJA 1N0HA 4MV1A 4EUFA 1C4XA 4IUCS 5ESDA 3VC3A 1KEZA 2JFNA 3ABQB 1E5LA 3KDSE 3PVZA 4DLUA 4H3KB 5CH8A 1OI3A 2ZIXB 1K8ZB 2IBSA 2ABWA 4U2DA 5EI5A 2AD5A 3Q12A 3RVSA 4AQDA 4AYWA 4BJ3A 3K4QA 2OBBA 2Z09A 1OHHA 3D3WA 4ND6A 3ZU2A 4BP9A 4V0KA 2GF2A 4B3RB 5ADHA 4TYQA 3NT5A 1YR2A 2YZ2A 5AJVB 1LK0A 1AKTA 3DFZA 2B61A 2BF7A 3KZXA 1CIJA 3FUCA 3FAKA 4FGWA 4N39A 4UHEA 2H1RA 2AOWA 3EVBA 1X1TA 1THMA 1LBQA 1Y1RA 4GO1A 1BQ3A 3U4QB 1LGYA 1BYUA 4M86A 2RKBA 3PI7A 4MW1A 5HS6A 3VU9B 2ZTVA 4W5QA 4L7QA 5DTEA 1L5YA 3U5ZB 1NMSA 2JASA 4C5CA 2VDKB 2JG3A 1LH0A 2HT6A 4IF6A 4DQXA 3QPCA 4V2UA 4B83A 3UJHA 5A0TA 1U8UA 1QGUA 4ARCA 5KIAA 1F20A 1FNNA 1ZN7A 2KPOA 2P0EA 3VM6A 4CM4A 3V4FA 4F7WA 5K6AA 2CLEB 4PYNA 4MAFA 3BWVA 3LXMA 3R8FA 2YWJA 4QTYA 1J8FA 2IKSA 4Y6RA 3LLUA 2I1WA 4QNRA 4EKIA 4HH4A 3LG2A 1QR6A 3IEMA 3LFTA 4PZEA 4R9SA 1CQWA 5L6MB 3H1PA 4O2BA 1OAAA 2YV1A 5CR9A 5IJZA 1YHNA 3QMMA 4E7PA 1SKAA 4ZEOA 2DXIA 3I01A 4QUAA 3L01A 4YRTA 5DX0A 3KKZA 2JK1A 4ILEA 1TECE 2OUKA 4WKPA 1X80A 4PGFA 4JUBA 1G2OA 1Y5NA 1JLHA 2GTPA 4O4HF 4G8CA 3LVQE 2J87A 3PPWA 5BSWA 5KU7A 4EFDA 4EFNA 3U44A 5IXSA 2E48A 1GA1A 4OMUA 4U2GA 1YK1A 2QYSA 5CIWA 2BN4A 4AO7A 4ZVNA 1N6IA 2FZEA 2ADOA 5HS4A 3V6MA 1MHTA 2JC3A 2O8CB 3W5AA 1DP4A 3HFGA 3DO5A 4KLZA 1KHTA 2NXNA 3O4HA 5K0GA 1YL6A 2JZCA 3AETB 3KPJA 4ZOLB 5AJYA 5HG0A 8ADHA 2QLLA 2J9FA 3DMHA 3G9ZA 4XKJA 2GZ3A 3R0IA 1TTPB 4CEHA 1C81A 2X8JA 3CMMA 1OW3B 2VQSA 3C3AA 3DMDA 4YEDA 5HQJA 4KBYA 4FE7A 3I3OA 3AIKA 2UKDA 4I5DA 4URUR 3DMFA 5EHQA 2IOQA 5FLEX 3W9BA 3ZNOA 4BB5A 5CG2A 5JZOA 2IEIA 3AVWA 3DOIA 2O1XA 1K75A 3DNFA 1IAVA 1V5GA 3MYRA 5DLQC 1RXVA 1NY6A 2I3BA 3C7AA 4W9RA 4TUYB 4M8KA 3W5HA 4X1IB 5L53A 4HWGA 4K3UA 3IUJA 1REQA 4BO8A 1DOHA 4EVQA 4B3JA 2IYAA 2NO4A 4H7HA 5M5BA 4BB9A 3TR0A 1A76A 1EFCA 3E2IA 1BEZA 3JARA 4Z2YA 3SP1A 3T1TA 4K9LA 1EQAA 2IUSA 2KLHA 2N1MA 4IJMA 1CD5A 3KVNA 1HDRA 4BQQA 1YF3A 4FWBA 3EAQA 2HXGA 1TTQB 4ZZ0A 2V7QA 4NU8X 4HOYA 4WASA 1SUAA 3IJPA 2D74A 2RJNA 1L5OA 2WTEA 1L4YA 4Q3EA 4DEXA 2RAVA 3LQ4A 1SG0A 1JKFA 4NATA 4KPUB 3NKLA 3ODPA 2VHVA 5H4HA 3VH1A 3DFKA 3NBMA 3I6MA 4TSFD 1T2FA 1WSDA 4ZQHA 3RH0A 4FD3A 1QAQA 4CM8B 4D98A 1HFKA 2Z2XA 3JS5A 3O2NA 2B83A 4N3NA 5C32A 4KBFA 3TZQA 1GUFA 2JEOA 2R65A 3WGTA 4OBBA 3RSLA 4BP8A 2MSLA 4NEHB 1CWUA 4WK2B 4X0EA 4UHCA 2R8OA 2BD0A 5KTMA 3NWOA 5LFAA 2XYGA 4DIKA 2EKQA 2W2TA 5DSTA 4X1OA 1M2KA 3ZGOA 3FOWA 1XD9A 2ET6A 3I0MA 2JIOA 3QWBA 4DCTA 1NWHA 3ROPA 5KJCA 3NM4A 4CUKA 4DR5B 2QB5A 4C4PA 5LQMA 4DB4A 1KDVA 3JZFA 3FCEA 2PZBA 3OCVA 2JBHA 4WQMA 5IAKA 5LZ8A 3S1AA 1KAGA 4ZT4A 4QM7A 4CKBA 4FKBA 1DRJA 3GJ8A 3EXEA 3QTBA 2WKRA 4MRRA 4RO0A 4LOLA 1KMQA 2C84A 3WGNA 1C80A 3O91A 3ZWXA 5JFTA 3T1HB 2JL1A 1HXHA 3V1MA 3DS8A 5LLDA 1I9CA 1VLMA 2A9VA 3EUFA 2RGAA 4R54A 5DBFA 4YXFA 5A4FS 3UHAA 1EDDA 3T9BA 3U3DA 1T9GR 3A31A 3ORYA 3A06A 5J4YA 4LEIA 2O20A 3JVDA 1OU0A 5D3ZA 1J2EA 2IXBA 4B76A 1O58A 2HRQA 3ULKA 3TCXB 4OY3A 3QVLA 4FJ1A 2PBLA 3HDQA 4Z1OA 4F4HA 2XIJA 5J4VA 5KNBD 1F2DA 2UV8A 1VLZA 5BR1A 4R71A 2ZBGA 3OUZA 1GFWA 3TQFA 3WHIA 3ZW7A 1VSQA 4YMIA 1NC1A 4EK9A 3V97A 3DV9A 3WE7A 1SQGA 1K4MA 1Y9EA 3QBDA 3L6BA 3W9UA 4RK7A 2C0QA 3W6OA 1T5TA 3SHVA 3WQSB 2Z1MA 1H85A 1OV4A 2PUWA 3LUAA 3PA6A 3NS7A 4D81A 4F5WA 1W34A 4ZPJA 3IJEB 