5K3FA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - his280asn/fluoroacetate - cocrystallized - single protomer reacted with ligand
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
297
structure length
296
Chain Sequence
LADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGNFLPEEAPDQTAEALVRFFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of dimer asymmetry and protomer dynamics in enzyme catalysis.
pubmed doi rcsb
source organism Rhodopseudomonas palustris (strain atcc baa-98 / cga009)
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
total genus 113
structure length 296
sequence length 297
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k3fA00
1EHYA 1QO7A 4NZZA 1CUBA 5C8ZA 1U4NA 1HBJA 1PV1A 2H1IA 3PICA 4BB0A 1XLVA 5ALFA 2BUCA 1Y7IA 4UPDA 2WFMA 3G0IA 3WI7A 1WM1A 1IZ7A 2W6CX 4UHDA 3S2ZA 4KAAA 4W1RA 3ILSA 1CUVA 1UOOA 5ALDA 4H7KA 4MYSA 4CI9A 1CUUA 1VKHA 4OSEA 3R3XA 3W2TA 2BFNA 2HA7A 2WFLA 2C0PA 5BOVA 5AI8A 5ISMA 2QM0A 2AJCA 3TRDA 5ALHA 3O4IA 3JYHA 2G5PA 3QVMA 5IKXA 2JGEA 2JBWA 1U8EA 1GGVA 5AI5A 5IVDA 4KAJA 1QGED 2G63A 3FCYA 4DNPA 4PSUA 5YASA 4CIBA 3FVRA 1UK6A 2HA0A 5ALMA 4H77A 5HF5A 4BE4A 2DCMA 1TQHA 1EDBA 1ZGCA 3WKBA 1JJFA 1Y7HA 3WWOA 1XZDA 1CUGA 3D59A 5CMLA 5ALZA 1O6FA 4XIIA 5EHXA 2JEZA 1BE0A 3C8HA 2CB9A 3FLBA 5SYMA 5DYWA 2XMCA 1BU8A 4K5QA 5AOBA 2XQGA 4QWWA 1UK7A 3AIOA 2FUKA 2JGLA 1R3DA 1WB6A 1USWA 1ORVA 2XQFA 1F8UA 1EK2A 2WIKA 5JAUA 2C5FA 2VATA 4B80A 4KEAA 4UFOA 2Y2UA 1J1IA 4CCYB 5A6VA 1H2XA 4DNQA 1LPOA 1EH5A 3C45A 2O7VA 4Y2XA 1XLWA 3K6KA 4BAUA 3C5VA 3DDUA 4ZWNA 4FOLA 4Y2JA 5AKKA 2QVBA 3AZPA 3W06A 5JALA 5D3ZA 3PFCA 5CT8A 4P08A 4Y9SA 1F6WA 3QPCA 3WKDA 5JZ9A 4KAFA 2YXPX 1X2BA 5EHZA 5JATA 4WFJA 4HS9A 5EHNA 3ZLTA 3QMVA 1YA4A 1BRTA 1G4HA 3TEJA 3H2GA 3AILA 3BIXA 1JU3A 3G0GA 1AC5A 4BP8A 1L7QA 1DWQA 3FYUB 1VZ3A 4F60A 2ZYSA 1LBTA 1UOPA 4J3JA 1DX6A 4H7DA 2XUHA 3EIOA 3C70A 2H7CA 1MPXA 5JD4A 2QS9A 1L7RA 1W76A 1U65A 5CT4A 4E46A 4DNFA 1XRLA 2PU7A 2XUJA 5AKJA 1N5RA 1BCRA 2ORYA 4PW0A 5EHQA 4WDQA 4HRYA 5CT9A 3AZQA 1QIDA 4OU5A 5ALGA 2B4KA 1XRRA 4GW3A 4F21A 1B6GA 1THGA 3BF7A 4Q34A 2DHDA 1QIIA 3E1GA 4PO3X 5JD5A 3OPMA 2XB6A 3H2JA 3KWJA 1LPSA 3K9BA 1LPBB 4HTAA 1YSCA 5DWDA 1P0IA 2WTMA 3OOSA 4HXFB 2ZYHA 3FSGD 1LPNA 3HYSA 4TPKA 4ARBA 2OQVA 3OM8A 2QOEA 4WY5A 3FNBA 1UFOA 1LPMA 5SYNA 5BWCA 2YASA 2HRQA 4X3CA 3WK4A 5AK6A 3IUMA 1R88A 3JW8A 1DWOA 5HZGA 4C01A 3G0CA 3STXA 3FYUA 3RKSA 1P0PA 5AKGA 2WKWA 1R4ZA 2VAXA 4GXNA 5FPPA 4JH0A 3G9UA 4IO0A 5J3JA 4K6HA 3SK0A 4UBKA 4QE3A 1SCKA 1QOZA 1EXWA 1M33A 2JIDA 3I2GA 2XMBA 2QUAA 3WJ2A 5AM0A 3ESCA 3I2KA 4DYHA 1GPKA 4Q3OA 3H17A 1CVLA 1OILA 1R1DA 4S0XA 4WFKA 1CUXA 2JGIA 3VVLA 1RP1A 4AMYA 2BCEA 5AI0A 5DJ5A 1QE3A 2XMSA 5T4BA 1ZGBA 3R0VA 4FLMA 3I1IA 2WFLB 4BDSA 4DGQA 1K63A 5HF8A 4G9GA 2HL6A 1QTRA 3QITA 1DX4A 2WM2A 3WIBA 3A70A 3HI4A 5K3FB 3AINA 1DT3A 2XI4A 4FFVA 3ZPXA 4QLAA 3KDAA 3HEAA 5EFZA 2OAEA 2W22A 1QIJA 4KR0A 4N5IX 3PF8A 1CUZA 2PSFA 3GELA 1AZWA 4LXHA 4P92A 2Z8XA 3A2LA 2ZYRA 3R3VA 3DNMA 3W04A 1IUOA 5AK5A 2AJBA 1FFCA 1MT3A 3HSSA 1P0MA 4BCDA 5LLSA 5C8XA 3WLAA 2HU7A 4PSCA 4ITVA 3ZLUA 2PBLA 3F8SA 1FFBA 5JASA 4QDTA 1QONA 4G4GA 4PF1A 1EB8A 4PSDA 3IVMA 3OC0A 3N0TA 1FFDA 4DMFA 3QMWA 2Y2VA 4UBJA 2OCIA 4X85A 2EEPA 3T52A 2OGTA 1TCBA 2DR0A 4BCBA 3O95A 2QXTA 4LXGA 3D5EA 5LZ5A 3VJLA 4B83A 3WK8A 3EQ8A 1CEXA 1A88A 5AIAA 4QZVA 1Q84A 3W9UA 6YASA 4MXDA 5HKAA 4UBMA 4BCCA 1A8UA 1CUIA 1ZD4A 2H9YA 4EBBA 4KRXA 3U0VA 2XUKA 3GROA 2Z5GA 4EZIA 5ALEA 1AX9A 2ECFA 4OYYA 3E0XA 4Q3KA 5BV7A 3IBTA 4LIPD 4PV7A 4KACA 4Y2RA 5LYYA 4MQMA 1N1MA 5CH5A 3DYVA 4AXBA 5D3KA 2HADA 3V48A 4MQLA 3KSRA 1K4YA 5DYTA 3H1BA 5ALIA 1MN6A 3OG9A 2XMZA 1GPNA 1XZFA 2CEKA 5EIEA 1UWCA 4W9RA 2QR5A 5CURA 1AQLA 2PSJA 1ZIYA 1TAHA 1E66A 2OQIA 1SCQA 5IVKA 5ESRA 3WWDA 4CG2A 1WOMA 5FDFA 3Q8WA 1HQDA 2WILA 3RM3A 3FBWA 4L3WA 4Z49A 4DM7A 4IHAA 5AP9A 3KOOA 2Y6VA 3C43A 3EQ7A 4DMCA 4BE9A 2QKYA 4G5XA 1Q0RA 2HU5A 3STUA 2PSEA 3RLIA 2GYUA 5AKZA 3BJRA 2VJBA 1D07A 2VEOA 5AK4A 1MU0A 3DL7A 5LKAA 1EA5A 5LZ8A 2JGKA 4U2GA 1R50A 3VJMA 1B41A 5LZ9A 5AJHA 5IVIA 5AM2A 2RI6A 2HA3A 3HABA 2WJ4A 4KE8A 3ZV7A 2I3DA 2OXEA 4BTVA 2PX6A 5AKYA 4EA6A 3ZLVA 3WJ1A 4RE5A 2BKLA 5HFNA 3QPDA 1KU6A 3DS8A 5I9IA 1ODSA 1N8SA 4U2BA 1XZHA 3F98A 1PFQA 2X8BA 4E14A 1QIHA 2HM7A 2OCKA 4X6YA 1H2YA 1KEZA 3I2HA 3K2IA 2C58A 4I3FA 4QDXA 2RIPA 3GUUA 5EIAA 3V1LA 1CUAA 1MX5A 5IVHA 1SFRA 1ZIXA 4FNGA 5AIBA 4KRYA 1MAHA 1MX9A 3VVMA 3ESDA 3W05A 4WY8A 5FXMA 2BUBA 3WA6A 4RPCA 1QTIA 4OD0A 3LP5A 4J0IA 4UBIA 1QFMA 3ED1A 5T4FA 1TIBA 3WKEA 2DFPA 3HRHA 4OPMA 2DSNA 1JMKC 5DTJA 3BF8A 4HXGA 2OGSA 3IURA 4L0CA 1H23A 3DEAA 1N5MA 3BIWA 2Y1KA 3OURA 5CXUA 2QJWA 1XQXA 5ALNA 2O2HA 5CH3A 4H35A 2NW6A 1WHTA 3PDCA 3LLCA 2WIDA 3BJMA 1P0QA 3WL8A 3QMMA 1UK9A 2OCLA 1XRQA 2EDCA 5AM3A 2QT9A 5DTIA 4X92A 2BGNA 4KYVA 5HK8A 2X76A 2CMFA 2E3JA 2DQYA 4B0OA 2WIJA 3UUFA 1YAJA 4N8SA 4EY5A 1AUOA 5JAHA 2JGMA 1J2EA 4AX4A 3TJMA 5AK3A 1K8QA 3HLKA 3HC7A 3QBJA 3B5EA 2WJ3A 2C0QA 4OYLA 3G9XA 1BS9A 1XZGA 4JEIA 3IIIA 3PF9A 2C4HA 1VXOA 4BAGA 4K6KA 2VF2A 2PPLA 1GT6A 3C5WP 3DL4A 5HF9A 2BUAA 3G7NA 