5K3EA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/glycolate - cocrystallized
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
297
structure length
295
Chain Sequence
b'LADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHNRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSTPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluoroacetate dehalogenase
publication title The role of dimer asymmetry and protomer dynamics in enzyme catalysis.
pubmed doi rcsb
source organism Rhodopseudomonas palustris (strain atcc baa-98 / cga009)
molecule tags Hydrolase
total genus 115
structure length 295
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k3eA00
5ALXA 3ZPXA 3O95A 1QIEA 4J0IA 5AM1A 4L72A 3G9TA 4WFIA 1ZD2P 3PFCA 4PW0A 5JASA 3E4DA 3AUKA 1E8MA 5AIBA 3WMRA 5AKGA 5JD5A 1UKCA 2WFLA 1UOPA 3STVA 2CUTA 2ROQA 3R40A 1D07A 3G7NA 3G9UA 5JD6A 2XUIA 5F4ZA 5LZ8A 2XE4A 4QLAA 4BAUA 4OD0A 3Q8WA 4FTWA 3ZLUA 1R1DA 3H2GA 1TIBA 4BBZA 1CUSA 2YASA 1LZLA 3RLIA 5E4YA 2WFMA 4X6XA 5EHNA 2H7CA 2GYWA 3DYIA 5DYYA 3E0XA 2CJPA 1XZKA 2XUAA 3G9XA 4DSAA 3UMJA 1AURA 2C5GA 2XUJA 4J0DA 1BCSA 1O6GA 4EY8A 3GROA 1BEZA 2XMBA 1H2XA 2PPLA 1G4HA 2H7XA 1CUJA 4KE7A 1THGA 4EZIA 4LIPD 1QJ4A 5IKXA 4X85A 3WWPA 3V1NA 4B0OA 2Y6UA 3TRDA 5CTAA 3C5VA 1RYYA 4A16A 1AGYA 2C0QA 3DL7A 4DMKA 2NW6A 3O9MA 3ZI7A 3SX4A 4DTCA 1CUWA 4INZA 1LZKA 2C5FA 2WUDA 2JF0A 1GKKA 2FUKA 2ONCA 1VLQA 5LIPA 3BF7A 4KR0A 4KE8A 2PM8A 1LPOA 1THTA 2WLSA 4C4XA 2OCGA 5HFAA 1R4ZA 4UHDA 1ZD5A 5EGNA 3V1KA 3R3UA 5K3FB 3ED1A 2ZJFA 3BWXA 2ZYHA 1E66A 2V96A 3HACA 3DCNA 3D3NA 2ZJ6A 2GYVA 2PX6A 3OOSA 2JGFA 1R88A 2XUGA 3WK7A 4C87A 4OU4A 1EDBA 3QPAA 1H2YA 5AI9A 3WJ1A 1BN7A 3PI6A 4BVJA 4UBNA 2AJCA 5CXUA 2JGMA 1CUYA 2RHTA 3DEAA 2X8BA 3HJUA 1TCCA 1PV1A 1XRMA 2E3JA 2QMQA 1LPAB 4V2IA 5AKHA 2C58A 1CUDA 4AZ0A 4Q05A 1BE0A 1H2ZA 3I2JA 1CUHA 5A62A 5FLKA 2FJPA 1Q83A 1J06A 4ZV7A 1CQZA 1DQZA 4NS4A 2WQZA 4BZZA 4KAAA 1XLUA 2QXTA 4PV7A 5D6OA 2QTBA 4G8DA 4K6GA 2RIPA 3RK4A 1YS1X 1ZGBA 1OCEA 5LLSA 2YH2A 3R3YA 1UT6A 5KREA 2WTMA 4JEIA 2O2GA 4XIIA 4Q82A 1T4MA 3N0TA 3D7RA 4A5SA 5FRDA 3FNBA 1HQDA 3LCRA 4Q3KA 5AKEA 4X7BA 1XQVA 3WLAA 4I19A 1O6FA 1LPNA 1HLGA 4W1QA 1J2EA 3NUZA 4AN1A 1SOMA 2K2QB 2Y6VA 1ZIXA 4OB7A 4MWTA 1VJ5A 2D0DA 3I6MA 2B20A 2BGRA 1CV2A 5AOAA 3FLEA 4OB8A 4W1RA 2OCIA 5IVHA 3ESBA 2B61A 4PSDA 2AXEA 3FYUA 1J07A 1JU4A 3ZV7A 3LIPA 1XLVA 1YCDA 2HA6A 1CLEA 1E8DA 3UUFA 4KE6A 5AICA 2XUKA 5E4TA 1EVEA 4QEKA 2PVSA 3ESAA 4QA9A 2BGNA 2PSFA 2OQIA 3C8DA 3PE6A 1I6WA 3C6BA 5ALZA 1SFRA 4WDQA 3O0DA 3O9VA 2R11A 1GZ7A 4DSZA 3CCCA 1QIIA 2LIPA 1YA4A 2HL6A 2Z8ZA 3QH4A 5BV7A 3F96A 5ALQA 1MO2A 5AHXA 3I1IA 4G8CA 5EI5A 2CKMA 4C88A 4LXHA 3I1YA 2XT0A 4P92A 5AK3A 3STTA 3G9ZA 1FFBA 2CMFA 1EINA 1ODTC 2OGZA 5ALOA 2RGUA 3N2ZB 3SK0A 2VT6A 1YB7A 4BRZA 3I2FA 4MQLA 1UOQA 5KWIA 3RARA 3BDVA 2WIDA 1XZGA 1MX5A 4WY8A 4DGQA 1FFEA 6YASA 4FHZA 5AKXA 3V48A 4TVKA 4ARBA 3WWDA 4B85A 1P0PA 4N5HX 1CUFA 4BE9A 1AUOA 5D7BA 1EI9A 3FYUB 1JT2A 3QMMA 1EXWA 3HZOA 3WJ2A 4LKOA 1PJAA 3PUHA 3VVLA 1IUPA 1NU6A 4B7ZA 4QE3A 2V97A 5FDFA 1YASA 4X91A 1DWOA 4YPVA 1QIDA 3F8SA 1W75A 3B3QA 3A6ZA 2OGSA 5AK4A 1MPXA 4AXBA 1X70A 1MNAA 5DNUA 3AFIA 5AH0A 2WSLA 3H2IA 3WIBA 2OLEA 1FFCA 2ZJ7A 4Y9SA 5SYMA 1GPNA 3WI7A 5ALRA 3FYUC 4ZGBA 3GBSA 5A7HA 2XB6A 1TCAA 3C6XA 3YASA 1B6GA 2XLCA 3IUNA 4E11A 4CG3A 4P9NA 2WM2A 3FLBA 1PFQA 1K4YA 2BFNA 5FOQA 2BUBA 2G4LA 4BCDA 3HYSA 1XRPA 2WIFA 3OTQA 1HPLA 4H7FA 5AP9A 2GBFA 1EVQA 3EQ8A 1TK3A 5ALGA 4FBMA 3KSRA 5CH8A 5AKYA 3M3DA 2O2HA 4BAGA 2WU3A 1IZ7A 4G4GA 3FWHA 5HF8A 3IA2A 3LP5A 1LBSA 4Y2UA 1WM1A 1F8UA 2OCKA 3U1TA 5FKJA 2X5XA 1LPSA 2ZVDA 5HF9A 5JALA 5AJHA 1WB4A 4YASA 2QOEA 2YXPX 3E3AA 3G0BA 4JUIA 2FX5A 4X3CA 3VISA 1XZAA 4JYPA 3WWCA 2IX9A 4FWBA 3LIIA 2VJBA 4DMCA 3HC7A 3FSGA 1C7IA 4JYMA 4PQEA 5BOVA 4EBBA 3QM1A 1ETHA 1A7UA 5JZ9A 2V9ZA 4UFNA 3WZMA 2WIJA 4RPCA 4AX4A 3WKEA 2JBWA 1VE7A 2V98A 5H3HA 4DMHA 5ALVA 2QKYA 4UBOA 2WFZA 3KWJA 3VXKA 4Y7DA 2Q0XA 4UBIA 3KOOA 4CG2A 5AKZA 5JYCA 4X92A 1DWQA 2CBGA 5HCUA 4XVCA 1FSSA 3WK9A 2JEZA 5DYTA 3ZWQA 3WA7A 1MN6A 3IVMA 5E4JA 2VAXA 4HXFB 3IBTA 4J0KA 2HRRA 2JGLA 1XFDA 2PL5A 4BRSA 2Y1KA 3HABA 1H2WA 1E89A 1MX9A 1ZIYA 4IO0A 3G0CA 2IITA 3C8HA 3WK4A 3W9UA 2QR5A 4HTAA 2XQKA 4BATA 1YAHA 3V1LA 2PUHA 3VJMA 5BWBA 1CUXA 4KEAA 3QZUA 4KAJA 2UZ0A 3K6KA 1CR6A 4H7JA 3C45A 1ISPA 4E15A 3WQHA 5K3FA 5AKJA 2JGJA 2DQYA 2HA2A 1DTEA 4WDRA 1NU8A 4HRYA 5IH7A 3WK8A 3VDXA 2Z8XA 5JATA 1ZD4A 1TCBA 1LNSA 3O4IA 4X71A 3RKSA 4DNQA 3D5EA 1K8QA 2G5TA 1WB5A 5AM4A 4GECA 4H18A 3W04A 1KEZA 3H2HA 1XZFA 1MAAA 4N5IX 1C4XA 3D2BA 2GZSA 2DR0A 1T2NA 1EH5A 4BTVA 5K3CA 3I2IA 4LXGA 3EQ7A 2PSEA 5ALLA 4OPMA 3PFBA 1DU4A 2ZSIA 3D2CA 4X90A 3G02A 4UFOA 2XUPA 4KRYA 4BVKA 4WY5A 2PSDA 2DHCA 4CI9A 3GUUA 5T4FA 4F60A 4CCWA 3S8YA 1UKBA 2PKYX 1Y37A 2J3DA 1R9MA 2Z3ZA 2RONA 4QDZA 2G63A 4EHBA 2ZSHA 2BCEA 4H7IA 1EX9A 2R8BA 3MUOA 4J0HA 4L3WA 1QIMA 1W76A 4Y2RA 5AK6A 1BROA 4MQMA 2I03A 1W52X 2QZPA 4AB1A 4B0PA 1QLWA 5ALSA 4Y2QA 3EF3A 1WPXA 4HXGA 1GQRA 1UK6A 1VE6A 2C7BA 4AN0A 3BIWA 5AM5A 1LBTA 4Y2YA 5EHQA 3BIXA 2AJ8A 1E8NA 1QO9A 2QUBA 