5B3KA 5KDLA 4DTCA 2XE7A 3K9GA 3L0SA 2FFHA 3GP3A 2QG9A 3EZ2A 4P38A 2VT7A 5EQTA 4PN3A 5JQGB 5HUJA 4D0LB 4ZVMA 1IZ9A 4HDSB 4Z3OA 2Q29A 4K26A 1VPTA 3I2YX 2YXEA 2ZPAA 2Q41A 3EEBA 4FEAA 4KR0A 1E60A 4KP7A 2QSJA 1KK0A 1L7XA 1QKIA 2QMYA 4HQOA 2GCNA 5GONA 4BFYA 2I67A 5FBWB 3ICEA 2ZSAA 4MQEB 1L4UA 2AC2A 3R23A 2Z4SA 1G16A 2X13A 5COBA 3HBLA 2ZJ7A 4DLPA 3WLMA 1AE1A 1F8XA 3RI3A 2IP4A 5BNWA 3PGA1 1TIBA 1ONOA 5BSEA 1OH6A 4DLYA 5JNWA 2H52A 1LS6A 1XP8A 1SD1A 5KBYA 1T6BY 5SICE 2RGWA 3AWDA 1TYDE 3KEQA 1DOZA 5K7SA 1M2FA 3N07A 1F17A 4PYIA 4D9MA 4YV2A 3JSAA 3EMBA 4FZVA 3W5CA 4TWAA 3JWEA 1FU7A 4RZSA 1L1EA 3TUJC 2VYVD 5BMVF 3TDMA 1S1MA 3G02A 5B12A 3LLCA 4CL3A 3AX6A 3T0FA 1WXXA 3FMGA 3WIEA 2AK2A 1NX6A 1PYGA 2J5BA 2PXAA 5CPFA 4YVFA 5KYGA 3FOBA 5KOHB 3KLMX 3EUAA 2IGTA 5M29A 4N0MA 4UOZA 1E89A 1OWLA 3O2JA 1BDJA 4M8LA 4PCVA 1NASA 5DW3A 4ZT5A 1ID8A 5KVAA 2FF7A 4WINA 4XYEA 3T7SA 2EV9A 4CM6A 1L4EA 2WTMA 1MB0A 1SBYA 1F2UB 2HQ1A 3IV9A 2B2CA 4K6CA 2QLJA 5DHRA 3RROA 3PLRA 2IXDA 2W2VA 1TADA 1XMIA 4IDHA 3PSHA 4WBNB 3B82A 3S99A 3TLJA 1Q7EA 2Z1DA 3C6MA 4ONEA 2Y1CA 1L4KA 1PGQA 2A3NA 3KEGA 5JDIA 1Z13A 1XKXA 2A67A 2J5XA 5DBEX 3O75A 3LF2A 3RLFA 4TLLB 1CHDA 1KVRA 1TM7E 3E9YA 2A7QA 2WW8A 3HI6A 2HCTA 3W5JA 3P97A 4ABYA 3M6VA 2RGYA 5ALLA 4BIMA 2OD9A 3BJRA 5DLYA 3QYPA 3UTCA 3E1GA 3HADA 3OIWA 3EW7A 4LVCA 4QE3A 1NXQA 2HDNB 2VF8A 3NAQA 2MT9A 2PD6A 3DVAA 3EQ8A 3O8LA 5AVSA 5EEHA 1T29A 4AF6A 1UK9A 4FZ5A 4ZVTA 5B1SA 4NFSA 1O0SA 5C8XA 1N2OA 1JTVA 3KRTA 2BSAA 4H1UA 2FVXA 1UBLS 4JOCA 2HM7A 4CF5A 2KW5A 3N8GA 4M9RA 4RPHA 5HF5A 5JOQA 2YWXA 2GJ9A 2WD9A 3UXYA 1Z6ZA 2DULA 5E0KB 4NYIR 4QYIB 3DV2A 4DJJA 2IYFA 2FF5A 4LRYA 3VOSA 4H35A 1J1IA 4BO5A 4LBYA 2W0MA 3U4MA 5KWIA 5JJIA 5EUCA 1IY2A 2FDRA 4GC5A 5F98A 2PNJA 1P9RA 4CRWB 1C0LA 4MI9A 3ESYA 1BXRB 1XZAA 4HMOA 2OFXA 2PJUA 4OATA 1LPOA 4RE5A 4G37A 5ALSA 3RUHA 3IO3A 3TF5A 2LE0A 2FWRA 2YJNA 3BTVA 2OGUA 4BWFB 4CDRA 1HE3A 4MB0A 1DO0A 4NV3A 3FPEA 4HLUA 4OQXA 1Z08A 2FPWA 4D43A 3T3OA 5J23A 1U9CA 4U2EA 4I2VA 1Y1PA 4BMPB 1L8LA 1NVDA 1HBJA 1TAUA 5G02A 4DSAA 1KEUA 5BN4A 4PICA 1JFSA 1SUFA 2BTQA 3WP0A 1PO7A 3DDZX 5B58T 3AM1A 1BC5A 4M49A 1THTA 3HKCB 4R1UA 1FX1A 5ECYA 3TQOA 1NDHA 4HYEA 1U81A 2FLKA 3PT5A 4LZAA 4UHJA 3IHLA 2ZI4A 3IIIA 4ENRA 4OB6A 3AIMA 4C3ZA 2VXOA 3H11A 4MITA 3MXTA 3GFOA 3I62A 1H8HA 5CDHA 4WOJA 1AUPA 7REQB 3DAFA 4DCVA 1W76A 1N0IA 1OV6A 3MINB 1QYIA 4M9SA 5CA1A 5JI2E 1Y98A 4RD4A 1A72A 3VHQA 1OXVA 3UK6A 4X64B 4KWCA 3GJ5A 3HZZA 1TD1A 5IT9A 4UVDA 1EVLA 1E5XA 3NHMA 4FX5A 4HN4B 3OY2A 2VUHB 4NFLA 2QE7A 1T1EA 2FN8A 1W581 2EZ8A 1VTKA 4CM1A 4F4DA 3F97A 1B3RA 4A0HA 1QOZA 4JI2B 3FPBA 2QAGC 1M33A 2G0NA 1V11A 2VPPA 3CTMA 5GGXA 1NT2A 1Z88A 2DBQA 3EG9B 3O84A 3RARA 1OF1A 1JBEA 3ZQ6A 1ZMTA 3FZGA 3NBAA 2P7IA 4EI8A 1I2MA 4EA6A 5MHTA 3L0PA 4BVKA 1XZ8A 4QPPA 1H2YA 1NLUA 4PG6A 5MDHA 2V7BA 5K3AA 3VDXA 2D0OB 1GGKA 4LHSA 1O97C 1P2UA 1CNMA 2ADFA 4W5RA 3NHFA 2ZTSA 1F48A 1RRPA 4D46A 1N57A 4P32A 5CXUA 3I9MA 4WK4B 1ND5A 3CJQA 3V9AA 5KVCA 1M5TA 3NBFA 3PEWA 3H65A 2XXAB 1K6IA 3EISA 5ILQA 3ZE1B 4PO3X 5HK8A 1CUZA 4ARBA 5TQ2A 3BXPA 4KRFA 1GU7A 3H1BA 5D7BA 3WDSA 5I8PA 3LH5A 2IYRA 3VKVA 1XCBA 3QI7A 2FMTA 4NENA 2Q4OA 3ZHOA 2ODTX 4Z4FA 2FSFA 4UJ5A 2CNBA 3TG2A 1FNMA 