4M0EA 1VJ5A 5C7YA 1JJIA 4NVRA 4C6HA 3AUKA 4BP9A 2HFJA 3A6ZA 3I2JA 5HQ3B 1E8DA 4DLNA 2WTNA 3WK9A 1RWQA 3M82A 4IQ4A 2WG1A 2XQKA 4GHWA 4HXEB 3KXPA 1CUCA 3HJUA 3LS2A 4INZA 3IA2A 1UKAA 3CCCA 4P9NA 1SOMA 5CH8A 1JFRA 1E3QA 1EK1A 1ZJ5A 5CTAA 2HA6A 1ORWA 2XQJA 5BWBA 4X90A 4H7EA 1UKCA 2I03A 4CCYA 3EQ9A 3WZMA 3FOBA 3I1YA 2HU8A 4X91A 4XVCA 4G8CA 2R11A 2VJAA 3R3WA 3VJKA 3CN7A 2WG2A 3D2BA 1K5PA 3STTA 1WPXA 1EDEA 1T4MA 5DYYA 4ZI5A 2B20A 5JZBA 4ARAA 1CFJA 3QH4A 1XKTA 3WIOA 2HA2A 1JU4A 5E4TA 3O4HA 4LYEA 5C81A 3B12A 1QIEA 4AN1A 1CQWA 5AKHA 2DQZA 5K3FA 3OTQA 4FNMA 4AMZA 3O9MA 3E3AA 5AICA 3SX4A 5DLPA 2XUFA 4I4CA 1RYYA 1CPYA 2XMQA 3PE6A 1UKBA 2PSDA 2GYWA 5ALTA 3ZWQA 4BAZA 1A8SA 4CFSA 3DLTA 4H18A 5AKLA 1EX9A 3F9CA 1VLQA 1XZAA 3VKFA 5ALRA 3UUEA 1MX1A 4N8EA 1WB5A 4J0DA 1QO9A 4LHEA 2ZJ7A 1HL7A 2P8SA 3ESAA 3R41A 3WWPA 4B82A 1TCAA 1ZD2P 2FX5A 5FV4A 4BVJA 1NX9A 3ANSA 1XRNA 4B7ZA 4J0HA 1YS1X 4BVKA 2RHTA 1CR6A 2XUIA 5FRDA 5E4JA 2OGZA 3PUIA 3C6YA 5AKEA 4GBGA 3H2IA 3B3QA 1YB7A 1DINA 4UHCA 4X97A 2AJDA 4X6UA 1GQRA 4A5SA 4GI1A 3GA7A 1XZKA 1QIKA 1A7UA 2HRRA 2PSHA 1XKLA 1G66A 5JD6A 2PVSA 1CUJA 2Z3WA 4KJXA 4KE9A 2D0DA 1QFSA 4FBLA 4V2IA 2YYSA 3AIMA 4Y2QA 1YAHA 2Z8ZA 4H7IA 4C4XA 2EDAA 1F0PA 1E89A 2Z3ZA 3ZI7A 2PL5A 2X5XA 2XUPA 1BEEA 1JJBA 4GWLA 1FFAA 3O0DA 3C87A 1HLGA 2ZJ6A 3ICWA 4MWSA 4X95A 4J0CA 4MWTA 3R40A 5IH7A 1AMNA 1CIJA 1WCYA 1ZJ4A 3YASA 1UZAA 1WB4A 3AJAA 3GZJA 5HKBA 5HCUA 2YH2A 1VOTA 4RE6A 1ZD5A 3WL6A 4Q3LA 1EDDA 1AKNA 4FBMA 5AM4A 4HAIA 4XX1A 1W75A 1W4LA 1XRMA 1MTZA 2PM8A 4X00A 3I6ZA 1VXRA 3WYDA 3BWXA 1FSSA 3IULA 3WL7A 4AO6A 1H22A 5T4HA 3O4GA 2WU3A 4HRXA 2CUTA 4ZV7A 4FDMA 4B85A 1E8NA 4N5HX 4W1QA 2XUAA 5FLKA 4J0JA 3DYIA 3WK5A 3D7RA 4NMWA 5ALPA 1U2EA 2O7RA 1EB9A 5E4YA 4Y2PA 5I8PA 5ALKA 2VAVA 4K6GA 2IIVA 5FP0A 4DMHA 1DQZA 4QA9A 1IUPA 2HHAA 3QM1A 4DSAA 1SCIA 1YA8A 2WSLA 4HZGA 1YCDA 4ROTA 3JWEA 1BCSA 1XZCA 1UK8A 3V9AA 2ES4A 2QUBA 1JI3A 1L7AA 4BVLA 4W1PA 1XZIA 4FHZA 3BE8A 5JYCA 2HIHA 2G4LA 4ZREA 4EY7A 3IUJA 1MNAA 5ALSA 5A7FA 4ETWA 3G0DA 4FMPA 2QMQA 3HXKA 2O2GA 1EVEA 4YASA 2H7YA 4DMKA 2J4FA 1ISPA 5T4EA 1DWPA 4QNNA 5FOQA 4UBLA 4W63A 3DKRA 5D6OA 3DKKA 4QDOA 3GFFA 3D3NA 1OXMA 4D9JA 1XZEA 1H2ZA 5DNWA 2C5GA 2WU4A 5A7GA 5AI4A 4TVKA 4UFPA 1FFEA 2FJ0A 4C88A 4MEBA 1KU0A 2J4CA 1QLWA 1FJ2A 5HFAA 3ESBA 4G4JA 5ALLA 2D5LA 1CUEA 2CJPA 4JUIA 3F97A 3M81A 3N2ZB 1ZI9A 4Y2UA 5JANA 4U2FA 1G5FA 3DOHA 2VSQA 5EI5A 2R8BA 1X2EA 4UBNA 5KREA 2WHPA 4LXIA 1T2NA 2PU5A 4X93A 2ZSIA 2PUJA 3H18A 4KE6A 1YR2A 2UZ0A 2ZVDA 5K3DA 1QZ3A 4WJLA 1ZI8A 3WK6A 3NWOA 5A62A 4L9AA 1S8OA 3DQZA 2QRUA 4QEKA 2J3DA 1CUFA 3H0CA 1WHSA 3C6XA 4HVTA 2ZJFA 4IH1A 3UMJA 1CUDA 4B6GA 3SWWA 4OB6A 2WIFA 4OU4A 3DJYA 2FJPA 2B9VA 4AO7A 1ZI6A 1XLUA 3DD5A 4DNOA 4X7BA 3E4DA 5AH0A 3WK7A 4UFNA 4N8DA 3STWA 1TCCA 2C7BA 4TGLA 4OUKX 2QJRA 4BDTA 1BN7A 2WHQA 2VT6A 1ACLA 3QPAA 5D7BA 2OAGA 1BN6A 1HDEA 1GKKA 4QDZA 4AB1A 4AZ3A 1W6RA 5LP1A 4W1SA 1IUNA 2VT7A 1CQZA 3D0KA 2CZQA 4J7AA 5ALUA 1YASA 3SC2A 4BBZA 1LZLA 4C87A 4AO8A 2HA4A 4YX9A 2B61A 2WHPB 3F67A 1HPLA 3V1KA 1JKMA 1TKRA 2ACEA 3F96A 2G5TA 3STVA 2GZRA 3IB3A 5H3HA 3V1MA 4PNZA 5JADA 3WZLA 2H7XA 5LZ7A 4ZRDA 2V96A 1W1IA 1XZLA 4WFIA 4AN0A 3D2CA 1F0NA 4MJ3A 4UHBA 4Q1VA 2AXEA 2VA9A 2RHWA 5ALQA 4A23A 2K2QB 1CUYA 3CXUA 3FLAA 2GZSA 3NGMA 4CCWA 1VE6A 3ANTA 3MUOA 1OCEA 1I6WA 3WMRA 4KE7A 3DCNA 4B9EA 1MJ5A 4UHEA 4FLFA 3I28A 4B84A 1Q0ZA 3C6BA 4Y7DA 3CCBA 4L72A 4BRZA 4E15A 4CG1A 5FKJA 5ALXA 5JAPA 4G8DA 4LKOA 4OCZA 1GKLA 4MYDA 4OB7A 1W52X 4DSZA 1Q83A 2OPHA 3WWCA 3AZOA 5FPQA 2HA5A 4JNCA 5A2GA 3HZOA 3PI6A 2O2IA 4QLOA 5LZ4A 3VISA 2XMRA 2WUFA 5KWIA 1XROA 3CN9A 2Y6UA 3G9TA 4RNCA 1CLEA 3D2AA 2XUOA 2V9ZA 3U1TA 2XUQA 3FSGA 1THTA 3IDAA 4H7HA 2BAGA 2IX9A 4ZV9A 3WA7A 3M3DA 1QJ4A 4X94A 3QYJA 2ONCA 4BRSA 1DQYA 4QDUA 3T4UA 1LPPA 2OG1A 1BEZA 1ACJA 3H19A 4B9AA 2PKYX 3C6ZA 4H7JA 3MGAA 3KWFA 3AIKA 4UBOA 3D4LA 5EGNA 4Y2TA 1LPAB 1E5TA 3DOIA 5CRIA 2QZPA 5DNUA 1YB6A 5CXXA 4E11A 3O9VA 2DHCA 2RGUA 2WLSA 4XWGA 2GBFA 4EY8A 2XMGA 4ZXFA 1EVQA 3NUZA 1Z68A 1E8MA 5AM5A 4GDMA 4JYPA 3FCXA 1NU8A 1XRPA 3QZUA 1G42A 3IUNA 4BC1A 3BDIA 5ALJA 3WWEA 1C7JA 5FUMA 4GLBA 4Y2VA 4B81A 3L1HA 4G1FA 2VJCA 4RGYA 1WPRA 4IH9A 4Q05A 2AJ8A 3PUHA 2GBIA 4YK7A 4BZWA 3FYUC 4BC0A 1XQYA 2ZYIA 5AHXA 3R3UA 4CIAA 4X6XA 3I6MA 3FYTA 1LBSA 2VJDA 4OB8A 5KWJA 1CUWA 3G8YA 5K5EA 4WCVA 2BJHA 2CBGA 1R9MA 1YS2X 4EY6A 3I6YA 1TRHA 5ALOA 1XZJA 5A7HA 1O6GA 2XLCA 3BDVA 4WDRA 3ICVA 3VDXA 1IVYA 4F5ZA 3MUNA 5JARA 5AO9A 2WHRA 1H2WA 5AI9A 1AGYA 2DHEA 1SC9A 1X70A 1MO2A 4M0FA 1XQVA 2GBCA 1C4XA 2QXUA 3HACA 5LIPA 2BGRA 2WG0A 3BXPA 1GQSA 4BATA 2VQ6A 4Q82A 2I78A 2WFZA 1EI9A 1K6EA 2VTVA 5ALVA 1VA4A 4G9EA 3EBLA 5DNVA 4YPVA 1XZMA 4C4ZA 3R3ZA 3A2NA 3W9BA 1MAAA 3AFIA 2RONA 4EB0A 3I2FA 4BTLA 3L1IA 4CG3A 3G02A 2XT0A 3M83A 5ALYA 5I7UA 2WIGA 4FKBA 2RAUA 1AURA 4G4IA 5K3CA 1VZ2A 2ZSHA 3P2MA 2HFKA 2XLBA 4B0PA 2PUHA 2XUGA 4DTCA 2WQZA 3Q0TA 4J0KA 3C8DA 1ETHA 4FLEA 4GECA 5JAOA 3VXKA 2XQIA 4A16A 4P93A 1TK3A 7YASA 4H7FA 1C7IA 3LIPA 3H1AA 3FVTA 3I2IA 2XDWA 4BYMA 1CV2A 2WUEA 4PQEA 1PJAA 5CBKA 5CT6A 3MVEA 1DU4A 3RARA 1J07A 1NU6A 2CKMA 2XMDA 