3WWOA 1XQXA 3STXA 5HQ3B 2DHEA 2DQZA 1FJ2A 3G0DA 4FFWA 4RNCA 4RE6A 3JWEA 4G4JA 4OSEA 4U2GA 3PDCA 2H9YA 2O2IA 3H18A 1W6RA 4NZZA 4B80A 4MEAA 3A2MA 3H1AA 4RGYA 2J4CA 1UXOA 3STYA 1MTZA 5C8ZA 1A88A 1ZJ4A 1USWA 4JH0A 3FSGD 4HS9A 4AQDA 2EDAA 4QDUA 1CIJA 1F6WA 2I3DA 2QS9A 3HRHA 4ZI5A 4PO3X 2VAVA 3A70A 2JIDA 3H2KA 1ZD3A 2DHDA 2VF2A 4GHWA 5C8XA 1CUUA 3EIOA 5DWDA 1UKAA 4IQ4A 3K2IA 3TGLA 4K5QA 4Q1VA 4GI1A 5K5EA 5C81A 5JAHA 4B83A 4PNZA 2XLBA 3H0CA 2H7YA 3BDIA 1MAHA 3PF8A 2WIKA 2WJ3A 1A8UA 1N1MA 3KWFA 3L1HA 5IVIA 1HDEA 5K3EA 3AZOA 2AJDA 2JGEA 3R41A 1XZMA 3L1JA 3DDUA 4E46A 3NWOA 4FLMA 4UHEA 2I3ZA 2GBGA 4GEGA 3WL5A 3O4HA 4PSUA 5KBYA 1R50A 3QPCA 1AKNA 2Y2UA 3FAKA 1VXRA 5ALFA 4OU5A 3JW8A 4J0JA 3QITA 2QUAA 3BF8A 5FP0A 4G5XA 1GXSA 1GT6A 2HADA 1U8EA 5A2GA 4QDOA 3QYJA 4GXNA 3C6YA 4H0CA 2XUOA 1N5MA 4CCYB 4UFPA 1BU8A 4U2EA 3TJMA 4AMZA 3FBWA 4BCCA 2RAUA 1M33A 3H19A 1UK9A 5ISMA 5LZ9A 1K63A 3X3HA 1YB6A 1XRRA 1CUVA 1UK8A 4NVRA 1AC5A 5CMLA 3D2AA 3B5EA 1H23A 1EHYA 3WL6A 4MYDA 1CUGA 3K9BA 3NGMA 1QTRA 2VJAA 4XWGA 4BP8A 2WG0A 4IH9A 3U0VA 4W63A 4LYEA 5I8PA 2W6CX 4Y2JA 1S8OA 3OURA 1FFAA 5ALUA 3WWEA 3IURA 3IDAA 3DD5A 4ZWNA 1CUIA 5C8VA 5FV4A 4B6GA 1Q0RA 4X6YA 2GYUA 2PU7A 3HEAA 4M0MA 5D3KA 4AO6A 4FBLA 1A8SA 2BKLA 5AOBA 4B81A 3G0GA 1LGYA 4K6HA 4ZV9A 5E2IA 2WG1A 3W06A 1ZI8A 2CB9A 4DNFA 4HAIA 1SCKA 5LYYA 4ARAA 3SWWA 4FNGA 3E1GA 3OPMA 4EY5A 1VOTA 3DKKA 5JAOA 1ZI9A 3C70A 1MT3A 1VA5A 4BE4A 3D59A 2FJ0A 3ZLVA 4W1SA 1WPRA 4FOLA 5HF6A 2VT7A 5DNVA 3R3XA 4BC1A 3WKAA 1ORWA 5HF5A 1JMKC 4C01A 2HU7A 3IB3A 2P8SA 4QDTA 4GW3A 1E3QA 2H1IA 1IUOA 3CCBA 5EHZA 1JKMA 2EDCA 4CIBA 3Q0TA 3G8YA 5ALTA 5DNWA 4BB0A 1BN6A 1DX4A 1IVYA 4JNCA 4DM7A 3C43A 5HKAA 2O7VA 3DQZA 4BDTA 2GZRA 1K5PA 2QVBA 3VJLA 4D9JA 4FMPA 1QIHA 1X2EA 2JGKA 4I4CA 4BCBA 3LS2A 4UHHA 2XQJA 4DMFA 1QIFA 3OM8A 2HHAA 5AKIA 5ALJA 4EY6A 2DFPA 4O08A 3ANSA 1U2EA 4M0EA 1VKHA 3LLCA 2HA0A 4A23A 3BJMA 3L1IA 2BJHA 4XJVA 3KXPA 4UUQA 1GPKA 2AJLI 2BUAA 3GA7A 5D3ZA 2PU5A 1CQWA 4L9AA 1YS2X 1XKTA 3BJRA 3DLTA 4F21A 2IIVA 4EY4A 2OXEA 1LPPA 1ZICA 3WA6A 2WJ4A 3AZQA 1L7QA 2ZYIA 1YA8A 3GFFA 1ZJ5A 4B82A 4MXDA 3VKFA 3FVRA 3WK5A 1F0PA 3BXPA 3ESDA 3KD2A 2ZYSA 2QM0A 3IIIA 3H1BA 4QNNA 1XZJA 4DYHA 5ALHA 5K3DA 3EQ9A 2XMQA 2C0PA 4AO7A 1XRNA 4FFVA 4ZXFA 3GELA 3H2JA 4L0CA 2WHPA 4IH1A 3IUMA 4H7DA 5ALWA 1QO7A 1YAJA 5LKAA 1DWPA 1GPLA 2ORYA 4MWSA 5I9IA 5A7FA 2ES4A 3H17A 5LZ7A 2XQFA 1XZIA 3ILSA 5CT6A 1QONA 1DT3A 5FPQA 4K6KA 3JYHA 1ODSA 1ACLA 3T4UA 4EY7A 1B41A 5CH3A 5AI8A 2GBIA 1UOOA 4OB6A 1YR2A 1IZ8A 3QPDA 1HKHA 1WHSA 2XDWA 4QLOA 1BRTA 3D4LA 2JGIA 3R3WA 5A71A 1RP1A 3WKBA 4GDMA 3AINA 1MNQA 1WB6A 1CEXA 4ZREA 5JADA 1IMJA 4PSCA 5AM3A 1DT5A 3F9CA 1ZI6A 2HM7A 5ALIA 5CRIA 3AJAA 2HFKA 5CBKA 3BE8A 4S0XA 3VJKA 3IUJA 2HRQA 1P0QA 5EIEA 1VZ3A 4F0JA 4J03A 3V9AA 2DSNA 1TRHA 4UBKA 5HQ3A 2EEPA 2B9VA 4B84A 4U2DA 4UPDA 2OAGA 1CPYA 1U65A 4NMWA 3I28A 4WCVA 5LZ2A 2HA3A 4F5ZA 2WHPB 2RI6A 1DQYA 2DCMA 2XMDA 4OCZA 1GKLA 4QWWA 1Y7HA 5CT8A 4G9GA 1WOMA 5T4HA 4DLNA 3C6ZA 2VA9A 4N8SA 1CVLA 1BEEA 3C5WP 3FLAA 2WHRA 4Y2TA 1AQLA 5FXMA 5ALNA 1QFSA 3I2KA 2QXUA 1K6EA 3W05A 4K2AA 3DOHA 4W9RA 1JFRA 4P08A 2PSJA 4MYSA 2HA5A 4HXEB 4J7AA 1JU3A 3DJYA 1WCYA 2PBLA 4J3JA 1J1IA 2XQIA 1H22A 4YX9A 5AI5A 1Z68A 3EBLA 3KDAA 5HKBA 4UBJA 1U4NA 4G8BA 2XMSA 3FCXA 4AZ3A 5CURA 4QWMA 4B9AA 4X97A 1C7JA 3F67A 4U2BA 2Z3WA 4WJLA 5JZSA 1AX9A 4C89A 3NOXA 5SYNA 5AO9A 3SC2A 5AM2A 4BDSA 2WFLB 2X76A 5AIAA 2XMGA 3DL4A 4H77A 1G5FA 4KRXA 5YASA 3WIOA 1LLFA 2WUEA 1EK2A 4H7HA 1WHTA 4UBMA 3WYNA 4Q34A 3MVEA 5HK9A 3GZJA 1UWCA 5HFNA 4UHCA 5EIAA 5AI4A 3R3VA 3RM3A 4FKBA 5CW2A 1YSCA 3A2LA 3IULA 3O4GA 5T4EA 1ORVA 1DINA 5ESRA 1TAHA 5KWJA 5IVDA 2ZYRA 4CCYA 2I78A 4AMYA 2BAGA 1ODCA 2XI4A 3AZPA 2D5LA 1IUNA 4KJXA 3ZLTA 4BC0A 3HLKA 1AZWA 2WUFA 4C4YA 3DNMA 4LHEA 4Y2VA 1P0IA 4CFSA 5DTJA 1W1IA 3M82A 3AIOA 1XZHA 5K3BA 1CUAA 2WG2A 2VJCA 1G42A 2XQGA 3ICWA 3MGAA 4GWLA 3M81A 1HBJA 5HZGA 2GBCA 2HA4A 5EIHA 1NX9A 4IHAA 3FVTA 1TKRA 1ZOIA 1W4LA 4W1PA 3STWA 4PF1A 1E5TA 3MUNA 4KE9A 4LXIA 4HVTA 1MX1A 5CH5A 1CUEA 1XZLA 1XKLA 4BP9A 2W22A 4DIUA 2PSHA 1KU0A 5HK8A 2WUGA 2WU4A 1Y7IA 1JI3A 1Q84A 4X00A 4Z49A 5AM0A 1FFDA 2J4FA 1XZBA 1ACJA 5DJ5A 2WILA 1UK7A 1OILA 1SCQA 4EA6A 3DKRA 4UHFA 5ALKA 2C4HA 4CIAA 2WJ6A 1JMYA 3IUQA 4E14A 3O4JA 3B12A 2OPHA 4ROTA 5J3JA 1VXOA 3I6ZA 5IVKA 1QIGA 4IH4A 4P93A 3FYTA 5DLPA 5AI6A 2VATA 1SC9A 4H7KA 1R9NA 4FNMA 1MJ5A 3HSSA 1A8QA 1XLWA 1QIKA 3VVMA 1MU0A 2XUFA 4YK7A 4TPKA 3D0KA 4I3FA 1EK1A 1Q0ZA 2HU5A 5CXXA 1F0NA 4X6UA 5AI0A 3UUEA 1UZAA 2CZQA 3HXKA 4Y2SA 3CXUA 1KU6A 3BL8A 3T52A 2WTNA 1EDDA 1XZDA 1QZ3A 3WL7A 5ALEA 2HIHA 3OC0A 4GBGA 4RE5A 5ALYA 4G4IA 3F98A 1R3DA 1EB9A 2OCLA 7YASA 5LP1A 3STUA 2HU8A 1G66A 2VSQA 3AIKA 2ECFA 5CT9A 1N5RA 5FUMA 4OYLA 1TQHA 2XMRA 4FLFA 2VTVA 3FOBA 3WKDA 2WHQA 1AMNA 4ZRDA 1XQWA 2OGTA 4QDXA 5T4BA 3OG9A 2OAEA 3WKCA 3CN9A 5ALDA 2XUQA 2XMCA 1EA5A 5DTIA 1DX6A 2CEKA 5JIBA 2ACEA 3PICA 4OYYA 5JANA 3QVMA 5DYWA 1BS9A 4TGLA 2HDWA 4H35A 3C87A 2JEYA 1GQSA 1N8SA 2B4KA 4M0FA 5ALPA 3TEJA 3PUIA 3WL8A 2Z5GA 4Y2XA 2AJBA 1L7RA 5CT5A 2QJWA 5I7UA 1ZGCA 3I2GA 1HL7A 1CFJA 