5K5PA

Crystal structure of staphylococcal nuclease variant delta+phs i72k l103k at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEVEFDKGQRTDKYGRGLAYIYADGKMVNEAKVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I72K L103K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5k5pA00
3SK8A 1EZ6A 3C1EA 5KYIA 2F0SA 4G57A 2F0GA 5IGCA 5C4HA 1EYCA 5CC4A 4RKBA 2EYFA 5DEHA 2NUCA 3LX0A 4I65A 4F8MA 1SYDA 4OL7A 4DFAA 5C3WA 5J22A 2F0MA 1A3UA 3R3OA 1SYEA 2F0VA 4LAAA 1EY4A 3QB3A 5IGGA 4IALA 2F0QA 2F0JA 2F0NA 2F0LA 2SOBA 4WRDA 1KAAA 4ME5A 5F2DA 5NUCA 2RDFA 1KDAA 5CV7A 2PQEA 1F2ZA 3NHHA 4KJOA 3S9WA 5EGTA 4N9PA 2EY6A 2RBMA 4ZUIA 5I6YA 4NMZA 1SNDA 1A3TA 4QMGA 1SNQA 2SNMA 3TMEA 1JOOA 4ID6A 1KABA 4ZUJA 2EYLA 1EYDA 2EY1A 1F2YA 1STNA 1EQVA 2OF1A 2PYKA 4K6DA 4KY6A 4QF4A 2EY2A 5CV9A 2RKSA 4EQPA 5EKKA 3TP5A 3TP8A 3MEHA 2LKVA 1A2TA 2F0TA 4K2LA 5I9PA 3QOLA 3NUCA 2EYOA 1II3A 1STYA 3OMGA 5C4ZA 5KRUA 5CV6A 1STHA 3U9OA 2WACA 5K5PA 2EYPA 2OEOA 1SYGA 4ODGA 5C3XA 4YIJA 5IGBA 5J1ZA 3PMFA 2F0OA 1SYFA 3BDCA 4EQNA 1NUCA 1U9RA 3MHBA 4J1MA 5IGFA 2EYJA 4KV6A 1JOKA 3VA5A 3HEJA 3SK5A 3EVQA 4KJNA 1EY8A 5C6AA 1TR5A 5HURA 1JORA 5I9OA 4KD3A 4TRDA 2F0UA 5IODA 1IHZA 1EY7A 4PMBA 3TP6A 2F0PA 3D4WA 2O4XA 3EROA 4KY5A 5E1FA 3SR1A 3D6CA 1JOQA 1TQOA 4K5VA 3NXWA 1STGA 2KHSA 4E6IA 3DHQA 4DGZA 5KIXA 1SNCA 4IZ8A 2PZTA 1SYBA 5JOBA 5IGEA 2PZWA 3MZ5A 4F7XA 5HGTA 1STAA 1F2MA 2F3WA 1ENAA 5I6WA 2HQEA 3NQTA 4K5WA 1KDCA 4B9WA 5IIFA 2EXZA 3OMCA 3P1HA 5CV4A 5C5MA 1EY0A 1EYAA 2EYHA 4K14A 5KGUA 2M00A 4KY7A 3ERQA 4S3SA 3MXPA 4B9XA 5ISRA 2F0EA 2QDBA 5J39A 1KDBA 1NSNS 3QOJA 4K5XA 3T13A 3V2TA 4IUNA 4J6HA 4K8JA 2EY5A 3DMUA 3ITPA 4KD4A 1EY9A 2F3VA 4NDXA 4EQOA 4QB4A 3T16A 3MVVA 4HTHA 5DAUA 5M9OA 4R8NA 4DU9A 2OXPA 4RKLA 4DF7A 3OWFA 4KHVA 4PNYA 4KTAA 5KEEA 2F0HA 5JAVA 1EZ8A 3NK9A 5EKLA 2PZUA 4HMIA 5CV5A 5IOCA 1A2UA 3NP8A 5E3FA 3SHLA 3C1FA 4WORA 2EYMA 2PW7A 4NP5A 4PMCA 4K2KA 5CGKA 5KYLA 1TT2A 3D4DA 1EY5A 5CV8A 3SK4A 3SXHA 3TP7A 1SNPA 1SYCA 2PW5A 1SNOA 2F0DA 4N9TA 3SK6A 5C5LA 3OSOA 2ENBA 5CR3A 2KQ3A 5IGDA 1RKNA 2F0KA 2F0IA 3BDLA 1ENCA 3H6MA 1SNMA 2SNSA 4MIUA 2F0WA 4K8IA 3P75A 1STBA 3D8GA 3HZXA 3RUZA 1A3VA 2F0FA 4HMJA 4NKLA 4ZQ3A 3EJIA 3E5SA 1AEXA 1EY6A 4EVOA 4H7BA
chains in the Genus database with same CATH superfamily
2KCCA 5I2XA 2R3ZA 3U58A 4C1NI 3F8TA 4XTCS 2NUCA 1P8LA 4DFAA 4BA1I 1A3UA 1JT8A 1WTRA 3NE5B 1Y1WH 3H15A 3K7AB 5FLXL 1TWGB 1PH7A 2RQXA 2VY3A 3GO5A 3GTPB 3TSSA 1VDZA 1MKHA 5D14A 2BCOA 3R2TA 1G291 1KXLA 1CA5A 4HIMA 1EQTA 1Q1EA 3AEVA 1ET6A 3RZOB 1TKWB 4AH6A 3I4NB 3M4YA 5DNFA 3W2DA 3PQIA 2IL8A 2WFWA 1U9RA 3HEJA 4KJNA 1YITA 3F2BA 1EYGA 2JA7H 3S2DH 3JAME 1A63A 3HKZB 2CWPA 1HR0Q 3JAMc 2BE5D 3PF4A 1TWAH 4BXXH 2A74C 5M5WB 2B8FA 1SE8A 4Y52H 2R92B 1DOKA 2DY8A 2NZHA 1Q3LA 4PZ7A 3J80i 1I4GA 4DV3Q 1GUSA 3K5NA 2KA7A 1HNWQ 1Q82C 3A74A 4KHVA 4P71A 4GKJQ 4R1JA 4GNXB 2O5IC 3CCJA 1EU4A 1QVFA 4FXDA 4R4QA 4DV3L 5E3FA 3K59A 3D4RA 4WORA 2L15A 1YIJA 3RN5A 5JEAH 1HNWL 1PZJD 4A3GH 1EQQA 1KRSA 2PW5A 1SNOA 1X3GA 4NPSA 3HOYG 3HOWB 2ENBA 4GKJL 2KQ3A 1VQLA 3NEMA 3A5UA 4JI5Q 4DKAC 1IL2A 2BA1A 2F0WA 2IJ0A 2F0FA 4NXNQ 3EJIA 3NWSA 2R7DA 3N6RA 1ET9A 3I56A 3I72A 4RGOS 4CJ0B 1GUTA 1Y1WG 3ZYYX 4JI5L 1H95A 1BCPC 5LHY1 4UP7A 4ZRZA 5GAHC 1X3EA 4NXNL 2E2HH 2HDLA 2OQ0A 4K0KQ 4DV1L 4DK3C 1XXGA 1A3TA 2WP8J 2HD3A 2EYLA 4APVA 5LMNW 4K2LA 4B3TQ 2Z6KA 5E4XA 1UEAB 2WAQG 3QOLA 5TSSA 1ZEQX 2O5JC 3A56A 2OT2A 3TZDA 4K0KL 1UWVA 4LUOA 2F0OA 2JA7G 1BDOA 3UE0A 1GUOA 1EIGA 3MHBA 4BWGB 3E0JA 2EYJA 1O7LA 2RCFA 3SK5A 2VQEQ 2TMPA 4JBMA 2E2IH 1H9SA 4H44C 1ILQA 2L55A 3S24A 1TWAB 3TZUA 1HRJA 4RGNA 2K75A 2VNUD 2HIVA 4OO1G 3DEOA 1STAA 2VQEL 1EWHA 3NQTA 3CF5A 4LFCL 1NE3A 3P1HA 5CV4A 3GTMH 5ELNA 3X3MA 2PNHA 4MN3A 1K83H 3CPWA 1I50H 1MJCA 2DJGC 5GROA 1NTGA 4Y7NB 3DEPA 2IHEA 4EQOA 3LNNA 1VQ9A 4TSSA 5DAUA 3MTSA 2JP1A 3VR2A 2AHOB 4L6TB 4A75A 1QOHA 2HIXA 1SSOA 4B3MQ 3M7GA 2L1BA 1UAPA 3H3VC 1IYVA 4JVZA 3T1YQ 3CQZH 4A3GB 4DK0A 2RDGA 4LUZA 5FLXc 2KECA 2G9HD 3QG1A 1BQQT 2ZTEA 2UU9Q 1SLJA 2LXKA 1AZQA 3H0GB 5C5LA 2K1BA 1V1QA 4B3ML 1IBMQ 1Y8PB 2KUMA 3HZXA 1A3VA 3T1YL 1PTOD 2B8GA 2FINB 3Q22A 4P73A 1B3QA 1F77A 3RLNA 2E8GA 