4FFWA 1QIMA 2ACKA 5E2IA 2XUDA 5ALWA 3EF3A 2JEYA 1LZKA 4H0CA 4C4YA 1J06A 2JGFA 2AJLI 4IH4A 3H2KA 5AKIA 2J3QA 5HF6A 5K3AA 1ZICA 4K2AA 4LYDA 2V97A 5KBYA 4J03A 1UT6A 1XZBA 1IZ8A 3NOXA 5AKXA 2V98A 4QWMA 4U2EA 3L1JA 5EIHA 2QTBA 4O08A 3PFBA 2GBGA 1A8QA 5HQ3A 1UOQA 1IMJA 2HDWA 4NS4A 4DIUA 2GYVA 5LZ2A 1CRLA 1JMYA 2JGJA 4AZ0A 5AM1A 4UUQA 4FTWA 1GPLA 4C89A 4GEGA 1XQWA 3FAKA 4J0GA 1ODCA 3LIIA 1UXOA 5K3BA 5CT5A 1DT5A 4UHFA 5AOCA 4UHHA 4F0JA 3S8YA 3WL5A 1VA5A 5A71A 1XFDA 3TGLA 5AOAA 2ROQA 1QIGA 3G9ZA 3H04A 4G8BA 1HKHA 3FWHA 2WUGA 3O4JA 4XJVA 4ZGBA 1CUHA 1ODTC 5HK9A 3LCRA 3A2MA 3R3YA 1VE7A 2OCGA 2XE4A 1LGYA 3FLEA 3RK4A 1JT2A 1LNSA 4U2DA 4BZZA 2WJ6A 1ZOIA 4M0MA 4Y2SA 3BL8A 3X3HA 4FWBA 4MEAA 5JZSA 4EY4A 3WQHA 3IUQA 5K3EA 3GBSA 5AI6A 3WYNA 3G0BA 3WKCA 5C8VA 3KD2A 3V1NA 4X71A 2LIPA 2OLEA 4EUSA 4EHBA 1EINA 2JF0A 4U2CA 2Q0XA 1MNQA 2WUDA 5LKRA 1DTEA 4JYMA 1GZ7A 1CUSA 1ZD3A 1LLFA 5F4ZA 2IITA 2I3ZA 1QIFA 3H2HA 1BROA 1R9NA 5JIBA 1Y37A 3WKAA 4AQDA 4I19A 3STYA 1GXSA 4Y2YA 5CW2A
chains in the Genus database with same CATH superfamily
3BFKA 4BX3A 1VM6A 2GJKA 1QO7A 3HYTA 3ZHVA 4DM3A 4EK9A 2XY4A 2RHHA 3AHCA 1GN9A 1TU4A 1Z2EA 2PJUA 1DG3A 3RHTA 2VZEA 4QGGA 5KVAA 3VHLB 1FSPA 4F6RB 4U7FA 3M5CA 1ZN9A 1JG1A 1NBOA 1XXHB 3G8BA 4R8RA 5BYKA 3PICA 5KTPA 4OHCA 3CVXA 2FDXA 3UKDA 2HMTA 1ZD9A 1XLVA 4RVCA 1CIVA 3H7IA 1YTUA 2DCUA 2H3HA 1Y7IA 3LBNA 4I6JA 4UJ3A 2PX0A 2WFMA 4XB6B 3ZV4A 3WI7A 4B74A 1OASA 2XE7A 3V2UA 3WQRA 3OCZA 4DNXA 2AYYA 3GUCA 4Q9HA 4DG5A 5AVWA 4GVPA 4W5NA 1NXQA 2FSVC 4IDQA 1Z7EA 3RFXA 4BP3A 4DMGA 3IQHX 3NB0A 4HAWA 2ZDQA 4KAAA 4W1RA 4CQLB 3ILSA 4Q3BA 5B2ZA 5AW2A 2BW0A 3T7SA 3OJ0A 3PT5A 4OH1A 3V8QA 1ULHA 1WCIA 1X9GA 3UCFA 4EUSA 1VKHA 1Y9ZA 1EZ1A 5JC1A 3KE8A 4FZVA 4IMPA 5EZ5A 3PA8A 4OSEA 2AYZA 3TJZA 1MC1A 4JUAA 4RHEA 1XL1A 4FQ5A 2HA7A 3KP1A 3OM0A 2G70A 2QM0A 2VOEA 2VSYA 3MJSA 1HT1E 2AJCA 1JDZA 1SB8A 2CHVA 2G1UA 3VPCA 2ZTVA 2MDTA 3KEOA 1ND5A 2NU8A 3T5TA 5JXIA 3TRDA 3ZLBA 4YCNA 2ZJOA 5ALHA 3L0CA 3LHIA 4LOLA 4G41A 4MI6A 5ERGB 2G5PA 2BWJA 3FRJA 2P6UA 4G63A 1JIVA 1LQ2A 2JBWA 5AJTA 4BQSA 4V1CI 3G88A 3N2IA 1TUBB 1U8EA 1Z5VA 1P33A 2X1VA 2H2DA 3EGXB 3IGFA 3W7BA 1IQRA 3SS9X 4ZEXA 3UFXA 3WY9A 4B48A 1E9AA 2DQ4A 2DTXA 2Q4OA 4CQMB 3HV2A 4MWCA 1HDGO 1T25A 3E7DA 4KAJA 3FGPA 3TCKA 1AOXA 3OPYB 1H85A 4Q37A 1GPWB 4N1AA 1FNMA 1IXSB 4WESA 4EO9A 5K0ZA 1PEDA 3DBHB 1TMOA 2VNJA 5D85A 2DWQA 4XCVA 3CVWA 1UK6A 2BFEA 4ENPA 3F9IA 1VC2A 3A27A 4ZEOA 3FNHA 2V03A 5L45A 1U2GC 4ZOCA 5HF5A 1P9WA 1RYHA 1Z28A 1L8XA 3HY4A 4XQ9A 2XH8A 3HJNA 2ZUCA 2BFBA 4IVRA 5IFLA 1P5ZB 1A4IA 4YRFA 4DIBA 2Z95A 1T1SA 1CCWA 1RM4A 3D59A 2W2NA 4LOHA 3SQOA 2IY8A 5CMLA 3OCCA 4Q5IA 1RMYA 5ALZA 1U9YA 3A4TA 2NAFA 3OMLA 1NQAO 1QAMA 2MSEB 3EJWA 2FI1A 1G55A 4YJKA 2AEFA 3DOFA 5JSUA 1BE0A 2PXAA 3C8HA 5EKUA 3EZYA 4YRAA 5BYBA 1FRVA 1X94A 3P4YA 2OO5C 1I3CA 2CB9A 3FLBA 1W88A 5SYMA 1W5FA 3DZDA 2C9MA 3CF4G 5DYWA 5LP6C 3EIEA 3OLQA 4LJ4A 2QYSA 1R00A 4I4TF 1GFWA 1V3VA 5I7HA 2ZE8A 1ZD8A 2MTBA 3HBJA 3D31A 2IEGA 4MRAA 1UK7A 2YNMD 5I7WA 2X3YA 2JD2A 4GRIA 1D2HA 4NK5A 3GCGA 2C8VA 4MRSA 2FUKA 4R3NA 5BV2P 3BMOA 3L4KA 3VPXA 2NYUA 2G09A 2GF2A 1ADCA 1HZZA 3W5UA 1QV9A 1KMHB 3RS9A 2WRZA 4JJIA 4DLLA 2X7JA 3W2IA 4X20A 1ZSNA 3OP4A 2R84A 1U3TA 3KQVA 1OT5A 4A0SA 3PZRA 1VFNA 4BO2A 3Q88A 4MUFA 2LIVA 2YRXA 4FYJA 2W4IA 3FCEA 4ZQGA 1MG0A 1OTYA 3UXMA 4JA0A 1IM8A 3W5CA 2QQFA 2C5FA 2O57A 5FTWA 2VHYA 2E89A 3IP7A 2WU8A 3IAUA 4IEEA 3ZG6A 1E2JA 3LC0A 4JI0B 5DHFA 3LY8A 3LRXA 1ZM7A 3GMIA 1AQJA 2Y2UA 2Q45A 1CQXA 1J1IA 2VP5A 3IP6A 4UVGA 5A06A 2PUBA 4CCYB 3JQDA 1EGQA 1NY5A 2DKOA 3Q5EA 3QEMB 5J5CA 5KDDA 1C7ZA 2A1IA 3NWBA 1LPOA 4GBJA 3VQTA 4BNDA 4D4IA 5P8WA 1ZDMA 4YO8A 2VQFB 3VO8A 1M5RA 2VLBA 1ONPA 2ZK7A 5LQSA 4F45A 4JQSA 4D9MA 2BISA 5AW0A 1LV8A 2XA1A 4DIOA 1U8TA 4IDNA 3SZ3A 3ZJUA 5KYNA 2X0JA 3W1WA 5CDHA 5EPOA 5AFSA 3TW0A 2F1IA 2O20A 3VYTB 2OV4A 5JS1A 2JARA 3CBQA 4KYTA 4FU0A 5FB3A 3O8DA 4XE5A 1KK0A 3RS7A 3RNOA 2FQXA 2PZKA 3HB7A 3KPYA 3R6WA 4PC2A 1EWYA 3CXRA 3FSJX 1A4UA 4B45A 4ZWNA 4FOLA 3JRNA 4Y2JA 2BBWA 1CP2A 5AKKA 3ILVA 3LCUA 2QBYA 2CV1A 1WOYA 1WLYA 1D6NA 3AZPA 1W8IA 1O2DA 5F12A 1KOLA 2A0UA 2HIAA 3UK0A 3QEBZ 1QQBA 3Q3GE 3IV7A 3KXDA 5D3ZA 5DOVA 3TLKA 4C7OA 5JPIA 4RU1A 1S1CA 2QQ5A 3R5TA 3SYNA 3V5NA 4DOMA 3AUAA 4LFBB 3U1BA 2A3NA 3G2PA 3AP1A 3WQSB 1YI1A 3JWJA 1RLIA 4Y9SA 1F14A 1A5BB 2FN7A 3FTDA 4KGVA 1B93A 5BUSA 1X86B 1UDBA 2ZKLA 4PPFA 5J59A 3WKDA 1M7BA 5LLDA 3DXYA 3IT2A 3HDTA 2AFIE 4EWLA 1EE2A 4IJ5A 3QOXA 4LVOA 1A4XA 4GLFA 5CFNA 1ZWKA 4N5NA 1Z74A 1IRIA 3ND6A 5BN4A 3CNHA 5DEOA 1NURA 2I1LA 2W6JA 2PX2A 3E8MA 3WBBA 2XEDA 4LF5B 3TKLA 1K6JA 3FYDA 4JASB 4Z0NA 1YA4A 2ZPAA 4I4IA 2M6KA 4EVIA 5EN4A 4Z1OA 1IY1A 1P9LA 1Q1QA 1A8PA 1PK7A 1YL5A 1ZINA 4OEHA 2C3OA 4CV1A 3BL6A 3O93A 2GJAA 2VHJA 1JPJA 1P3Y1 1JU3A 1Z5PA 3D54D 1G2PA 2JRCA 1DWQA 1EFTA 2H4YA 4O5OA 4I2NA 3UOWA 3FYUB 4KO8A 4F60A 1IONA 1ODJA 2FP4B 2ZYSA 3ZXXA 5GZ1A 1NQXA 4UVIA 5FOTA 4AYTA 4MQUA 4BWYA 1LBTA 2HH9A 2P5YA 1P9OA 1UOPA 3NEYA 4A6PA 2LPMA 4J3JA 1I2BA 1VCHA 3ORQA 3ETGA 2Q2NA 2OCDA 2QAGC 5EJ4A 1Z38A 2RGDA 2VDWA 4KWTA 4DANA 1UPFA 2XUHA 3LVRE 4XQEA 