1JJFA 1VZ2A 5BWCA 4GLBA 4J0CA 1XROA 3W9BA 1EB8A 1CUZA 4XX1A 4BAZA 2J3QA 1QE3A 5EHXA 4Y2PA 4LYDA 2O7RA 2VEOA 5A7GA 4N8DA 4BVLA 4EB0A 5A6VA 4MJ3A 1X2BA 4G9EA 3I6YA 3WK6A 1JJBA 4UHBA 1XZCA 2WKWA 4KYVA 3WYDA 5JAUA 3DS8A 4FDMA 2Y2VA 5K3AA 4DNOA 1EDEA 1GGVA 4HRXA 5EFZA 1QIJA 2QRUA 3ANTA 5AK5A 3FCYA 3P2MA 2HA7A 3V1MA 2HFJA 1XZEA 3A2NA 3H04A 3ICVA 4OUKX 3S2ZA 4C6HA 4EUSA 4ITVA 4X95A 5LKRA 4BZWA 2ACKA 1CUBA 5AOCA 1L7AA 2QT9A 4Q3LA 4AO8A 4CG1A 1LPBB 3G0IA 5LZ5A 3CN7A 4QZVA 5C7YA 5AKLA 1SCIA 3DOIA 4C4ZA 4WFKA 4U2FA 4G1FA 2OG1A 2QJRA 5JARA 2PUJA 1VA4A 1QFMA 1OXMA 2YYSA 2G5PA 1CRLA 2WIGA 3R0VA 4H7EA 3W2TA 5CT4A 3HI4A 2VJDA 4HZGA 3PF9A 4FLEA 2XUDA 1JJIA 2XMZA 1XRLA 5JD4A 1RWQA 2VQ6A 1UFOA 4J0GA 3QBJA 5LZ4A 1BCRA 3ESCA 1QTIA 1P0MA 3M83A 4KACA 1QOZA 4BYMA 2XUHA 1CUCA 5JAPA 3WZLA 3F97A 5AKKA 4WFJA 4U2CA 4Q3OA 4B9EA 4BTLA 3DYVA 4DNPA 4N8EA 1LPMA 4X93A 2RHWA 3AILA 4X94A 1XQYA 5FPPA 3AIMA 4UBLA 5ALMA 3QMVA 3QMWA 1XRQA 1QGED 4MEBA 4ETWA 2OQVA 2BUCA 3R3ZA 5JZBA 3I2HA 4KAFA
chains in the Genus database with same CATH superfamily
1ESZA 4ZVKA 1ABFA 4RY8A 5CDFA 1A4RA 1U3UA 3LC1O 1G59A 3VZPA 5JYEA 1QIEA 4CKEB 5KTNA 3KJXA 4N5NA 3K96A 1KVQA 2F59A 3OZIA 3QE4A 1ECFA 3HGMA 5AM1A 5T3UA 4RK6A 4M99A 1S9HA 1SY7A 4CF6A 3PSHA 3MQFA 3FPJA 1JDTA 1TQ8A 1LSSA 5DDIP 3JALB 2BH9A 3VPXA 4CI0B 4IIJB 4KPFC 1EUYA 3D3QA 4QHTA 1H2FA 1GTVA 2R1TA 3KTFA 4P33A 5KAPA 2QLFA 4QUEA 3ZV4A 3T1OA 3IXQA 1Z5WA 5ED0A 1RR6A 3AUKA 4OQ4A 2Y4NA 4BNDB 1E8MA 3RR2A 2XXBA 4AJJA 2ZIZA 3QIVA 3WMRA 5KVAA 3INTA 2VZEA 1QYIA 3S4YA 1Q1EA 4MKGA 4URUR 3VUFA 2E1PA 4PIMA 4OOEA 3DZGA 4MW2A 3PE4A 4KN9S 3R3JA 5J2TF 4MWDA 5F9HA 4MUIA 1KVRA 3R40A 1G2IA 3ZWYA 1D07A 3G9UA 3U3ZA 1NYTA 2AD1A 4X7MA 1H0HA 5G4KB 4KMOA 4N76A 4GUDA 5F4ZA 2UZ4A 3CZ5A 2XE4A 3M70A 1K88A 2G7MC 1BCRB 3DOJA 3GMIA 2YN4A 3G5UA 4RQTA 4E2ZA 2CLMB 4XA8A 1BOOA 4C7VA 1JP7A 1Y63A 5CX4A 5ICEA 1BDIA 5BQXA 1K92A 4E1AA 4ZCPA 3JZDA 4CJXA 4NAVA 4BAUA 3B1KA 4XIJA 1I1QB 4BIMA 5A02A 1DXHA 1VI6A 3DE7X 3GBVA 5CCDA 1U31A 4G1BA 1ADYA 1XG5A 4QJ5A 4FTWA 1E99A 3U7GA 3PEUA 1ATZA 5KVSA 4JI5B 3TTVA 1Y89A 2RKBA 1FFYA 3QF7A 4KYIB 4GLJA 1AHHA 1TT7A 2Q8PA 4F6RB 4IJVA 1SCJA 1WZ2A 3ZE7A 2YASA 1QCYA 1SN7A 1TKCA 5C2JB 4D9GA 4DLZA 3NJ8A 2YHBA 3UPDA 1K3UB 4XYLA 4EJ0A 1PJSA 2MSWA 1RRVA 1P73A 2Q6TA 4PO8A 3BQMB 1RRMA 3KQSA 4MRMB 5IULC 5DYYA 2OTCA 1S3GA 4OBWA 1NRXA 3IPYA 3THSA 3ZY2A 1KF0A 2AQIA 4IIUA 2XUAA 2JCSA 5KYWB 4PS0A 4B7CA 3G9XA 5B6IA 4DSAA 1JHQA 2G67A 4OEHA 1PL0A 5DPMA 1TPYA 1IJBA 1CNFA 2XUJA 2B30A 3AY7A 2ETVA 1IDN1 1JWBB 3W1VA 5B1EA 2NYRA 3WE7A 4IFTA 3T06B 3JR7A 1GZHB 2GVDC 2XWBF 3IGFA 3BEDA 3B6ZA 1ODFA 1RAAA 3GNTA 1O2DA 4QXMA 3QY9A 2GXSA 3AXTA 2HJ9A 2NZ2A 4H0FA 4KE7A 3OZRA 5TS2A 3K70D 4ZDKA 3V46A 2OO5C 1OPRA 3PX3A 3EXAA 1F2UA 1QJ4A 1YO6A 2Q1UA 4X85A 3IBSA 3TXAA 3GLFE 2WJZB 3JQ7A 1EX7A 2Y6UA 3TRDA 3WBFA 5B55A 1P5HA 5CTAA 4KPYA 5EG5A 3DG9A 1RYYA 1H1LA 2KW5A 5IBQA 3D6HA 4HQ0A 4NBNA 1N9KA 4LBYA 2P5SA 4R68A 1UBMS 2JLVA 2I8AA 3O75A 4WNAB 2VK8A 3S8MA 1DEOA 1US8B 3PXDA 1URPA 3D1VA 2VZ0A 1O94D 2ADFA 4JCCA 5GINE 3THYB 1CJCA 2VC2B 5E7IA 4TT3D 2A5DA 4ZI2A 1PSWA 3HTXA 4EEZA 2JJ1D 2ZIVB 3PENA 2RGBA 1KZGB 1BOFA 4DTCA 1CUWA 1XVUA 2O52A 4I5IA 4F2WA 1FFWA 1GUBA 4RANA 3OJOA 2WUDA 5HX7A 5L3VA 3QQPA 2JF0A 5DYGA 4ALNA 2FUKA 4B2LA 3VC7A 4ZI7B 1BFUA 3BH0A 3V33A 5KEIA 3SJZA 3V1UA 2NUBA 3B82A 2GVNA 5GY7A 2I3AA 3EGDA 1ST3A 1ZUWA 1X1QA 4RF5A 5E3HA 2XRFA 4CT0A 1PL6A 4WLVA 1VP9A 4LRSB 5CFPA 2QZ9A 3ZEIA 2WLSA 1THTA 1KFBB 3FTFA 2OCGA 1KEPA 1RPNA 4E7OA 3B9QA 3A10A 3QELA 1HX7A 3B60A 1ZM7A 2ZRFA 5DCWA 3BHNA 1I4WA 5EGNA 2NT4A 1Z33A 1JE1A 1FBTA 1J9ZA 4PGGA 4LYHA 2L17A 5CLIA 1F7VA 4FJ0A 3RU9A 4G1CA 4C7BA 16PKA 2I7XA 1NX6A 1JHZA 3GF4A 4LDJA 3OE1A 4HNGA 5EUCA 2L42A 4HUQA 2XZOA 1RHRA 2C2XA 4NP6A 4QOFA 4E5NA 1EM8B 2PX6A 1ZVQA 3QRWA 3OOSA 3AFGA 2JGFA 3W6ZA 3ZNQA 2I7TA 4C87A 2A1TS 3Q8KA 2IYVA 3JY6A 3QWHA 1H2YA 2HIAA 2JPDA 3MT7A 4IJKA 1OROA 1AZSC 3D2LA 5AI9A 3RG8A 4F9GA 4L16A 4UHJA 4ZJUA 4I0WB 1JLRA 2W2NA 1DB3A 4MYHA 5BMOA 3CKLA 4S2UA 5JRJA 4LDQA 4AN4A 1J99A 2EU8A 1DC5A 5L6LB 3R7DA 3O91A 4HDAA 3SZRA 3D8UA 2CWDA 3AHHA 1IN8A 1JYFA 2FJUA 3WYFA 1K7FB 1PLLA 2ZFUA 5IANA 3JCZA 1CUYA 1TD9A 4J6EA 1JDVA 3FNFA 2WZQA 2ACWA 3LUCA 5AW5A 5ICMA 1Y3BE 1GNQA 1QYCA 1PDOA 1W48A 4QTTB 4C7OB 1F2VA 1RKXA 5JG7A 4UM9D 5G0UA 3ERCA 1PKXA 3EY9A 1AQIA 1KDZA 4ADSG 2QMQA 2P75A 3AG6A 3IJ5A 3U4GA 2VHZA 2CXTA 5FWYA 2C58A 1DAMA 2NU6B 1YU6A 1Z4PX 5I9TA 1RPZA 1CUHA 4TKUA 1HQKA 1R0LA 1J06A 4ZQIA 4EYSA 4RK5A 4KI7A 3HO8A 3LPLA 1LJ8A 4RVOA 3BHIA 3TXXA 3UWOA 1DQZA 2FE1A 2D0IA 2ZOSA 4D9FA 4FMDB 4DA7A 1WUJS 1XZ8A 3NASA 1Z0FA 2VKTA 2WQZA 3PVSA 4K88A 3FG9A 1JVSA 3IUEA 4KAAA 2BDTA 4WECA 2JCBA 1YUBA 4BIIA 2JLBA 1IOZA 4EGAA 2XAUA 4CHGA 3MERA 5D6OA 4B7XA 2QTBA 4E21A 4G8DA 4K6GA 1THMA 1W85B 1YDGA 2HNBA 4LSWA 1SWWA 3SEAA 1DWUA 3DAYA 3DF7A 4I50B 4D80A 1ZGBA 2IZZA 1MEEA 1I5RA 3F6SA 4JSYA 4KPGA 3S55A 3D6MA 3KSDO 4LF5B 1UBTS 2Z95A 4QQNA 1J8MF 2ERYA 5IWCA 2FP4A 2C4NA 3D4IA 1J1ZA 3AF0A 4EGJA 1UZNA 4MYCA 1DTWB 1ULAA 3BDAA 4MW1A 5JNWA 1QHHA 1GPBA 2O2GA 4IS3A 4JEIA 4XIIA 4CU5A 4K40A 4JC0A 2E5LB 