2I2AA 1OXKB 3PNYA 4PF1A 2H1FA 4I50F 3UF0A 3VTAA 3B3FA 3SYTA 5CTAA 4ICIA 5CAEA 3QEBZ 5I01A 421PA 4Z7JA 2JAPA 3F71A 4V0QA 1EUDB 1OFUX 4MUXA 2QUZA 3ZU6A 4YMVA 2J0SA 1GWNA 1P7CA 3LWBA 4ZAWA 2D00A 4HH3C 3QIVA 1KI7A 1CQJB 3Q7PA 4DIEA 3L93A 1TA9A 1HV8A 2QP9X 2GXAA 4ALIA 5EP4A 3AHJA 1UP6A 4PRLA 4JJZA 3WLRA 4UE3S 4U1RA 3EPKA 3MTBA 1ZUD1 3RFCA 1MXHA 5JASA 4CI9A 1KS2A 4HXEB 5F73A 1H93A 2W90A 1YMVA 2X2EA 2QL5A 3AVVA 4MKXA 5ABPA 3OQMA 2PZJA 2OUIA 4JU8A 4G4SO 1S4MA 2BKUA 1T3LA 3CF4A 3LP5A 2CDAA 4MMZB 2CXSA 621PA 5L9AA 3FPCA 5LPNA 1DRWA 4BLQA 4EGQA 3DB1A 2FKNA 3H6KA 3HG7A 4C3UA 4KO3S 2HY7A 2PSDA 3L8MA 3PFCA 4CT5A 1UJMA 2WPDD 3BSSA 3EGXB 4NJEA 2J4DA 1UDRA 1BXGB 5FUXA 3STTA 5REQA 3AEQB 3GW8A 3GLRA 3GCGA 3D6UA 3BRCA 2WAMA 3LPNA 4DIMA 4IMRA 5I8WA 2PBZA 4RD3A 3LCRA 4GPEA 2ORWA 3NBYC 2C9MA 5KYYB 1XQVA 2GS9A 3B51X 3FYHA 4E46A 1V47A 3L8FA 2VP9A 3LI2A 3RYCA 5U4QA 1Y7IA 4B6JA 1XXHE 1VYHA 3ABOB 2UVQA 1QG0A 2D1TA 4JY7A 1P7PA 5JI3E 3VC2A 1WD7A 1TIPA 3S1LA 1C4KA 4P93A 4DMLA 3W78A 5JEDA 2BE7A 2YTZA 1Z25A 1YIAA 2Z8ZA 2Q7XA 1EDZA 1XJCA 4ER3A 1XKQA 4E30A 3CM0A 3QBVA 3R76A 2FP3A 4GOMD 3SC6A 1T5BA 5LB2A 4NCHA 3U3MA 3RFVA 3VNRA 1IBRA 2R1TB 2V6MA 3L41A 3QBTA 3CE6A 2J46A 3ROQA 2F3SA 4BWVA 3ZE0B 3KZKA 1WHTA 3Q8KA 5I7HA 2AI3A 3N8NA 4YJKA 1SUIA 4DCGA 3WJ1A 2WIFA 5B6IA 2DUJA 5D7NA 2V9CA 1H9CA 3OLCX 4LJYA 4DCPA 1Q6YA 1ZJYA 1JDSA 1T5OA 2IGBA 2OCYC 1QHHA 3GGPA 1X77A 2IX9A 2JGRA 3U17A 1G8GA 2AQ8A 4DC9A 1J70A 1KRXA 1IN6A 4XB6B 3Q9UA 1CEEA 5C8ZA 2H4FA 3DQQA 3SWWA 4MUEA 1VA4A 3C7KA 2HHAA 3VNVA 2FSSA 1PIWA 2DTXA 3ZK7A 5B4UA 1YCDA 2GFQA 3NVAA 5K5EA 4JOQA 1KSGA 1YOVB 1MO6A 3NM6B 4Q3OA 4AAYA 2IBMA 1F60A 1A7KA 4M0EA 2AZTA 2VR1A 4HB0A 4TLAA 1I0ZA 2LCIA 2P2YA 4Q34A 5HBRA 5TMDA 1N2GA 4BMZA 5J63A 2Z2JA 2Q6VA 3PEEA 2EFYA 1NMQA 2ZAMA 3HYSA 4HX9A 3NKFA 3UENA 5FH9A 4DA0A 5SY9A 1TLLA 2X86A 4GC9A 2YIMA 1HYQA 1KY5A 3GVHA 2CL6X 3K6RA 1E8NA 1FC0A 3MYYA 3KYCA 4UREA 5IH3A 1ECLA 1JI0A 2WG2A 4JJ7A 1ESZA 3C6QA 3PR3A 4QTUB 1O54A 2C98A 4OQPA 4DJEC 4ZO6A 4MH0R 4O8CA 3A1WA 4P81A 3TIIA 3DBRA 4YS6A 1PSDA 3KE9A 3LBHA 4GAEA 5I48A 3D8BA 2WUFA 4IRMA 2YWGA 4A0RA 4QUHA 1M1YB 5F78A 2PR2A 1H5NA 5AVZA 4CM9D 4TV8F 4JXJA 1L5RA 3NT2A 1UFOA 4GWLA 1GTRA 4R5HA 1Q7BA 1ZNXA 2AN9A 2QSZA 2V6IA 3DCJA 3MWDA 4NYMR 2F3RA 3HLTA 4IDFA 4ZT2A 5B1IA 2E2WA 3C4JA 4X60A 4TM7A 4P4UA 1HNZB 2R4QA 1CEYA 2VTBB 5LDGA 5K0LA 2I4TA 5GJWC 3RUFA 3F3MA 3KX2A 5E4JA 2O4UX 3Q11A 2XB2A 1QG4A 4IRUB 2YICA 4JBIA 1PK7A 5EXPA 4LJ7A 4DFDA 5JD6A 4Q9AA 4IMIB 4LF4B 1QU2A 5SZJA 3IPCA 4WZ6A 4HWSA 2RGXA 4MRMB 2JARA 3ZDEA 1XUOA 1N4DA 5KNCH 5F9MA 4HDCA 2G5GX 2NXCA 3FA2A 3JQPA 4OL9A 4UEWA 2DRIA 4AX4A 1BGWA 1HDOA 1IVYA 4KO8A 2XT6A 1TYAE 5LP1A 1B73A 3GI1A 2YBDA 3MLBA 2CLKB 2PGNA 3MBIA 1SB8A 2HWYA 5B3LA 1L7MA 4ZC8A 4UAJA 1O87A 1U28A 2HX1A 1BTOA 1MIOA 5CLIA 3WO0A 3CZQA 5IEJA 3T1YB 4M4SA 2EX0A 1VLLA 4LZLA 4XQ9A 1R8QA 3SSNA 4B87A 5EQJB 1PZXA 4ARZB 5J4LA 5IYZA 3N5CA 3BS4A 1AM4D 4FLEA 4WY2A 4GMKA 4C6RA 1VC2A 2FN3A 4F5YA 3KT6A 5EY5B 4G1MB 1WSWA 4TL8A 3BFXA 3GLKA 2Q7OE 2ZBRA 1K6EA 3QE2A 4J3JA 5HM6A 1TJ3A 3HXTA 1M10A 2O2ZA 2V98A 1M1UA 2BFFA 3PDJA 3HP1A 3LFHA 4WECA 3BXOA 1DZ3A 3H1EA 3R0JA 2GYVA 1KMIY 4R2HA 4UBNA 1HURA 5I4BA 2NV0A 3IQEA 1JLLB 