3H7AA 3TSZA 3WRYA 2AQKA 2EW8A 4OM7A 4TLMB 1HYHA 1U7UA 3PNLA 1TADA 3EZLA 4V0QA 4NE2A 4D4LA 4M7WA 1C2TA 6GPBA 1XMPA 3HJCA 2B4YA 2C78A 3QI2A 3AESA 1N25A 2JJ1A 3KSDO 4PGHA 5IAKA 2PCJA 1ZZEA 5KSOA 4QL3A 1QKKA 3RTDA 3NH6A 4LDJA 2XUJA 4WZAB 4HCJA 2PLAA 3AOEC 3SE7A 4Z4QA 1Z0DA 3JYLA 1TGVA 1E1QA 3R5KA 3W7VA 4PW0A 2BSXA 4FFOA 5KQLA 1D1PA 1LJ8A 2DH5A 5AW6A 2PUGA 3CZ9A 2B2XA 3BMQA 3M1YA 4CT0A 1KI9A 5TVKA 1KSFX 3AZQA 1Z15A 2E0IA 1S2LA 3VPHA 4EKEA 1QV7A 4LX0A 3UEOA 2PT5A 4DV4B 3S44A 2B4KA 1HSOA 2C5LA 1JNYA 4ENWA 1ZR4A 3R6GA 2NV0A 4YDHB 3N6VA 3CW9A 1OXUA 3QUCA 4CU5A 1QHGA 5B12A 3OCVA 2D2EA 4H4CA 3TTVA 3D7NA 3LBFA 1EKXA 4Q34A 4XVRA 4LWOA 4A1FA 4AECA 2DHDA 2ECKA 2R7MA 3E1GA 3L9XA 2BN4A 4HX9A 4O1MA 3H2JA 1G21A 3R74A 2Q5JA 5CLLA 1NXSA 1PCXA 1UPBA 4I5IA 3GVPA 1HNZB 4BHTA 2ATIA 2FMFA 1C1YA 3OPXA 1YK1A 1PR6A 4HXFB 3RANA 1NI4B 4ID3A 1SIBE 2IVZA 3DLPX 4F38A 1NNSA 3NIWA 5EQJB 2I7CA 1I5RA 1OZHA 1OGYA 3HYSA 4N40A 3JAWB 4HB4A 4MGHA 4ARBA 5BNWA 3SVTA 1Z0IA 1L8OA 1UBRS 1UJMA 4PAMA 1B0PA 2G72A 2G77B 3IPXA 4JLSA 5HG0A 1P1JA 2CNNA 1AHHA 1UFOA 3O8LA 4F93B 1OFGA 2ZITA 3B1FA 4MV9A 5SYNA 5IF3A 2PPVA 3BERA 4DCCA 1DRWA 4UHJA 3ELUA 3KFLA 2A33A 1JX6A 1YO6A 4KLRA 4X3CA 2EL9A 4EFLA 3SVLA 5JH7F 1M67A 1DWOA 3WLLA 1ZMXA 2R8EA 1P2FA 1M1YE 4EATA 1ODIA 4K28A 1KQNA 4YRMA 2ZLBA 1N6RA 4GPIB 4D57A 4O2AF 1ANKA 3B5JA 3D6AA 4ZDIA 4J4TA 1PR1A 5BV0A 2GS9A 1X87A 1JDVA 3SGLA 4E5MA 3RKSA 1CYEA 3RG2A 5DYIA 1NTRA 5A5VA 2GN1A 5LN1A 5AKGA 1CULC 2WKWA 2XRFA 3LTEA 4QYSA 1W88B 4GXNA 2HSJA 3MIIA 5F33A 4OV6B 1YE8A 1ZW1A 3EA4A 5J2UB 3UJPA 5J4LA 3P71T 2ZB2A 4IO0A 4K6HA 1DFHA 2A5DA 2IUYA 4LJSA 4QPPA 5ED0A 3KYIB 1EUQA 5EXDA 4W82A 1GXSB 2Y77A 4QE3A 3DZBA 4JZYA 4NZOA 1SCKA 4YNBA 2FRXA 1SBQA 1M33A 2O2CA 4L74A 2AFIB 2NVUA 3H1TA 1YRAA 4JIMA 1XK7A 1KPGA 1TZKA 2GESA 2ZS7A 3FHTA 3C24A 5J9FA 4RXTA 4YRIA 1E5QA 2YYZA 4YJ3A 1SZDA 4D4HA 4WCDA 5KQPA 1HLPA 2Z5VA 3C3DA 4G0VA 2DVMA 1UINA 1PEAA 4IDFA 4DYHA 2OP1A 3BTUA 4KUHA 4OK5A 3HA3A 5H16A 5ER9A 1BMFD 3PE3A 3REGA 3OCYA 4IJWA 2EFGA 2VYQA 4MMYB 4S0XA 3QU2A 4WD3A 4WHMA 5JQGA 1CUXA 4I3HA 4DXDA 4ALNA 4EPYA 3KQHA 2DKFA 1PSDA 3WL3A 3EG5A 2FE4A 3TZHA 4ER5A 5JSZB 4AMYA 2QZ9A 1CHNA 2BCEA 2CFOA 1XVIA 3IYLW 3KZCA 4ZPJA 4WXPA 5FHQA 1F2UA 2RAFA 3FNIA 1RZVA 3A6KA 4TMTA 2PMEA 3S70A 2OSBA 1FVOA 4TZ0A 1O77A 2NU6B 2Q4DA 5KTNA 2A57A 2X9GA 1ZGBA 1QH9A 2I3AA 4URUR 5BSUA 1J1UA 1Y1RA 1OU0A 3KYBA 1JKJB 4BNDB 2GN8A 3K0FB 4MGZR 2GVZC 3UYKA 4TYWA 3U7RA 2G0NA 2HRBA 3QVOA 4MUIA 4NU6A 5DASA 2WFLB 1X1CA 3ZNPA 1Z6YA 2Z9CA 5UKDA 4BDSA 1GUYA 4PTLA 3K6SA 1HNXB 5EVCA 3U44A 1XMQB 3LPDA 1MAUA 1SY7A 4MR7B 5BSTA 3L8ZA 2BC9A 2RDMA 3T1NA 4G9GA 4CDNA 1ID1A 3DLBA 4YJGB 4G0PA 4ERXA 5F2KA 3QITA 2E18A 2O2DA 3C48A 2AF3C 5E8JA 5L3RA 2FSIA 2LV8A 3HI4A 4ID9A 4IDEA 4HBGA 4AC9A 1R6AA 4MA4A 4UTXA 4IO1A 2NTJA 5EE0A 2RHJA 5B1HA 1PF7E 3M9LA 5TS2A 4D02A 3IBGA 4QELA 1M2KA 2C3PA 3ZPXA 3KDAA 5EFZA 3MOIA 4G1VA 5I3ZA 2QRHA 2CWWA 4DJEC 4ECAA 3ND8A 2OAEA 4D3FA 1CQJA 1V7QA 2W22A 1Z0UA 2RSLA 3JSXA 4GWKA 3UWKA 3PF8A 2CJWB 1ZNYA 2EBFX 5CGQB 3VH2A 1LDEA 4AW9A 2I7DA 4ZHQB 4B1FA 4W4TA 1XCMA 3TIIA 1IOLA 1DS6A 1KP3A 1NLYA 4KK4A 4NJEB 1IY0A 4KXWA 2C3UA 3BGOS 3KKNA 4E08A 4O3MA 3U2QA 4P92A 1AA9A 1GLVA 3V46A 2IUFA 4CGYA 2ZYRA 1LX7A 3R3VA 3NIFB 4PTYA 4JUDX 2ERXA 2NXCA 2CVFA 3M6MD 2PRJA 1ZESA 3G1WA 2PZFA 2FSPA 5AK5A 3V7YA 2NZ2A 4AJ4A 2IOFK 1FFCA 1F7UA 1L1QA 1QOPB 3RFTA 1PHRA 1UDXA 1SBTA 2W6ZA 5LLSA 5C8XA 3GIWA 2ZWMA 4TKUB 2QM3A 4PSCA 4Q19A 5KYWA 1RRMA 2ZRLA 1D6SA 5GADl 3ZLUA 2DHQA 2HCJB 4W8HA 3F8SA 4RTJA 3TL6A 4OQNA 1N2CA 1XKXA 3M6VA 3I58A 4QVGA 3B6JA 3H8WA 1T8PA 3I8OA 3HB9A 4QDTA 5F5XA 1JFVA 3ZS9A 3TLZA 3DAPA 1AKRA 3IVMA 4BNYA 4MDHA 4DMFA 2W6NA 5IBCA 4M2LA 1WXWA 1LLQA 3MGCA 4R31A 1E3IA 2Q1YA 4UXIA 4D45A 4R1TA 5ITWA 3FOWA 1XI2A 2OCIA 3GLGB 2VHTA 1FB5A 3PXBA 4PSAA 2A9VA 2FWAA 4HQRA 1C3JA 5DO9A 1QH8B 1MJGA 1T8YA 3O95A 3R76A 2QXTA 3NORA 3VJLA 1ABEA 4B83A 5CW1A 1NBME 1VP3A 3PZBA 1U6KA 1Z5ZA 3KPVA 5G0SA 2AEMA 1CEXA 1EZZA 2NTEA 4ZT7A 3HJRA 3QHAA 1TF5A 5AIAA 3W8DA 3ZLTA 2X5NA 1O87A 2CUKA 5JU6A 2Q41A 3UUWA 4BO6A 1L4LA 2JA2A 4B76A 3O8BA 6YASA 1JT9A 2DWCA 2CLHB 3BE6A 4XDZA 3PEVA 3GFRA 1ATIA 1GM5A 4KPEC 4N6OA 2HCTA 4MXDA 4DQDA 3ZWKA 4YFVA 4OUDA 4BCCA 5IKPA 1PSZA 3B82A 3H5OA 2A0FA 4WCFB 1CY1A 1MPTA 2B69A 3EAQA 3ME5A 1RKUA 4TTQA 5ER6A 5FTMA 1PDWA 3DE6X 3BXOA 3EXHA 1RHQA 4MLZA 4L4SA 4RD6A 3JWGA 4O3FA 2FWNA 1JXAA 3O7WA 3U0VA 5DWVA 4ZAXA 2IDZA 1CZLA 4IY1A 4KX3A 4RQAA 3LZCA 2ECFA 3GN2A 2WE8A 4OYYA 4QQKA 3ND7A 2ZIVB 4N7JA 3MWJA 5JFGA 3E0XA 1BA2A 2PHZA 3K09A 5HNKA 4AZTA 2O6HA 3RUHA 1V1RA 3K96A 3EGIA 4RYLA 4DSNA 3B6IA 2X41A 3OE5A 4UAVA 4RTSA 2RGAA 4Q4AA 3QFCA 3SD7A 3U56A 2QUIA 1OB2A 2RKOA 2RBKA 2GGSA 2ZUVA 2F1RA 5CH5A 4G0UA 1IEVA 2MYNA 4NV0A 3TPZA 4HATA 4AXBA 4QUJA 4ZMBA 2D1QA 2O8EB 5TR9A 1U99A 1WY7A 3QBVA 4R5HA 4MQLA 1X8JA 3KSRA 3KVRA 2B34A 2IOQA 2EF1A 3N8NA 5ECGC 1K4YA 4ZODA 3FR8A 3ACCA 3H1BA 4TTAA 1MN6A 1PYOA 2QMOA 3DMFA 1NP3A 3ZUPA 2O8EA 1P6QA 3IR6A 4LHVA 1D09A 1MO4A 5G53C 1XZFA 3AY3A 3DE4X 3ZVLA 4L16A 1LB1B 4AY6A 4JP3A 3BA6A 3TAUA 3V8BA 1RJ9A 2GK6A 2J59A 1F7VA 4QU8A 3S2UA 1D1TA 