1E2ZA 2R61A 2UU9L 1HUMA 4GN4B 1IBML 1M8AA 4RCNA 3CAMA 1PFBA 1CQVA 1NMGA 2VZAA 2F0NA 4DK6C 4NXMQ 3ICEA 1RF2D 2C9OA 3M3YH 1F2ZA 1LTGD 3KLSA 3F2DA 3CD6A 3GTOH 3MXNB 2B2WA 4QL5A 3S14H 3TMEA 3G6EA 1MD2D 5IYBG 2A8VA 3TP8A 2LKVA 4NXML 1KAWA 1PYSB 4BY7H 1NBWA 5K5PA 2A69C 4A3EB 1NJIC 2KOLA 5IGBA 1AZPA 4H02A 1GUNA 4DV7Q 4OWTB 4YCUA 3HOUH 3LWUA 2E2IB 4J1MA 3FP9A 1YJNA 2OCEA 2B29A 1FYCA 4JI0L 3EVQA 3RMHA 4ZCKA 2ZTDA 5HURA 2K33A 2NBFA 4L63B 2K04A 2E76C 4A93H 1VQGA 4QUFA 4DV7L 2WINB 4DGZA 1LTRD 3J7AF 5M3MG 3S1MH 1DD2A 3GTMB 1PZID 1VQHA 4N8X1 1WFQA 1K83B 3TBIB 4XQJA 2UUCQ 1ASYA 3VR3A 1I50B 5EBCA 4CHTB 3ERQA 4S3SA 3I55A 1KNAA 3STBD 2F0EA 2QDBA 4F87A 3K58A 3QOJA 1HH2P 1VQKA 1HA6A 1X55A 3H3VH 3ITPA 4PV1C 2RF4A 4OEMB 4A3JG 1TY0A 4P2CB 2YV5A 4HTHA 1X32A 3RLFA 1PH2A 2NVYH 1HHVA 3CQZB 2UUCL 1XTDA 1VQPA 1A2UA 1MGSA 3BZKA 4NB3A 1G2SA 1H9RA 3OYYA 4PMCA 1YJWA 2DNCA 5EJWA 1N32L 3SK4A 2B2VA 1XPRA 2RSOA 1VF5C 3OOCA 4DUZQ 3BYYB 2CHBD 1HA5A 3BZDB 1BCPB 4YWLA 3U50C 1ENCA 2AMCB 1D8LA 4RA8A 1STBA 1LT5D 4DR1Q 3G48A 4NKLA 1YHBA 3MEFA 5A2QL 3I70A 1EY6A 1CKNA 4MZ9A 1TS3A 2PMZB 2YU9H 1CA6A 3K81C 2UXBL 1QB5D 4DUZL 1JE5A 3UDIA 3ND9A 3Q23A 2UUAQ 4Q0FA 2FXQA 3QB3A 3M3YB 2BH8A 1H9JA 2JA9A 4O42A 4ME5A 3GTOB 4DAMA 3PO2G 2NTSA 2AUKA 4DR6Q 2YTXA 2XIWA 1QILA 1Y69U 2A68C 2Y0SB 1S4ZA 5C4XB 4ID6A 2UUAL 4IUPA 1PMRA 4RHSA 4HAEA 4HJ5A 3BYTB 1AE2A 1VQCA 5EQ0A 2WKDA 3HOUG 1KD1C 1II3A 4RMFA 2XRQD 4OIJA 5CV6A 4DR6L 4FO2A 4C56C 1XPOA 2GVBA 3GTLB 3TDQA 5J1ZA 1WD0A 1QZHA 1TWFH 1RL2A 2CH4A 4LFAL 2Z6KC 3NBHA 5IE8A 1TR5A 1OO9B 1OTCA 4KD3A 4TRDA 5AJ3Q 3BS1A 1HQRD 3EFXD 2BDNA 3AB9A 3L3OC 3DHQA 2FJ2A 2MP1A 1HPCA 3F1ZA 1PTOB 1W6KA 1JICA 5HGTA 3NSWA 4A3CH 1SE2A 2N3SA 5FLMH 2XN9C 5AJ3L 1K0RA 3NQIA 2UUBQ 3KLSX 4GOPA 5CORA 2VXWA 3HFZB 5C44G 1ESRA 3V2TA 5FK9C 1D5ZC 1PH5A 3GTKH 1WCMB 5C0XI 1EQRA 4A3IH 3TS2A 5LMNQ 1B7YB 4NW2A 1D7QA 4KTAA 2F0HA 1LABA 3NENA 2B2YA 2UUBL 4L5QA 5EKLA 3KF6B 1S5ED 4JK1C 2QEJC 1NMFA 4KHZA 1LTBD 1SMYC 2ZXRA 5KYLA 3D4DA 2D2CC 3C3LA 3SXHA 1I3QH 2MGSA 4MTKA 3K7UC 3HOZB 1I6VC 3OSOA 3A7LA 3HRZC 5CR3A 2UXDL 1QUQB 3BDLA 4UY8C 2CVRA 2YU9B 4JV5Q 4EVOA 3Q0AA 1EZ6A 4LNQA 2JYOA 3N52A 4FXKC 1JB3A 2HQLA 2VW9A 5HGQA 2D0PA 4C2MB 5DEHA 1LTAD 3JAML 1S5BD 4F8MA 3CCMA 4R4OA 2F0VA 4A3KG 2GA4B 5IGGA 3HP3A 4JYAQ 2IX0A 4JV5L 3ONAB 4G7ZC 2WV6D 1AH9A 3ND8A 4RHRA 4DAPA 1U5KA 4N9PA 4ZUIA 5I6YA 2ZJRA 1K8MA 4HSPA 4BBRH 1DM0B 3RNUA 1KABA 4LF4Q 2EY1A 4L5TA 4QUCA 1P16A 5ELFA 3M9BA 4JYAL 2XVSA 4XT3B 1A15A 4I7AA 2PQAA 1TWFB 5G3LF 3TS0A 2B2WC 2E5LL 5M5XH 1VQEA 1YZ6A 3D31A 1KRTA 3PMFA 2D62A 4LF5Q 1DXMA 4RCOA 1MSHA 1XX8A 3J81E 1NUCA 3MA2B 1J9OA 4N8FA 1IW7D 3J81c 1C9OA 1JORA 4IUTA 2EQSA 2DY7A 4PMBA 3X3NA 2OQKA 2VQFQ 3P20A 2Q8RE 4LF5L 2DN8A 2H4OA 4B3SQ 1B1ZA 4F7XA 1O7ZA 5EPKA 4QIWE 3FKIH 4CDDC 3HOXG 4FF2A 1X3PA 1N36L 4A3IG 1IBLL 2JEBI 2Z0SA 4B3SL 4UP8A 1HFNA 1U4LA 1K0SA 3T16A 3EIVA 1V43A 2WIIB 4DF7A 3QWNA 4RGTA 3L9AX 1PFMA 1ZYRC 1K8GA 1WTXA 2E2JB 3NK9A 1FJGQ 4HMIA 4KMUC 1ONLA 2XWJB 2Z6BA 4LMQD 4FDBA 4ILWA 3SHLA 3C1FA 1CI3M 4DNRB 3M7NA 2JA5B 4LF9Q 2EYMA 1JWSD 4GLXA 2C35B 1I4RA 3PIP3 2A6HD 3H09A 1K9MC 4HJ7A 2LFNA 2HCIA 1OXXK 1VF7A 2K03A 4DR4Q 1I6HH 1FJGL 4C3JH 3CW2C 4EQ5A 3BVMA 4LF9L 4QIWB 3VYSA 1L1OA 2B2VC 4AIMA 4CDFC 4YCWA 5ELDA 4RGMA 1OXTA 3TRZA 3VDYA 1CTMA 4DXFA 4EX5A 3RD4A 2A6ED 3SE0A 2KVMA 4BBRB 4DR5Q 2PCFB 1ML0D 4KJOA 1Q7YC 1STEA 4QMGA 4GN3B 3HOYH 2L4NA 4RAUC 3HOVG 5I9PA 2M2LA 4HIOA 4DR5L 5DM73 1AN8A 1SYGA 1RD9D 3D3RA 4QJFA 3S16B 3HG9A 4KKTA 3CC4A 1EIHA 2LY7A 3QIAA 2A73B 3PO3H 1HUNA 1H9SB 2Q2HA 1KHIA 1Z47A 1EWCA 3J80E 2ZM6Q 5M3FH 5EPJA 2XGTA 4YCVA 4X64Q 3SDZA 2JQOA 3V05A 5D65A 3I4MG 1IHZA 1VS0A 1NAPA 3FKIG 1EEFD 3TREA 1F9QA 1Q8IA 2RDHA 4JW0A 1T5XD 4DUYQ 1H9KA 3HKSA 3NBIA 2E75C 4LK1C 3J7ZC 3JC66 2QILA 5I6WA 2ZM6L 1BKBA 4K5WA 1V1PB 4X64L 2JXMB 5E4WC 1JQYD 1UEBA 3CCLA 2QGQA 1KLGD 4IJLA 4IUNA 3E9HA 4J15A 2K5HA 3V96A 4DUYL 4DU9A 1ZKOA 1NCVA 5CYUA 4GOPC 4JI7Q 2YYZA 2Q2IA 1UNSA 1X3QA 3PGZA 5ELEA 2K5QA 5FOBB 1SN8A 1VQ5A 4C3JG 1I6HB 3OPOA 1DYQA 2B2YC 2F0DA 2MO1A 4N9TA 4OO1H 1XNQQ 3ULJA 3DWQA 4JI7L 2VUMH 3KLRA 1FGBD 5IGDA 1C7YA 1YJ9A 3A7AB 4WJ3M 5LL6S 3RUZA 4A3MG 4OONA 2YTYA 