2UU9B 1M73E 2SHKA 1NJGA 4GQIA 2C31A 2ZBPA 3LAWA 4JVLA 4OFWA 4Q7KA 1CDEA 1P2VA 1ZYUA 2AEFA 4OLHA 5IP5A 4B8ZA 1NE7A 2PTHA 2YCBA 5AJWA 1FIUA 3DMHA 3ZWVA 3KTAB 1G60A 4DG5A 2VHUA 2R6FA 3LCRA 4LC0A 4BNKA 4Q3KA 1XQVA 4HADA 2R751 4OHUA 2VBFA 2RGNC 3GRZA 3LL7A 1HTWA 4I19A 1O6FA 1SZDA 4ZT5A 5DULA 5BN3A 3CY6A 2VH2A 1IU9A 2H07A 4JUFA 1Z35A 1UDAA 2ZUBA 3R0QA 4KLZA 4RXTA 3QFRA 2VYND 3JQGA 2GNPA 4AN1A 2ZPUA 5I4KA 1Z6AA 3QKSB 2QZJA 1IY2A 1LKZA 2Y6VA 3KU4A 1PDVA 1F8GA 2IPOA 5EPEA 3V4VB 4AULA 1LH0A 2W8ZA 3GMSA 1RCTE 1D0SA 2PX2A 1PJQA 3SFZA 2DEUA 1CV2A 4JR2A 3U17A 3OT5A 2XJ4A 4W1RA 5L7TA 3EZ6A 3D4BA 1DAHA 3HYLA 3LPDA 3B38A 4M9UA 4MUXA 4AKSA 1CY8A 2QGZA 3F6YA 4RSRA 1NR1A 2WJGA 4BP3A 4TYYA 2F2TA 3Q3CA 2QRVB 4XGKA 1YJAA 2JDIA 3SBDA 5FOWA 3HJTA 3LD9A 3EZYA 5HUJA 2R7LA 5FJIA 2EYQA 1TPZA 3HKDB 4XQ0A 3ZHSA 5BUZA 3DC7A 1JG2A 1YCDA 2HA6A 2XYHA 2Y71A 3H0KA 4O8ZA 4K6CA 3TLGA 5AICA 3KAKA 3ZKAA 4LRTB 5E4TA 2NWQA 1KS9A 5EGSA 3I8OA 2QYOA 5TLSA 2YY5A 2YXDA 3GJXC 2BELA 1JHPA 3O2JA 3B89A 4C5BA 1MPTA 3BH6A 2G36A 1I6WA 2C3MA 2PMFA 5ALZA 2Q7DA 3LKZA 5BW5A 4PPYA 3FTQA 2BFPA 4ZT3A 1MD9A 3EWAA 3KHSA 3QLVA 2EZ9A 4ZHQA 2G72A 1LJLA 1I1OA 4C2TA 1ZWLA 3O9VA 3IC5A 3LZCA 4RF2A 4BJ1A 1VBMA 4TV8A 4DIFA 1N0WA 3EEOA 1W49A 3QU4A 3LSYA 4YMTA 1U8ZA 3U9LA 1MX3A 2YQ5A 2PPVA 2XAAA 3L8CA 3ENQA 1LFDB 2JD1A 4I9FA 2C95A 1VBKA 5CJPA 2I34A 5GONF 3RSGA 4MUEA 1YA4A 2Z8ZA 3T9AA 4IQ8A 1ZM2A 4FNOA 4OFXA 3F96A 4Q3NA 1MO2A 4OSOA 4R2IA 5EI5A 1M2OB 3K32A 2CKMA 1GGMA 4XLLA 1T5LA 4ZVUA 2QM3A 1SCBA 4A2QA 4JWTA 2HBYA 3I1YA 2HOQA 2XT0A 4Q6BA 4LMPA 3TPCA 2WIBA 2Q7OE 2QN2A 4BFVA 2FZ4A 3RAJA 2LRHA 1SUCA 3W0LB 5AK3A 3PDHA 2YQZA 7MDHA 3X1ZA 2XB9A 2RGCA 3KS9A 3STTA 4A6EA 4MYRA 2SCUB 4FGSA 1D1QA 4EGQA 4YUWA 1FFBA 2CMFA 1EINA 2IDKA 4CEHA 2JLRA 3EIEA 4V1CA 4ZOQI 3I92A 3SQOA 1ZHHA 4YDRA 4BNWA 4JCOA 2COKA 1E1YA 3SK0A 2QAGA 4BMCA 2JFFA 5K2OA 4W5WA 3RYFA 2FPMA 5CB8A 1UOQA 3GQBB 5KWIA 3ER6A 1L1QA 3A28A 2D1SA 5F9FA 2K2WA 3RARA 1VMIA 1ZUIA 4ZALA 3QJGA 2QR3A 2Q3MA 4WKGA 1RZVA 3Q7RA 4F1JA 1MX5A 1Z34A 4MRVA 4RAOA 4OK6A 5BP7A 1BQ4A 2J9YB 3PXCX 4FN5A 1ODIA 1JWAB 1SUPA 4I1OA 4LQDA 2R25B 4TN5A 3SHOA 1JR3D 5KNLA 3VNUA 1W94A 2VHQA 1G8MA 1S8FA 2WHXA 1U1CA 1R0CA 2NTEA 5HEKA 4A15A 4FHZA 2ZJ4A 2JBHA 4O0LA 4XLZA 3V48A 2GEJA 4ARBA 3WWDA 3FSJX 3CCFA 4B85A 1WU7A 4BX3A 1N6IA 4FHCA 2WT9A 3QUAA 3SZUA 3GJRA 2YN0A 1ZUD1 3HJBA 1HO3A 3TAHA 1L5QA 3IP6A 4EPXA 5KTTA 3PPIA 1DARA 4U39A 4GP7A 3R7BA 4UEKA 3ANXA 4JT8A 5TPZA 3FYUB 4Q37A 3AVUA 3OUZA 1JT2A 4RD2A 3D8RA 3HZOA 4X20B 3EY4A 3F6PA 3HEBA 3N2KB 4TM7A 3KYDA 4UE3S 4MJLA 5TF4A 3TIFA 3RIEA 3CBQA 3VVLA 1IUPA 4A9AA 2R8ZA 2C84A 1E3LA 2J87A 2QDKA 1WTAA 4XKJA 5KMGB 1C3OB 1M8GA 2POQX 5BNWA 1DKLA 3FZNA 1X87A 4Q4HA 3G0HA 1PZGA 5FDFA 3RD5A 3K0SA 1C3LA 3CRVA 2I4IA 4MUJA 4TLBA 5JDCA 2LGJA 4JYAB 4AUMA 5HYVA 3GLIE 4N7BA 3L9WA 1P0CA 3HO6A 4NE7A 5DF1A 1P39A 1YVEI 3CUWA 3REQA 2J45A 3A6KA 5CK5A 2QMYA 3F8SA 2HC9A 3V6MA 4IDOA 1TC2A 2RC5A 4YP9A 5KSYA 5J5AA 1EWTA 3PR2B 2YX1A 1DQPA 4FK8A 4EUEA 2H54A 3HPRA 3JYPA 4JVSB 5AK4A 1E9AA 3IMEA 4CHTA 4A5OA 2OOSA 4FWIB 1RYBA 2IYSA 3TCKA 3VNSA 1X70A 2P3QA 2IOHA 1E79A 1XMXA 1L4LA 3NVDA 3E8SA 4KBGA 2Z5VA 4ECEA 2EP7A 2IDJA 4R9RA 4ZO4A 2J7KA 4DLVA 3AFHA 2J5BA 4Y6QA 1XDWA 4MVJG 3TWOA 1Q1ZA 2X9NA 2QL5A 2ZBVA 4TL8A 3EEFA 3REFA 4AS3A 4Y9SA 1CCWA 3DDHA 3X1YA 4IIJF 3E70C 4OHOA 2CL0X 3KFLA 2Z2XA 4O4JB 5TVGA 3LVFO 2GH1A 2C4MA 1T3GA 3V4RA 1H42A 2QJFA 2CCKA 4RVNA 4OBEA 1X1TA 1YMQA 4KK3A 2FQYA 2C97A 4RVFA 5B3AA 2PWPA 2IBTA 2WDPA 1N77A 2C57A 4LSMA 1LLCA 5A7HA 1ZN9A 2BISA 2C2GA 2GN1A 2W0MA 2XB6A 3NS7A 4K9OA 5ENVA 5LDDC 2GQ0A 2XLCA 2J3LA 3GDFA 3H0EA 4LA4A 4A03A 1WOYA 3MCZA 4CG3A 2YWEA 4EKIA 3HJFA 2Q5LA 421PA 4BQOA 3N1UA 4MULA 4ISCA 4BFLA 3AERA 4ERXA 1PFQA 2CJFA 3ESYA 2H16A 3KVOA 2OYRA 4ZEWA 3X44A 2BFMA 3QKIA 2AUNA 3MBIA 4GYYA 2GEUA 3BKWA 3D1JA 4GH5A 4JL6A 1EUDA 1SO8A 1NBIA 3OTQA 5BXYA 2TRSB 1CY1A 1DDOA 4BKUA 4R9NA 2HJRA 1KJNA 2OXFA 3CHYA 3PXGA 1V5WA 2BRUC 2BEWA 4Q93A 4WXYB 5D1NA 9ATCA 3D1LA 4LGMA 3NALA 2GBFA 3QXGA 1RI2A 4WGGA 3DE0X 2GJ9A 4HDSA 2DFLA 2NO0A 3M8KA 2QDXA 1TCUA 3MAGA 1OB5A 2Y66A 4XEUA 2LW7A 3GJ5A 3D6AA 4G4GA 3FWHA 1RWVA 4IKEA 1ZJJA 4URHA 1OTHA 3U7IA 3LUGA 3IDQA 2J48A 2P41A 3ZOZA 1P29A 1Z06A 4LK2A 1P6XA 1G3RA 1KY2A 1W5EA 3FCCA 4P5PA 2JI7A 4IIEA 1W47A 2AV6A 2VQDA 5JS8A 4OX9B 4WESB 1A4UA 2FW0A 4FT4A 4ALJA 1H66A 4ZP1A 1H6AA 2G88A 3L6OO 1LSJA 4ND8A 1RYFA 4I9HA 3V3KA 2G1PA 3VSBA 4UM5A 4EM6A 1BIFA 5FKJA 4FR0A 1GNRA 3KKOA 3RRJA 4PN7A 1OW3B 1B7GO 2P2DA 3ETDA 4MROA 5ER6A 3TUZC 2GI4A 3FTCA 4Y2GA 2B1RA 3D0RA 2XF2A 4RY9A 2DJIA 3FIUA 5K0EA 2Q4TA 2I4MA 1S4QA 2P6PA 4GOLD 4Z3KA 2JI6A 4XD7D 3TFQA 4TUYA 3SN6A 3VPBA 4F4FA 4EVSA 1WB4A 4F9FA 5CDSA 2IX3A 2AK3A 2B3TA 4IGIA 3G0BA 5C32A 2FX5A 2WF9A 4H3VA 4YPFA 1FUYB 1XZAA 3WWCA 3ZUPA 2H2DA 3FUCA 1Q17A 4FWBA 1NP7A 3LUAA 1XI2A 4OHMA 2Q2QA 3HC7A 1T9ZA 4N18A 1PR9A 5CBPA 1BMFA 2XIJA 5C1DA 1PK7A 1OAOC 2FRVA 2TYSB 4IGEA 3SZ3A 1QHFA 3BWVA 4QL3A 1BXRB 4EBBA 3PHCA 1HMPA 2WMOB 1DC7A 2X0DA 2A8YA 3U44A 2OM6A 1QJCA 2Q2NA 1OWLA 5ICFA 4EGCB 1LK5A 4N0PA 4DADA 2VT3A 3TRIA 3WZ2A 2V9ZA 5BV1A 3A26A 