2ID9A 2ZRCA 1F51E 1K89A 4AG3A 4AJHA 2H4WA 4KXNA 4HX5A 1RE1A 2A5LA 3GCZA 1S02A 1Q7TA 1FJHA 2EYQA 1MV5A 4UQPA 3WLJA 4P2GA 1QHGA 2A1TR 1YU9A 2DVMA 2QP3A 1OBVA 2Z56A 1GTZA 2XTZA 4OQMA 3U3JA 3ZWPA 2IXGA 4B6SA 1RRKA 2ZDQA 4WL0A 4BGUA 4AJ1A 5L3RA 1Q83A 4EG7A 5CA0B 3A4IA 4O4IB 1GDDA 1HDZA 2PH3A 2ZBUA 4N0DA 4YQEA 2YIDA 3MFYA 2H1LA 4FEGA 4IGIA 4JLSA 3ZQJA 3A6KA 4AC9A 2XUZA 5I7VA 4IG4A 3EFOA 4OI1A 2J3QA 4CV2A 4XUDA 3RASA 1FDUA 4FMDB 2GZDA 3CEAA 4RKFA 1EDOA 3PDCA 4ECAA 5CLHA 3PE4A 1XK6A 3EF3A 4BBPA 1AS3A 1G8KA 2WIKA 4L73A 4GPZA 1I7QB 3ER8A 4I3HA 5C8YB 1UAYA 3LQQA 3O8OB 1CB7A 2H5EA 4H6VA 1TQ4A 2ANCA 2HSWA 2ZQ5A 4A3SA 3H9BA 4M76B 2PGLA 1R9GA 1RYNA 2WOJA 4JA2A 3OESA 4KN8A 3KKOA 5JZSA 1RYEA 1T0BA 1UXHA 1GZSA 3IAHA 4RMGA 1YFZA 3A1TA 1JU4A 5D3MA 3KTDA 1L3CA 1SVNA 3FI9A 3KD2A 4OQQA 4P3NA 5GGYA 1WHSB 2HZ7A 3IT3A 2QY9A 5LD2B 4OFWA 4I9UA 3TI7A 5E7JA 4BFUA 3PTAA 2ZXFA 5IVIA 3DYVA 3N2EA 1WKVA 5HCIA 4E2FA 1CUIA 1PZNA 3L5OA 3NETA 2JFUA 5E3HA 1CJCA 4EEKA 2ZIXA 5CFZA 5LWQA 1SA0A 3PYXA 1MR3F 3G89A 1XWWA 3O4RA 1L5ZA 4IBOA 4CMEA 4XRGA 1YVDA 1JA1A 3GJQA 4LWOA 3ZY4A 1I32A 3LHDA 2EIHA 3B13B 4KQMA 1NSYA 2P1ZA 3S3TA 1MQAA 2OV8A 4BLOA 1DWUA 2GASA 2R6GA 1YS1X 4UE6A 1IZ0A 2XY4A 5LB4A 3G6KA 4AJLA 2P6NA 3DMGA 2QPLA 1GT91 3PQ4A 4ADSG 2B9EA 3UK7A 1RHUA 2C8VA 1CQXA 1KJQA 1RLIA 4XTRA 1Z6GA 1ZGHA 2JJ2A 3BXHA 3IJRA 3OI7A 3PHGA 1M76A 4J03A 1ADGA 5B53A 3EVZA 1WCXA 3LWNA 4RMJA 3V4PB 4LDAA 3VU9A 1Y82A 2ZWPA 5ARBA 3IIMA 1E99A 1WPXA 1P18A 4BVFA 4BPBA 2BMDA 2NV2B 1ZVJA 2IYEA 2OHFA 4NK5A 3W6UA 2I66A 1TPYA 3NRJA 4U39A 1G64A 1L7AA 2AA3A 3MWEB 1D0IA 3NHUA 5H9WA 3QU7A 3L1HA 4AWBA 3OQPA 2HF8A 1EEXB 3OZGA 3T41A 3FDJA 3ZI0A 3HB9A 3V1LA 4E5SA 3K1ZA 1EX6A 4ZYVA 2DCUA 1K5GA 3MGBA 4GEKA 3ZY3A 3LM8A 1QRSA 2BZ1A 2G9QA 3HU5A 1P8AA 2G17A 3A1EA 1KE2A 4B80A 1I4WA 1VL0A 2J0UB 4M60A 1G2PA 1J8QA 2AG6A 5A71A 3QMWA 2LKDA 5EWMB 1Q0HA 4BO2A 2Q5EA 4W63A 4QEDA 3ILXA 4FCWA 1KIMA 821PA 1YJXA 3C15C 5KDOA 1PEDA 2VP6A 3GVXA 3DOOA 4OXRA 4DR4B 2XJ9A 3AWIA 3WGKA 2PGJA 4ZIRB 3D5QA 3P9PA 1R6DA 4RIGA 2GAIA 1KOFA 3TTWA 1T2VA 3AI2A 4N18A 2WTBA 4NONA 1SCUB 2IP2A 2CMFA 3DR3A 9LDTA 5G4LA 5GQSA 2O8CA 5TQ0B 4FT2A 3EPRA 1UK6A 2BDTA 4U7GA 4C2AA 3ORRA 1EX7A 1ZEMA 3AETA 3NONA 4ZOLA 4XEUA 1HO3A 1XPOA 1ZWKA 4G89A 1CUCA 1SVUA 4EB0A 1M7BA 1QSGA 2W8BB 4RVFA 5KPDA 4DV4B 2GPBA 3LHKA 1E9FA 3FGOA 3OWXA 2JD0A 2PZEA 3B3QA 3GT7A 3WRYA 3HJRA 1CRZA 1VOTA 2OBMA 4HEQA 3TQQA 2FRDC 3DEIA 3TLMA 4KXWA 1UJ2A 3CTPA 3TW8B 4E5UA 5CFLA 3EPHA 4TUYA 3LGXA 3LWZA 2ZI6A 4P7KA 4X1IA 2Y99A 3DAPA 4LY3A 4FVTA 4FCVA 4KMOA 1C1XB 2IQ5A 2OLKA 1RI2A 2OM2A 1ZRHA 1E9DA 2N46A 1Z0DA 3LUCA 5FL3A 3H4MA 1FMCA 2C58A 4KSCA 3PNPA 4ARAA 4E5DA 5IC4A 4EGAA 2E0IA 4NOJA 1NT4A 5BYAA 3KSDO 4HFNA 1Q1EA 3WIBA 4CLHA 2H7XA 1TF2A 1U3WA 3N1UA 4W5HA 1M8PA 4BKRA 1X7ZB 2FPIB 3EC1A 3FVQA 3L7BA 4DVJA 5IG2A 5CX1B 3UO8B 4BO1A 4DMCA 2O7QA 4KPUA 3UUEA 2YV2A 3WGLA 4AJ2A 1L4MA 4TRRA 2RHRA 3WLQA 4HS4A 5BSVA 3R44A 3WK8A 1PR0A 2VJBA 4WCDA 3OO0A 4CM8A 4QPJC 3Q3CA 3SJUA 3IFSA 4AVYA 4UE2A 1M75A 3R0ZA 1NUQA 2K7ZA 3ABRB 1ND6A 3VXKA 4XJVA 2Q28A 2Y3IA 2FW0A 2D1FA 4BAUA 1JSLA 3TJRA 2ZJ0A 5IM5A 3D0QA 5BW4A 3ADCA 4JP8A 4O4JF 3WMFA 3DDHA 1ZZGA 3AR2A 4EDHA 1T9HA 3DW1X 1B2LA 1KAEA 2BV3A 