5K4PA

Catalytic domain of mcr-1 phosphoethanolamine transferase
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
Knots found
sequence length
324
structure length
323
Chain Sequence
b'DTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTSAYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable phosphatidylethanolamine transferase Mcr-1
publication title Structure of the catalytic domain of the colistin resistance enzyme MCR-1.
pubmed doi rcsb
molecule tags Transferase
total genus 125
structure length 323
sequence length 324
other databases KnotProt 2.0: S +31
ec nomenclature ec 2.7.-.-:
pdb deposition date 2016-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 5k4pA00
4ZG9A 5LIAA 3DYCA 1N2KA 1AJBA 5LQQA 2RH6A 2ZKTA 5LRMA 4UOOA 1EJJA 4LR8A 4NWXA 3E2DA 4LRBA 3ED4A 3BDGA 1EQJA 1SHQA 1SHNA 5C66A 1ZEFA 2GLQA 2W5QA 4TN0A 2IUCB 3IDDA 1HJKA 4UPKA 3SZYA 3UO0A 4LR7A 4LQYA 3M8WA 2GSOA 4MY4A 2X98A 4MHXA 1ANJA 3TWZA 4CYRA 1KH5A 2GSNA 1KHNA 1K7HA 2QZUA 4KM4A 4CYSA 3OT9A 1ALIA 4B56A 1URBA 1N2LA 2GSUA 5EGEA 1EW2A 3NKNA 3UN2A 1EW9A 1EI6A 1KHJA 3LXQA 4FDJA 1ELYA 5HRTA 3NKOA 3M7VA 4GTYA 3A52A 1ED8A 5IJQA 4ZG7A 3MK0A 3TG0A 4LRAA 4UPIA 4CXUA 5DLWA 1O98A 2W5WA 4LRCA 3IGZB 1EW8A 2GA3A 3WAXA 3DPCA 4LREA 1B8JA 1KH9A 5L0EA 1HDHA 3NKQA 3T02A 4ZG6A 2VQRA 4UPLA 1P49A 1Y6VA 5INHA 2W8DA 2W5VA 1AJCA 1ALKA 1KH4A 3BDGB 4KAYA 4LR2A 5K4PA 3NVLA 1AUKA 3UN3A 1AJDA 4UOPA 3TX0A 2ANHA 3M8YA 3KD8A 4GTZA 1ALHA 5LRNA 3MK2A 4CXSA 1AJAA 2W8SA 1ANIA 2XR9A 3NKRA 4MIVA 4GTWA 4KAVA 5GOVA 5L0BA 2W5TA 3B5QA 4NWJA 1ELXA 1KHLA 1KHKA 5DLTA 3NKPA 1KH7A 2IFYA 4UORA 1Y7AA 1FSUA 3M8ZA 1E1ZP 4LRFA 5L0KA 1ALJA 4KJDA 3WAWA 4CXKA 3UNYA 2D1GA 1E3CP 3MK1A 5TJ3A 3T00A 4KJGA 2IUCA 3IGYB 1ZEBA 4YR1A 1E33P 4LR9A 5DLVA 2W5SA 1ED9A 2W5XA 3WAYA 4QAXA 4N7TA 4GTXA 5KXAA 3T01A 4FDIA 3BDHA 1O99A 4LRDA 3WAVA 2G9YA 1HQAA 1ZEDA 1E2SP 3NKMA 3Q3QA 4UPHA 5GRRA 3CMRA 5IJSA 5AJ9A 3BDFA 2W5RA 3SZZA 1ELZA 1URAA 4ZGAA 3UN5A 2XRGA 5EGHA 3WBHA
chains in the Genus database with same CATH superfamily