3OTIA 4YRCA 1PWZA 2G83A 1W5SA 5T8KC 3U7QB 5IT0A 5CURA 1AQLA 2PBFA 2PSJA 3HCBA 4MWEA 5T41A 1V5GA 2DPHA 3OQ1A 4UOZA 5J2UF 2OQIA 4PZAA 3HRKA 5F7JA 1LI4A 4AX8A 1KK3A 2C8JA 1QHHB 4L7QA 4TOIA 2GF0A 4L28A 2J9FA 4LZJA 3PR3A 5AVRA 4IIJA 5B58T 2CT8A 5TPZD 1E94E 2A30A 4JEHA 3RKUA 1HQDA 1KYZA 1U0JA 3KEQA 2A2ZA 3SHWA 1ODKA 3FBWA 1W5TA 4L3WA 3FGNA 2QVXX 2BF4A 3A4MA 4IHAA 1TZCA 4LPKA 5AP9A 1RLMA 2GPSA 3DVLA 4DMCA 3R3HA 1KC3A 2PBZA 1YJQA 2Z0MA 1RZ3A 1HX7A 2QKYA 4BQFA 2WLTA 4C0BA 5AESA 2PSEA 2BEUA 3B89A 3PD1A 5KTRA 1NW9B 5KWEA 2RI1A 2ZR7A 2JK0A 3RLIA 2ZU0C 1K7FB 1NVKA 2WOOA 3FWKA 1TKBA 5K0LA 4D0SA 4YHHB 5LQMA 5IAAA 1YTLA 3H5VA 2GZ3A 1SVKA 4R2MA 5LXTF 3WMFA 1MU0A 4O29A 1R0BA 2LRHA 3RVNA 1FMLA 1K2WA 2O3SA 1W59A 1C0LA 5KNBA 4KMRA 2I1WA 5IM5A 2ZUTA 1JWLA 1DUIA 5EIBD 5FJJA 2ORWA 2EOAA 2CHFA 4LC0A 5BO5A 1KAEA 3A9WA 1K0FA 3P5BA 4IW3B 1VPTA 4JNKA 1S3SA 4Y9DA 5KNBH 2D1RA 4TN1A 5KKCA 2JGKA 3D0OA 2ZDGA 3ZOKA 5KHLB 1R50A 1R9JA 1V48A 4HYTA 2RI0A 3B9QA 4JP2A 4ZEMA 2O8FB 1B41A 3L0PA 4NU8X 1Y9AA 3W3AA 3N6XA 1UXGA 4E4YA 2AFRA 4QXMA 4LZZA 3N0XA 2VCEA 3AHFA 4TLLB 4UCFA 4EQZA 2ATVA 1AO0A 1LDBA 5E95A 3SJZA 4Q7MB 4YYZA 3H5LA 1AKWA 1MW9X 2GEKA 1EDOA 2RI6A 4LHXA 3HABA 3UAWA 3V8VA 4TRMA 1LK7A 4GVXA 4J0FA 4FSXA 5DNCA 4U7DA 4KX5A 3VU8A 4BTVA 2ID7A 2N75A 3E5HA 1BFDA 2J5BA 4M0KA 4LE1A 4JUBA 5L6MB 3RS2A 4DCVA 3DSRA 3UNXA 1MHPA 2OVBA 3IBSA 1R6TA 4KQFA 2PZJA 1Y8RA 1VKOA 1KU6A 4E21A 2HPZA 1BWQA 3H3JA 3KSAC 2GNPA 4BQOA 4HNGA 1VDZA 4YJDA 4ND8B 1OWMA 1B00A 2BE7A 2Z3VA 2CL7X 4HGQA 4HH1A 3JQRA 4JGIA 4LYJA 4LNUB 2Z04A 3M6UA 4PYMA 3T4XA 3T8YA 8AT1A 1ZJJA 4OX9B 3EXEB 4KKVA 4X9XA 1G20E 2BKEA 4X6YA 3RBVA 2PKQO 3EX7C 4NLLA 1W0CA 1D4ZA 2CW5A 3KB8A 3LPMA 1EX1A 1QHEA 2JI6A 1GQFA 2I6QA 2ZB8A 3I4FA 1H3NA 4PFSA 3GUUA 1X8KA 1UFQA 4B3HA 2BMVA 5H68A 5IT5A 4B3BA 1UJCA 2EYQA 2I2XB 2F64A 3OZ7A 3V8PA 1CUAA 2AOWA 3B2QA 3G8AA 3IHWA 1PYDA 3KXLA 3QYFA 4BFUA 3VNUA 1GZVA 2KJQA 4GT1A 1UBOS 5HS6A 1YVPA 2VZ9A 4KWIA 2B5WA 2KX7A 5TQ0B 3NHLA 3SS7X 1K3UB 1OYWA 4F4JA 4CM9A 1Z4NA 1EP9A 2QD1A 3V80A 4LZWA 4AZSA 4PVDA 4ZQBA 4PO8A 3TEFA 5ELLA 1MAHA 2J9FB 3CNEA 1CDEA 1Z5NA 2NQ8A 3IQFA 1M34A 3LTNC 2IXEA 1WABA 4BGDA 5A0FA 4U0JA 2QM8A 1ZD1A 3GCXA 5SZIA 4JHXA 4I7EA 1ZVKA 4MPDA 3C1TA 2JZCA 2BUBA 3BSFA 3WA6A 2G1JA 1XLTA 3O7MA 2BFDB 1UP4A 4L9SA 4EGJA 1RI2A 4F3RA 3ZGZA 3O1HB 4OJMX 1XXHA 3R5XA 3T0GA 5L4LA 1LVHA 3AKCA 2CCGA 3MCWA 5K1ZA 1YRYE 1XHLA 2FVXA 2I2DA 3FWPA 1G8JA 1QFMA 1WMDA 4INJA 4UVHA 1Y1SA 3IKLA 3OKAA 4YJ2F 5C80A 1CJUC 3JRXA 3AHIA 1J20A 3CUUA 2WJAA 5T4FA 5DRTA 3OHPA 1TIBA 2C4UA 4XTCS 1SUIA 2CXNA 2IZZA 7REQA 1R4MB 3EEFA 2FG6C 2J7KA 3E9CA 1KI3A 1IVNA 4PN7A 4HXGA 5KWSA 4AJOA 1UL1X 2R86A 4L0CA 4BJ6A 2J6BA 4BLUA 4CQLA 4UOEA 2ZJYA 3A3OA 3MRVA 4W8GA 5I4IA 1M72A 1OPRA 5IN5A 4YUVA 2YN4A 2Y1KA 3O03A 4KLZA 1N36B 1E0JA 4MKRA 4OLAA 1G18A 2O2HA 4ZVUA 4M9UA 4UPEA 3IXLA 1YUMA 2IOFA 1WHTA 4RD4A 2Q1UA 2ZIAA 1JLSA 3QJGA 4H1HA 4XGKA 4YV1A 3DFKA 3LLCA 4KO2S 4WKOA 3QUSA 1RC8A 1T4GA 3GPDG 3NAQA 3AW8A 1G7SA 3D9QX 3GRFA 1AF7A 2GRUA 1GQ2A 4TZTA 3TFOA 2QVYX 4C2AA 1OX4B 4ZAGA 1YBHA 2O3UA 5T57A 5B6JA 2P30A 3EH1A 4PHTA 2XF2A 5SY6A 4ZAFA 5J40A 3SZMA 3ST7A 1I13A 3GU3A 4ZVQA 1YRLA 1JEQB 1ZYUA 1AY0A 1UK9A 1M8JA 2OCLA 3D6NB 4M9XA 4MLDA 5JSYA 1NVFA 2JL1A 3BCUA 5THQA 4YQFA 5CVTA 2EDCA 1ZCZA 3GPBA 4BGUA 3GDGA 2VQSA 5P21A 1C9KA 2QT9A 4M46A 1TZ2A 2FP3A 3PK0A 4NU5A 5FWXB 1TW3A 2AQHA 1IBKB 1JBQA 3KB2A 3MK31 1LD3A 3B3FA 4QBHA 2RHCA 1XZQA 3MIZA 4DMLA 4CLXA 3UGJA 3DPUA 3PUJA 1AUOA 5TS3A 4WLEA 2WYVA 3DA8A 1VKZA 4B44A 4EY5A 2Z6QA 4M1EA 5AK3A 3TJMA 3A6DA 5FEUA 4LDQA 1POWA 4P4NA 1CS0B 1F9EA 2INGX 3HC7A 3EZGA 3NIGB 4JJEA 2AIRA 1FFXB 3B5EA 3K15A 2WY2D 4DMRA 4C7BA 3CV3A 1B43A 1YZ3A 5ABPA 3OWHA 5I9TA 2A14A 4MTCA 4OYLA 2JCVA 2ZJAA 3U1VA 3C1AA 4A0FA 2F55A 2YUIA 4G4SP 3IIIA 2FFRA 4Z0TA 1VXOA 4FI3C 2H16A 3E81A 5BV8A 5K0NA 3TL3A 1E6EA 1GTRA 3RJTA 2D0PB 2Z58A 3ASYA 4M1OA 5KHAA 2PLWA 3BRSA 1M34B 2XWBF 1ZUHA 3DL4A 3LHKA 3RROA 2PS1A 2KYRA 2FSHA 3BIOA 1OI3A 5HF9A 5D5PA 3TNFA 2BUAA 1KH2A 2EJCA 3G7NA 3OBBA 3LGXA 3CPSA 2ESRA 3V4RA 3CEMA 4I46A 5DGHA 1JJIA 1Z0FA 3O3MB 1MFZA 2Q2VA 2AV6A 1ONOA 3A6ZA 3O73A 4BNFA 2I2WA 4RD0A 4XLZA 3ZUGA 5HQ3B 2IYSA 3L41A 4BNJA 3CM0A 3FDXA 2POQX 2R1ZA 3IV9A 4IQ4A 4RFSA 1CZKA 4H6VA 3W0LB 4EPXA 1YJAA 5BR8B 2WG1A 5DBFA 3F6YA 2XQKA 3CIFA 2BGLA 2QVLA 5H4HA 2GM9A 3SOZA 3WLHA 4D6PA 4GHWA 4DQXA 2AKEA 4K05A 1PLKA 1VPDA 3K53A 3RJZA 3T3PB 3TGWA 5IYZA 2Q6VA 4JROA 1RXWA 4BEVA 2JIPA 1PJZA 2QIPA 1QPGA 1EVIA 1B74A 1E2PA 3P9KA 4GR5A 4INZA 3CCCA 2PKXA 3K0EA 1NM5C 4Q15A 3ZWWA 4G0OA 3AG6A 4IDCA 2UYHA 4AQ7A 1ZHOA 3FTFA 2F00A 2W90A 4ICIA 3T7CA 1EK1A 1ZJ5A 2YZ7A 1Z36A 4K9NA 4Y9TA 1LRJA 4FM9A 3FMFA 4Q9DA 3UMGA 3URKA 3T4PA 3U62A 2HA6A 1H9CA 2WD7A 4ZVSA 5FPKA 1ORWA 2IUTA 4DE5A 3BWBA 4BFVA 4GRAA 4XB1A 4H7EA 1VRVA 3JCZA 3G79A 4XI9A 1HE4A 3DUWA 4CCYA 3EQ9A 3JTMA 4WQMA 3WZMA 5COAA 4JFRA 1SXJA 1L4EA 4PRZA 1ZFNA 2Q3HA 2VFAA 4G8CA 1YV9A 4FYPA 4JBWA 3TUIC 2O54A 4IOJA 1RJGA 2D1YA 2G7MC 4CF7A 3Q40A 2ZJ3A 3INNA 1U7HA 4TMXA 1RPTA 3NH9A 2B8TA 2JKZA 1XOIA 2QX6A 2ZSDA 3FPAA 2ZT6A 3R7SA 3UJ6A 1ZKDA 5BNTA 1QCDA 1SKBA 