2FX3A 2G7ZA 3G23A 2Q5FA 2ZUWA 3ELDA 3KJXA 3LYLA 3OQ1A 3HXQA 1P9LA 3W9SA 1MJFA 2H06A 3V4LA 3U31A 5FUVA 1W19A 4OHYA 2QD2A 1ZJ5A 3EF0A 2GSWA 1A8IA 4TQUS 4HZIA 4J0JA 4BNMA 1E2EA 3CUVA 2R5NA 1SKUA 3F5FA 3G68A 3G2OA 4QOHA 3EIHA 3HUDA 1H0HA 3HY3A 1L8AA 1ZL2A 3Q9SA 2ZSUA 4FS3A 1PJ2A 1AKWA 1IOWA 2F3PA 1V4VA 4MO9A 2QL6A 3FZNA 4HAUA 3RVQA 4UPEA 1MAUA 2CUTA 2A14A 3DYBA 3UOWA 3V8RA 5HWSA 1QVVA 4MHOA 4QOGA 3TSAA 2G1PA 4LOKA 8ABPA 3WSVA 4UDOA 1VRVA 3A4TA 3I92A 1EVIA 3BIFA 4UAVA 1XAJA 2R1VB 2PMEA 3TRKA 2OZEA 3W8DA 1ADBA 1XVTA 3PQ2A 5AXAA 4C05A 5EXSA 1R16A 3AO0B 1VPVA 2OCDA 4CDNA 3KOYA 1O94D 1PQYA 1ZC4A 5ALKA 3WYGA 5KNCD 1HNWB 2OBFA 3NWJA 4EJ0A 1Z4PX 4KKXB 1FVFA 4QLOA 3FGPA 1QZ3A 1Z12A 2HRZA 2O8NA 4BX2A 1VBMA 1G5PA 1OTYA 3BB1A 1AQYA 4Q47A 3EVCA 1R0WA 1S7CA 1NBMA 3DGEC 4HDSA 3NWPA 4NZNA 1W36C 5CVTA 3DULA 3VJLA 4EMTA 4B3MB 4N49A 4CIXA 3A3NA 4CMJA 1ULZA 2GZ2A 1RAAA 3FCOA 3ACDA 2HREA 4RPJA 2JGNA 4AJKA 2WP8J 4F93B 4MGHA 4N3CA 1FTWA 1B1CA 4XARA 2M2IA 5ENZA 4MQEA 2QWXA 3SG0A 2LP4Y 3ILVA 5BT8A 4LJ9A 4TTJA 1KQPA 1L7VC 4D9EA 5C35A 4YY3B 1RC8A 1W59A 5KVQA 4DRXB 1XBTA 4WKBA 1ZIXA 4R9NA 1Y5IA 4EMBA 4LKOA 1QQTA 3RTEA 3LUJA 4ZCRA 3E8XA 2CY0A 3WA7A 4X65B 1UZMA 2GVDC 5LMZA 1IMJA 5LXTF 4E70A 1U90A 2Y0EA 4H18A 1EIWA 2VLBA 4LKRA 3DZIA 3C6BA 2A1UB 2PMBA 1GL6A 5T5QA 3FXAA 3C14C 4GU5A 2YOFA 3N8KA 4CQLB 3EXFB 4EY3A 1C4WA 5DJ5A 3KLPX 1P4JA 1WP4A 5TX7A 2Q1YA 2R6AA 2XLBA 3BK7A 3F49S 1M6YA 2AMYA 1O9HA 1LK5A 2VOEA 3F9CA 4IQ8A 2EKBA 5FAXA 3ZNNA 5KOHA 1LTQA 2OAGA 4ZVQA 5HM8A 2XCSB 1RWBA 1SIWA 2XYVA 1QTNA 2OFWA 4D4GA 4TYNA 2GOYA 3LYHA 4DXDA 4HVLA 3PEYA 2P5YA 4G1FA 4WOCA 3SMVA 3TZKA 3NYWA 2X5OA 4Z0HO 1F2UA 3GQBB 4D26A 2B5OA 2MSWA 1FPQA 1Z83A 3E9DA 3ZC3A 4BVGA 4WBNA 3FOFC 4NXMB 4KIGA 3B5JA 3M33A 4YTEA 3BRWD 1VPWA 3N28A 4C04A 3C3YA 1H2RS 2SBTA 5GP1A 4UU7A 5K0CA 2YJZA 1NWCA 4KLCA 2MSCB 3IDSA 2JFYA 3UK0A 1JSRA 1YJBA 2BAGA 2HEIA 4LG1A 4PC6A 4XR4A 1NJSA 3I45A 5F2EA 4J2TA 2HKIA 3ZIAD 4EI2A 3SC4A 3U7EB 5CGZA 5DOZA 3EWAA 2CLDX 3PJGA 2V65A 4IM7A 4UTOA 1V25A 1XKLA 3STVA 4AP9A 3GGOA 4RFSB 3E3AA 1USVA 3VKHA 2VRNA 3FVWA 3VAYA 4XX0B 3QW2A 2ZIFA 1RWQA 3OKAA 4W6QA 1EP3B 2IHNA 1E4EB 1W5EA 1DBWA 3TKAA 1BJTA 3VDNB 4IPTA 4LMAA 4HR7A 3ZUGA 4OHBA 1LNZA 1UDXA 2M6SA 1YBHA 1MA3A 4G5HA 4QGBA 4CIAA 3E82A 2A78A 1CUJA 4UQLA 4PRKA 3CCFA 1NHWA 1AQLA 2PGIA 3K0CC 4QYIA 3BJZA 2C31A 4G3XA 1T2NA 3RADC 1V48A 1U0OC 3G8CA 4BC0A 4LNAA 3V8VA 1BXRA 1CDOA 2VJDA 3RHZA 2L69A 2Q4TA 2QTRA 2YMLA 1ZHFA 1XLVA 1ZNWA 2C4WA 3AF2A 4MWCA 5JCOC 4CZ2A 3NOVA 2Z2KA 3QHQA 3DBOB 4O59O 5J2TF 4ALKA 3S8EA 2WYHA 3HN7A 3BE6A 1XZBA 1JSXA 3M1YA 1NLZA 4OI0A 4TTIA 4WK6A 1GGHA 2QD5A 5FYQA 2J48A 4EG1A 5HCNA 3G9UA 3HC7A 4WLFA 4BMCA 3IAEA 2C97A 4EYGA 4ZT6A 3HCWA 5AVVA 1WB9A 4YPOA 1QHXA 3IR6A 1NVWQ 3J7TA 2I8CA 2HA5A 3HKCA 1MJNA 2C88A 2BEVB 3NJ4A 4LRTB 3VO2A 1QH9A 2QN1A 4YMUA 2UUBB 2R6ZA 3LU1A 1KWGA 1DKLA 2W22A 4HWKA 3RK0A 4BEBA 1HFJA 3K15A 4QKQA 5AR1A 7REQA 1G5IA 3KQLA 2DR2A 5E3IA 3KUDA 4B82A 2F1OA 2ZUCA 1F0NA 2ON6A 3MINA 4H4CA 2GTIA 2QRQA 3M6LA 3ZEIA 5EAIA 2WBLC 3WKDA 2K7FA 1UEIA 1XNRB 1DJPA 4IP0A 5ETJA 3GJ6A 1N3IA 5EJEA 1K9VF 1W8IA 4MZDA 3M81A 5I7AA 2FQQA 2CJFA 3CX6A 3DHEA 2IBTA 4BZQA 1PZFA 4HB4A 5L4SA 4P53A 1NLFA 3OMWA 