4ZG9A 5LIAA 3DYCA 1N2KA 1AJBA 5LQQA 2RH6A 2ZKTA 5LRMA 4UOOA 1EJJA 4LR8A 4NWXA 3E2DA 4LRBA 3ED4A 3BDGA 1EQJA 1SHQA 1SHNA 5C66A 1ZEFA 2GLQA 2W5QA 4TN0A 2IUCB 3IDDA 1HJKA 4UPKA 3SZYA 3UO0A 4LR7A 4LQYA 3M8WA 2GSOA 4MY4A 2X98A 4MHXA 1ANJA 3TWZA 4CYRA 1KH5A 2GSNA 1KHNA 1K7HA 2QZUA 4KM4A 4CYSA 3OT9A 1ALIA 4B56A 1URBA 1N2LA 2GSUA 5EGEA 1EW2A 3NKNA 3UN2A 1EW9A 1EI6A 1KHJA 3LXQA 4FDJA 1ELYA 5HRTA 3NKOA 3M7VA 4GTYA 3A52A 1ED8A 5IJQA 4ZG7A 3MK0A 3TG0A 4LRAA 4UPIA 4CXUA 5DLWA 1O98A 2W5WA 4LRCA 3IGZB 1EW8A 2GA3A 3WAXA 3DPCA 4LREA 1B8JA 1KH9A 5L0EA 1HDHA 3NKQA 3T02A 4ZG6A 2VQRA 4UPLA 1P49A 1Y6VA 5INHA 2W8DA 2W5VA 1AJCA 1ALKA 1KH4A 3BDGB 4KAYA 4LR2A 5K4PA 3NVLA 1AUKA 3UN3A 1AJDA 4UOPA 3TX0A 2ANHA 3M8YA 3KD8A 4GTZA 1ALHA 5LRNA 3MK2A 4CXSA 1AJAA 2W8SA 1ANIA 2XR9A 3NKRA 4MIVA 4GTWA 4KAVA 5GOVA 5L0BA 2W5TA 3B5QA 4NWJA 1ELXA 1KHLA 1KHKA 5DLTA 3NKPA 1KH7A 2IFYA 4UORA 1Y7AA 1FSUA 3M8ZA 1E1ZP 4LRFA 5L0KA 1ALJA 4KJDA 3WAWA 4CXKA 3UNYA 2D1GA 1E3CP 3MK1A 5TJ3A 3T00A 4KJGA 2IUCA 3IGYB 1ZEBA 4YR1A 1E33P 4LR9A 5DLVA 2W5SA 1ED9A 2W5XA 3WAYA 4QAXA 4N7TA 4GTXA 5KXAA 3T01A 4FDIA 3BDHA 1O99A 4LRDA 3WAVA 2G9YA 1HQAA 1ZEDA 1E2SP 3NKMA 3Q3QA 4UPHA 5GRRA 3CMRA 5IJSA 5AJ9A 3BDFA 2W5RA 3SZZA 1ELZA 1URAA 4ZGAA 3UN5A 2XRGA 5EGHA 3WBHA
chains in the Genus database with same CATH topology
4ZG9A 5LIAA 3DYCA 1N2KA 1AJBA 5LQQA 2RH6A 2ZKTA 5LRMA 4UOOA 1EJJA 4LR8A 4NWXA 3E2DA 4LRBA 3ED4A 3BDGA 1EQJA 1SHQA 1SHNA 5C66A 1ZEFA 2GLQA 2W5QA 4TN0A 2IUCB 3IDDA 1HJKA 4UPKA 3SZYA 3UO0A 4LR7A 4LQYA 3M8WA 2GSOA 4MY4A 2X98A 4MHXA 1ANJA 3TWZA 4CYRA 1KH5A 2GSNA 1KHNA 1K7HA 2QZUA 4KM4A 4CYSA 3OT9A 1ALIA 4B56A 1URBA 1N2LA 2GSUA 5EGEA 1EW2A 3NKNA 3UN2A 1EW9A 1EI6A 1KHJA 3LXQA 4FDJA 1ELYA 5HRTA 3NKOA 3M7VA 4GTYA 3A52A 1ED8A 5IJQA 4ZG7A 3MK0A 3TG0A 4LRAA 4UPIA 4CXUA 5DLWA 1O98A 2W5WA 4LRCA 3IGZB 1EW8A 2GA3A 3WAXA 3DPCA 4LREA 1B8JA 1KH9A 5L0EA 1HDHA 3NKQA 3T02A 4ZG6A 2VQRA 4UPLA 1P49A 1Y6VA 5INHA 2W8DA 2W5VA 1AJCA 1ALKA 1KH4A 3BDGB 4KAYA 4LR2A 5K4PA 3NVLA 1AUKA 3UN3A 1AJDA 4UOPA 3TX0A 2ANHA 3M8YA 3KD8A 4GTZA 1ALHA 5LRNA 3MK2A 4CXSA 1AJAA 2W8SA 1ANIA 2XR9A 3NKRA 4MIVA 4GTWA 4KAVA 5GOVA 5L0BA 2W5TA 3B5QA 4NWJA 1ELXA 