5K4PA

Catalytic domain of mcr-1 phosphoethanolamine transferase
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
Knots found
sequence length
324
structure length
323
Chain Sequence
DTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTSAYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the catalytic domain of the colistin resistance enzyme MCR-1.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Probable phosphatidylethanolamine transferase Mcr-1
total genus 125
structure length 323
sequence length 324
other databases KnotProt 2.0: S +31
ec nomenclature ec 2.7.-.-:
pdb deposition date 2016-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 5k4pA00
5GRRA 3NVLA 1KH9A 3BDFA 3M8ZA 3UN5A 3NKQA 5L0BA 1Y6VA 1KHJA 1ELZA 4KJGA 5C66A 3ED4A 1KHLA 1HDHA 1P49A 1ALIA 3UO0A 1AJDA 4TN0A 2GA3A 1AJBA 3OT9A 1AJAA 5DLVA 5AJ9A 3T02A 1EW8A 5LIAA 3SZYA 2RH6A 5KXAA 4LR2A 1E2SP 4GTYA 1EW9A 3DYCA 1EI6A 3MK2A 4NWXA 2W5TA 4CYSA 1ANIA 1HQAA 2W5RA 2W5SA 5INHA 3IGYB 3WAWA 5L0KA 2W5VA 1SHNA 5K4PA 2W5WA 3MK0A 1AUKA 1EW2A 2W8SA 4MHXA 4UPKA 4ZG6A 5EGHA 3WAYA 1EJJA 2XRGA 3KD8A 3Q3QA 3SZZA 1O98A 3M8WA 1ZEFA 5TJ3A 1AJCA 4LQYA 4QAXA 3T01A 1ELXA 3NKMA 4LRAA 1ALHA 3WAXA 4CXSA 4ZG7A 5EGEA 1KH5A 2IFYA 2VQRA 1ZEBA 1KH4A 2ANHA 3DPCA 1N2LA 4LR9A 2W8DA 3LXQA 1ZEDA 4LREA 4LRBA 4NWJA 4MY4A 5IJQA 3TWZA 2IUCA 4B56A 3NKOA 1ED9A 4GTWA 2G9YA 1Y7AA 2W5XA 4UOOA 5LRNA 4LR7A 4KAVA 2GSOA 3B5QA 4N7TA 1N2KA 1URAA 4KJDA 3WAVA 1ALKA 4UPHA 1ED8A 3T00A 1E33P 1KHNA 2GSUA 4KAYA 3BDGA 4KM4A 1SHQA 5GOVA 3NKRA 2D1GA 4UOPA 5IJSA 4LR8A 4YR1A 4ZGAA 3TG0A 4CXKA 4FDIA 2GSNA 3BDGB 5DLTA 4GTXA 3IGZB 4CYRA 3NKPA 3UN2A 5LRMA 5DLWA 3NKNA 3CMRA 3UN3A 1HJKA 2XR9A 3A52A 3IDDA 4LRFA 1O99A 4UPLA 1E1ZP 2X98A 4FDJA 3E2DA 4GTZA 1URBA 1B8JA 1ALJA 1K7HA 5HRTA 2IUCB 3WBHA 3M7VA 4UORA 4UPIA 4ZG9A 1FSUA 4MIVA 1KHKA 2QZUA 3MK1A 5L0EA 1E3CP 2GLQA 1EQJA 3TX0A 1ELYA 1KH7A 3BDHA 1ANJA 2W5QA 3M8YA 5LQQA 2ZKTA 4CXUA 4LRDA 4LRCA 3UNYA
chains in the Genus database with same CATH superfamily