5IS2A 2ZT8A 1YH3A 1P0CA 2PBFA 3OQVA 1KC3A 1ZVKA 2G63A 4LSGA 4ROTA 4C5AA 3KUXA 4IIDA 3OZCA 2YMPA 4KKVA 4Q3NA 5FTNA 2AC7A 1DIHA 3N7TA 3TTSA 1TM1E 1X13A 2BMVA 4CNBA 5HFJA 4MI1A 3I04M 1OGIA 2WJVA 3EASA 1NKSA 4OAOA 4D41A 5IHPA 2Q5LA 1FLNA 1Q7CA 4J1SA 4OHWA 1ZUNB 2I6QA 4KQGA 5CVVA 3TAUA 4AN0A 1NMXA 4RVNA 3EG9A 4XD7A 3ESQA 3HHEA 2ZM6B 3SQXA 1SH7A 5E38A 3O3OB 1HSZA 3T5PA 1RQGA 4JKYA 1YD7A 3BAFA 4E13A 3SIPA 4EELA 2ZRIA 4TS4A 4CWAA 5A4MS 3E15A 2QVBA 2V7VA 2GFHA 5H82A 3WLNA 3Q9LA 3KAPA 4O3FA 1Y4SA 2D4AA 4EAAA 1G9XA 1XPUA 5TPZD 1Z7YA 4IY1A 3PI6A 1X38A 3TVTA 2XXAA 2VP5A 4NEGA 1RMTA 3QY0A 2GCOB 3OOEA 5F2NA 3TLYA 3OAAA 2COKA 2WJGA 4DOMA 3CIOA 2GNOA 2QPAA 2QTNA 1P0MA 1Z5GA 5LA6B 1JJFA 3AR9A 3ETJA 1WCIB 4TMXA 1E3WB 1Y4AE 5IP5A 1VZ2A 5EESA 2C9YA 1N2IA 3BWXA 3D7LA 3FWYA 3PHCA 2Q8NA 2XWJI 1ZI8A 4HXFB 5IVPA 5FB3A 2V7UA 3LCJA 2WF5A 2I80A 2VRCD 4KFSA 1PNTA 5A7FA 1ZR2A 3L7LA 2JJYA 1P1IA 1SQFA 1T9AA 2X14A 1EUDA 3C3WA 4LVUA 1GQ2A 3IO5A 2H9AA 4X90A 4QDZA 1KDYA 4LF5B 3TBKA 1HX7A 1CQJA 1ZJ6A 1TUGA 2C5HA 4LGVA 1TUEA 2EDCA 4KLAA 1HQYE 1ZUWA 4Y1FA 5IBPA 1HA3A 1JZQA 3K0AB 3AF1A 2XDAA 3M4YA 5C3MA 1F8FA 1IEWA 2D1SA 5K2OA 5CLGA 4PW0A 3AF6A 4QRIA 1ZWLA 2WJZB 3KQMA 1N6OA 2IW3A 1HLPA 1P0FA 4JB3A 4LJ6A 4QOSA 2HWWA 1HRDA 3BULA 4MULA 3SHWA 1CJKC 4TVBA 2FFBA 3AHGA 3G2KA 4AMVA 4B9EA 1ORWA 2BJWA 5C7IO 1Z07A 1KU6A 2OZLB 3MCTA 3CEMA 1AQIA 5IJWA 3AEKB 2IYQA 4Z0TA 3RYIB 2PE5A 4OHPA 1ZIYA 3FDXA 3Q7EA 4LJ4A 4PG7A 5BOVA 4QECA 4YDQA 4BOYA 3ET5A 3E9QA 5G1OA 4MIOA 3VU8A 2D5LA 3EDMA 4HNSA 5BRAA 3EGXA 5EZYF 1BXGA 3OQNA 4MYTA 1YA8A 3CFYA 1QPZA 2FK8A 3AEQA 1PD1A 3QKSB 2I0FA 5LR6A 3IEVA 1OVGA 3KJQA 3H75A 4DMGA 2RIRA 2W2OA 2ZUBA 2JGIA 4M0UA 5ALGA 2Z98A 4N01A 4D79A 3NEPX 1OXBB 2F62A 2BMFA 5KYYA 3KPYA 2LW7A 3EWNA 5KCMA 1VJRA 4RA6B 4RKQA 3DTTA 4Q1DA 3HI4A 1FDVA 3O9ZA 2WWFA 5CDUA 5K8UA 2ZDGA 1M73E 5DYTA 1V5WA 3WB1A 3LKVA 5ELMA 1KFKB 3A3KA 4C4RA 4PLVA 1LRKA 4DWVA 4MW6A 3QUQA 1NW6A 2J85A 2X5KO 3CR7A 1I30A 1QOQB 4RF5A 2CFIA 1QP4A 2JIDA 1DKOA 1NXPA 2BFPA 4JN6B 4XRRA 4L3OA 5INTA 3NOOA 1N78A 1GTMA 2IUYA 1J8MF 1TJ5A 2YL2A 3WNZA 1QS0B 3BH0A 2FKAA 5KTPA 1QVWA 4CMAA 3FRIA 2R1TA 4UARA 2AHOA 2HJGA 2Q1SA 1FCJA 4GPIB 3OPYI 4UULA 4A2CA 1QB8A 4RU1A 3SKVA 1KMMA 3V80A 4MYDA 1WSBA 2GRUA 3CWCA 4GXRA 3ACBA 3RS9A 2ZJ5A 1JKIA 2C3UA 4TYWA 3L82B 4Z86A 1NU6A 4M7RA 2G28A 2IEDA 1XELA 3BDVA 4ZQBA 1OTXA 1INLA 3M8KA 2X22A 4ETWA 4JB0A 4PFSA 5B36A 1CDZA 5H70A 1GNSA 2A5DA 4YRIA 1B41A 4QXRA 1E2QA 3ZD6A 4Z99A 1GRNA 1O6CA 1LC0A 3VQTA 1FMJA 1JQ5A 1XPJA 1TM4E 2A84A 1A5SB 1E77A 1N1MA 2JHPA 3CB4A 3D81A 3EZ6A 3IAAA 1KKUA 4QNNA 1JIVA 3BHNA 3VC7A 4GPD1 3VO1A 4EOGA 5E1OA 1BOFA 2XB6A 1K8XB 1YOVA 3G1TA 3EVEA 4QFDA 8GPBA 1NR1A 4FFSA 5HDQA 5KVVA 2RE8A 1FOEB 1JU9A 1HUQA 1H23A 4DC1A 4AG6A 1UCFA 2AG8A 1EFTA 2VWHA 2R6HA 4GQAA 1PTJC 2HQSA 2CMKA 2JH8A 4Z9BA 2B82A 5ICSA 4MGYR 2HHHB 1Z5OA 2WQZA 1A7AA 5K3OA 4M1YA 1UJ5A 5K8JB 3H1TA 4OQDA 2P2LA 3T7TA 4C0KA 2GWRA 3BMOB 4DXAA 4PGGA 3S7TA 4B1FA 1MT3A 2AD1A 4PHFA 4AUMA 2VZ8A 3EGOA 2PSSA 1M1YA 1SEPA 3LA6A 4C7XA 1G7TA 4MP8A 1ODJA 3BWYA 4KG7A 5D87A 4G0WA 2VG8A 1COWA 4OBXA 4R1TA 1G8JA 4DM7A 1QDEA 4UZSA 4RAQA 2VWPA 2ONYA 1MA0A 5LBTA 2VTBA 3LBIA 2PS0A 3DE5X 4EJSC 1QIEA 3GWGA 