1KHLA 1KHKA 5DLTA 3NKPA 1KH7A 2IFYA 4UORA 1Y7AA 1FSUA 3M8ZA 1E1ZP 4LRFA 5L0KA 1ALJA 4KJDA 3WAWA 4CXKA 3UNYA 2D1GA 1E3CP 3MK1A 5TJ3A 3T00A 4KJGA 2IUCA 3IGYB 1ZEBA 4YR1A 1E33P 4LR9A 5DLVA 2W5SA 1ED9A 2W5XA 3WAYA 4QAXA 4N7TA 4GTXA 5KXAA 3T01A 4FDIA 3BDHA 1O99A 4LRDA 3WAVA 2G9YA 1HQAA 1ZEDA 1E2SP 3NKMA 3Q3QA 4UPHA 5GRRA 3CMRA 5IJSA 5AJ9A 3BDFA 2W5RA 3SZZA 1ELZA 1URAA 4ZGAA 3UN5A 2XRGA 5EGHA 3WBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZG9 A;  5LIA A;  3DYC A;  1N2K A;  1AJB A;  5LQQ A;  2RH6 A;  2ZKT A;  5LRM A;  4UOO A;  1EJJ A;  4LR8 A;  4NWX A;  3E2D A;  4LRB A;  3ED4 A;  3BDG A;  1EQJ A;  1SHQ A;  1SHN A;  5C66 A;  1ZEF A;  2GLQ A;  2W5Q A;  4TN0 A;  2IUC B;  3IDD A;  1HJK A;  4UPK A;  3SZY A;  3UO0 A;  4LR7 A;  4LQY A;  3M8W A;  2GSO A;  4MY4 A;  2X98 A;  4MHX A;  1ANJ A;  3TWZ A;  4CYR A;  1KH5 A;  2GSN A;  1KHN A;  1K7H A;  2QZU A;  4KM4 A;  4CYS A;  3OT9 A;  1ALI A;  4B56 A;  1URB A;  1N2L A;  2GSU A;  5EGE A;  1EW2 A;  3NKN A;  3UN2 A;  1EW9 A;  1EI6 A;  1KHJ A;  3LXQ A;  4FDJ A;  1ELY A;  5HRT A;  3NKO A;  3M7V A;  4GTY A;  3A52 A;  1ED8 A;  5IJQ A;  4ZG7 A;  3MK0 A;  3TG0 A;  4LRA A;  4UPI A;  4CXU A;  5DLW A;  1O98 A;  2W5W A;  4LRC A;  3IGZ B;  1EW8 A;  2GA3 A;  3WAX A;  3DPC A;  4LRE A;  1B8J A;  1KH9 A;  5L0E A;  1HDH A;  3NKQ A;  3T02 A;  4ZG6 A;  2VQR A;  4UPL A;  1P49 A;  1Y6V A;  5INH A;  2W8D A;  2W5V A;  1AJC A;  1ALK A;  1KH4 A;  3BDG B;  4KAY A;  4LR2 A;  5K4P A;  3NVL A;  1AUK A;  3UN3 A;  1AJD A;  4UOP A;  3TX0 A;  2ANH A;  3M8Y A;  3KD8 A;  4GTZ A;  1ALH A;  5LRN A;  3MK2 A;  4CXS A;  1AJA A;  2W8S A;  1ANI A;  2XR9 A;  3NKR A;  4MIV A;  4GTW A;  4KAV A;  5GOV A;  5L0B A;  2W5T A;  3B5Q A;  4NWJ A;  1ELX A;  1KHL A;  1KHK A;  5DLT A;  3NKP A;  1KH7 A;  2IFY A;  4UOR A;  1Y7A A;  1FSU A;  3M8Z A;  1E1Z P;  4LRF A;  5L0K A;  1ALJ A;  4KJD A;  3WAW A;  4CXK A;  3UNY A;  2D1G A;  1E3C P;  3MK1 A;  5TJ3 A;  3T00 A;  4KJG A;  2IUC A;  3IGY B;  1ZEB A;  4YR1 A;  1E33 P;  4LR9 A;  5DLV A;  2W5S A;  1ED9 A;  2W5X A;  3WAY A;  4QAX A;  4N7T A;  4GTX A;  5KXA A;  3T01 A;  4FDI A;  3BDH A;  1O99 A;  4LRD A;  3WAV A;  2G9Y A;  1HQA A;  1ZED A;  1E2S P;  3NKM A;  3Q3Q A;  4UPH A;  5GRR A;  3CMR A;  5IJS A;  5AJ9 A;  3BDF A;  2W5R A;  3SZZ A;  1ELZ A;  1URA A;  4ZGA A;  3UN5 A;  2XRG A;  5EGH A;  3WBH A; 