2F52A 1IL8A 4OGQC 4HJAA 2EE1A 2JA6G 4A3FB 4X3TA 3C1EA 1D2BA 2F0SA 2P5ZX 4DV6Q 5IGCA 5GADC 1EYCA 2R92G 3CXCA 1OXUA 1XNQL 3DM3A 3PIO3 1TWHH 3AYHB 1XNRQ 4OELB 4YY3Q 1Q8KA 4JBJA 2TSSA 3EBEA 4V0BA 4KI0A 4DV6L 2WAQE 1Y1VB 3HOYB 1Z9FA 4DNTB 1J6QA 5ELCA 4CJ1B 3WOEA 4CKEA 5JJKA 2O2LD 1XNRL 1EQVA 4XT1B 2EJFC 1N33Q 4YY3L 2RKSA 2ICEC 3MEHA 4DV1Q 1MIUA 1K3RA 1HZCA 2EYOA 3PO3G 3L7ZC 1Y1WB 1GHJA 1JWMD 5M3FG 2K52A 1F9SA 2EDGA 3KDFB 3U4ZA 2DNEA 4JPBW 1QNKA 3DLLA 1N33L 1C0AA 1U4MA 1EWIA 5G3LD 5K36G 1EY7A 1D5XC 5IP9H 4V190 5FKAC 2PZTA 3NTKA 4OX9Q 1SJED 4KK7A 5IYBH 2WAQB 2HHHQ 4B9WA 5IIFA 1BCPD 5C5MA 3KF8B 1LT6D 1YVCA 3I2ZA 5ISRA 3RLOA 2JA7B 1EIFA 3S2DB 1SDFA 4K5XA 4U68A 5EAYA 1WYDA 3AFQA 4IFDJ 4IJHA 4LFCQ 4OX9L 5M9OA 4J8QA 1CKOA 2HHHL 2F1MA 1IBKQ 3G6JB 1PV4A 1IKLA 4X3KA 1AE3A 3KLWA 5CV5A 3NP8A 5T1GA 4BBSG 2QKIC 2VUMG 3ZJYC 3K5LA 1TS4A 4ZYSA 1PXUA 1BOSA 5M3MH 1LO5D 3TN2A 4DNIA 1M1KC 3W5OA 4ALPA 1IBKL 4Q5VA 3GD7A 3EQLC 3D8GA 2AWNA 5JJLA 1CKNB 1B50A 1GD7A 1E0BA 3CMAA 5GAEC 3SK8A 2KEDA 1O78A 1TWHB 3QR8A 4FP5D 4R8IA 1EUJA 5JPMC 3RN2A 1E22A 3SGIA 4A3JH 3SEBA 1CFMA 2MFIA 2Z9HA 4OL7A 2B63G 2ZJPA 1L1OC 4PZ8A 2NVQH 2F0LA 2BOSA 1KAAA 4K6LA 2EY6A 2SNMA 4G4KA 4GKKQ 1STNA 4C3IH 1KLUD 4QF4A 2B3GA 5IY0A 2R93H 2F0TA 3FMCA 3VR5A 3NUCA 3G71A 1HFGA 1ICFB 2R7ZG 1O7IA 2E2HB 1I4XA 3H0GG 5C0XJ 4HN7A 3NBHB 3RR5A 1D1IA 4UPAA 2X6GA 5IP9G 4GKKL 5IGFA 3VA5A 1JB7A 1F9PA 4HIKA 1EY8A 3EN2A 1B2TA 3PSIA 4GLVB 1MSGA 3I3CA 4X66Q 4KY5A 3OTOQ 4BA2I 3PO2H 3E0EA 4DA2A 3UE1A 2OWOA 1FNWA 4JI0Q 4GNXA 1VQDA 3DM1A 1TXYA 5KNDA 1GO3E 1RTNA 1JJCB 4GOPB 1EYAA 4X66L 3OTOL 3MXPA 2SDFA 4KHPQ 5ELBA 4EGVA 1SBBB 2ALYB 2JA8G 1E1OA 1QE6A 4KD4A 1R9TH 3LGJA 3CHBD 2L0CA 3M4PA 1CHPD 4QQBX 3FEWX 5EPLA 4JCVE 1ILPA 1LTLA 4A3EG 1QVGA 4IQZA 1WTOA 2EZVA 1VMPA 1PH1A 4KHPL 3T53B 1JJ2A 5M3MB 3B6YA 4LF7Q 3GTQH 2Q8IB 5ELOA 2A69D 2FHTA 1VQMA 1A6XA 3MXUA 3A8IE 1PRTC 1RKNA 1NY4A 4IPCA 4K8IA 3FVQA 3W1BA 3KFUA 1N32Q 4LF7L 3ER0A 3J81L 4A3JB 3H3VI 1LTID 5C44H 2EOTA 4L5RC 1EOVA 1O80A 2DUDA 1VQ4A 2NVQB 5J22A 4L5SA 1AW7A 2ZXOA 2RA4A 2J0TD 4LW1A 3E9IA 1F9RA 1XMOL 2UXBQ 2IT1A 1G6ZA 4JBKA 4C3IG 2J7ZA 3A8KE 4ZAIA 3S9WA 5EGTA 2RBMA 2R93G 1O7YA 1N8RC 3AMUA 1T9HA 1EU3A 1HJPA 3FPUB 1SJHD 1PH3A 2OF1A 5CV9A 1UE5A 1ASZA 1WTHA 2EJMA 1CT1D 5C4ZA 2KHJA 4YWKA 3CC7A 3PIPA 3BVGA 2XTIA 3IL8A 1PYBA 3S14B 4ZKCB 4A3KH 3PO2B 2F0UA 4WJWA 4IFDH 3SR1A 1U4RA 5T1IA 1HZ9A 2N8NA 4K5VA 4LFAQ 1WJJA 4BY7B 1SYBA 4POFA 4A3DH 1B8AA 3IFDA 2K01A 2PZWA 3DXJC 1VQ6A 1G91A 4UDUC 3HOUB 5IP7G 4DR3Q 1S5CD 3OMCA 4RH6A 1JE4A 1SFOH 2M00A 4KY7A 2Y0SG 5D3DA 1D1KA 3G4SA 2F4VQ 1LACA 2B2TA 3K5OA 1WTWA 4A93B 2PNRC 2A68D 4BY1H 4DR3L 2IY5B 3S1MB 4XQNA 4FF4A 2NN6H 4H13C 3GTJH 1WD1A 2UXCQ 1YNJD 1B3AA 1EIYB 2CCZA 1HXYD 2F4VL 1CM9A 2PW7A 1I94Q 4MHEA 3ULPA 3S1NH 1B53A 3TP7A 3UDGA 1SNPA 2WB1G 1TWCH 2E74C 3CU7A 4G7OC 1LLRD 2F0IA 3H6MA 3S1RH 2EXDA 1FD7D 2HCCA 4JG2A 2UXCL 1FNUA 1GXDC 2N55A 2NVYB 5C44B 3HOXH 1L1OB 1CK1A 2V4DA 3K57A 3S17H 1NR2A 4KLKA 1I94L 1X56A 2UXDQ 1QG7A 4R4IA 3J80L 2OTLA 4RKBA 1YNNC 4I65A 2JE6I 4IPHA 4DV4Q 2F0MA 1WVLA 3M4OH 1FR3A 4L8JA 5I4DA 1B70B 4HR7B 3DWAA 1SRUA 4MNOA 1WOCA 2RDFA 1TS5A 3DUZA 1JR0D 1X6OA 2IX3A 4P75A 1I4QA 4LFBQ 4QGUA 1SNQA 4RFBA 4DV4L 4X6AH 4K6DA 1BUVT 4KY6A 4XDXA 4EQPA 4RWSC 1E24A 3TP5A 2K5VA 4FXGC 3AU7A 2ID0A 2WACA 4ODGA 4LFBL 3HOZG 1GJXA 3PUWA 1MBYA 2VB3X 3AFPA 4A3KB 1SMYD 4IFDG 3I91A 5JPNC 3OWEB 1EL0A 3Q8DA 2NTTA 1R4PB 2L11A 4ME3A 3CCSA 2E5LQ 1FGUA 3CCVA 1NNXA 3KK7A 5BN5A 4JI6Q 4A3DG 3WOFA 1CZWA 4DV0Q 3CMEA 2CW0C 2DJFC 2IPKD 1JOQA 2GN5A 1PDQA 3NXWA 4AYBG 5FO7B 2VL6A 4E6IA 3KBXA 4A3BH 2EPBA 4OIKA 2NVTH 4WJ4A 5IGEA 4XQQA 4LUVA 1QNUA 2AUJD 2F3WA 3BG3A 3PIOA 1W3SA 3HGBA 1M90C 5C3EG 4JI6L 1ZXTA 1IW7C 5KGUA 3HOVH 4DV0L 1G51A 4BY1G 4GNXC 5KNCA 3C46A 3T13A 2NN6G 3GQBA 2D5DA 4K8JA 1N36Q 3PUXA 4PNYA 1IBLQ 5JAVA 2F4IA 1PLFA 1LYLA 1JWUD 1KNEA 2PI2A 4U673 1G6PA 3CCUA 3I4MH 1BBWA 5JEAJ 4JC0A 4C3HG 3A54A 4GS3A 5FO9B 5HY6A 2A5HA 1GUGA 3S1RB 5CV8A 3K6OA 3HOXB 4JI2Q 3GTKB 3S17B 3D0FA 1WTPA 2F0KA 4A3IB 4UAIA 3K7AH 3A55A 1TWGH 1Y8OB 2G9DA 3VR4A 3GTPH 3E5SA 4JI1L 5KYIA 2CFMA 3MXGA 3H94A 2JSOA 3BDOA 5CC4A 4IPGA 4Z9CB 