5GRRA 3NVLA 1KH9A 3BDFA 3M8ZA 3UN5A 3NKQA 5L0BA 1Y6VA 1KHJA 1ELZA 4KJGA 5C66A 3ED4A 1KHLA 1HDHA 1P49A 1ALIA 3UO0A 1AJDA 4TN0A 2GA3A 1AJBA 3OT9A 1AJAA 5DLVA 5AJ9A 3T02A 1EW8A 5LIAA 3SZYA 2RH6A 5KXAA 4LR2A 1E2SP 4GTYA 1EW9A 3DYCA 1EI6A 3MK2A 4NWXA 2W5TA 4CYSA 1ANIA 1HQAA 2W5RA 2W5SA 5INHA 3IGYB 3WAWA 5L0KA 2W5VA 1SHNA 5K4PA 2W5WA 3MK0A 1AUKA 1EW2A 2W8SA 4MHXA 4UPKA 4ZG6A 5EGHA 3WAYA 1EJJA 2XRGA 3KD8A 3Q3QA 3SZZA 1O98A 3M8WA 1ZEFA 5TJ3A 1AJCA 4LQYA 4QAXA 3T01A 1ELXA 3NKMA 4LRAA 1ALHA 3WAXA 4CXSA 4ZG7A 5EGEA 1KH5A 2IFYA 2VQRA 1ZEBA 1KH4A 2ANHA 3DPCA 1N2LA 4LR9A 2W8DA 3LXQA 1ZEDA 4LREA 4LRBA 4NWJA 4MY4A 5IJQA 3TWZA 2IUCA 4B56A 3NKOA 1ED9A 4GTWA 2G9YA 1Y7AA 2W5XA 4UOOA 5LRNA 4LR7A 4KAVA 2GSOA 3B5QA 4N7TA 1N2KA 1URAA 4KJDA 3WAVA 1ALKA 4UPHA 1ED8A 3T00A 1E33P 1KHNA 2GSUA 4KAYA 3BDGA 4KM4A 1SHQA 5GOVA 3NKRA 2D1GA 4UOPA 5IJSA 4LR8A 4YR1A 4ZGAA 3TG0A 4CXKA 4FDIA 2GSNA 3BDGB 5DLTA 4GTXA 3IGZB 4CYRA 3NKPA 3UN2A 5LRMA 5DLWA 3NKNA 3CMRA 3UN3A 1HJKA 2XR9A 3A52A 3IDDA 4LRFA 1O99A 4UPLA 1E1ZP 2X98A 4FDJA 3E2DA 4GTZA 1URBA 1B8JA 1ALJA 1K7HA 5HRTA 2IUCB 3WBHA 3M7VA 4UORA 4UPIA 4ZG9A 1FSUA 4MIVA 1KHKA 2QZUA 3MK1A 5L0EA 1E3CP 2GLQA 1EQJA 3TX0A 1ELYA 1KH7A 3BDHA 1ANJA 2W5QA 3M8YA 5LQQA 2ZKTA 4CXUA 4LRDA 4LRCA 3UNYA
chains in the Genus database with same CATH topology
5GRRA 3NVLA 1KH9A 3BDFA 3M8ZA 3UN5A 3NKQA 5L0BA 1Y6VA 1KHJA 1ELZA 4KJGA 5C66A 3ED4A 1KHLA 1HDHA 1P49A 1ALIA 3UO0A 1AJDA 4TN0A 2GA3A 1AJBA 3OT9A 1AJAA 5DLVA 5AJ9A 3T02A 1EW8A 5LIAA 3SZYA 2RH6A 5KXAA 4LR2A 1E2SP 4GTYA 1EW9A 3DYCA 1EI6A 3MK2A 4NWXA 2W5TA 4CYSA 1ANIA 1HQAA 2W5RA 2W5SA 5INHA 3IGYB 3WAWA 5L0KA 2W5VA 1SHNA 5K4PA 2W5WA 3MK0A 1AUKA 1EW2A 2W8SA 4MHXA 4UPKA 4ZG6A 5EGHA 3WAYA 1EJJA 2XRGA 3KD8A 3Q3QA 3SZZA 1O98A 3M8WA 1ZEFA 5TJ3A 1AJCA 4LQYA 4QAXA 3T01A 1ELXA 3NKMA 4LRAA 1ALHA 3WAXA 4CXSA 4ZG7A 5EGEA 1KH5A 2IFYA 2VQRA 1ZEBA 1KH4A 2ANHA 3DPCA 1N2LA 4LR9A 2W8DA 3LXQA 1ZEDA 4LREA 4LRBA 4NWJA 4MY4A 5IJQA 3TWZA 2IUCA 4B56A 3NKOA 1ED9A 4GTWA 2G9YA 1Y7AA 2W5XA 4UOOA 5LRNA 4LR7A 4KAVA 2GSOA 3B5QA 4N7TA 1N2KA 1URAA 4KJDA 3WAVA 1ALKA 4UPHA 1ED8A 3T00A 1E33P 1KHNA 2GSUA 4KAYA 3BDGA 4KM4A 1SHQA 5GOVA 3NKRA 2D1GA 4UOPA 5IJSA 