4QUJA 1N32B 4IDGA 3U2QA 3OPVA 3UUGA 5HZMA 3TOZA 2JBWA 3R3SA 2V98A 4UOEA 1HDOA 2DBRA 3F6BX 3QYFA 4N7RA 1VFPA 1I36A 3OLYA 4DMHA 4NCHA 1MTOA 5EXXA 2WFZA 1JDBC 3BMCB 3K73O 1Q1QA 2UZ1A 2YYYA 2YYAA 3OIVA 2VDUE 4Q3CA 1SELA 4W9NC 2P62A 4Y7DA 1DC3A 4QRIA 2ONZA 1LWNA 4CIXA 1Y5MA 3AFOA 3P9NA 1H2AS 3RSQA 2CCJA 2DPYA 4ZI7F 3DLBA 2XSZA 3LA6A 4QFBA 2Q1XA 1DOHA 1T36A 2D1FA 2PBZA 3DUFA 1A7KA 3MRSA 5FNZA 5L7YA 4CG2A 4G0YA 5AKZA 4LCEA 1DWQA 1X7ZB 4PU0A 4XQCA 3NV9A 2NLOA 1I01A 2JIPA 2CBGA 1IDOA 1UMBA 1VSVA 3AB7A 3IILA 3KT3A 5C9ZA 5HKOA 2EFCB 1FSSA 3OPYB 1OFIA 2R79A 4X8OA 4CN9A 7MHTA 1XC7A 3LYUA 1L5RA 3COYA 5HBGA 2A88A 4QKQA 1QQTA 3IVMA 4NFSA 5KDOA 2J08A 3O8LA 2FPLA 4XARA 2Y0DA 2HRRA 1DKPA 1I0IA 3KL2A 3NNNA 1GSOA 5DEIA 3HXPA 1C80A 4DLAA 4KWTA 2ZTSA 1C9MA 2VTKA 1S0UA 1ODLA 3RUEA 4CIVA 1JEYB 3OTOB 5EWMA 3ZVKA 1KI7A 521PA 3CA8A 4RA6B 1H6CA 5EYPA 1T43A 1R4NA 4P0PB 1H2WA 4MTCA 1F14A 1D2NA 2QNBA 4OHCA 4CMBA 3QNUA 2WP8J 4YMGA 3TO5A 3EVAA 1E89A 1MX9A 2C3PA 1X7GA 1ZIYA 4I1RA 4L5IA 3G0CA 3DJFA 3U1VA 2IITA 4Z53A 1QB8A 3IVXA 4AK9A 1NUTA 1QBGA 2Z6VA 1JS1X 3WK4A 1Y9ZA 4S1VA 4P8RA 4W7IA 3EVDA 5FOVA 2NZ8A 4JKIA 5G41A 1KDYA 3GLFB 1CR4A 2AEEA 3RASA 4CF3A 1RQ7A 1WNTA 2QR5A 3Q9NA 4RHFA 5DBOA 1NN5A 3DONA 3G1UA 1KARA 2YFQA 5DT9A 3TGWA 4AL4A 1J33A 3VJMA 2VJQA 3WMGA 3QZUA 3G17A 1EXMA 1U7OA 1SC1A 2TMKA 1RWMA 2YV4A 4M1MA 1EXDA 2DF8A 2BBOA 3QSYA 3KXLA 1JLLB 3DAPA 3OPNA 1ISPA 3K31A 4LAFA 1IPHA 2OWEA 5K8LA 2XB2A 1DZIA 3NHZA 4Q3DA 1NN1A 1T2DA 1UBOS 3SJ7A 5CNMA 1IY9A 3WQHA 1XXHE 5AKJA 3PWZA 3VZSA 5GV8A 5MGNA 4KMMA 3I58A 4ND4A 3KBOA 3KV3O 1AB6A 4RKFA 4CIWA 1IQUA 2FN7A 2CV1A 4OJMX 4M53A 1RXSA 4GMGA 2VBCA 1XYYA 2P0YA 1KJZA 1N6HA 3T3GA 2YY7A 3NM5A 1ZH2A 1DTEA 3MAJA 4WW0A 5AJZA 1NU8A 2F9MA 2GASA 1KOLA 5KU1A 1LWOA 4UQOA 2EFHB 1AQ6A 4Q48A 1KI8A 4Q7QA 3BQNB 1Z36A 3JV7A 1MHPA 4OYHA 4D41A 3NONA 4DJ5X 2J9FB 3MT9A 4EBFA 1W2HA 4R0NA 2GTHA 4REOA 1P17A 4YAFA 1MC1A 3ZVLA 3UOAB 4DR7B 5F12A 1FUKA 2QX9A 4N6GA 1N9ZA 2ORIA 4CM5A 4F8EA 1WB5A 3OMWA 1J2RA 2PQ6A 1Y1SA 3OIFA 4AY3A 1S6YA 3RRNA 3WLSA 1NDUA 4TWRA 1QTNA 5BSEA 3H2HA 1PAUA 3KUCA 4PFSA 1ECJA 4N5IX 4FCCA 2CKDA 2P77A 3QKWA 1E2NA 4RK7A 3DF9A 4RWEA 5AVKA 3WLOA 2D5CA 2PGXA 2ZE7A 5NLLA 2FR8C 3A9UA 4A7PA 4CMIA 4HPJB 5AVSA 1GUYA 4WWHA 4YJGB 2O8EB 4I50F 4MVJI 4G0PA 1J0AA 3DWEX 5JS7A 4BWFB 2VDNB 4LVCA 1WDLA 3IR5A 4PAGA 4ZYVA 1GADO 2QTGA 1WF3A 5K3CA 3OE5A 2QJOA 3EC7A 1OU0A 3I2IA 1GCAA 3EW7A 3OECA 5EE1A 1DV2A 3DXFA 3DOOA 3ID6C 2PSEA 5ALLA 4CMJA 1JFFA 2QRNA 3MCVA 4Y3UA 2G6TA 4G37A 2WHEA 1T2FA 3EVNA 4JJFA 5K01A 1PQUA 3DLHA 3VPGA 3WS7A 3KXDA 2LTAA 3IBCA 4UFOA 4V2UA 4Y1RA 5KYUB 4RV4A 1LV7A 4KRYA 1JIXA 3ASZA 3BRSA 2YJ3A 4AM8A 4CKCA 1UBFA 2NZYA 2BDUA 3CVXA 2IS2A 2IYAA 4PLFA 3I4LA 4O4LB 1Z5OA 4F60A 3IMKA 1T9CA 2IPMA 3GLVA 4ZJZA 1T4BA 3TR5A 2JBAA 3S8YA 4E5VA 5L4SA 1UKBA 3UBMA 7REQA 1FYEA 1WHSB 2PKYX 3L05A 4FUTA 3W8DA 3ELBA 2N9UA 2Z3ZA 1E5XA 1Y1KE 3GK3A 1P31A 3GRYA 4WEOA 3VHXA 1GDTA 4GZLA 2J6IA 1XO1A 5BSUA 4EHBA 4CDMA 4AKHA 1II9A 3RAFC 4AI6A 5EL0A 4BO9A 2GLTA 3R5TA 4NENB 3KDSE 2HUNA 4HD8A 1VCMA 2RBKA 3M4YA 2ZSHA 2BCEA 3S44A 4R9SA 4JXZA 4UMDA 1KI6A 3U31A 1EX9A 3MUOA 2C5EA 5M29A 3ELDA 4E5SA 3RT1A 4MVJE 1SU6A 4DHEA 2RK6A 4H4DA 4QM6A 1J22A 4LVNA 2F17A 5EZYB 1GZ6A 2ECKA 1BROA 3NHRA 4ZN6A 1V3TA 2DPLA 2JAHA 4W6ZA 2IHKA 5DO9A 5ELLA 3U80A 3UMGA 3VMFA 4YR7A 5JDIA 2ZS8A 1SUBA 3GGSA 2FPKA 3VYTB 3CFYA 1JAYA 5ALSA 1GGHA 1T9BA 3EF3A 1WPXA 2BY4A 1U7WA 2H31A 2ZI3A 3IAM1 4Y2QA 5BRNA 3VPSA 4P34A 4PC2A 1UK6A 5H8WA 3KJQA 1VE6A 4RJJA 1VL2A 1UJ2A 2I2DA 3HB5X 2Y1DA 4WL0A 3BIWA 4JMPA 5AM5A 5I5GA 3DVAB 4O5OA 3PWKA 1SIWA 2VP6A 3OZXA 5H1YA 4Y6SA 3OJFA 1E7WA 1EGQA 2M6RA 2MSKA 3KQMA 4L57A 5D3QA 1XEXA 4NJEB 4RTRA 2QT1A 1LLQA 2YZMA 3ND8A 4P7KA 2B4QA 3MD0A 4LWQA 2JAPA 2NXEA 2O8NA 1BX3A 1BX0A 4E32A 5HRAA 3JD1A 1XQXA 2PUVA 1L7VC 2ZI4A 1JQDA 3RJ9A 3ZDQA 2DQZA 4KIUA 2VEDA 3LY7A 5DBIA 3MWDA 3B2EA 3H86A 3VSDA 4RE6A 4ZYLA 3T0FA 3JWEA 3IAAA 3PQDA 4GS5A 4CLRB 2J5KA 2B6NA 1XELA 4CUZA 2I6FA 4CF7A 2AFVA 2IEZA 4QUAA 5DTEA 3TNJA 3L4EA 4II2A 5K20A 1TRKA 1KIFA 3H18A 1NKTA 1W6RA 3U0BA 4QUGA 2WWYA 3UCEA 3N6VA 2VQEB 4YO8A 3PUKA 3GOQA 3R5KA 2HCBA 4WVLA 3VC2A 3KQHA 4EJFA 1N2GA 5CX1B 2VDOB 4JVMA 1QOPB 1Z4QA 1ZN8A 3WLLA 3SNHA 2PIAA 1KYXA 2AI2A 1ZCFA 3FB4A 2ZTHA 2HJGA 2L69A 5GGXA 4D26A 2J4CA 1C0KA 3STYA 1QE0A 721PA 3UTDA 2WWRA 3UW1A 1UPBA 4WBNA 3K9QO 5CDFE 1J7KA 3NHBA 1W96A 3GVHA 3NI2A 1J9GA 1KE1A 1S5PA 3KFVA 4W5OA 4H60A 1CNEA 1ZJ4A 3I64A 1USWA 2H1RA 3CUUA 3RTCA 1Q0LA 5KINB 4OI0A 2G1KA 2Z09A 4L4SA 1Q5PA 3QX3A 4KKVA 3JWPA 1O6CA 1YQDA 1QO0A 4M2LA 4FHEA 4PO3X 4ILEA 1X1AA 2VAVA 1KAMA 3A70A 2AC2A 1G98A 2IUUA 2NPFA 3OLCX 2ZWAA 3U49A 4IY1A 2XX3A 1N33B 1A4IA 4O4IB 1C9DB 3IT2A 1T15A 2GOYA 4WXEA 3H2KA 2IH4A 3PRHA 2H2IA 4M9QA 2XTNA 3JX9A 4POAA 1SEVA 1XEWX 2DHDA 2ZRKA 4W5QA 5LXTA 4MV4A 2EF0A 4NIMA 4KSBA 3SQNA 5H16A 3UXHA 2JHFA 5EJ2A 4RA9A 4EPRA 4EJ2A 3M49A 4MQUA 1J24A 3RS3A 3VR0A 4UPEA 4OK5A 3EIOA 2H65A 2GSWA 4BO2A 3TDMA 1FFXA 3CZRA 2R8PA 1KETA 1QORA 2J0EA 2QTWB 3DT8A 3TLJA 3KQQA 3HDQA 3QV2A 4QYIA 5FPSA 1CZLA 2P2GA 4FEAA 4GI1A 4RZ2A 3KLMX 3ZQKA 2WUWE 