5AFWA 1IXRA 5C0XG 3M4OB 3A0JA 4JI2L 4DPGA 1SYDA 2JJQA 1E1TA 3I4NH 1I3QB 2F0QA 5F2DA 1S72A 1GM5A 1PH6A 1HNXQ 4NMZA 5IWAQ 1BXTA 1VQAA 3K80C 5DM63 1TU2B 2EY2A 1B4OA 1B44D 2K32A 4OWXB 4A3MH 2K28A 1ZYRD 3ERSX 3VYRA 1HNXL 1F2LA 2JA6H 1E2WA 3VA7A 1VQOA 2K50A 5IWAL 1GUWA 2NB0A 4X3SA 2R92H 1HNZL 4ULLA 1FNVA 3TQYA 4A3BG 3AQQA 5C6AA 1OXVA 2I07B 5CMDA 2L9HA 2XSCA 2F03A 2NVTB 3D4WA 3Q24A 2O4XA 3A8JE 3CKIB 3I4OA 2I5MX 2B39A 4IZ8A 5M5XB 4IPDA 2XWBB 2JEAI 3PUVA 2AQ2B 4JI8L 1PTOF 1PH8A 2QEXA 3CCRA 5JJIA 4CGYB 4IN3A 4B9XA 4DR7Q 1L2FA 4PZ6A 1SROA 1S3OA 3L0OA 4IURA 5JVH3 4J6HA 2Z1CA 4B08A 4QB4A 4CJ2C 1Q1BA 4ZK9B 3T56B 3J80c 3FRPB 2CWAA 1Z7TA 3I4MB 3CCQA 1BVSA 2B2TC 2PZUA 3FKIB 1V8QA 4DR7L 4R4CA 3URYA 2MNAA 5K36H 2MPMA 3HKZE 1L0YB 4WFN3 2CKZB 2HUGA 2X6LA 1CSPA 4HSVA 2K14A 4M1UB 1QVCA 2GVAA 3SK6A 4JI4Q 3T4AC 1RJTA 2R6GA 1TS2A 1X54A 4FYDA 3CPFA 2BE5C 1HZAA 1VQIA 1HCZA 3U9OA 1D5MC 2ASBA 3I4NG 1HQMC 1LM0A 2ES2A 3E3XA 1KQSA 5C4HA 3FDTA 2I5HA 4JI4L 1YHQA 1DZ1A 3LX0A 3R3OA 4FNFA 1W6JA 1EY4A 1UE7A 2IW3A 1YBYA 1PHJA 2QA4A 1PA6A 1JMCA 3R93A 4C3JB 4R4TA 4BBSH 2KEEA 2KENA 3FHWA 4RG1A 2QF7A 3HKZG 2ICIA 4OO1I 4A3MB 3OIPA 5C4JH 2LSSA 1I5FA 3KYHC 3KUPA 5EKKA 1K73C 2A19A 2JA6B 4B3RQ 5EBDA 4DAYA 4LWCA 2D0OA 1VMCA 2AKWB 1RCVD 5C3XA 1PRTF 4YIJA 1WTQA 1LTSD 1HTPA 3SVMA 4DR2Q 1HR0L 5M5YH 4EQNA 2G5DA 1YI2A 3LWEA 4G7HC 3MFYA 2B63H 4B3RL 4X62Q 4A3FG 1SE3A 1C48A 1SXTA 5D3IB 3IRBA 4DN4M 5E1FA 5IT9L 4Y7NH 1VQJA 5GAGC 4DR2L 4F88A 4M8AA 2K6AA 4LJZC 3MZ5A 3WWVA 1JCKB 5CBAE 2Z4IA 1BR9A 1RODA 4IUQA 4X62L 3PO3B 2Z4HA 2MUYA 4A4IA 3HOWG 2K05A 5DLQE 2EYHA 2K4KA 3S15H 2L5TA 1BF4A 2BA0A 1Y1VG 5M3FB 1BBXC 3JAMi 2R7ZH 1NSNS 2KCTA 3H0GH 3PF5A 4NDXA 1WI5A 4XXEA 3IFTA 1LT4D 3K0XA 4R8NA 2ATWA 3GV3A 3WDNA 1I4PA 1FVIA 1MHWC 4PMWA 2Z8LA 1EEID 1WTVA 5COYA 1PFSA 1EFWA 3UI2A 3NPPA 1ESFA 2N78A 5CGKA 1GHKA 1Y8NB 2RHQB 4CKBA 2EJGC 3J81j 2N49A 2QCPX 3K8AA 3D6WA 3GP7A 5IYCH 1BO0A 4O2DA 1AEXA 3J7AV 3FPPA 2ZTCA 2DGYA 2F3IA 4OXPA 1RDPD 2JA8H 1PH9A 1Q12A 3R2IA 1PVOA 4BBSB 2VUMB 4JBWA 4A3EH 2SOBA 3KJPA 1GVPA 5CV7A 1GKHA 4B3TL 5C4JB 1L0XB 3UDFA 2KCMA 3GDEA 3IAYA 1B9NA 3GTGH 1SNDA 4BXXG 3CRLC 1JOOA 1QJOA 3QO2A 4ZUJA 4C1NK 3BU2A 4AQYQ 1SR3A 3F2UA 1UUPA 4DV5Q 1Y14B 2OTJA 5M5YB 2K5DA 3MWYW 2B63B 1SYFA 1V1PA 2RSNA 1DJRD 1K3BC 3I7FA 2H1EA 4AQYL 1PTOC 1KL9A 2RVLA 4DV5L 2N88A 2FMCA 3VYTA 2NVXH 5BN3A 1CQFA 2KHSA 5JEAG 1PFNA 4A3GG 1SEBD 3T1HQ 5JOBA 5FLXE 2AQ1B 3NWTA 3S15B 2Q2UA 2HQEA 1KDCA 2R7ZB 1EY0A 3CRKC 1NR4A 4HJ8A 2RCNA 1H9MA 4DK1A 3T1HL 3A5ZB 2EY5A 3BZCA 3MVVA 2KJXA 2OXPA 4RKLA 2FFKB 3S1QH 4OHJA 4TKOB 4XIGS 5IOCA 2VS1A 2JK8A 1L0WA 1QZGA 1KC8C 4XYQA 4YHHQ 1N34Q 2K5NA 5IYCG 1CKMA 5FJ8H 3TEHB 1OXSC 2I46A 1DGSA 3PCOB 5IP7H 2B2UA 1Q81C 3CC2A 1VQ8A 1YEZA 1XPUA 2JA8B 1XWEA 4YHHL 3MFGA 1N34L 5C4XH 1E3PA 1FL0A 2YTVA 1QWYA 2EYFA 3NELA 3L2PA 2QDLA 5EKIA 5A35A 1S5FD 3CCEA 4LAAA 1CHQD 1TVXA 1AFPA 4IALA 1PYWD 3STBC 4WRDA 3PUZA 3GTGB 3KDFA 3GTLH 5IT9E 4KKSA 1A8VA 1EOTA 3NHHA 2CH4W 5IT9c 3MC0B 1DOMA 1YNXA 3W1GA 4O1NA 1SE4A 2PYKA 4X3UA 4IO9A 3J7A5 1DOLA 4KKUA 1XMOQ 1I4HA 4JOIA 3U4VA 5H1SE 4HEDA 2HDMA 3OW7A 5FO8B 1SAPA 5KRUA 3OMGA 2EYPA 1PTOH 3U9SA 2X69A 2PI2E 2PMZE 4KN7C 3PV0A 1LTTD 3KF8A 1C4QA 2BDOA 4O0AA 4QCLA 4KV6A 1JOKA 1VQNA 1JC7A 1A0IA 2NVXB 1CSQA 4C3IB 1PRTD 4ZKBB 1TIID 3S2HH 3E6ZX 2F0PA 2R93B 1WCMH 3D6CA 5E7NA 2ZJQA 5GQOA 1SNCA 2Y0SE 3EA6A 1BNZA 1E7ZA 1HZBA 1GOZA 2PQAB 2KHIA 1F2MA 4I7ZC 1K28A 4ZLTF 4LF6Q 3F2CA 4K14A 1G2TA 1K8AC 2NYZD 3NTHA 3OHXC 1M4VA 2C5CA 3S1QB 3HOZH 1IYJB 2IX1A 4IUVA 2K7VA 5I2YA 1LUZA 3BVZA 3OWFA 4LF6L 4POGA 4A3LH 2J4XA 1HTLD 2WB1E 4IFDI 1B9MA 5FJ8G 4HJ9A 2NZOA 3T51B 1CZGA 4DR1L 4K2KA 4C2MH 5KNBA 1QCBD 1R9TB 2BH2A 5C4XG 2XRSD 1SNMA 2KCNA 2SNSA 4MIUA 5C3EH 3RZDH 2CQOA 1XMQQ 4GZYC 1T5EA 4BY7G 4ZQ3A 1D6EC 1VQBA 1PZKD 4H7BA 1YNJC 4DXGA 1HR0W 2F0GA 3GTQB 2VB2X 4XYOA 3O13A 4PQXA 2NN6I 5C3WA 3J7YW 2K5WA 2E2DC 3I73A 2IWHA 4CBVA 5BN4A 1AP0A 1XMQL 1J5EQ 3Q6SA 2ZT9C 2F0JA 5L37A 1KIXA 4A93G 4DV2Q 2H5XA 1KDAA 4FF3A 4P74A 2PQEA 4C3HH 2WB1B 4QY7A 3KBGA 1N9WA 4A76A 1G8ZD 1F2YA 3MXNA 1Z6HA 4IOAA 1J5EL 1IZ6A 4TQUS 4UP9A 1LT3D 4DV2L 1W2BA 1STYA 1Q90A 3GV6A 2D9UA 5IYDH 