4LR8A 4YR1A 4ZGAA 3TG0A 4CXKA 4FDIA 2GSNA 3BDGB 5DLTA 4GTXA 3IGZB 4CYRA 3NKPA 3UN2A 5LRMA 5DLWA 3NKNA 3CMRA 3UN3A 1HJKA 2XR9A 3A52A 3IDDA 4LRFA 1O99A 4UPLA 1E1ZP 2X98A 4FDJA 3E2DA 4GTZA 1URBA 1B8JA 1ALJA 1K7HA 5HRTA 2IUCB 3WBHA 3M7VA 4UORA 4UPIA 4ZG9A 1FSUA 4MIVA 1KHKA 2QZUA 3MK1A 5L0EA 1E3CP 2GLQA 1EQJA 3TX0A 1ELYA 1KH7A 3BDHA 1ANJA 2W5QA 3M8YA 5LQQA 2ZKTA 4CXUA 4LRDA 4LRCA 3UNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GRR A;  3NVL A;  1KH9 A;  3BDF A;  3M8Z A;  3UN5 A;  3NKQ A;  5L0B A;  1Y6V A;  1KHJ A;  1ELZ A;  4KJG A;  5C66 A;  3ED4 A;  1KHL A;  1HDH A;  1P49 A;  1ALI A;  3UO0 A;  1AJD A;  4TN0 A;  2GA3 A;  1AJB A;  3OT9 A;  1AJA A;  5DLV A;  5AJ9 A;  3T02 A;  1EW8 A;  5LIA A;  3SZY A;  2RH6 A;  5KXA A;  4LR2 A;  1E2S P;  4GTY A;  1EW9 A;  3DYC A;  1EI6 A;  3MK2 A;  4NWX A;  2W5T A;  4CYS A;  1ANI A;  1HQA A;  2W5R A;  2W5S A;  5INH A;  3IGY B;  3WAW A;  5L0K A;  2W5V A;  1SHN A;  5K4P A;  2W5W A;  3MK0 A;  1AUK A;  1EW2 A;  2W8S A;  4MHX A;  4UPK A;  4ZG6 A;  5EGH A;  3WAY A;  1EJJ A;  2XRG A;  3KD8 A;  3Q3Q A;  3SZZ A;  1O98 A;  3M8W A;  1ZEF A;  5TJ3 A;  1AJC A;  4LQY A;  4QAX A;  3T01 A;  1ELX A;  3NKM A;  4LRA A;  1ALH A;  3WAX A;  4CXS A;  4ZG7 A;  5EGE A;  1KH5 A;  2IFY A;  2VQR A;  1ZEB A;  1KH4 A;  2ANH A;  3DPC A;  1N2L A;  4LR9 A;  2W8D A;  3LXQ A;  1ZED A;  4LRE A;  4LRB A;  4NWJ A;  4MY4 A;  5IJQ A;  3TWZ A;  2IUC A;  4B56 A;  3NKO A;  1ED9 A;  4GTW A;  2G9Y A;  1Y7A A;  2W5X A;  4UOO A;  5LRN A;  4LR7 A;  4KAV A;  2GSO A;  3B5Q A;  4N7T A;  1N2K A;  1URA A;  4KJD A;  3WAV A;  1ALK A;  4UPH A;  1ED8 A;  3T00 A;  1E33 P;  1KHN A;  2GSU A;  4KAY A;  3BDG A;  4KM4 A;  1SHQ A;  5GOV A;  3NKR A;  2D1G A;  4UOP A;  5IJS A;  4LR8 A;  4YR1 A;  4ZGA A;  3TG0 A;  4CXK A;  4FDI A;  2GSN A;  3BDG B;  5DLT A;  4GTX A;  3IGZ B;  4CYR A;  3NKP A;  3UN2 A;  5LRM A;  5DLW A;  3NKN A;  3CMR A;  3UN3 A;  1HJK A;  2XR9 A;  3A52 A;  3IDD A;  4LRF A;  1O99 A;  4UPL A;  1E1Z P;  2X98 A;  4FDJ A;  3E2D A;  4GTZ A;  1URB A;  1B8J A;  1ALJ A;  1K7H A;  5HRT A;  2IUC B;  3WBH A;  3M7V A;  4UOR A;  4UPI A;  4ZG9 A;  1FSU A;  4MIV A;  1KHK A;  2QZU A;  3MK1 A;  5L0E A;  1E3C P;  2GLQ A;  1EQJ A;  3TX0 A;  1ELY A;  1KH7 A;  3BDH A;  1ANJ A;  2W5Q A;  3M8Y A;  5LQQ A;  2ZKT A;  4CXU A;  4LRD A;  4LRC A;  3UNY A; 