1LZKA 3BXFA 2NO9A 4RL4A 2CMDA 5L4NA 1G8HA 4PC3A 2PBRA 5J5CA 1F4VA 1HGXA 2CXRA 1SQSA 3WGYA 4DMKA 3RSZA 5COQA 4UU1A 2JCGA 2XVAA 3O0DA 4H0NA 4TX1A 3UPDA 3V34A 3SJ7A 4AG5A 4QLAA 3MF4A 4MRMA 4A1OA 1NBHA 2B35A 1V43A 3K4PA 5JALA 1PQUA 1YA4A 1AQ6A 4ZOAA 4PLWA 2GEBA 2OCKA 1IOVA 4CFZA 1U5BA 3E0XA 4Z4CA 3AILA 1AHNA 3FGZA 2I2WA 4JI1B 2JIZA 2VSXA 4EB3A 2ZJZA 4LJSA 1PEAA 1D7AA 4G5FA 3C74A 2XAUA 2UZ3A 3WGZA 1W0CA 2I2CA 4G9BA 2BP7B 4XUEA 2WNHA 1GNQA 4ISCA 221PA 2XADA 1ULSA 1DE0A 3LVBA 3IQZA 3NC0C 4TXJA 4ARZA 3ZDYB 1QYWA 1EQ2A 4HPWA 2RJOA 1ZMBA 3ZWMA 1JR4A 1WQ4A 1ECCA 5A2GA 4B43A 2W6NA 4MVJF 4ZQIA 2QVCA 5HZMA 2RAPA 1YHYA 4RA9B 4ARSA 1JIUA 2HO4A 4BL5A 3KUUA 4TWJA 4CW7A 4F3RA 1NJ5A 1XL0A 2CLLB 2R1ZA 3R0VA 1R5BA 4WW0A 2KSQA 3IEXA 2IS6A 2QRNA 3H3FA 1K4KA 3KBBA 1QYVA 1LI4A 5F77A 2WMYA 3SFVA 1DAOA 3Q6NA 3IALA 4HLDA 1JLLA 4FK8A 1LY1A 2ZREA 2GXQA 1Y3BE 4GRIA 4F6LA 3VTFA 4X54A 3SHFA 4EEXA 4EG0A 4Q4JB 4ZVPA 3RUIA 2BTOA 5J43A 5LLSA 1I2ZA 2PFSA 5K8IA 2XE4A 2XVZA 4XB2A 1JR2A 3E81A 3H2YA 2P4SA 4DQDA 3GDOA 4CKCB 1W52X 4YR9A 1PLKA 3FCCA 1ZAYA 1TMYA 2I99A 2PR7A 3KQVA 3TO5A 2HWXA 2X3UA 3W3AA 4O4IA 2IDZA 3A6LA 2Z95A 4HGNA 3PNVA 2WAYA 1P2GA 3ANYB 2GK3A 4UHKA 1U3TA 2UDPA 3U7QB 1A9PA 1KVUA 3KHSA 4OFZA 4YRSA 2I03A 4JYZA 3BQ9A 4ZTUB 3PDWA 3FLEA 4YRNA 3UUWA 3EWIA 4E5KA 1M2WA 3GRYA 3FIJA 4LS3A 1PWHA 4FDLA 5C8YA 4HUTA 3T3HA 4X6YA 1R8XA 2GCPA 3CU5A 3EH2A 3O8OA 2QTZA 5IUKC 4CQMD 1KAOA 4WDQA 1NN0A 4QOEA 4YH1A 4P0PB 1P91A 5AI9A 4ZO8A 3BORA 3TL2A 1UOOA 5ARCA 4B2IA 1X86B 4NBNA 3RS5A 5H4GA 4LPKA 1Z16A 5ECDA 1VPEA 3E3LA 3KTFA 4O2AF 1W4AA 3ENVA 2JGMA 3TGWA 2FSVA 2QF7A 3QVGB 3E5RA 2ZXUA 1CT9A 1WHSA 4H3SA 4HB3A 3LXRA 1QGOA 3NFRA 1QMPA 2FQWA 3R3XA 4QFCA 3NIWA 4DLBA 4EA7A 1CJUC 2QJOA 2JLYA 1OXUA 4CFYA 2PWAA 2D8MA 4KXQA 5FQOA 3O26A 1SELA 1SOVA 1XALA 1YFKA 3MM4A 3B12A 4JVLA 4N7MA 5KYKA 4D4IA 1I7PA 5JNTA 3DE7X 3EGCA 4TVOA 2WWHA 4K81B 4BV3A 3NMUF 3OEWA 2YASA 3JQRA 3AY7A 2UXCB 2IL1A 5I9MA 4F04A 1P1BA 3AHIA 3IAS6 2QUAA 2X7HA 4BTEA 1A95A 2FY8A 1ISGA 2C42A 5JZBA 4B40A 2JLZA 3ADPA 1LS1A 1TVEA 2YZGA 3OE7A 4KN9S 2E6KA 3LC7O 3DHWC 3V2IA 1UBTS 2PD4A 1V8PA 2GJ4A 1VSTA 2XB9A 3LXUX 4X6LA 4L74A 3U4QA 1RKXA 3WISA 2ZTHA 3TZCA 4L02A 2BFWA 3DMRA 1WUIS 4XD2A 3IEKA 2Q1WA 3GWZA 2BBOA 4X6UA 2P62A 5DYYA 5AI4A 2C9ZA 4RYLA 3TIFA 4J0FA 3EFEA 1SKMA 3KE8A 4CE6A 1AF7A 3MWEA 4P58A 1JIJA 2EEZA 3DZKA 4CDMA 4D8UA 5GINE 1F12A 2B36A 3HP4A 3L0OA 2IH5A 2HLDD 3ZDXB 4QUIA 4ZO7A 2VK2A 3KG2A 4FIDA 4GVXA 4QDJA 1Y6FA 3QKTA 4IO0A 4LSWA 1QRUA 2GI4A 4D6PA 2J0UA 4FSHA 1UJCA 4E51A 4JC8A 2JLVA 4QYTA 5EWMA 1V8ZA 3CH7A 3VI4B 3L4KA 4DR7B 4G67A 3THOA 1MH1A 1U8YA 1O5IA 3CPEA 1GNTA 3FHLA 3LX6A 4LRUA 2VEOA 3JVEA 4MICA 3I5XA 1J9GA 1EHYA 4ZARA 2P3SA 4PLTA 1T1JA 2V6GA 1EXVA 4ZIRA 3GUVA 1UOPA 5C46F 1JYEA 3QVWA 3FVRA 1ULTA 1CS4C 1P2TA 1QTRA 4M1KA 3QEAZ 4MVJG 4NOMA 4KVGA 1CJMA 1SCUA 1E0AA 4DR1B 2JLBA 1A2KC 2IEYA 5TQ0A 2PM8A 4C78A 4DA6A 5IUJC 5ISMA 5EJ9A 3UNXA 2EX1A 3C6YA 4LZZA 3OX3A 1Z0SA 1V45E 3HKDB 5JMWA 4E1VA 3UAVA 5IXJA 3I2HA 2W8BA 2XMDA 4F4IA 3OCZA 1AGPA 2YN2A 4TN1A 5TF4A 2IWRA 2EZTA 3DE4X 3T7RA 4GL2A 5BQOA 3BFKA 4N5IX 3DM9B 3HKEB 4GM1A 4QULA 1G19A 1KH2A 4ZVOA 3ZGXA 4F2PA 1X7XB 5F1KA 1H6BA 4JLOA 3GB9A 2VUSA 3NEAA 