3KJOA 5JVG3 3K0YA 2MO0A 1BBUA 4AYBE 5C0XH 1WCMG 5JJZA 3S2HB 4TVAB 5BR8Q 1X3FA 4GLAC 3TP6A 1JJGA 3EROA 2EIFA 5KIXA 1ICWA 4P72A 2R7FA 2E2JH 2L12A 4BS9A 5BR8L 1YNND 3H91A 2EXZA 2JA5H 5LMNL 3C2PA 3OIQA 1R4QB 4H0LC 4PG3A 1S5DD 3M85A 1KTKA 1KDBA 3I8ZA 1RIPA 4A3LG 3VYUA 2MJ8A 1EY9A 2F3VA 1YHAA 2I0QA 3DWPA 1K8OA 4A3DB 5KEEA 1LV9A 2RHSB 3M4QA 4DAVA 1EZ8A 4AYBB 1Q46A 3K5MA 2PO4A 3OW2A 3MAQA 1SFOB 4NP5A 3P7JA 1EY5A 3UDXA 1SYCA 5C3EB 3RZDB 3IKJA 1E2VA 1S40A 2SEBD 2XNAC 1X65A 4BY1B 3P75A 2JN4A 3KOJA 3GTJB 1C8CA 1XTCD 2MQHA 2WKCA 4G57A 2CW0D 2LMCB 1VQFA 5LMUQ 1CUKA 1PRTB 2A1AA 2NZ1D 3W3AA 2B2UC 1Q86C 2HT1A 1IKMA 3S1NB 4FF1A 1SYEA 1TWCB 4JI1Q 4C3HB 5J3BA 4LF4L 5NUCA 3S16H 4LF8Q 2IHFA 4HIDA 3I90A 3R8BA 1UE1A 2V1CC 3G7LA 5LMUL 2AQ3B 1XJVA 2I5LX 1BCPF 1U4PA 1VCIA 4A3CG 1EYDA 5IYDG 4DAYB 5FLMG 1A2TA 4LF8L 1J8IA 1STHA 1TY2A 2A6HC 2OEOA 1MJEA 3RZOH 2MHVA 1EFID 5A2QE 5CBEE 3BDCA 2EVBA 2M9VA 4JOIC 4CDEC 2VQFL 4YWMA 2LXJA 1V9PA 1ENFA 1MI2A 5I9OA 1U0LA 2AWOA 5IODA 3VR6A 4HCSA 3ULLA 1TQOA 1A62A 1STGA 1HNZQ 2KBNA 2JA5G 4IOCA 1SMXA 3CP0A 1ENAA 2Q8TA 2Q2TA 1UE6A 3J81i 2A6EC 5M5WH 2QW7A 4FVMA 4JI3Q 2PPBC 4KN4C 4JI8Q 4UHVA 4CKCA 3DMUA 4R9WA 3I4LA 4OWWB 1DONA 4A3BB 4GN5A 4MTNA 1IYUA 2CQAA 1PH4A 3PUYA 4A3FH 4X65Q 4JI3L 1DCZA 4DR4L 3KF6A 3HOVB 1RTOA 3BJUA 1TT2A 2LS01 2NWGA 4IUUA 2FMMA 4BBRG 1X9NA 3NTIA 1XYIA 4CDCC 3HS0C 1RHPA 1V1OA 5LL6X 2ZXPA 5J39A 4ABNA 1VQ7A 3QJYA 4X65L 1QUQA 3HOWH 4HMJA 1Y1VH 4HCEA
chains in the Genus database with same CATH topology
2KCCA 5I2XA 2R3ZA 4C1NI 4XTCS 2NUCA 4DFAA 4BA1I 1A3UA 1WTRA 3NE5B 3K7AB 5FLXL 1TWGB 2RQXA 3GO5A 3GTPB 3TSSA 1VDZA 5D14A 2BCOA 3R2TA 1G291 1CA5A 1EQTA 1Q1EA 1ET6A 3RZOB 1TKWB 3I4NB 3M4YA 5DNFA 3W2DA 2IL8A 1U9RA 3HEJA 4KJNA 3JAME 3HKZB 2BE5D 2A74C 5M5WB 2B8FA 2R92B 1DOKA 2DY8A 1Q3LA 1I4GA 1GUSA 3K5NA 2KA7A 4KHVA 2O5IC 1EU4A 4FXDA 5E3FA 3K59A 3D4RA 4WORA 5JEAH 1PZJD 2PW5A 1SNOA 3HOWB 2ENBA 2KQ3A 2BA1A 2F0WA 2IJ0A 2F0FA 3EJIA 3NWSA 3N6RA 1ET9A 3I72A 4RGOS 4CJ0B 1GUTA 3ZYYX 1BCPC 5LHY1 4ZRZA 2HDLA 1XXGA 1A3TA 2WP8J 2EYLA 4K2LA 5E4XA 1UEAB 3QOLA 5TSSA 1ZEQX 2O5JC 3A56A 2OT2A 3TZDA 2F0OA 1BDOA 1GUOA 1EIGA 3MHBA 4BWGB 3E0JA 2EYJA 1O7LA 3SK5A 2TMPA 1H9SA 4H44C 1ILQA 2L55A 1TWAB 3TZUA 1HRJA 4RGNA 2VNUD 4OO1G 3DEOA 1STAA 1EWHA 3NQTA 3P1HA 5CV4A 3X3MA 4MN3A 4Y7NB 3DEPA 4EQOA 3LNNA 4TSSA 5DAUA 3MTSA 2JP1A 3VR2A 4L6TB 1QOHA 1SSOA 3M7GA 2L1BA 1UAPA 3H3VC 1IYVA 4A3GB 4DK0A 2RDGA 2KECA 2G9HD 3QG1A 1BQQT 1AZQA 3H0GB 5C5LA 2K1BA 1Y8PB 2KUMA 3HZXA 1A3VA 1PTOD 2B8GA 2FINB 3Q22A 1F77A 1E2ZA 2R61A 1HUMA 1M8AA 4RCNA 1PFBA 1CQVA 2F0NA 1RF2D 2C9OA 1F2ZA 1LTGD 3KLSA 2B2WA 3TMEA 1MD2D 3TP8A 2LKVA 5K5PA 2A69C 4A3EB 2KOLA 5IGBA 1AZPA 1GUNA 3LWUA 2E2IB 4J1MA 1FYCA 3EVQA 3RMHA 5HURA 2K33A 2NBFA 4L63B 2K04A 2E76C 4QUFA 2WINB 4DGZA 1LTRD 3J7AF 1DD2A 3GTMB 1PZID 1K83B 3TBIB 4XQJA 3VR3A 1I50B 5EBCA 4CHTB 3ERQA 4S3SA 1KNAA 2F0EA 2QDBA 4F87A 3K58A 3QOJA 1HA6A 3ITPA 4PV1C 1TY0A 4P2CB 4HTHA 1X32A 3RLFA 1HHVA 3CQZB 1A2UA 1MGSA 1G2SA 1H9RA 4PMCA 2DNCA 5EJWA 3SK4A 2B2VA 2RSOA 1VF5C 3OOCA 3BYYB 2CHBD 1HA5A 3BZDB 1BCPB 1ENCA 4RA8A 1STBA 1LT5D 4NKLA 5A2QL 3I70A 1EY6A 1TS3A 2PMZB 1CA6A 1QB5D 3ND9A 3Q23A 4Q0FA 3QB3A 3M3YB 1H9JA 4O42A 4ME5A 3GTOB 2NTSA 2AUKA 2XIWA 1QILA 1Y69U 2A68C 2Y0SB 1S4ZA 5C4XB 4ID6A 4IUPA 1PMRA 4RHSA 4HAEA 3BYTB 5EQ0A 2WKDA 1II3A 2XRQD 4OIJA 5CV6A 4FO2A 4C56C 3GTLB 3TDQA 5J1ZA 1WD0A 3NBHA 1TR5A 1OO9B 4KD3A 4TRDA 3BS1A 1HQRD 3EFXD 2BDNA 3AB9A 3L3OC 3DHQA 2FJ2A 2MP1A 1HPCA 1PTOB 1W6KA 1JICA 5HGTA 3NSWA 1SE2A 2XN9C 3NQIA 3KLSX 5CORA 2VXWA 1ESRA 3V2TA 5FK9C 1D5ZC 1WCMB 5C0XI 4NW2A 4KTAA 2F0HA 1LABA 2B2YA 5EKLA 1S5ED 4JK1C 2QEJC 4KHZA 1LTBD 1SMYC 2ZXRA 5KYLA 3D4DA 2D2CC 3C3LA 3SXHA 2MGSA 3HOZB 1I6VC 3OSOA 3A7LA 3HRZC 5CR3A 3BDLA 2CVRA 2YU9B 4EVOA 3Q0AA 1EZ6A 2JYOA 3N52A 4FXKC 1JB3A 4C2MB 5DEHA 1LTAD 3JAML 1S5BD 4F8MA 2F0VA 2GA4B 5IGGA 3HP3A 2IX0A 3ONAB 4G7ZC 2WV6D 3ND8A 4RHRA 4DAPA 4N9PA 4ZUIA 5I6YA 1K8MA 4HSPA 1DM0B 1KABA 2EY1A 4QUCA 5ELFA 2XVSA 4XT3B 1A15A 1TWFB 5G3LF 2B2WC 3D31A 3PMFA 2D62A 1DXMA 4RCOA 1MSHA 1XX8A 3J81E 1NUCA 3MA2B 1J9OA 1IW7D 1JORA 4IUTA 2DY7A 4PMBA 3X3NA 3P20A 2Q8RE 2DN8A 