5GQSA 3R8XA 1SUEA 2F1JA 4J90A 1NVAA 2BEWA 4DQKA 1FJGB 5FPYA 2H92A 2OBYA 4GICA 3ANNA 2ZATA 1QCZA 3JV7A 1ADYA 2V55B 4HDMB 2NO1A 5DISB 5IEBA 4B2YA 5MDHA 2Q0SA 4DLAA 3DAFA 5DYYA 3HXQA 1NMZA 1Q92A 2BT4A 1H42A 1BVYF 1Y7PA 4CN9A 5AD1A 3QH4A 1SO8A 1DC5A 2FSFA 2P7IA 5DP1A 2QX8A 2VP4A 3TLXA 2UUCB 1YS6A 2FPIB 4QXRA 1GTSA 3FTEA 2PZEA 4NCNA 3GH3A 5K0JA 1JU4A 2QL6A 3LUJA 2COEA 1QYCA 3HGMA 5TC4A 1L5GB 3O4HA 1Z6PA 2XNKA 3BCRA 4R2KA 1G3MA 1WXDA 1W2WB 3PDJA 1QIEA 4AN1A 5F23A 3I9JA 5AKHA 4XD7A 5JWHA 3IIEA 4FYKA 1NKSA 1RBYA 4A2QA 1EWQA 2NLOA 3PFHA 2A5LA 2QM7A 3OTQA 4OHBA 3URMA 1U1GA 2LR0A 4FNMA 4ARUA 5I4KA 5I5EA 3R0XA 1JQAA 4NICA 3ZQ4A 3E3AA 2A5JA 3NOVA 3TW8B 1RBZA 3HO8A 3L93A 4DY6A 5KSZA 5F98A 4PSKA 1A2KC 3CLUC 2P0EA 2JLCA 5LMZA 1C1XA 2C2BA 2AX4A 5U9CA 1Y3BE 1OOEA 3PE6A 3GPLA 2OFPA 4NJMB 4BFZA 1WMEA 1DE0A 2PSDA 4GMXA 3TW4A 5F1PA 5ALTA 9LDBA 4FX2A 1XDWA 2GEVA 4BAZA 1Z33A 2AR7A 2IPNA 2E82A 4RK6A 1FPMA 1YDHA 4CFSA 3DLTA 5K8UA 3OUZA 1FTSA 1CQPA 4HQ6A 5AJVB 2OCBA 4Q66C 1FYVA 1P7YA 3EXAA 4DV7B 1MRZA 3P1JA 2LW7A 4Y18A 1SVOA 3PQFA 5D6NA 2VTBB 5LDHA 3VKFA 1X6VA 2QRJA 4KMOA 3GEGA 2YXBA 5ALRA 4D7AA 5FAKA 1MX1A 1ZXXA 1XN4A 4QJ5A 1QH1B 4N8EA 1TK2A 3X1YA 2P9GA 3N8KA 4WGFA 2HJSA 3F6EX 2F1OA 2RH4A 3IUPA 3IQGX 1HL7A 2VHQA 2O0LA 3EUEA 5B53A 4UQLA 3OIWA 4L5IA 1NIJA 3MSXA 2J6IA 3R4CA 1QHXA 3RSZA 1QE0A 3FBGA 4XD2A 1A77A 2VRBA 5DBIA 5E9JA 2W0MA 1MEEA 3WWPA 3PP8A 3EVDA 3IAEA 4P7FA 4UAJA 1NX9A 1MT0A 3OEHD 3O5AA 1Q7BA 4TL8A 1YS1X 5JCJD 1T2EA 1Y6ZA 3GRRA 4HAUA 4L6AA 1DTWA 4JN6B 1U90A 1NNEA 1Q57A 1ISSA 1B1CA 1UXIA 2A84A 4DSOA 5K03A 1KDPA 3KFXA 4QUBA 4OREX 2HWKA 5F3DA 3VTFA 1KQFA 1LC3A 5IASA 4A8HA 4W6QA 2Q1WA 3CF4A 2CK3A 1Q1ZA 3DOOA 3PUIA 1E4VA 1KDZA 2VTDA 3PDIA 2EV9A 1J0DA 3FX2A 3C6YA 3IP1A 4D4MA 5KTKA 4CEJB 5AKEA 1GSAA 3UBTA 4GBGA 3H2IA 2ZAGA 3B3QA 5GJVC 1YHNA 1D8AA 1KDRA 1YB7A 3TVYA 1RXEA 1TM1E 4UHCA 4X97A 4YRDA 3SC2B 4MS4B 1I7DA 4Q00A 4Z0HO 2Z5FA 4BU1A 4E5YA 4GPTA 4EAQA 3B6KA 2DERA 1UBKS 2VHXA 3PENA 1HEIA 3WSVA 1RPAA 3KKMA 4Q7JB 2ZRKA 2JHCA 2WT4A 1M7GA 2J5QA 4QOSA 3SMQA 4ND2A 5LUBA 4L4RA 4UTNA 4RUKA 1YDMA 2RGYA 2Q9BA 3KZOA 4KG7A 2X1HA 4JC4A 1RMTA 5U4QA 3BTSA 3CT4A 4H3KB 2OK8A 1Q77A 2CXHA 3E2IA 1WMFA 3KUUA 1CUJA 4ZMRA 4RFLA 3FHJA 3LKZA 5BXQC 3OUTA 3DJFA 4KE9A 1V1RB 4XWOA 3IVAA 4BVEA 4E4RA 3DVQX 3TWOA 4L51A 3GMSA 5C35A 1AK9A 3OQIA 3PWZA 5ARCA 4B6PA 5EWJA 4IYJA 1B76A 1WF3A 3E9RA 3HKBA 3TIGA 1VMDA 3N74A 1E89A 1LKZA 3E82A 3EC2A 3WSTA 2F3PA 2WQ6A 2XGSA 2UUBB 4CETA 3MYRA 4L8VA 1EVLA 2WJZB 4MMXB 1G1AA 1X0XA 1I3LA 3KYDA 2WNIA 4QTYA 1F60A 1BEEA 1JJBA 4GWLA 4FMDF 3V7NA 4COKA 4IX1A 5J5VA 2OECA 3C3CA 3DMRA 3KKQA 4MWTA 2V6GA 3FOCA 4HGPA 4MVXA 3IT3A 4R2HA 4B75A 1RHUA 2QORA 5DBOA 3R9XA 1NXTA 3BH7A 4X1IB 4ARZB 1AMNA 4EQ6A 2YWFA 1EFVB 3COVA 1CIJA 2A58A 4M53A 3EHDA 4TYQA 3JQEA 1KJNA 1ZJ4A 5IX8A 2Z08A 3UUGA 5I45A 4XUGB 4OXNA 3UN1A 3DXZA 1ZSVA 2BDEA 2AVNA 1WB4A 4FNAA 4Y6OA 3ZTTA 5JAZA 3GZJA 3VHRA 3Q3HA 1JAYA 4V39A 3LH5A 1ZOSA 3HVUA 3L8EA 4GVLA 5G2OA 1VOTA 3SSAA 5FOUA 5L3SA 2FCAA 4CU2A 3CVVA 1QZXA 1ZD5A 1L4YA 3U4IA 4FOTA 2P3LA 2XX3A 4G1BA 3HXMA 4LRQA 1CLUA 3OFSA 2QLMA 1IG0A 3P2OA 5EVJA 2BEJA 5AM4A 1RR6A 4ADSG 1BHSA 1P2GA 1L5WA 3G2JA 1VE9A 2FLVA 3SIRA 2PM8A 1XRMA 5KJ6A 3K8QA 4KLAA 3T7RA 4X00A 3SI7A 4LMRA 1Y82A 3ZH2A 5K0EA 1SIWA 3WYDA 3VU3A 4D46A 2YFQA 4FCVA 4G86A 1RKQA 2LP4Y 1UWVA 3NASA 5T4HA 5IAOA 1E6WA 4EX7A 3TTXA 2WT8A 4EB6A 3A25A 1O1YA 1Y81A 4HPXB 3IH5A 3G2LA 2DT8A 2Y71A 2FFQA 3LUDA 3LK6A 1FEZA 4ZQIA 2ADMA 4UDYX 1N5LA 2XOEA 1I0IA 2C77A 2XTNA 2DT5A 5J4VA 4CDMA 3G85A 1C8VB 2PS0A 3D4NA 1QG0A 1I10A 5LB2A 1T0HB 1FLNA 2O2JA 1SU8A 2Y1EA 3OE7D 2JBAA 1RM3A 1V8BA 1Y34E 3D7RA 4M0DA 3NKVA 4AKSA 3QKSB 5EJ9A 1U8CB 3COWA 5E4YA 5LVAA 4ER6A 5E4FA 1Y3CE 1YKFA 4RL6A 5FORA 9LDTA 4DLZA 4TTRA 2WU1A 4OSPA 4MRVA 4RKYA 1SCAA 4LGCA 4CKBA 2I2FA 3ZVKA 3ANXA 3VNRA 3A06A 5LWQA 4ZQEA 1TTTA 3S2FA 5LDDC 2ETXA 1PSWA 3FAZA 1T9GR 2R97A 3HK2A 1C9DB 4FFSA 3T5PA 3Q7SA 5LA6B 1WZUA 1G59A 1QOQB 5IUKC 4FE3A 3V9AA 3MTGA 4Q4CA 4FK8A 1J21A 2JLAA 1KMCA 4MIOA 2NP7A 4L8YA 5TDHA 4JB3A 3DDWA 2WJWA 1FUYB 4J9UE 2CWDA 1YFZA 3PUWA 4G24A 2Q46A 4YCCA 3SBXA 1IWPB 5T3YA 2MCFA 1XZIA 1C1DB 2R7LA 1ZSYA 2BR3A 3BE8A 3NGXA 1A71A 3OAAD 1CSEE 3OOEA 3FTPA 4MQ4A 4QRIA 4BEBA 5JQWA 1QJCA 3GC6A 3ZGXA 1JAHA 3T9DA 1N33B 1DQSA 1L4FA 5ECYA 1I7SB 3IUJA 1EVYA 5ICMA 1J6UA 1W47A 2VQ3A 4WN9B 3TW8A 3WSWA 5I51A 5BSWA 3FTQA 4NYIR 4Y8VA 2XPCA 4KPGA 2OD2A 3EBPA 4R1OA 3G0DA 3GA5A 5F1YA 4EOGA 3BMNA 4OXXA 4UJ5A 2QMQA 1BE8A 8ABPA 1L7DA 2O2GA 1Q7TA 1I1NA 1QB8A 1Q0SA 2NSYA 1TA4A 2OD7A 3F8TA 1XNJA 4HDRB 1TLTA 5HJEA 3QY9A 3KQTA 5H3LA 2H7YA 1HXHA 1A95A 2GMWA 2FZWA 3SXPA 1IPHA 4DMKA 5KMGA 3AM5A 2W2OA 2ZI7A 4I55B 3KO8A 3VH4A 3RT1A 1K7EB 3JVUA 1WX1A 3AEUB 4M9QA 3VTZA 4EELA 4CUKA 2JFZA 3VSCA 1R12A 2RK4A 4LMAA 5C3UA 5KCZA 1E4OA 3OMWA 2B25A 3AR5A 4YUXA 4PLPA 3WNZA 4P0TA 3VSEA 3GFFA 4KR3A 4RAQA 3SQWA 3OO1A 1OXMA 3WIVA 2WKRA 3COYA 3ICQB 1E3TA 3FNQA 1VYUA 3JVVA 3WXBA 1BS1A 2JASA 4R8MA 4NYJQ 1XFAA 2M6LA 1XPUA 1AV7A 3WNBA 1OE0A 3ER9A 4D9KA 4KO4S 5DNWA 4PYLA 1ENOA 1MH1A 4D92A 1T35A 1E9RA 1B16A 2WJJA 4IDHA 1ZVVA 