4UBIA 4XSHA 3GGGA 3TW8A 1W94A 3SSOA 3FGNA 2IWHA 1I1NA 1J09A 1P0QA 3FSGA 4F4UA 1CE8B 2ID7A 2E37A 3L02A 4XOUA 3T1OA 4PHCA 2BJVA 1AKYA 1C1XA 5DCWA 5DWVA 1TYEB 3II6X 4TKLA 2OQVA 4KVAA 1RCFA 3AESB 4C87A 2X41A 3W90A 2PN1A 3TLEA 1RAEA 2QORA 1CJTC 1M0SA 2A9OA 1LZLA 2ZCUA 4FMCF 4JZKA 3WICA 2AQHA 1GXSA 1Z6PA 2ISCA 1X70A 2IEAA 4BMYA 1Z06A 4Z4GA 2PYZA 2R7KA 1X7ZA 2FPIA 1NW9B 2YS7A 3R7SA 5CX1A 2P9ZA 1VHDA 1J00A 2QZ4A 4PNEA 3C5CA 1FS4A 3DKKA 2FYTA 3WFIA 3EOBI 2QYOA 1LSJA 4HH0A 3AUAA 1QQBA 2C5SA 2ZBVA 2FQ1A 3LIIA 4H7JA 4QRHA 5LQSA 1O8CA 4FGSA 4H6XA 1ONBA 4PG5A 1JF8A 5IDXA 4BEJA 3D0OA 1TQDA 4MEBA 4FQ8A 2YFHA 1C1HA 2FP4B 1QIMA 5TMBA 5FD8A 4IDBA 5BN3B 1CUWA 5KB3A 3PFFA 4L07A 2K5UA 1B0AA 3SZMA 5JU6A 1TFUA 1BMDA 1GNPA 1VCNA 1EFRD 5E6UB 1K0FA 3PCXA 1T24A 3UQYS 1RPJA 5EINA 3KEFA 2HA2A 5U4XA 5CLFA 3C3CA 3IDOA 4TXLA 3GJ7A 3DL0A 1Z8FA 5FL7D 1K92A 1P1CA 3RUPA 2EW8A 2VQEB 2AF3C 4EH1A 3KBOA 4NCNA 1UT5A 3CF2A 4A10A 5GV7A 4YV0A 4I55B 1FA9A 5IKXA 1CQIB 3AVQA 4YJ3B 1KI6B 2VF5X 3ONVA 4AU1A 1J06A 1GCOA 2WZBA 4RLFA 3GEDA 4ZQFA 3ZCTA 4IKOA 2I54A 2X8BA 4YT8A 3ESBA 5K6RA 3JQ8B 2ZB8A 3B85A 2GARA 1B8VA 3EVDA 3O3CA 4UD2A 1SHTX 3CSDA 3C1TA 2X23A 2XXJA 3NYQA 3B1YA 2W2XA 2VYNA 3LL7A 1KDOA 3MG9A 5CD9A 2BGGA 1ZGBA 3P2JA 1ISPA 5A7GA 1H2AS 4LHWA 1K6JA 2X3FA 3O9VA 4M36A 4BKUA 4KXVA 2TRSB 4TPKA 1U7ZA 2EG9A 2WAXA 1P7YA 3G85A 3JYOA 4H6PA 3ZZUA 3GUZA 3MELA 4HLCA 1XB2A 2CF5A 2GMWA 1P9OA 1Y7HA 1LDEA 2ZT6A 4RQUA 3QUCA 1KVTA 5JO9A 2DYKA 4Y2HA 4P4TA 1E5TA 3RC8A 1KDPA 5GAJA 4WFIA 1XD8A 5HFNA 1PNRA 4BBAA 3LGAA 2IYNA 2EC5A 1YB4A 3NAZA 2HV9A 5FOSA 2O8DB 2GJSA 5DBGA 3D3JA 4HNGA 4L28A 3WQBA 4CEJB 4DARA 4HGPA 1Z73A 1WM1A 3TTYA 3IP6A 2R2AA 1YL7A 2FMHA 4W8HA 2C2XA 2FMFA 2Z4TA 2PKXA 3L8DA 3WSWA 4UXIA 3ZV6A 1PD0A 3GA7A 4PCAA 2GF9A 1B43A 1HT2E 2QJRA 4GXTA 5FT9A 1C9EA 2GK7A 1PR9A 1TK9A 1B8NA 1YRLA 3Q7RA 4G0QA 4G1BA 4MW2A 4NZMA 4PAWA 1II0A 2GPJA 4RCYA 1JL3A 1N8KA 1UPBA 2C96A 2IELA 2R2GA 1CULC 1KEKA 5D6OA 4DRXA 1F3LA 2VXCA 2YQ5A 4BY9E 2B8WA 2DU8A 1T5IA 3BXGA 1EDBA 2LRHA 3HJGA 2IUUA 4BQPA 1O95D 2V54A 4MVXA 4YYEA 1JAZA 1O77A 1N2EA 2FAXA 2XF2A 2A1UA 3F7TA 3BIWA 3KFVA 1H4SA 3Q41A 4XQCA 5H3HA 2I6FA 5E9JA 3DBVO 3WX0A 16PKA 4CQLA 3EXFA 7GPBA 3BH7A 5TRTA 4XFKA 2PUDA 4EYQA 2P4QA 2EF0A 2X5XA 3COVA 1PW5A 3IS3A 3K1TA 4CODB 5AVQA 1R0XA 2IHZA 1OI7A 4O4LB 1MTOA 4GD3Q 5A6SB 4CKWB 5E0OA 5KWJA 5LWHA 1IXZA 3RVBA 1QONA 2NVBA 4J1QA 3IKLA 4PRZA 3SF0A 2C7BA 1EVQA 1Z7WA 3T7IA 2WFLB 6ADHA 4G5GA 5KS2A 1EGHA 3BE4A 2OG2A 4IJVA 4CKZA 1AMNA 2PXXA 4RPLA 4KR3A 2O2YA 2OHGA 5LIRA 3F90A 2FR8C 3GJZA 4IGFA 4IIXA 1EBBA 4V1CI 3FCUB 2CLCX 2VL7A 3GN1A 2IS2A 1PX0A 3OSZA 2VPWA 3D6NB 4G8JA 2R86A 3PENA 2BI4A 2QVYX 1IXKA 5AUQA 3N2IA 3PNSA 2FR0A 4B7CA 1XL1A 2H2WA 4Q16A 1QHNA 2GVZC 1W36B 3HVRA 1ZK1A 5THQA 3A2MA 4YX9A 1KERA 4J2OA 2KMLA 4WXYB 4E03A 4LXGA 4RFSA 3F96A 1LF5A 1M1XB 1FFEA 1C1YA 4XX0A 4YJFB 2AF4C 2JH3A 2H0QA 1S2NA 4G23A 3MZ0A 4OQ4A 3T8YA 1E4EA 3WWYA 3K94A 4GBED 4KAFA 1WETA 1CEXA 5C18A 2O5VA 5BN5B 3I72A 2D8AA 1WMDA 5CCDA 1ZUHA 1Z8DA 4Q24A 1XV5A 2WDZA 3IP9A 3DEHA 4RXUA 2I22A 4U2FA 4EX7A 3GRUA 3JYQA 4P3OA 3G2QA 3GNTA 3IH5A 3I6ZA 4BDSA 2IHKA 1XMPA 4QGGA 1XZHA 3H17A 1Q16A 3ETEA 2TMYA 4G26A 4Z0NA 3LPDA 3BC1A </