#chains in the Genus database with same CATH topology
 5GRR A;  3NVL A;  1KH9 A;  3BDF A;  3M8Z A;  3UN5 A;  3NKQ A;  5L0B A;  1Y6V A;  1KHJ A;  1ELZ A;  4KJG A;  5C66 A;  3ED4 A;  1KHL A;  1HDH A;  1P49 A;  1ALI A;  3UO0 A;  1AJD A;  4TN0 A;  2GA3 A;  1AJB A;  3OT9 A;  1AJA A;  5DLV A;  5AJ9 A;  3T02 A;  1EW8 A;  5LIA A;  3SZY A;  2RH6 A;  5KXA A;  4LR2 A;  1E2S P;  4GTY A;  1EW9 A;  3DYC A;  1EI6 A;  3MK2 A;  4NWX A;  2W5T A;  4CYS A;  1ANI A;  1HQA A;  2W5R A;  2W5S A;  5INH A;  3IGY B;  3WAW A;  5L0K A;  2W5V A;  1SHN A;  5K4P A;  2W5W A;  3MK0 A;  1AUK A;  1EW2 A;  2W8S A;  4MHX A;  4UPK A;  4ZG6 A;  5EGH A;  3WAY A;  1EJJ A;  2XRG A;  3KD8 A;  3Q3Q A;  3SZZ A;  1O98 A;  3M8W A;  1ZEF A;  5TJ3 A;  1AJC A;  4LQY A;  4QAX A;  3T01 A;  1ELX A;  3NKM A;  4LRA A;  1ALH A;  3WAX A;  4CXS A;  4ZG7 A;  5EGE A;  1KH5 A;  2IFY A;  2VQR A;  1ZEB A;  1KH4 A;  2ANH A;  3DPC A;  1N2L A;  4LR9 A;  2W8D A;  3LXQ A;  1ZED A;  4LRE A;  4LRB A;  4NWJ A;  4MY4 A;  5IJQ A;  3TWZ A;  2IUC A;  4B56 A;  3NKO A;  1ED9 A;  4GTW A;  2G9Y A;  1Y7A A;  2W5X A;  4UOO A;  5LRN A;  4LR7 A;  4KAV A;  2GSO A;  3B5Q A;  4N7T A;  1N2K A;  1URA A;  4KJD A;  3WAV A;  1ALK A;  4UPH A;  1ED8 A;  3T00 A;  1E33 P;  1KHN A;  2GSU A;  4KAY A;  3BDG A;  4KM4 A;  1SHQ A;  5GOV A;  3NKR A;  2D1G A;  4UOP A;  5IJS A;  4LR8 A;  4YR1 A;  4ZGA A;  3TG0 A;  4CXK A;  4FDI A;  2GSN A;  3BDG B;  5DLT A;  4GTX A;  3IGZ B;  4CYR A;  3NKP A;  3UN2 A;  5LRM A;  5DLW A;  3NKN A;  3CMR A;  3UN3 A;  1HJK A;  2XR9 A;  3A52 A;  3IDD A;  4LRF A;  1O99 A;  4UPL A;  1E1Z P;  2X98 A;  4FDJ A;  3E2D A;  4GTZ A;  1URB A;  1B8J A;  1ALJ A;  1K7H A;  5HRT A;  2IUC B;  3WBH A;  3M7V A;  4UOR A;  4UPI A;  4ZG9 A;  1FSU A;  4MIV A;  1KHK A;  2QZU A;  3MK1 A;  5L0E A;  1E3C P;  2GLQ A;  1EQJ A;  3TX0 A;  1ELY A;  1KH7 A;  3BDH A;  1ANJ A;  2W5Q A;  3M8Y A;  5LQQ A;  2ZKT A;  4CXU A;  4LRD A;  4LRC A;  3UNY A; 