5C81A 3C3YA 3FDIA 3W5UA 4LY6A 1DIHA 4CETA 3BE5A 1O7JA 1R8JA 2QQEA 3KJFA 1G64A 9LDBA 2QD2A 1PIWA 3OJLA 3A3YA 1Y1RA 2IUFA 2V0CA 4WK4B 4BLQA 3PF8A 4CBVA 5AUOB 2EFDB 3GUYA 2O8BB 2GZ1A 1Y3IA 4CGYA 3AHJA 2FWAA 2PGDA 2ZPTX 3O90A 1P3JA 1N1MA 4A8JB 3KWFA 3DE1X 4ZVQA 2AXPA 1D4OA 1HFKA 3JYLA 5I9BA 1WP4A 2BC9A 4I1PA 5E4FA 4HQOA 3SC2B 1ZNZA 5ELXA 2E5WA 4JLKA 1EJ6A 1STOA 4HX5A 3CVVA 1HDEA 1BD4A 2UZ3A 3WNCA 3IE2A 3OOEA 3AZOA 1QKIA 1ZMBA 3JPYA 4ZYUA 2EEZA 4EF5A 2G77B 3CNBA 5ENZA 1K89A 4C6RA 2JH9A 5B3LA 2FW9A 2GCEA 4RW0A 2VJLA 4F3KA 2C1EA 1BXGA 3GVCA 4RHUA 2G9RA 3NWOA 4UHEA 5JAQA 4B45A 3UAOA 4B6OA 1LBQA 3O4HA 4GMFA 3IP3A 3RTGA 3GY0A 1AKNA 3CEPB 4URZR 2I80A 4BZPA 3A3OA 3WRXC 2NV6A 2QP9X 4YQYA 2O2SA 3CX7A 2QAJA 3ES9A 1RE1A 3PPXA 1PRYA 2OAQ1 2P0EA 1AVTA 4UUMA 3RK0A 2FRDC 3KZOA 1KZ6A 1Q3KA 2VRNA 2YJNA 2HRCA 4F5YA 2IOQA 1V41E 1P1JA 3BBLA 2A57A 3OFKA 5K9ZA 2CZGA 3RC8A 5B58C 3UMVA 4IV5A 3HP1A 5FTLA 4TSFD 2I4LA 4GOJA 3HDYA 1TE2A 4RPLA 5JCJD 1Z5UA 1XVAA 1UMDB 2YV3A 3NIFB 4DIKA 5A2GA 2QN6A 3H4IA 1XCOA 2VZ8A 2HPZA 3M4XA 4NJMA 4ALMA 4CCYB 5EE0A 5IHPA 1F17A 1GG5A 4C9BA 3UJNA 2V7TA 3MWKA 4O4JF 4U2EA 4CEIA 3VU3A 2DTXA 4D4HA 3BZUA 4M49A 4DCGA 2CGEA 1EUCA 4D3SA 1C3VA 3F78A 3WY9A 4HG2A 4LZPA 2B2NA 1IBKB 1I80A 1YDWA 1MMFB 1M33A 2Q3LA 3H19A 3BJIC 4CMKA 4KR2A 4ZHSA 2FCAA 3TAUA 5EE3A 1LRKA 3X3HA 2BRUA 2OP0A 3PX7A 2PA3A 2G07A 2Q0SA 4FQ7A 1Y8ZA 3SP1A 1AQNA 1AC5A 3OEHA 1P6QA 1NNEA 4IDDA 4BNYA 4F96A 3L7LA 2ATVA 4JOBA 4BFWA 3S29A 5JXJA 5EINA 4ZCQA 3T5AA 1KJ8A 4EG7A 2AJTA 1R3UA 4H9GA 1DC4A 4JLOA 1ZRHA 1AS3A 4HN2A 1ZG3A 3L2OB 2WHYA 4JI8B 3K9BA 2JJYA 1YUNA 3GLIB 3H4MA 2H4HA 2CJWA 1RQXA 3M6LA 1QTRA 2UYOA 1X7YB 3QU5A 5FD8A 4XYMA 1IH8A 3OCJA 2PUBA 1Z22A 3K3PA 3WYEA 4BP8A 4NNOA 3MT8A 2WG0A 1A50B 4M9ZA 3UJ6A 4US2R 1A1VA 5CHEA 3UBTA 3G82C 3ILVA 3JZIA 5KTKA 4URFA 3GZNB 5BVHB 2UYHA 2NP7A 3T6KA 1UZLA 4EYGA 5ARBA 5L3QA 5HE8A 1N92A 1TT5A 4IV8A 5HHTA 1FFAA 5ETJA 1D2GA 4M1YA 1RPAA 4LN1A 3LDHA 1KBQA 2FR1A 4I36A 4Q19A 5DZSA 3SHQA 3HE3A 3KEGA 3UK1A 2P2YA 4ZWNA 2JIMA 1CUIA 4P7JA 4PVDA 3GRVA 2VK1A 1CZUA 4HQFA 5CW1A 5CCEA 5G02A 2W48A 4ISBA 3SJCA 1GSIA 1EFVA 4QTYA 1IN4A 1C29B 1JA1A 2G6BA 2PU7A 3HEAA 3UIEA 3WSTA 3U7QA 2QBYB 1TM3E 5FIUA 4LC9A 2D3WA 4BEJA 3PT5A 1VDZA 1SVLA 2XIQA 1PZHA 1YULA 4FBLA 5IKEA 1JSZA 3RU3A 3K8ZA 4N82A 1L5LA 2PFSA 3OT4A 4X1KB 3UCXA 2C8JA 1R00A 1I7DA 2Y1CA 1P60A 2REXB 3D81A 5EJ4A 3B9BA 3OU2A 4OV6B 4TWZA 2VDPB 1V5IA 2VQSA 2XODA 2PKEA 4J07A 1ZI8A 5LLDA 4X8LA 4WVFA 3TW8A 1JHOA 3UJCA 4DB2A 4EB6B 3F9RA 1FX0A 2BFWA 1JH8A 1DG9A 2VJMA 1A97A 3D8SA 4QU0A 4RIHA 4PIPA 1GGFA 4Z6KA 3AU9A 1ZI9A 3C70A 5JRDS 1MO4A 1VI2A 2JJMA 1GN8A 2OB2A 2Q4OA 3VVCA 4BN0A 4YMVA 1XKQA 1FUEA 1AXGA 1Q6YA 2OBBA 3U4AA 3UTCA 5K0SA 2FEXA 3U09A 5LBIA 1OIVA 2ZJYA 1WPRA 2PV0A 1KIAA 4YRQA 3O2NA 2CBZA 3O8QA 3WQBA 2PFKA 4ZEVA 4B48A 2G1JA 4B3BA 4P83A 2GPAA 3E3OA 4LE1A 4DW8A 1MOSA 3FZGA 3H2SA 2X6RA 4XQGA 1JVBA 1XN1A 3WLNA 4BBPA 5ICGA 4L0QA 3UPTA 3MMZA 5BMVB 2HU7A 3MM4A 1L8QA 1MABB 2OENG 3CWQA 1Q11A 1OBOA 3OKCA 1KMCA 2CY0A 1NRIA 1FS4A 1ZEJA 3D31A 4QXOA 1QDEA 1TIKA 2ATEA 2IV2X 5GTDA 4GW3A 3ILHA 1PZMA 3F8TA 1N2HA 1HYQA 2W2QA 1U3WA 1U0TA 3D4OA 1E4EA 4KXMA 4R7ZA 1ZQ1A 4CIBA 1X6VA 1IBCA 1KQOA 1D2CA 3AP1A 4W5RA 2VRBA 4XWOA 4A0QA 1U7PA 1FTYA 4BB0A 5TQJA 4LTDA 1AF7A 4BS9A 5AVWA 2BHSA 1Q0PA 1V7PC 1ZOSA 4LX8A 5KTPA 4ASUA 1A9TA 3RTDA 1N0IA 3NHYA 2DC1A 2V7XA 4HX9A 3PNSA 3WV5A 1N5KA 3O8OB 3R7AA 1KAQA 4OHVA 4DTIA 2HDHA 5L53A 4JNCA 2ZM5A 2RAVA 4B8YA 1X7WA 5ITZB 2Y9PB 5LYJA 1NMEA 2RH9B 4JSTA 4L8GA 4YCJA 1N1DA 4G81A 1I6LA 4UU7A 1K6MA 2VPIA 4NEHB 3SQMA 1F06A 4YGYA 1P5JA 4EENA 5IBRA 1YZGA 1MKYA 3DTVD 3TUIC 1IAQA 5KYNA 3VJLA 3EZFA 3IVAA 4OSPA 4KHPB 2WNIA 3VR6D 1QIHA 2XNCA 4M8SA 2JFPA 3SE7A 4RETA 1CZRA 2B1IA 1B4DA 3E2IA 1EJ2A 4MJXA 2XCTB 1K2WA 2C2YA 3CGWA 4KGXA 4MGZR 4OH7A 1X15A 5LNK1 4YROA 3L0ZA 3Q4GA 2H52A 1K6IA 3CEMA 2EERA 3ANMA 3DT6A 3LXXA 3OM8A 4HEHA 3UV3A 3IKTA 4UUNA 1MVOA 4NC9A 3EZ7A 3P45A 3RSOA 3RW9A 1W5BA 3ETLA 3I3SR 4C3VA 3AV0B 3LL4A 2P7HA 4AY4A 3LLCA 1X9IA 5JARA 1JLHA 2F8LA 2RGWA 3CLTC 4JR0A 1OA0A 5F77A 4HNAB 1ZCZA 2VNSA 4MI9A 4UUQA 3K6RA 1LNQA 1RAIA 2AJLI 2WAXA 1SJ9A 3CO0S 3DB1A 3R7WB 3TVYA 2JAOA 1QK5A 5BNTA 2GF0A 2IQIA 3LO8A 4JLAA 4JQCA 4AMUA 2BPOA 2R47A 5FX2A 3TH5A 3RKUA 1Z9BA 5DEOA 3DAOA 2FEPA 3DLTA 4IDHA 4NG5A 4N49A 4OAPA 2IIVA 2OXEA 4XTCS 4IBOA 5AJUA 3SZMA 1G3QA 3MJHA 4KN5A 4YAKA 4DBZA 1IXSB 1NYLA 3GJ8A 2UYCA 5C7LO 1F1BA 3FJYA 3SI7A 1L7QA 2ZYIA 4Q4AB 1D2HA 2RHCA 5DOVA 4X65B 2CF5A 1T1SA 2XA2A 2D4AA 2WSMA 2X3FA 3N76A 1T5DX 1BC5A 4MXDA 5COQA 3VKFA 4EJSB 3QVGB 3QVWA 3SSMA 2O2CA 4NU5A 1BJRE 3LJKA 4KX3A 5A04A 1K0FA 1R27A 1PV4A 1QF7A 4INOA 3ESDA 2O0LA 4ZQHA 4Z7JA 3D8NA 1M74A 2HIGA 3QW2A 2ID4A 2OV3A 3IIIA 3KLPX 1R0ZA 1R4MA 4UVDA 3H1BA 1XRJA 2O2EA 3GV0A 1SHKA 2JHCA 3GJTA 3PDIA 4ALIA 2IHBA 3ACDA 3KPVA 3QX7A 4QXRA 4DJFC 2C1ZA 1G291 2R9VA 4AO7A 1XRNA 2Z5LA 2G40A 4JV5B 2P4SA 3GELA 4PC1A 4D8UA 4L0CA 2PV7A 2WHPA 2JKVA 5DNCA 3L8HA 1PW7A 1E59A 3IUMA 1XXHB 2UVDA 5DN6A 3LUFA 5LKAA 3OM1A 1NT4A 1O58A 1WXDA 1G17A 4O4LF 4NDAA 2AMLA 5A7FA 3V7NA 4MKXA 5M5BA 4QSHA 