2H4OA 1B1ZA 4F7XA 1O7ZA 5EPKA 4FF2A 1X3PA 2JEBI 1HFNA 1U4LA 3T16A 1V43A 2WIIB 4DF7A 3QWNA 4RGTA 3L9AX 1PFMA 1ZYRC 1WTXA 2E2JB 3NK9A 4HMIA 4KMUC 1ONLA 2XWJB 3M7NA 4LMQD 4ILWA 3SHLA 3C1FA 1CI3M 4DNRB 2JA5B 2EYMA 1JWSD 1I4RA 3PIP3 2A6HD 3H09A 2LFNA 2HCIA 1OXXK 1VF7A 2K03A 3BVMA 4QIWB 3VYSA 2B2VC 5ELDA 4RGMA 1OXTA 1CTMA 4DXFA 3RD4A 2A6ED 3SE0A 2KVMA 4BBRB 2PCFB 1ML0D 4KJOA 1STEA 4QMGA 2L4NA 4RAUC 5I9PA 2M2LA 5DM73 1AN8A 1SYGA 1RD9D 3D3RA 3S16B 3HG9A 4KKTA 1EIHA 2LY7A 3QIAA 2A73B 1HUNA 1H9SB 1Z47A 3J80E 1EWCA 5EPJA 3SDZA 3V05A 5D65A 1IHZA 1NAPA 1EEFD 1F9QA 1Q8IA 2RDHA 1T5XD 1H9KA 4LK1C 3NBIA 2E75C 2QILA 5I6WA 4K5WA 1V1PB 2JXMB 5E4WC 1JQYD 1KLGD 4IUNA 3V96A 4DU9A 1ZKOA 1NCVA 5CYUA 2YYZA 1UNSA 1X3QA 5ELEA 2K5QA 5FOBB 4C3JG 1I6HB 3OPOA 1DYQA 2B2YC 2F0DA 4N9TA 4OO1H 3DWQA 3KLRA 1FGBD 5IGDA 3A7AB 5LL6S 3RUZA 1IL8A 4OGQC 2EE1A 4A3FB 4X3TA 3C1EA 1D2BA 2F0SA 5IGCA 1EYCA 1OXUA 3PIO3 2TSSA 4V0BA 4KI0A 1Y1VB 3HOYB 4DNTB 5ELCA 4CJ1B 3WOEA 4CKEA 2O2LD 1EQVA 4XT1B 2EJFC 2RKSA 2ICEC 3MEHA 2EYOA 3L7ZC 1Y1WB 1GHJA 1JWMD 1F9SA 2EDGA 2DNEA 1QNKA 1U4MA 5G3LD 5K36G 1EY7A 1D5XC 4V190 5FKAC 2PZTA 3NTKA 1SJED 4KK7A 2WAQB 4B9WA 5IIFA 1BCPD 5C5MA 1LT6D 5ISRA 2JA7B 3S2DB 1SDFA 4K5XA 4U68A 4IFDJ 5M9OA 4J8QA 2F1MA 3G6JB 1IKLA 4X3KA 5CV5A 3NP8A 5T1GA 2QKIC 3K5LA 1TS4A 4ZYSA 1PXUA 1BOSA 1LO5D 3TN2A 4Q5VA 3GD7A 3EQLC 3D8GA 2AWNA 1B50A 1E0BA 3SK8A 2KEDA 1O78A 1TWHB 4FP5D 4R8IA 5JPMC 3SEBA 1CFMA 4OL7A 2F0LA 2BOSA 1KAAA 4K6LA 2EY6A 2SNMA 4G4KA 1STNA 1KLUD 4QF4A 2F0TA 3FMCA 3VR5A 3NUCA 1HFGA 2E2HB 1I4XA 5C0XJ 4HN7A 1D1IA 2X6GA 5IGFA 3VA5A 1F9PA 1EY8A 1B2TA 1MSGA 3I3CA 4KY5A 4BA2I 4DA2A 1FNWA 3DM1A 5KNDA 1RTNA 1EYAA 3MXPA 2SDFA 5ELBA 4EGVA 1SBBB 4KD4A 1QE6A 3CHBD 2L0CA 1CHPD 3FEWX 5EPLA 1ILPA 4IQZA 1WTOA 2EZVA 1VMPA 3T53B 5M3MB 2Q8IB 2A69D 2FHTA 1A6XA 3MXUA 3A8IE 1PRTC 1RKNA 4K8IA 3FVQA 3J81L 4A3JB 1LTID 2EOTA 1O80A 2NVQB 5J22A 1AW7A 2ZXOA 2RA4A 2J0TD 1F9RA 2IT1A 1G6ZA 4C3IG 2J7ZA 3A8KE 4ZAIA 3S9WA 5EGTA 2RBMA 1O7YA 3AMUA 1EU3A 3FPUB 1SJHD 2OF1A 5CV9A 2EJMA 1CT1D 5C4ZA 3BVGA 3IL8A 3S14B 4ZKCB 3PO2B 2F0UA 4WJWA 4IFDH 3SR1A 1U4RA 5T1IA 4K5VA 4BY7B 1SYBA 3IFDA 2K01A 2PZWA 3DXJC 1G91A 4UDUC 3HOUB 1S5CD 3OMCA 4RH6A 1JE4A 2M00A 4KY7A 5D3DA 1D1KA 1LACA 2B2TA 3K5OA 1WTWA 4A93B 2PNRC 2A68D 3S1MB 4XQNA 4FF4A 2NN6H 4H13C 1WD1A 1YNJD 1B3AA 1HXYD 1CM9A 2PW7A 4MHEA 1B53A 3TP7A 1SNPA 2E74C 3CU7A 4G7OC 1LLRD 2F0IA 3H6MA 1FD7D 2HCCA 1FNUA 1GXDC 2N55A 2NVYB 5C44B 1CK1A 2V4DA 3K57A 1NR2A 1QG7A 3J80L 4RKBA 1YNNC 4I65A 2JE6I 2F0MA 1WVLA 1FR3A 4L8JA 5I4DA 4HR7B 3DWAA 2RDFA 1TS5A 3DUZA 1JR0D 2IX3A 1I4QA 1SNQA 4RFBA 4K6DA 1BUVT 4KY6A 4XDXA 4EQPA 4RWSC 3TP5A 4FXGC 3AU7A 2ID0A 2WACA 4ODGA 1GJXA 3PUWA 1MBYA 2VB3X 4A3KB 4IFDG 1SMYD 5JPNC 3I91A 3OWEB 1EL0A 2NTTA 1R4PB 2L11A 3KK7A 5BN5A 3WOFA 1CZWA 2CW0C 1JOQA 2IPKD 1PDQA 3NXWA 5FO7B 4E6IA 3KBXA 2EPBA 4OIKA 5IGEA 4XQQA 1QNUA 2AUJD 2F3WA 3BG3A 3HGBA 1ZXTA 1IW7C 5KGUA 5KNCA 3C46A 3T13A 2NN6G 3GQBA 2D5DA 4K8JA 3PUXA 4PNYA 5JAVA 2F4IA 1PLFA 1JWUD 1KNEA 4U673 5JEAJ 4C3HG 3A54A 5FO9B 2A5HA 1GUGA 3S1RB 5CV8A 3K6OA 3HOXB 3GTKB 3S17B 1WTPA 2F0KA 4A3IB 4UAIA 3A55A 1Y8OB 2G9DA 3VR4A 3E5SA 5KYIA 3MXGA 3H94A 2JSOA 3BDOA 5CC4A 3M4OB 4Z9CB 5AFWA 5C0XG 1SYDA 1I3QB 2F0QA 5F2DA 4NMZA 1BXTA 5DM63 1TU2B 2EY2A 1B4OA 1B44D 2K32A 2K28A 1ZYRD 3VYRA 1F2LA 1E2WA 3VA7A 1GUWA 2NB0A 4X3SA 4ULLA 1FNVA 5C6AA 1OXVA 2I07B 5CMDA 2L9HA 2XSCA 2F03A 2NVTB 3D4WA 3Q24A 2O4XA 3A8JE 3CKIB 2B39A 4IZ8A 5M5XB 2JEAI 2XWBB 3PUVA 2AQ2B 1PTOF 4CGYB 4IN3A 4B9XA 4IURA 5JVH3 4J6HA 2Z1CA 4B08A 4QB4A 4CJ2C 1Q1BA 4ZK9B 3T56B 3FRPB 1Z7TA 3I4MB 2B2TC 2PZUA 3FKIB 1V8QA 3URYA 5K36H 2MPMA 1L0YB 4WFN3 2HUGA 2X6LA 4HSVA 4M1UB 3SK6A 3T4AC 1RJTA 2R6GA 1TS2A 4FYDA 2BE5C 1HCZA 3U9OA 1D5MC 1HQMC 5C4HA 3FDTA 1DZ1A 3LX0A 3R3OA 4FNFA 1W6JA 1EY4A 2IW3A 3R93A 4C3JB 2KEEA 2QF7A 2ICIA 4OO1I 4A3MB 3OIPA 3KUPA 5EKKA 2JA6B 5EBDA 4DAYA 1VMCA 1RCVD 5C3XA 1PRTF 4YIJA 1WTQA 1LTSD 1HTPA 3SVMA 4EQNA 3LWEA 4G7HC 3MFYA 1SE3A 1C48A 1SXTA 5D3IB 4DN4M 5E1FA 5IT9L 4F88A 4M8AA 2K6AA 4LJZC 3MZ5A 1JCKB 5CBAE 2Z4IA 1BR9A 1RODA 4IUQA 3PO3B 2Z4HA 2MUYA 2K05A 2EYHA 2L5TA 1BF4A 2BA0A 5M3FB 