#chains in the Genus database with same CATH topology
 4ZG9 A;  5LIA A;  3DYC A;  1N2K A;  1AJB A;  5LQQ A;  2RH6 A;  2ZKT A;  5LRM A;  4UOO A;  1EJJ A;  4LR8 A;  4NWX A;  3E2D A;  4LRB A;  3ED4 A;  3BDG A;  1EQJ A;  1SHQ A;  1SHN A;  5C66 A;  1ZEF A;  2GLQ A;  2W5Q A;  4TN0 A;  2IUC B;  3IDD A;  1HJK A;  4UPK A;  3SZY A;  3UO0 A;  4LR7 A;  4LQY A;  3M8W A;  2GSO A;  4MY4 A;  2X98 A;  4MHX A;  1ANJ A;  3TWZ A;  4CYR A;  1KH5 A;  2GSN A;  1KHN A;  1K7H A;  2QZU A;  4KM4 A;  4CYS A;  3OT9 A;  1ALI A;  4B56 A;  1URB A;  1N2L A;  2GSU A;  5EGE A;  1EW2 A;  3NKN A;  3UN2 A;  1EW9 A;  1EI6 A;  1KHJ A;  3LXQ A;  4FDJ A;  1ELY A;  5HRT A;  3NKO A;  3M7V A;  4GTY A;  3A52 A;  1ED8 A;  5IJQ A;  4ZG7 A;  3MK0 A;  3TG0 A;  4LRA A;  4UPI A;  4CXU A;  5DLW A;  1O98 A;  2W5W A;  4LRC A;  3IGZ B;  1EW8 A;  2GA3 A;  3WAX A;  3DPC A;  4LRE A;  1B8J A;  1KH9 A;  5L0E A;  1HDH A;  3NKQ A;  3T02 A;  4ZG6 A;  2VQR A;  4UPL A;  1P49 A;  1Y6V A;  5INH A;  2W8D A;  2W5V A;  1AJC A;  1ALK A;  1KH4 A;  3BDG B;  4KAY A;  4LR2 A;  5K4P A;  3NVL A;  1AUK A;  3UN3 A;  1AJD A;  4UOP A;  3TX0 A;  2ANH A;  3M8Y A;  3KD8 A;  4GTZ A;  1ALH A;  5LRN A;  3MK2 A;  4CXS A;  1AJA A;  2W8S A;  1ANI A;  2XR9 A;  3NKR A;  4MIV A;  4GTW A;  4KAV A;  5GOV A;  5L0B A;  2W5T A;  3B5Q A;  4NWJ A;  1ELX A;  1KHL A;  1KHK A;  5DLT A;  3NKP A;  1KH7 A;  2IFY A;  4UOR A;  1Y7A A;  1FSU A;  3M8Z A;  1E1Z P;  4LRF A;  5L0K A;  1ALJ A;  4KJD A;  3WAW A;  4CXK A;  3UNY A;  2D1G A;  1E3C P;  3MK1 A;  5TJ3 A;  3T00 A;  4KJG A;  2IUC A;  3IGY B;  1ZEB A;  4YR1 A;  1E33 P;  4LR9 A;  5DLV A;  2W5S A;  1ED9 A;  2W5X A;  3WAY A;  4QAX A;  4N7T A;  4GTX A;  5KXA A;  3T01 A;  4FDI A;  3BDH A;  1O99 A;  4LRD A;  3WAV A;  2G9Y A;  1HQA A;  1ZED A;  1E2S P;  3NKM A;  3Q3Q A;  4UPH A;  5GRR A;  3CMR A;  5IJS A;  5AJ9 A;  3BDF A;  2W5R A;  3SZZ A;  1ELZ A;  1URA A;  4ZGA A;  3UN5 A;  2XRG A;  5EGH A;  3WBH A; 