1O9GA 3Q72A 4V3CA 1OSNA 2C29D 1CTQA 2ISSD 1QONA 1L5VA 1SEPA 1T8YA 2REBA 3CSUA 3I3OA 4KQXA 4DA0A 4GFDA 2NTNA 4F2DA 1MAVA 4NDZA 3UV7A 3SJBA 4EKYA 1JQEA 3D3JA 5FBLB 3K0BA 4RH3A 1QYVA 1DP4A 3O73A 1GQFA 3BAFA 3ZGLA 3O8CA 5LQAA 1R6DA 4GMHA 5I3ZA 1IIBA 1OPXA 2NPOA 3DZDA 3FDXA 1XRSB 4LHXA 2NUAA 5LP6C 4O2BA 3GAMA 1GR1A 1LDNA 1P9RA 5ICSA 1V6AA 5EZYF 1UKEA 4XOUA 3S70A 3U4QB 1SQ5A 2GBIA 2H59A 3K71B 3E23A 3A4NA 1QH9A 1UOOA 2FETA 1OFUA 5KZMB 5KJEA 5B58T 4ZTZB 1L7DA 2EKDA 4FFLA 3P2IA 1ZGHA 4FOTA 5ERXA 3QPDA 5K1ZA 4A0SA 3W4KA 5K0CA 3UWMA 2CK3A 3L7KA 1IG0A 3U7FB 2XT6A 2OFPA 1PV2A 1Y4SA 2UYYA 1WMEA 4RPIA 2HJWA 4M8KA 1SOWA 5ERYA 3IPLA 3WGUA 1I9GA 3R3WA 5JECA 1GPUA 4GOND 4NCBA 3CYFA 4BVEA 1CE8A 1LQTA 2NVWA 4Q9AA 1R0XA 3ZHBA 4MV6A 1A8IA 3REOA 2ZUWA 1I4OA 2HX1A 4Q16A 4R4JA 4UPVA 4BJ6A 5HKKA 5LOVA 5C7IO 4HO1X 1XYVA 2PCJA 2O5RA 4UD2A 4XQ9A 1DJNA 1PS0A 4Q9KA 3FFAA 1IMJA 5HIMA 1DT5A 3F9CA 1WXIA 3C97A 3JQFA 4S1OA 1ZH6A 3VPHA 2CB0A 5L40A 1C8KA 2XYRA 5LQRA 2HM7A 3PNLA 3E3NA 1DKRA 3I1FA 3I9JA 3QLEA 2NU8B 1KOGA 3AJAA 1WDKA 2YRWA 2OBFA 5C51B 3RF7A 2P67A 1MA3A 1C7QA 2HRQA 2O5EA 2KSQA 5JEEA 1P0QA 3ZWOA 2NAFA 4H6WA 3MUEA 5BOSB 4IXDA 4RFSB 3AOEC 4GVLA 1JPNA 4FHFA 4OA5A 1VBNA 1M67A 1VZ3A 2GILA 4HWSA 3N86A 1H2HA 2IYQA 3EQ2A 1NBMD 3T1NA 4KREA 3MILA 4R2KA 4D6XA 2H5LA 2BMWA 3WICA 4L50A 1CEEA 4CN8A 1E5VA 4HDKB 4B3SB 3NIGB 3VH4A 4KQMA 4U2DA 2I6GA 2BBTA 1IBSA 4FFSA 4CFYA 4HJRA 4F9EA 5AD1A 3LLSA 3B1FA 1U65A 1P7YA 4MI3A 4LW8A 1XYGA 5F2OA 1Z6PA 2EYUA 4K28A 4Y1EA 2EAUA 3EGEA 3WMFA 4HMPA 4DZRA 5I48A 5LZ2A 2AI3A 4RH1A 2OKGA 1YZFA 2VP0A 5ESDA 1V1MB 2OKCA 3BTOA 3QVKA 1L1FA 3ZS8A 4F5ZA 5A4AA 1O87A 1DQYA 2FWIA 2P2SA 4MDEA 2DCMA 4O4IF 1U0BB 4OCZA 4QWWA 1E3JA 2ERCA 1OX5A 2FZ5A 1WOMA 3A1FA 4G9GA 2VNHA 1VP3A 3UOWA 2VNAA 5ILQA 2AKYA 3A6PC 3GT4A 3NVAA 3B7GA 1RHUA 2HEIA 2ZK7A 5HG0A 2FZKA 3HK2A 3ZJTA 2EZ8A 1GUAA 1M2EA 2P35A 2HXSA 3ZTWA 3UC9A 2N75A 4UVIA 5ALNA 5EHIA 5FA6A 3VOAA 4DYDA 1Z62A 2D2VA 1K6EA 4B4WA 1H0RA 2WYHA 5B7GA 2A9FA 3VVBA 3PHGA 4X41A 2CD9A 1KMHA 3JXEA 4HEJA 5EIXA 3OF2A 1CQPA 4QGSA 5BR1A 3MTAA 3IHTA 4RCZA 1OC4A 3ZUGA 3EPKA 1Z4MA 1OLXB 2CCGA 3QBVA 3PC8C 4P08A 1T3HA 3NFYA 1K3TA 1WU8A 3I9KA 4PHCA 1TVMA 1C1YA 4Q7EA 4GT1A 3RFFA 2VIIA 2NU7A 3WRVA 3H9GA 3H4VA 4BPRA 1OWOA 1YOVB 4GNRA 1V4BA 3FNEA 4O8CA 1WCYA 4FB5A 1O6ZA 2NVUA 1OZAA 2K4MA 4UAUA 2FAXA 5JCXA 1I4LD 1CZOA 1NQTA 3OCWA 1J0CA 3AEQA 5IJ9A 4DLLA 4RPJA 1NQWA 1J1IA 3QU7A 2AMYA 2XQIA 3QA3E 4OM7A 3ZE8A 1NQOA 4DLXA 1P2UA 3PB3A 2JLXA 4HWPA 1L7MA 5H02A 4MCHA 1Y1TA 2O3RA 1FY2A 3FN4A 3DH0A 1OTYA 2QLTA 4GM4A 1ID1A 2AB0A 2BMAA 5HPYB 1BVHA 3IIMA 4A36A 5HR5A 1Z5PA 5PNTA 4ONEA 3K9HA 2VQ3A 4YRBA 1K98A 4UBJA 1DAPA 4QRDA 3QBTA 4F85A 4XX0A 2BJVA 4XCVA 2H63A 3DCIA 3PV0A 4F4CA 4YRAA 2A1IA 2PMCA 3MGCA 2Z4SA 2EGGA 4XM0A 1A8HA 3GEMA 13PKA 1PL8A 1KZYC 3EXHA 3R23A 3W5CA 3H2ZA 2R1TB 1CHDA 1QAOA 2Z4RA 3D0OA 1GN9A 2BHTA 4YP7A 1ITZA 2Z3WA 3UJ7A 3L1UA 4WJLA 3QQ5A 5JZSA 2OXCA 1Y4ZA 5JSYA 4C89A 1PEAA 3NOXA 5SYNA 1HM5A 1C8LA 1GOTA 2W2LD 4NHOA 5AO9A 4ENTA 5JS6A 5JSUA 2ZITA 1A82A 2Q6VA 4RLHA 4BDSA 4OI4A 2ODWA 1C9JA 3PC3A 4KNYA 1ZBQA 3CJTA 3DL4A 4ZEXA 2JH8A 3RANA 1PTJA 1RI1A 1NMQA 2VKQA 3EC2A 5JR3A 3GNLA 1RI3A 1SD2A 2PT9A 1N7JA 3BXXA 1Z0IA 4EG0A 5EJ9A 5IYZA 2YHIB 4L2IA 4D5EA 3UH0A 1QLHA 1VGVA 2I99A 3ANYB 2GWRA 4F4DA 3TLCA 1CB0A 4KC0A 3QTTA 1WHTA 4UAVA 5BQPA 3COPA 2HLDA 3KZ1E 5CFRA 2ZVQX 1P4AA 5KJ1A 4HC4A 1N4AA 1VHTA 1SQ0A 2OORC 3A9VA 3FNRA 2OHJA 4MUNA 5AXCA 1UWCA 3FYDA 2IZ5A 3AVOA 3V7UA 4ZCRA 1WW8A 3AB3A 1QP4A 1U8CB 3WOHA 2Z9BA 3EUFA 1IHYA 1N8TA 1M34A 4L0DA 2J6HA 2Z9CA 1S02A 1YSCA 2FUNB 3ORYA 4TN1A 2PTGA 1DX9A 5CW2A 1R74A 1K7EB 3F1KA 3B1VA 3MUFA 1DEXA 2CHEA 2W9XA 4Y9RA 3X1WA 5LN1A 5DOZA 1DINA 5BUCA 3FOFC 3UGKA 4TLMB 5IK2D 2OILA 3BEOA 5TNXA 4EG8A 2PUWA 3UKDA 4HH4A 4WX2B 3ZXSA 4B3IA 3H13A 2H51A 2GEKA 5I51A 1OB2A 4C07A 3D7MA 4J1TA 5TJ9A 4RZQA 3AR4A 2KB0A 4UDXX 4Z0HO 5HUQA 1L3IA 4LFBB 1DHRA 1UZUA 4D8TA 1T8SA 4NMMA 4X8HA 2IV3A 1QAQA 3DW1X 1S7GA 1RWBA 3IB6A 1AO3A 1FP4B 1ZISA 2BEVA 4JFRA 4R0MA 3HLKA 2F43A 2QGFA 5DRYA 2ATXA 1X8LA 2FKNA 3IV6A 3OF5A 1RM0A 1X9GA 2X42A 5DK6A 3T7AA 3GXOA 3VRHA 4I1SA 4YVFA 4ZAYA 5THQA 4C4YA 3AY3A 2IP4A 3F7TA 4TTAA 1FF9A 3JD2A 4E70A 2D1YA 5JBQA 3T5DA 1QPBA 3W4IA 2QSUA 3W7BA 1WCV1 3HMQA 2FDXA 2Y1XA 1IXZA 3C2QA 2N46A 4JBNA 5FBZA 5KOYA 5FOSA 3M82A 1JHRA 2A4KA 2XOXA 3DBRA 3RUFA 3KQUA 1JFLA 4PVCA 2VJCA 1VB3A 2BZGA 3C7CB 1MO6A 2IYXA 4BNZA 2XQGA 1XTVA 4CQMA 2WW8A 4MH0R 4G0QA 3JQ7B 3MGAA 1UJNA 1B3BA 3HP7A 3L0YA 4HVCA 3M81A 5B1IA 1DDIA 1T2EA 1Y3DE 5HZGA 4BLPA 1FXWF 1OTXA 1TKAA 2GCNA 3CBGA 2HA4A 2NQ8A 2WJPA 1H1LB 1DJLA 1M54A 3AY0A 5EIHA 3Q11A 2ENUA 2G82A 2LD4A 5BWLA 4CNBA 3MGBA 2QMEA 2VPTA 1U3TA 3KKZA 1P1BA 5LDHA 1OOEA 3K05A 4LJKA 2ERXA 3JTMA 1PLKA 2V7QA 4OXXA 2OESA 1ZNYA 2X13A 3EBOA 3JARA 4MK4A 1G3IA 2IYPA 3DP7A 1E5TA 4FOPA 4AJKA 1A04A 3L6BA 4HDQB 3ENKA 3BRWA 1RVDA 4KE9A 3X2EA 4CM6A 4HVTA 3VR5A 1CZNA 3M5CA 2SBTA 4ZEMA 1CUEA 2X7XA 1V7ZA 3LUPA 4YCCA 1XZLA 3WNZA 5DT2A 1U0GA 1QG6A 3P8ZA 1UDWA 4NL4H 1HSOA 5FFMA 1NNSA 3RODA 3LQ2A 3N0RA 4NULA 3ZWBA 3SF0A 4CTMA 5K0LA 2I1LA 