2QJFA 3PDHA 4RH0A 5A7GA 1ZL0A 4B71A 4UFPA 3R7NA 4MZXA 1QF9A 3WLRA 3B1ZA 1MJHA 3GJXC 3IHKA 4GE3A 4LXQA 4PYKA 2J4CA 3GJ0A 1QLWA 1QUFA 3L8HA 4G4SO 5BSEA 3DEJA 5HFAA 5F9HA 5BVGB 5BW8A 1LX6A 1AKVA 4AJNA 4ZAVA 3TBFA 2XITA 1PV2A 1EX7A 1ENYA 2OO3A 3GL9A 3LBYA 2GEFA 1QANA 5B7PA 3FPSA 2JD1A 2QX9A 3GA0A 4RF2A 9ATCA 2YWXA 1KVTA 3CB4A 2MYUA 1PDOA 4MV8A 4KXMA 4HAZA 5JANA 5BNIA 2OHJA 1Y8QA 1EHIA 1G5FA 4J8PA 2WMOB 5FBHA 2VSQA 5BW5A 2VQDA 3LUPA 3PVSA 3GUVA 4OHFA 3RVJA 4D9GA 1FTQA 3DMGA 5H59A 5CA0B 2PYDA 2G9RA 5JXHA 2ZSAA 4IG4A 5CYGA 3OD5A 1TJYA 3DBIA 721PA 2DU8A 3VC7A 3ORSA 2NZXA 4TV8A 5C1DA 2TSYB 3LAWA 4MQ5A 1R0WA 2WM8A 5JDIC 1JI0A 4HDSA 1TCVA 1XV5A 2JBHA 4DUZB 3A9VA 3VMFA 3W8NA 5HE9A 2PUJA 3H18A 2ZVPX 5EJFA 3QNUA 4D8TA 5AJUA 1M6YA 1U2DC 2UZ0A 1Q1AA 1QQ5A 3LX6A 4NOLA 2BGTA 3WK6A 4GL4A 3NWOA 4IX9A 1MRNA 3K6JA 5A62A 4L9AA 3U09A 1UMBA 5ELMA 3PV0A 4I66A 5FBQB 2WJYA 2A67A 2PX3A 2JHAA 2R3SA 3NEPX 3T3HA 3HCOA 3SZRA 4Q02A 3MCVA 2FPPB 2VSXA 4GM1A 4LDZA 4LRUA 4N9WA 5AVYA 3ELDA 5KJEA 1RQRA 4BFCA 1XNRB 4RV5A 3EEOA 2ZJ0A 2O50A 3FMPB 3CZ5A 1S2IA 5TMDA 1E6CA 1GZ3A 4HNSA 4EFKA 2QRGA 3UMJA 2PVPA 4D96A 5A6SA 4I08A 4MAMA 4YJFA 3TZQA 4B6GA 1CJCA 2KW5A 2PZMA 4YA6A 5IAJA 2IP1A 1N77A 3SWWA 2ZZNA 1FVXA 3M89A 4OLHA 4QYIB 4AUKA 4F5WA 2XKJE 4LFAB 1F17A 2GJ9A 3IAFA 2FJPA 2CSUA 3KAKA 4V3BA 3C7CB 3FKSA 3C6MA 2WF8A 3PFFA 4LYFA 3LQKA 4BRUA 2OO7A 4B2LA 1T8RA 3VDQA 3DXFA 4UM8B 1ICIA 3WG9A 2WYOA 3C85A 1P0CA 4C43A 2JRLA 2Z83A 5HIMA 3T12A 2WZCA 5AH0A 4BMZA 1OSNA 3A36A 5GONA 3UZUA 1QGYA 1KI6B 3G13A 3SIXA 2QMZA 1UMDA 1U1CA 4I0WB 2CF6A 4L50A 1TCCA 2C2GA 1JQ3A 1QWOA 3R4VA 1KBOA 4TGLA 1PWYE 2QWXA 4OUKX 5LR6A 5I7OA 3L6UA 4LHZA 1XT6A 1BN7A 3PS9A 4WOJA 1EU1A 2FPGA 2YW9A 1K27A 3KS9A 4LRYA 1ZGGA 2HCRA 4JLPA 1VL6A 1ACLA 3GO4A 5EL0A 2VDMB 4LY9A 3P9RA 2BHRA 3GJTA 3QPAA 1D1QA 4GRDA 4M1MA 3TX2A 2D3WA 4WZ6A 2Q62A 2C00A 4QDZA 2OBNA 4W6ZA 4AZ3A 1XA4A 1W6RA 1VI6A 5GM2A 1HKUA 1L7EA 3CZPA 1NSTA 1GGJA 1P5RA 1UAGA 2VT7A 2H31A 2B0JA 2ZZKA 1PR2A 3NBAA 3WOHA 3IOBA 3SF0A 4E70A 4MQEB 5FTLA 5HRCA 2XCIA 4JB2A 4L8FA 4RVNA 1G9TA 4IS3A 5DF1A 4MHTA 5G4KA 1PWXA 4J7AA 5E0OA 4B43A 4BBZA 3MJTA 2Z2JA 4MIKA 1F9AA 3BGSA 1PNOA 3DLAA 3HNPA 3VGJA 1I2ZA 4FGZA 3U9SA 1RAFA 1NVUQ 2A7XA 3PX2A 3EXHB 2WAAA 4FKMA 5MN5A 4YX9A 1U94A 5F3RA 2AG5A 1MJFA 1XD9A 3AP2A 3G6WA 3CLTD 2VT2A 3IVCA 4Q7KA 3F67A 3OQBA 4TV8B 1UDAA 2WJIA 2C7PA 1AKQA 3AUYA 4CKWB 4HDSB 3WB2A 3FKQA 2JGAA 3DKIA 4QYTA 1N5DA 1IN5A 4WXMA 3D4BA 3I6BA 1HYQA 3ONVA 1JS1X 2H07A 4F56A 3KHSA 3GEEA 2IXFA 1LI7A 3AFMA 3BXHA 1IULA 4AU1A 1JWBB 2Q3JA 1RS0A 4YH1A 4LSWA 1JA0A 3BK1A 4PNZA 4FT2A 5JADA 2GAAA 3DXXA 2OC4A 5IKMA 1H1LB 3H6GA 4UW9A 1WPQA 3TQOA 4MKZA 5IHPA 1XTSA 4G2NA 4PLGA 5K8IA 3BWDD 5HKOA 3OWXA 1XZLA 5DTQA 3CG4A 4I4NA 4X8OA 3U4QA 4AWXA 3ENVA 1QRTA 4OVKA 1OJ7A 1WXIA 1EDZA 1N1EA 2A1TR 3ZQJA 3EYWA 2H2FA 4M1YA 2AFHB 2EP8A 2FWMX 2O1XA 3HU5A 3PC8C 5H81A 4F4FA 4CV3A 1PHPA 5ESDA 3C74A 3KX2A 4R1LA 1G3UA 1QYXA 4UMDA 1P2TA 2K2QB 5F78A 3EZFA 3RDPA 5IXYA 2BMEA 4J4HA 2FPSA 2IF2A 1RFLA 1CUYA 2Q1XA 1JALA 3CURA 3CXUA 3B8HA 2IHVA 3P9IA 3R3SA 4ZT6A 3S40A 2GZSA 4DIKA 4H15A 1K68A 2DE0X 1R0ZA 2Z43A 5E9WA 4CUZA 3PRHA 5BRNA 3MTBA 1I6WA 3C3AA 1BMFA 4NZ9A 5JFOA 4TLDA 3VR6D 3WMRA 2QZSA 2NXEA 4ZVVA 3RIGA 1MJ5A 3P8ZA 1T9ZA 3BMCA 3W5DA 3DE3X 3I28A 4B84A 1L5NA 2PEZA 4QASA 1A9PA 1Q0ZA 2JVKA 5C1BA 4UAUA 5IVPA 5IWCA 2H00A 4FN5A 3U3RA 2PMFA 1XEWY 1NT4A 4L72A 4PC1A 2V6MA 1VIVA 2DG2A 5IDWA 5KYWB 4XGNA 4CKCB 4XCQA 2VS1A 3KSZO 1Z2AA 4GPBA 1M1YB 3OZCA 3K9FC 5BUQA 3AC0A 1EJ6A 3HO6A 3ONNA 2WC1A 3BJZA 1JHQA 2DF8A 3JX9A 5CHYA 2PA3A 3PHLA 4N47A 5CVDA 3N7TA 3Q10A 2XXJA 2G9ZA 2F7SA 3OT5A 4IUDS 4BL5A 4ER3A 3QF7A 3SLKA 4AZ3B 2NU7B 1Y4ZA 1OLSA 4MYDA 1ILEA 2BEKA 3LOQA 1W52X 3LUBA 3IX7A 4BNXA 1GTZA 1LJUA 2FW7A 3S68A 2X40A 1QGOA 4FE4A 1JJ7A 3ZV3A 2IP4A 5BVHA 2P35A 1VLHA 2H65A 3U3DA 3HZOA 5A2GA 3VR3D 3QE9Y 3OM1A 3NHYA 3SEFA 5AVZA 1TVCA 4FS8A 4UQOA 2F8TA 2P9YA 4LRXA 4H08A 5FNVF 2PTGA 2XMRA 4MPPA 3ZDFA 2WUFA 4AS2A 1SELA 4NNPA 4DJDC 4DTIA 5KWIA 5GIPE 1E2FA 1XROA 4YEDA 2Y6UA 1S2MA 3K71B 2Z98A 3ZKAA 4RNCA 1YR6A 3L4EA 4J7CA 4DBZA 2SKEA 3THXA 3CZMA 3VBEA 5E0KB 4ILEA 3HJBA 3ZWPA 1NW8A 2J30A 3ZD6A 3DZHA 3U1TA 2HAEA 5FEMA 1IXYA 1R6UA 2ZSUA 1MB4A 1QYRA 3Q8XB 3AVUA 2UZ1B 2QQGA 4RY0A 1Y5RA 3AEYA 3KOUA 4FJ1A 1TYAE 4RK5A 5KYUA 2TYSB 1TEXA 4E2FA 5CX4A 5FL3A 2IX9A 3CFYA 2VZ8A 3KJGA 2AWOA 3PA6A 2W2KB 3V2GA 4A8PA 4EUEA 3WA7A 2GHRA 5CVCA 4ETIA 4DY4A 1YZTA 4WL0A 3I5XA 2EHDA 5HZHA 5A3SA 3RUPA 2QF7A 3CJTA 1NN1A 1BWPA 1A2BA 1G291 1Z8FA 2ZBPA 3AU9A 4EI8A 1RTTA 1HYBA 5M34A 1DQYA 1GGHA 3N0WA 4OXKA 1ZJYA 4QDUA 3EPHA 1OXKB 1XB2A 2J3KA 2PLNA 4Q16A 2VPTA 3QXGA 3A58B 4RW0A 1ACJA 3DGEC 4FQ7A 4BN4A 4JBXA 1T3GA 1BDIA 4S04A 5EWJB 2NVOA 4EHLA 3NQ41 2Q21A 1Q0LA 4UNRA 1I36A 1VRWA 4ESEA 2Q2OA 2NADA 3OJWA 4PYNA 1Y1QA 1VMIA 3TRHA 2I67A 3D4LA 1P7PA 1D04A 2C83A 2PWPA 2ASEA 2GXSA 2RHBA 4M9CA 4Y2TA 2R4TA 2FQWA 3M6LA 5CRIA 2QZPA 1YB5A 221PA 1PLLA 1OLXA 1Z5WA 2QP4A 1X7XB 1YB6A 3IRVA 3M1IA 4EW3A 3ZWMA 2DHCA 2R8ZA 1H65A 2RGUA 2I4NA 2CHQA 3BHJA 1YDEA 1PG5A 4XWGA 4FWIB 1OT3A 2X58A 3K6SB 2H6EA 1LF0A 