1BBXC 1NSNS 4NDXA 4XXEA 3IFTA 1LT4D 4R8NA 3GV3A 3WDNA 1I4PA 4PMWA 2Z8LA 1EEID 1WTVA 5COYA 3UI2A 3NPPA 1ESFA 5CGKA 1GHKA 1Y8NB 4CKBA 2EJGC 2QCPX 3D6WA 3GP7A 1BO0A 1AEXA 3J7AV 3FPPA 1RDPD 1Q12A 3R2IA 4BBSB 2VUMB 4JBWA 2SOBA 5CV7A 3IAYA 5C4JB 1L0XB 1B9NA 1SNDA 3CRLC 1JOOA 1QJOA 3QO2A 4ZUJA 4C1NK 3F2UA 1UUPA 5M5YB 2K5DA 3MWYW 2B63B 1SYFA 1V1PA 2RSNA 1DJRD 2H1EA 1PTOC 2RVLA 2N88A 2FMCA 3VYTA 5BN3A 1CQFA 2KHSA 5JEAG 1PFNA 1SEBD 5JOBA 5FLXE 2AQ1B 3NWTA 3S15B 2HQEA 1KDCA 2R7ZB 1EY0A 3CRKC 1NR4A 1H9MA 4DK1A 2EY5A 3MVVA 2KJXA 2OXPA 4RKLA 2FFKB 4OHJA 4TKOB 4XIGS 5IOCA 4XYQA 1OXSC 2I46A 2B2UA 2JA8B 1XWEA 3MFGA 1QWYA 2EYFA 5EKIA 5A35A 1S5FD 4LAAA 1CHQD 1TVXA 1AFPA 4IALA 1PYWD 4WRDA 3PUZA 3GTGB 5IT9E 4KKSA 1EOTA 3NHHA 3MC0B 1DOMA 4O1NA 1SE4A 2PYKA 4X3UA 1DOLA 4KKUA 1I4HA 4HEDA 2HDMA 3OW7A 5FO8B 1SAPA 5KRUA 3OMGA 2EYPA 1PTOH 3U9SA 2X69A 4KN7C 3PV0A 1LTTD 3KF8A 1C4QA 2BDOA 4QCLA 4KV6A 1JOKA 1JC7A 2NVXB 4C3IB 1PRTD 4ZKBB 1TIID 3E6ZX 2F0PA 2R93B 3D6CA 1SNCA 3EA6A 1BNZA 1GOZA 1F2MA 4I7ZC 4ZLTF 4K14A 1G2TA 2NYZD 3NTHA 3OHXC 1M4VA 2C5CA 3S1QB 2IX1A 4IUVA 2K7VA 5I2YA 3BVZA 3OWFA 2J4XA 1HTLD 4IFDI 1B9MA 3T51B 1CZGA 4K2KA 5KNBA 1QCBD 1R9TB 2XRSD 1SNMA 2KCNA 2SNSA 4MIUA 4GZYC 1T5EA 4ZQ3A 1D6EC 1PZKD 4H7BA 1YNJC 4DXGA 2F0GA 3GTQB 2VB2X 4XYOA 3O13A 4PQXA 2NN6I 5C3WA 3J7YW 2K5WA 2E2DC 3I73A 2IWHA 4CBVA 5BN4A 1AP0A 3Q6SA 2ZT9C 2F0JA 1KDAA 4FF3A 2PQEA 2WB1B 3KBGA 1G8ZD 1F2YA 3MXNA 1Z6HA 4TQUS 1LT3D 1STYA 1Q90A 3GV6A 2D9UA 5JVG3 3K0YA 5C0XH 5JJZA 3S2HB 3TP6A 3EROA 5KIXA 1ICWA 2L12A 4BS9A 1YNND 3H91A 2EXZA 3C2PA 3OIQA 1R4QB 4H0LC 1S5DD 3M85A 1KTKA 1KDBA 3I8ZA 3VYUA 2MJ8A 1EY9A 2F3VA 3DWPA 1K8OA 4A3DB 5KEEA 1LV9A 4DAVA 1EZ8A 4AYBB 3K5MA 2PO4A 3MAQA 1SFOB 4NP5A 3P7JA 1EY5A 1SYCA 5C3EB 3RZDB 3IKJA 1E2VA 2SEBD 2XNAC 4BY1B 3P75A 3GTJB 1C8CA 1XTCD 2WKCA 4G57A 2CW0D 2LMCB 1PRTB 1IKMA 2NZ1D 3W3AA 2B2UC 3S1NB 4FF1A 1SYEA 1TWCB 4C3HB 5NUCA 3I90A 3R8BA 3G7LA 2AQ3B 1BCPF 1U4PA 1VCIA 1EYDA 1A2TA 1J8IA 1STHA 1TY2A 2A6HC 2OEOA 2MHVA 1EFID 5A2QE 5CBEE 3BDCA 2EVBA 2M9VA 1ENFA 1MI2A 5I9OA 2AWOA 5IODA 3VR6A 4HCSA 1TQOA 1STGA 1ENAA 2Q8TA 2A6EC 4FVMA 2PPBC 4KN4C 4CKCA 3DMUA 4R9WA 3I4LA 1DONA 4A3BB 1IYUA 2CQAA 3PUYA 1DCZA 3HOVB 1RTOA 1TT2A 2LS01 2NWGA 4IUUA 2FMMA 3NTIA 1XYIA 3HS0C 1RHPA 1V1OA 5LL6X 2ZXPA 5J39A 4ABNA 3QJYA 4HMJA 4HCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SK8 A;  1EZ6 A;  3C1E A;  5KYI A;  2F0S A;  4G57 A;  2F0G A;  5IGC A;  5C4H A;  1EYC A;  5CC4 A;  4RKB A;  2EYF A;  5DEH A;  2NUC A;  3LX0 A;  4I65 A;  4F8M A;  1SYD A;  4OL7 A;  4DFA A;  5C3W A;  5J22 A;  2F0M A;  1A3U A;  3R3O A;  1SYE A;  2F0V A;  4LAA A;  1EY4 A;  3QB3 A;  5IGG A;  4IAL A;  2F0Q A;  2F0J A;  2F0N A;  2F0L A;  2SOB A;  4WRD A;  1KAA A;  4ME5 A;  5F2D A;  5NUC A;  2RDF A;  1KDA A;  5CV7 A;  2PQE A;  1F2Z A;  3NHH A;  4KJO A;  3S9W A;  5EGT A;  4N9P A;  2EY6 A;  2RBM A;  4ZUI A;  5I6Y A;  4NMZ A;  1SND A;  1A3T A;  4QMG A;  1SNQ A;  2SNM A;  3TME A;  1JOO A;  4ID6 A;  1KAB A;  4ZUJ A;  2EYL A;  1EYD A;  2EY1 A;  1F2Y A;  1STN A;  1EQV A;  2OF1 A;  2PYK A;  4K6D A;  4KY6 A;  4QF4 A;  2EY2 A;  5CV9 A;  2RKS A;  4EQP A;  5EKK A;  3TP5 A;  3TP8 A;  3MEH A;  2LKV A;  1A2T A;  2F0T A;  4K2L A;  5I9P A;  3QOL A;  3NUC A;  2EYO A;  1II3 A;  1STY A;  3OMG A;  5C4Z A;  5KRU A;  5CV6 A;  1STH A;  3U9O A;  2WAC A;  5K5P A;  2EYP A;  2OEO A;  1SYG A;  4ODG A;  5C3X A;  4YIJ A;  5IGB A;  5J1Z A;  3PMF A;  2F0O A;  1SYF A;  3BDC A;  4EQN A;  1NUC A;  1U9R A;  3MHB A;  4J1M A;  5IGF A;  2EYJ A;  4KV6 A;  1JOK A;  3VA5 A;  3HEJ A;  3SK5 A;  3EVQ A;  4KJN A;  1EY8 A;  5C6A A;  1TR5 A;  5HUR A;  1JOR A;  5I9O A;  4KD3 A;  4TRD A;  2F0U A;  5IOD A;  1IHZ A;  1EY7 A;  4PMB A;  3TP6 A;  2F0P A;  3D4W A;  2O4X A;  3ERO A;  4KY5 A;  5E1F A;  3SR1 A;  3D6C A;  1JOQ A;  1TQO A;  4K5V A;  3NXW A;  1STG A;  2KHS A;  4E6I A;  3DHQ A;  4DGZ A;  5KIX A;  1SNC A;  4IZ8 A;  2PZT A;  1SYB A;  5JOB A;  5IGE A;  2PZW A;  3MZ5 A;  4F7X A;  5HGT A;  1STA A;  1F2M A;  2F3W A;  1ENA A;  5I6W A;  2HQE A;  3NQT A;  4K5W A;  1KDC A;  4B9W A;  5IIF A;  2EXZ A;  3OMC A;  3P1H