4DMMA 5HK8A 1BYUA 4Z4FA 4TX1A 4TL6A 3OQBA 1OUMA 2X2FA 3EGDB 1JI3A 1P4HA 2RC6A 2ZRPA 3CLSC 4Q9DA 5EJEA 5IF9A 4GC9A 4OM8A 2JK0A 3ZD8A 2ZRLA 5LA6B 1FMJA 3CRQA 3DAFA 3KRTA 4NPHA 1LS6A 5KKNB 4Z99A 1U3FA 4ZVRA 2WTXA 3QELB 2NO6A 3W5JA 1JQ5A 1OYOA 1KP3A 4DPKA 1FP1D 3LWDA 3RUPA 4MIKA 4MV3A 1YOBA 4ZTBA 4CMCA 5B4UA 4QT0A 5BMVF 4EH1A 3DKRA 3OTHA 2ASEA 3MZ0A 1XQ1A 5THXA 4BQIA 4ZFNA 3HWWA 3CH6A 2QQ0A 5JJCA 3PD1A 3GYBA 3IUQA 3LSTA 3O2QB 2PZ8A 4HUQB 1PSZA 3ZX5A 3OUTA 2VF5X 4DMUB 1AKVA 2I62A 2OPHA 4B4OA 1S1CA 1MRSA 1I10A 1Q21A 2I54A 4YQFA 3B2NA 2N1BA 2TS1A 4P93A 1K5GA 4U7TB 3ZGVA 1L7NA 3FYTA 3LYHA 2CLLB 5F2KA 3CLRC 2G80A 4YLGA 1R8YA 4L0MA 2KQUA 2QL6A 1KYQA 3W90A 2ZJ5A 2PVCA 3DHEA 2NV2B 5J1TB 1U0OC 2R6DA 2NZVG 3PDJA 4G0OA 3EFOB 4HV4A 3D0QA 1U0SY 1T24A 1UEXC 3HSSA 4PAQA 1T9GS 1IZYA 2D54A 5HM8A 1A8QA 1XLWA 3HB1A 1R0KA 4QBFA 1E3WB 3RS7A 1F0KA 1S8NA 2XHZA 1W44A 4HN4B 5JPDA 5A3VA 4B17A 4YXFA 5DI9A 3GT0A 3EDMA 3LNTA 3OD1A 4I3FA 4OVKA 1V16B 1YZLA 4JSRA 4PZDA 1YRQA 4Q1BA 3GLGB 1EK1A 3JD0A 3UEOA 2HU5A 4FYMA 2QN7A 2AYZA 3KEQA 1F0NA 5CYFA 5AI0A 2IEYA 4OJNA 2WOJA 3UUEA 1JHMA 3IQXA 1PT7A 1U80A 1JIKA 2CZQA 3CZ4A 3HXKA 1CQIA 2KHZA 2QY6A 5TMDA 5CGZA 5FWYB 5JSZB 1XL1A 2G28A 2Q5FA 3DOEA 4ZVTA 2NG1A 1S2NA 3CRW1 1H94A 2CUZA 2E2WA 2PX0A 2PGAA 3T15A 3M9LA 4EUKA 5FPKA 2W6NA 3O1LA 4JBIA 4RUKA 4UD6A 1DCTA 3RC3A 4YJ2B 5JT1A 4TKUB 1BGVA 2ZRHA 2OSBA 2EW8A 1EDDA 1ODJA 1XZDA 1W1WA 2P5UA 3ECAA 3ILXA 4G5OA 4JUAA 1QZ3A 1ZK4A 4QGGA 4CEJB 2QXYA 3H87A 3H8SA 2D7JA 4AJNA 4F5EA 2HIHA 3FHLA 1U2SA 4JBYA 3JAWA 1P4RA 2H2AA 2ZPAA 3HVUA 2JARA 4KQFA 1UWVA 2YJTD 1QC5B 3TNLA 3TZLA 2WTUA 1UPXA 2P3OA 1V9LA 3HCNA 7YASA 5LP1A 4LZAA 2ZJZA 4G1EB 2R6CA 3Q3VA 4HLUC 1N0UA 2Y67A 6AT1A 3A9RA 5SZJA 4HDRA 2V8OA 3D7SA 3P0RA 4PCLA 1B73A 1N5RA 3LWNA 5CT9A 4EW2A 3DHVA 3NTUA 4A0FA 5KQPA 2GZAA 2YUIA 4QXAA 2XMRA 4FLFA 4LYFA 2CLFB 4LGVA 5FPYA 4Y9TA 1ZVMA 2QTHA 4BB6A 3EA0A 4YYZA 4IV0A 2J7PA 5CLHA 3QF4A 3GFGA 2ZSAA 4NRDA 1O8BA 2GO1A 1SXJB 2J0UA 5T4BA 4QSMA 1GHTA 4MKRA 4EHDA 4MV9A 1M6VA 3GVXA 4DV4B 2VO1A 1NMSA 2C9MA 2Q5QA 2OD2A 2OFOA 3VJRA 2J3MA 1MXHA 1TW3A 1V2GA 3A6JA 4IAOA 5GP1A 3K1ZA 1O95C 2XUQA 1IXRC 2VXYA 3F6CA 2BP7A 1X42A 1EA5A 2RGDA 4P7GA 1JG1A 1JUDA 2WAYA 2BDEA 3LU1A 2MYTA 2RHJA 4LGCA 2FK7A 5DTIA 4N3AA 2CEKA 5BN3B 1GQYA 4EI2A 1G7SA 3EASA 3PICA 4JUBA 5FBRB 3U3XA 1Q6ZA 4OYYA 5EP4A 3BFJA 3E82A 4GPTA 3JQGB 2QLJA 2YWHA 3QVMA 4N5LA 1T5OA 3GLTA 4UKDA 5AQEA 2QB5A 5P8WA 3WIVA 2XT9A 4Y9DA 2NSDA 2J0SA 1EG2A 4H35A 1C30A 2JEYA 3B13B 3C87A 4JLBA 3VA7A 5BSHA 3TEJA 1XUOA 2RGRA 3WMEA 4BY9E 5TV2A 1FVFA 3LNCA 2L18A 2QF7A 4A91A 3HV0A 1BMQA 2CV0A 4PFJA 1LQ2A 3OTGA 3GH3A 4L07A 2Z5GA 3TLKA 4Y2XA 4Y7CA 4AG5A 4BQFA 1D0VA 4UZFA 2AJBA 3K6JA 1L7RA 4U0KA 1HWYA 1Y8CA 2RG7A 3G13A 2G4CA 2ZQYA 4WPGA 5DH9A 4A6PA 5F7OA 1VRWA 1JAHA 2ZWVA 1ZGCA 3RIMA 1E9FA 1V71A 1JJFA 1P80A 1P1RA 4EW1A 3FPFA 3TLGB 5BQ3A 5IDWA 3AVWA 1WV0A 3DBHA 1NC3A 3GRPA 5HS4A 3ZJ5A 2W70A 4PY2A 4I1IA 5K51A 4J0CA 1PJ3A 1JHAA 2I2XB 2ZWMA 4GO1A 3F4LA 4YI5A 3ROKA 5F1KA 1CUZA 2D0PB 3EGOA 3M6AA 4ZU3A 2BD0A 2VJNA 3N5KA 5D1HA 2ZYDA 4LYDA 5DRTA 2VEOA 1QDUA 3KPUA 2R86A 5K4HA 3K72B 2XZTA 3QU9A 1ARZA 1N5LA 4MJ3A 1HDGO 3IQGX 3SYLA 4ZHQB 1NQUA 4TYNA 3WK6A 4NZMA 1JJBA 5LR6A 1TX4B 4UHBA 2WKWA 4YMWA 1SMKA 2DAPA 3NANA 1O5TA 1I2AA 3LRPA 1SQFA 4TV8B 1DV1A 3BSFA 3QBDA 3G8CA 3DEZA 2GYYA 4P80A 3CPSA 1KEKA 5EFZA 4AKEA 1VJ1A 4HWKA 3MCTA 1EK0A 4DDWA 4N9WA 2VH5R 4FGZA 1OLSA 2VNIA 4D8YA 1I7SB 4IXWA 2IXGA 4HAXA 3C3BA 3FCYA 3I01M 1EKXA 2LIVA 2WJIA 1FLNA 4KNWA 3HR4A 3AR3A 1UC9A 1MXFA 4WZ6A 2HSEA 1Y7LA 3LCVB 1NY5A 1L9XA 3OZSA 4JDUA 4L9RA 1SCNE 4RV5A 3UA3A 3VDQA 4DIOA 4ABTA 1LTKA 2HFJA 3VQTA 2PS0A 4M1KA 3A2NA 4YLEA 4NG4A 3IUBA 4TYMA 2F1IA 5EKTA 2VH1A 4OUKX 4AZVA 2ZT7A 1H8EA 3F2VA 3WIEA 4BUCA 3IAHA 2VBGA 1L4BA 3VNBA 5A9SB 3U7RA 4IXTA 4MHTA 1U0FA 2R00C 4XJXA 2ACKA 3A05A 1VSBA 2K87A 2HT6A 3CG4A 1TCVA 2I4TA 4BKQA 1A27A 2W6ID 4CEHB 2PT5A 1GY8A 5D8DA 4D98A 2ZQZA 4V1CB 3AJ9A 2I9PA 2V54A 4WERA 3C98A 4E51A 1DHTA 3D7KA 3JVEA 4ESEA 2OT3B 4Z0PA 3RJTA 3IQEA 5HGJA 3II6X 5CFLA 3CNHA 5FTKA 3JPWA 4CKEA 3TQIA 3NTXA 1TUGA 2Q9BA 1DMSA 5C7YA 4B6FA 4RK4A 4MVJF 5K8IA 2F8SA 2VYVD 4WFKA 4LRYA 1YE3A 4U2FA 5A0FA 2B6HA 2QJRA 1UKVY 2DFNA 2PUJA 1MDBA 3FBGA 3VNRA 5FAKA 2BL4A 2IBSA 4P38A 4TVOA 2IZ7A 1K6XA 1QFMA 4OQDA 4D6YA 1OXMA 2Q1YA 4TLLB 3O0TA 3KVYA 1W5FA 1ISIA 3ORSA 2DH5A 2G5PA 2JFYA 2YYSA 5HIJA 3WOVA 4BB9A 2NO1A 5AVUA 4H7EA 4LE0A 2O2ZA 4BNDA 4YAEA 1V8BA 4PICA 2OXTA 1HDCA 4JB0A 5H3CA 5U4QA 4INJA 3E9NA 2VAMA 2QL9A 3H8VA 2FCRA 4QYSA 2GK7A 4XJTA 3WGOA 1WCIA 3DL0A 2PZEA 4WCFC 5HBRA 3UGTA 2FW6A 1LUAA 2J3EA 3PF9A 3IPRA 5ICCA 3KO8A 5EEHA 2Q5JA 3M9WA 4FLEA 4RDHA 4L74A 1DEAA 2XCLA 1PG0A 2BMDA 1RWQA 3AESA 4G65A 3L84A 4R8SA 5SYAA 5K6AA 3KYDB 3BWMA 1DDGA 3NGXA 2O7NA 3B7PA 2FN9A 2FWPA 4PLTA 4G23A 4OMUA 2PMBA 2BMJA 3QBJA 3SDSA 1EXVA 3OE4A 4PAOA 4S12A 3I72A 3A7DA 2WJAA 3A7EA 1BCRA 4Q3BA 4LGYA 1QZZA 2AUTA 4Q4HB 2QSJA 1T8WA 2WWGA 1QTIA 2H1CA 4JJKA 5D5HA 4LCBA 2H5EA 1H5QA 4EYEA 1L5ZA 3AF3A 3ZWPA 2W6JD 1TAQA 5K0ZA 5HE9A 3ZWKA 1WSBA 2OEPA 3IDSA 1PS9A 4X3PA 3REQB 1F48A 1QOZA