4KAXA 3UKOA 4ZI2A 2ZS9A 4MLPA 2R5FA 1K1EA 4IDGA 1SA0B 4IIYA 1A9XA 2ZT7A 4LGYA 4FGKA 2C5AA 3NUZA 4TYMA 1Z68A 2J46A 1Z7YA 3BEDA 2P2NA 4EGAA 2ACWA 3NO4A 3THRA 1ZXBA 1DWUA 2QN1A 1II0A 4S1NA 5D3MB 2R00C 2AXQA 4B4VA 4BJ1A 4CN8A 2FPRA 4OI1A 4ZT2A 4OP1A 1XEXB 2OCAA 3MS4A 1WDKA 3Q7QA 1QP4A 1SIUA 4ZHSA 1JECA 3KCQA 4YBRA 5FI3A 2GXAA 1C7JA 3FRHA 1SG9A 1HZJA 1OLOA 5FUMA 4W7SA 4NG4A 2VJCA 3NWPA 3T1QA 3LX8A 4IIEA 5DTEA 4E88A 3AIIA 1PNRA 3IRUA 3IJRA 2REOA 3WYBA 3K32A 4IH9A 4Q05A 2AJ8A 2IW3A 2GBIA 2QW0X 1SNYA 3GX1A 1JR3A 3KOWA 3NALA 3PUHA 4QUEA 4WKNA 4ZGWA 3GLIB 2BH2A 1SCNE 5HR5A 3KWMA 3USES 1M0TA 4TXHA 4P35A 2V59A 3T3EA 2GKSA 5E6SA 2GNOA 2WA1A 3REFA 3ZEAA 3R3UA 4R83A 5JRDS 1DHTA 1ZN8A 4EG1A 2HC9A 3CWZA 4JR0A 3I6MA 4ML3A 4PZ0A 4XA8A 5HQJA 2G9NA 3BHNA 4E1AA 1KXZA 1NF3A 4L5JA 3I2YX 2IXGA 5EE1A 2NOAA 5MF6A 4QBFA 2WWVD 1BWSA 1E5XA 4UD2A 2X22A 5KC9A 3D6FA 5TV2A 1W36C 2AW5A 4RABA 3DOJA 3NBZC 1MORA 4O4JF 3OPQA 1JIJA 2I62A 2DECA 4CIWA 4AURA 5IM4F 2A5GA 1X0VA 2X4DA 4H59A 3U3XA 1R9MA 2VUSA 2QRPA 3DV2A 1ABFA 5KC8A 2IL1A 3C3EA 4IVPA 4EG6A 4N5MA 4FGWA 5G41A 5BOSA 2HR1A 4LOKA 2XZTA 3ZWAA 1IBRA 1RW4A 5ALOA 3ZE1B 2IODA 4CLDA 5EJ6A 1XZJA 3EGOA 5A7HA 2BELA 1T0BA 1XR3A 1ZH0A 3LPLA 4O4IB 4C3ZA 3PITA 1U3UA 4TVBA 3EVEA 3K5WA 3Q0EA 1PZHA 2PJDA 2Z6VA 3MUNA 3JY6A 4GMHA 2CLLB 3EPJA 1QS0B 3K0HA 2XNDA 1BG6A 2OV6A 1A5ZA 3L5OA 1X14A 2ZUSA 4QD3A 1I4TD 5FADA 1USKA 1SC9A 1FXWF 2FW6A 3T7IA 2QT0A 1KAGA 3B9PA 3DV0A 3MJDA 4HNTA 1P73A 1XQVA 2XAAA 4MK4A 3J81A 5J1TB 3WAJA 5LIPA 2Q5FA 4R0MA 4LI0A 4FCTA 3TLEA 1TI7A 1L4NA 3ZQKA 1U1DA 3BXPA 2XXBA 3LDFA 5CYFA 1GQSA 2FPMA 1W25A 5A04A 2PLRA 4JBLA 3RT7A 1H6BA 4U9UA 3QG5A 2DY0A 1X39A 2VQ6A 1XE3A 2E4ZA 2I78A 5F1KA 2R8RA 2VTVA 5EY5B 1Y6FA 1KAQA 4WA8A 3BFJA 3IV6A 3HSKA 4Q4DA 4US0R 3N2YA 3PWKA 1L7OA 4MVJA 3EBLA 5DNVA 3SNHA 3NWJA 3V4OA 4YPVA 4IHJA 1UQUA 2Z09A 4YECA 2QAIA 3UGTA 3U4AA 4CCSA 3ENKA 5HTOA 5CLHA 2BFAA 3CQ9A 3MUFA 1EFAA 1S96A 4CEHB 1CJTC 4C4OA 3AKDA 1B3RA 3G8DA 4RPHA 4YAFA 3KZNA 1L5LA 2C4TA 4CMKA 2C94A 4JX8A 5FBLB 1P5FA 4EG5A 3HCDA 1SWVA 2YXDA 3PC4A 3VTKA 3PVZA 2E4XA 2QTMA 3WYEA 1Z6XA 2EWWA 2X9VA 3WNCA 4DVGA 3GFSA 3QVGA 4UQPA 2KSQA 2YDXA 3ZBUA 2ATCA 2OE2A 1FU4A 1KOJA 3VR5H 3BWVA 5EEGA 1KAHA 5I7UA 2AOVA 5HSGA 1VHJA 1XALA 5IJ9A 3NYRA 2IRWA 3MLAA 4BN5A 2BZ1A 3HUFA 1YA6A 1J22A 2QNIA 4HX5A 2JLQA 2XLBA 2PUHA 1QQ7A 3G5TA 3RS8A 4E7PA 4DTCA 3D8BA 3WFIA 2AN1A 3AJ8A 3BCHA 3I9OA 3MPOA 5DH9A 4TWAA 5AJZA 1QUEA 3F7TA 4WAUA 3FUXA 5FYQA 1QNLA 1KI6A 1UBGA 2JFHA 4LYYA 4OG2A 1KSGA 1DL5A 2QL5A 3UOGA 3RBXA 5JJBA 2LDBA 5IBQA 5E2BA 3ML1A 4JKIA 1B8PA 1JXMA 2IU3A 2ODNA 3TRKA 1KO5A 1LTQA 4I5FA 3ZY2A 5HWSA 4HKTA 5DM2A 1GQYA 4PAQA 4TLAA 4FVTA 5CB8A 3OQPA 1TL7C 1QPBA 4KN5A 4EHIA 2UZ1A 2B1JA 2EKBA 5I48A 4YALA 5FLXA 3WB1A 1NN0A 3BXEA 1C7IA 3OQIB 4Q4HA 5HP4A 1FDOA 2H1CA 1E92A 1HG0A 1O94A 1RMQA 1G6KA 2OFOA 3M1LA 2FAXA 4HNAB 4TSRA 3UJHA 4ZK6A 1NY6A 5DGIA 4MQEA 2II6A 3MINB 1RADA 3QVSA 1FW8A 1CV2A 1NI4A 1KWGA 2K5UA 1QK5A 2H1SA 5DN6D 3Q9NA 2XB4A 4PQEA 2HQOA 1AUXA 2OFWA 4NJEA 1EGVB 4P1ZA 4QTXA 3LZDA 4O5AA 1PJAA 1VBMA 3H2ZA 3IS3A 3MVEA 1YR8A 4BBAA 3DEKA 3HDVA 2HPVA 2XMDA 3TSWA 2RFLA 2ACKA 4AXXA 1U04A 5F2OA 1KYXA 3L18A 3PLAE 4LF7B 2XUDA 3SHVA 1T2AA 3RWOA 1PZFA 5EIXA 5ALWA 3KSBC 4RMJA 1RRCA 3AJRA 1WTAA 4AG6A 4H0CA 5E6UA 4C4YA 4ZICA 1ISRA 2HKIA 4PZUA 2JGFA 4IH4A 3H2SA 5FBRB 2RBEA 5AKIA 3BICA 2HUPA 5CNMA 1H3EA 2E4YA 4PCAA 3PXCX 4LYDA 3WTCA 1TRKA 1IAVA 1NFRA 2VNIA 4K3VA 5E6RA 4F96A 4ZCMA 5JOQA 3THWA 3P2YA 5AKXA 3N0VA 3WGQA 4U2EA 4WCFC 1DC8A 3L1JA 6REQB 5LQCA 2I4RA 1OVMA 2QTBA 1G5HA 3G3EA 4G25A 2GZ2A 4OI4A 5A9SB 3KUDA 1WSWA 3PFBA 4ZCPA 5K0FA 2YVLA 2JS7A 1USGA 3A1TA 3KJFA 2AS0A 2ZJZA 5HFJA 2E48A 1JUDA 3T9EA 5BRJA 1ZXLA 2AMVA 3DEYX 1FA9A 4L0QA 3F6SA 2EKDA 1JYSA 1MCZA 4OQQA 4L2IB 1BMQA 1WXXA 2BFEB 2Y1LA 2GYVA 4PHFA 4HWGA 5HPYB 1EHCA 1N7JA 2H5LA 2I2BA 3PQ6A 2C96A 3NXKA 1I33A 4G89A 3Q5GA 1QQAA 5JI3E 3RUDA 2X2EA 4H6PA 4AICA 3IBFA 4C89A 1NDUA 1XQWA 1HDXA 2VA8A 1W96A 1LK5A 2FR0A 3FAKA 3GH1A 4GEGA 3TLCA 5FWYA 5IS2A 1DG9A 1KE2A 4CIYA 1UDCA 4YUZA 2ADOA 1IM5A 3KAJA 1JU9A 3JYOA 1LDNA 1QC5A 3DBRA 4XJTA 3W2EA 1SVWA 4HGNA 1Z6QA 5H70A 3VR5D 5KX5B 1EUYA 5TMBA 1GCAA 1S2OA 3KVYA 1F20A 3EVNA 3W9YA 2OV1A 4OHVA 3E35A 2RCNA 3K0CC 3IMEA 4J7UA 4PLHA 2GLTA 3HKEA 2VZ0A 1Y9EA 5BURA 1VA5A 1MEJA 3VX3A 1TUIA 2HQSA 1AUQA 1S01A 1N2SA 2O7SA 4XYBA 4XGQA 1XFDA 1FVHA 4Q4LA 4J3FA 5TIIA 2GD2A 1L7BA 3L8GA 2W7TA 1I80A 1A98A 2VPWA 2YMLA 3AUFA 3IOCA 1OVGA 4RAOA 2C8KA 3CLHA 3KL2A 2FX2A 1MB2A 2J5XA 2DHRA 3EF1A 3H9CA 2W6MA 1AZLA 4L8GA 4Q7QA 4JBIA 4ZOBA 1E1YA 1YQUA 3FH0A 1RWOA 3FWHA 3DT9A 1LSUA 2CNDA 1L5QA 2XNCA 1OR8A 3BMOB 3KZMA 4XJVA 1O97D 3HKCB 4YJHB 5ICFA 4G97A 3RNLA 3KTDA 5IU6A 1A7AA 2O7QA 2OKGA 3K0AB 1G8HA 4V0SA 3A2MA 4LJ7A 4ENQA 5IDQA 1HR0B 3PWSA 3R0JA 3V55A 3R3YA 1VE7A 3I5UA 3HZRA 4MHOA 3DMNA 5CM8B 2OBLA 5CFRA 1U0TA 1QFXA 3OEHA 1N3IA 2W2PA 1FNCA 2BMWA 3UAGA 1FYEA 1HURA 1V7CA 2WJ6A 2YYYA 1RRKA 1RYDA 1J25A 3HYNA 3QE2A 4RVDA 3JARB 3IEMA 4L4XA 1JG2A 2VH2A 4YQZA 3IT0A 4R51A 1D0SA 2Q3EA 1E69A 1MO5A 3TRFA 1IEWA 4CI0B 4YRKA 1Z3IX 1I3KA 1X1BA 5A05A