#chains in the Genus database with same CATH homology
 4ZG9 A;  5LIA A;  3DYC A;  1N2K A;  1AJB A;  5LQQ A;  2RH6 A;  2ZKT A;  5LRM A;  4UOO A;  1EJJ A;  4LR8 A;  4NWX A;  3E2D A;  4LRB A;  3ED4 A;  3BDG A;  1EQJ A;  1SHQ A;  1SHN A;  5C66 A;  1ZEF A;  2GLQ A;  2W5Q A;  4TN0 A;  2IUC B;  3IDD A;  1HJK A;  4UPK A;  3SZY A;  3UO0 A;  4LR7 A;  4LQY A;  3M8W A;  2GSO A;  4MY4 A;  2X98 A;  4MHX A;  1ANJ A;  3TWZ A;  4CYR A;  1KH5 A;  2GSN A;  1KHN A;  1K7H A;  2QZU A;  4KM4 A;  4CYS A;  3OT9 A;  1ALI A;  4B56 A;  1URB A;  1N2L A;  2GSU A;  5EGE A;  1EW2 A;  3NKN A;  3UN2 A;  1EW9 A;  1EI6 A;  1KHJ A;  3LXQ A;  4FDJ A;  1ELY A;  5HRT A;  3NKO A;  3M7V A;  4GTY A;  3A52 A;  1ED8 A;  5IJQ A;  4ZG7 A;  3MK0 A;  3TG0 A;  4LRA A;  4UPI A;  4CXU A;  5DLW A;  1O98 A;  2W5W A;  4LRC A;  3IGZ B;  1EW8 A;  2GA3 A;  3WAX A;  3DPC A;  4LRE A;  1B8J A;  1KH9 A;  5L0E A;  1HDH A;  3NKQ A;  3T02 A;  4ZG6 A;  2VQR A;  4UPL A;  1P49 A;  1Y6V A;  5INH A;  2W8D A;  2W5V A;  1AJC A;  1ALK A;  1KH4 A;  3BDG B;  4KAY A;  4LR2 A;  5K4P A;  3NVL A;  1AUK A;  3UN3 A;  1AJD A;  4UOP A;  3TX0 A;  2ANH A;  3M8Y A;  3KD8 A;  4GTZ A;  1ALH A;  5LRN A;  3MK2 A;  4CXS A;  1AJA A;  2W8S A;  1ANI A;  2XR9 A;  3NKR A;  4MIV A;  4GTW A;  4KAV A;  5GOV A;  5L0B A;  2W5T A;  3B5Q A;  4NWJ A;  1ELX A;  1KHL A;  1KHK A;  5DLT A;  3NKP A;  1KH7 A;  2IFY A;  4UOR A;  1Y7A A;  1FSU A;  3M8Z A;  1E1Z P;  4LRF A;  5L0K A;  1ALJ A;  4KJD A;  3WAW A;  4CXK A;  3UNY A;  2D1G A;  1E3C P;  3MK1 A;  5TJ3 A;  3T00 A;  4KJG A;  2IUC A;  3IGY B;  1ZEB A;  4YR1 A;  1E33 P;  4LR9 A;  5DLV A;  2W5S A;  1ED9 A;  2W5X A;  3WAY A;  4QAX A;  4N7T A;  4GTX A;  5KXA A;  3T01 A;  4FDI A;  3BDH A;  1O99 A;  4LRD A;  3WAV A;  2G9Y A;  1HQA A;  1ZED A;  1E2S P;  3NKM A;  3Q3Q A;  4UPH A;  5GRR A;  3CMR A;  5IJS A;  5AJ9 A;  3BDF A;  2W5R A;  3SZZ A;  1ELZ A;  1URA A;  4ZGA A;  3UN5 A;  2XRG A;  5EGH A;  3WBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...