#chains in the Genus database with same CATH homology
 5GRR A;  3NVL A;  1KH9 A;  3BDF A;  3M8Z A;  3UN5 A;  3NKQ A;  5L0B A;  1Y6V A;  1KHJ A;  1ELZ A;  4KJG A;  5C66 A;  3ED4 A;  1KHL A;  1HDH A;  1P49 A;  1ALI A;  3UO0 A;  1AJD A;  4TN0 A;  2GA3 A;  1AJB A;  3OT9 A;  1AJA A;  5DLV A;  5AJ9 A;  3T02 A;  1EW8 A;  5LIA A;  3SZY A;  2RH6 A;  5KXA A;  4LR2 A;  1E2S P;  4GTY A;  1EW9 A;  3DYC A;  1EI6 A;  3MK2 A;  4NWX A;  2W5T A;  4CYS A;  1ANI A;  1HQA A;  2W5R A;  2W5S A;  5INH A;  3IGY B;  3WAW A;  5L0K A;  2W5V A;  1SHN A;  5K4P A;  2W5W A;  3MK0 A;  1AUK A;  1EW2 A;  2W8S A;  4MHX A;  4UPK A;  4ZG6 A;  5EGH A;  3WAY A;  1EJJ A;  2XRG A;  3KD8 A;  3Q3Q A;  3SZZ A;  1O98 A;  3M8W A;  1ZEF A;  5TJ3 A;  1AJC A;  4LQY A;  4QAX A;  3T01 A;  1ELX A;  3NKM A;  4LRA A;  1ALH A;  3WAX A;  4CXS A;  4ZG7 A;  5EGE A;  1KH5 A;  2IFY A;  2VQR A;  1ZEB A;  1KH4 A;  2ANH A;  3DPC A;  1N2L A;  4LR9 A;  2W8D A;  3LXQ A;  1ZED A;  4LRE A;  4LRB A;  4NWJ A;  4MY4 A;  5IJQ A;  3TWZ A;  2IUC A;  4B56 A;  3NKO A;  1ED9 A;  4GTW A;  2G9Y A;  1Y7A A;  2W5X A;  4UOO A;  5LRN A;  4LR7 A;  4KAV A;  2GSO A;  3B5Q A;  4N7T A;  1N2K A;  1URA A;  4KJD A;  3WAV A;  1ALK A;  4UPH A;  1ED8 A;  3T00 A;  1E33 P;  1KHN A;  2GSU A;  4KAY A;  3BDG A;  4KM4 A;  1SHQ A;  5GOV A;  3NKR A;  2D1G A;  4UOP A;  5IJS A;  4LR8 A;  4YR1 A;  4ZGA A;  3TG0 A;  4CXK A;  4FDI A;  2GSN A;  3BDG B;  5DLT A;  4GTX A;  3IGZ B;  4CYR A;  3NKP A;  3UN2 A;  5LRM A;  5DLW A;  3NKN A;  3CMR A;  3UN3 A;  1HJK A;  2XR9 A;  3A52 A;  3IDD A;  4LRF A;  1O99 A;  4UPL A;  1E1Z P;  2X98 A;  4FDJ A;  3E2D A;  4GTZ A;  1URB A;  1B8J A;  1ALJ A;  1K7H A;  5HRT A;  2IUC B;  3WBH A;  3M7V A;  4UOR A;  4UPI A;  4ZG9 A;  1FSU A;  4MIV A;  1KHK A;  2QZU A;  3MK1 A;  5L0E A;  1E3C P;  2GLQ A;  1EQJ A;  3TX0 A;  1ELY A;  1KH7 A;  3BDH A;  1ANJ A;  2W5Q A;  3M8Y A;  5LQQ A;  2ZKT A;  4CXU A;  4LRD A;  4LRC A;  3UNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...