A;  5CV4 A;  5C5M A;  1EY0 A;  1EYA A;  2EYH A;  4K14 A;  5KGU A;  2M00 A;  4KY7 A;  3ERQ A;  4S3S A;  3MXP A;  4B9X A;  5ISR A;  2F0E A;  2QDB A;  5J39 A;  1KDB A;  1NSN S;  3QOJ A;  4K5X A;  3T13 A;  3V2T A;  4IUN A;  4J6H A;  4K8J A;  2EY5 A;  3DMU A;  3ITP A;  4KD4 A;  1EY9 A;  2F3V A;  4NDX A;  4EQO A;  4QB4 A;  3T16 A;  3MVV A;  4HTH A;  5DAU A;  5M9O A;  4R8N A;  4DU9 A;  2OXP A;  4RKL A;  4DF7 A;  3OWF A;  4KHV A;  4PNY A;  4KTA A;  5KEE A;  2F0H A;  5JAV A;  1EZ8 A;  3NK9 A;  5EKL A;  2PZU A;  4HMI A;  5CV5 A;  5IOC A;  1A2U A;  3NP8 A;  5E3F A;  3SHL A;  3C1F A;  4WOR A;  2EYM A;  2PW7 A;  4NP5 A;  4PMC A;  4K2K A;  5CGK A;  5KYL A;  1TT2 A;  3D4D A;  1EY5 A;  5CV8 A;  3SK4 A;  3SXH A;  3TP7 A;  1SNP A;  1SYC A;  2PW5 A;  1SNO A;  2F0D A;  4N9T A;  3SK6 A;  5C5L A;  3OSO A;  2ENB A;  5CR3 A;  2KQ3 A;  5IGD A;  1RKN A;  2F0K A;  2F0I A;  3BDL A;  1ENC A;  3H6M A;  1SNM A;  2SNS A;  4MIU A;  2F0W A;  4K8I A;  3P75 A;  1STB A;  3D8G A;  3HZX A;  3RUZ A;  1A3V A;  2F0F A;  4HMJ A;  4NKL A;  4ZQ3 A;  3EJI A;  3E5S A;  1AEX A;  1EY6 A;  4EVO A;  4H7B A; 
#chains in the Genus database with same CATH topology
 2KCC A;  5I2X A;  2R3Z A;  3U58 A;  4C1N I;  3F8T A;  4XTC S;  2NUC A;  1P8L A;  4DFA A;  4BA1 I;  1A3U A;  1JT8 A;  1WTR A;  3NE5 B;  1Y1W H;  3H15 A;  3K7A B;  5FLX L;  1TWG B;  1PH7 A;  2RQX A;  2VY3 A;  3GO5 A;  3GTP B;  3TSS A;  1VDZ A;  1MKH A;  5D14 A;  2BCO A;  3R2T A;  1G29 1;  1KXL A;  1CA5 A;  4HIM A;  1EQT A;  1Q1E A;  3AEV A;  1ET6 A;  3RZO B;  1TKW B;  4AH6 A;  3I4N B;  3M4Y A;  5DNF A;  3W2D A;  3PQI A;  2IL8 A;  2WFW A;  1U9R A;  3HEJ A;  4KJN A;  1YIT A;  3F2B A;  1EYG A;  2JA7 H;  3S2D H;  3JAM E;  1A63 A;  3HKZ B;  2CWP A;  1HR0 Q;  3JAM c;  2BE5 D;  3PF4 A;  1TWA H;  4BXX H;  2A74 C;  5M5W B;  2B8F A;  1SE8 A;  4Y52 H;  2R92 B;  1DOK A;  2DY8 A;  2NZH A;  1Q3L A;  4PZ7 A;  3J80 i;  1I4G A;  4DV3 Q;  1GUS A;  3K5N A;  2KA7 A;  1HNW Q;  1Q82 C;  3A74 A;  4KHV A;  4P71 A;  4GKJ Q;  4R1J A;  4GNX B;  2O5I C;  3CCJ A;  1EU4 A;  1QVF A;  4FXD A;  4R4Q A;  4DV3 L;  5E3F A;  3K59 A;  3D4R A;  4WOR A;  2L15 A;  1YIJ A;  3RN5 A;  5JEA H;  1HNW L;  1PZJ D;  4A3G H;  1EQQ A;  1KRS A;  2PW5 A;  1SNO A;  1X3G A;  4NPS A;  3HOY G;  3HOW B;  2ENB A;  4GKJ L;  2KQ3 A;  1VQL A;  3NEM A;  3A5U A;  4JI5 Q;  4DKA C;  1IL2 A;  2BA1 A;  2F0W A;  2IJ0 A;  2F0F A;  4NXN Q;  3EJI A;  3NWS A;  2R7D A;  3N6R A;  1ET9 A;  3I56 A;  3I72 A;  4RGO S;  4CJ0 B;  1GUT A;  1Y1W G;  3ZYY X;  4JI5 L;  1H95 A;  1BCP C;  5LHY 1;  4UP7 A;  4ZRZ A;  5GAH C;  1X3E A;  4NXN L;  2E2H H;  2HDL A;  2OQ0 A;  4K0K Q;  4DV1 L;  4DK3 C;  1XXG A;  1A3T A;  2WP8 J;  2HD3 A;  2EYL A;  4APV A;  5LMN W;  4K2L A;  4B3T Q;  2Z6K A;  5E4X A;  1UEA B;  2WAQ G;  3QOL A;  5TSS A;  1ZEQ X;  2O5J C;  3A56 A;  2OT2 A;  3TZD A;  4K0K L;  1UWV A;  4LUO A;  2F0O A;  2JA7 G;  1BDO A;  3UE0 A;  1GUO A;  1EIG A;  3MHB A;  4BWG B;  3E0J A;  2EYJ A;  1O7L A;  2RCF A;  3SK5 A;  2VQE Q;  2TMP A;  4JBM A;  2E2I H;  1H9S A;  4H44 C;  1ILQ A;  2L55 A;  3S24 A;  1TWA B;  3TZU A;  1HRJ A;  4RGN A;  2K75 A;  2VNU D;  2HIV A;  4OO1 G;  3DEO A;  1STA A;  2VQE L;  1EWH A;  3NQT A;  3CF5 A;  4LFC L;  1NE3 A;  3P1H A;  5CV4 A;  3GTM H;  5ELN A;  3X3M A;  2PNH A;  4MN3 A;  1K83 H;  3CPW A;  1I50 H;  1MJC A;  2DJG C;  5GRO A;  1NTG A;  4Y7N B;  3DEP A;  2IHE A;  4EQO A;  3LNN A;  1VQ9 A;  4TSS A;  5DAU A;  3MTS A;  2JP1 A;  3VR2 A;  2AHO B;  4L6T B;  4A75 A;  1QOH A;  2HIX A;  1SSO A;  4B3M Q;  3M7G A;  2L1B A;  1UAP A;  3H3V C;  1IYV A;  4JVZ A;  3T1Y Q;  3CQZ H;  4A3G B;  4DK0 A;  2RDG A;  4LUZ A;  5FLX c;  2KEC A;  2G9H D;  3QG1 A;  1BQQ T;  2ZTE A;  2UU9 Q;  1SLJ A;  2LXK A;  1AZQ A;  3H0G B;  5C5L A;  2K1B A;  1V1Q A;  4B3M L;  1IBM Q;  1Y8P B;  2KUM A;  3HZX A;  1A3V A;  3T1Y L;  1PTO D;  2B8G A;  2FIN B;  3Q22 A;  4P73 A;  1B3Q A;  1F77 A;  3RLN A;  2E8G A;  1E2Z A;  2R61 A;  2UU9 L;  1HUM A;  4GN4 B;  1IBM L;  1M8A A;  4RCN A;  3CAM A;  1PFB A;  1CQV A;  1NMG A;  2VZA A;  2F0N A;  4DK6 C;  4NXM Q;  3ICE A;  1RF2 D;  2C9O A;  3M3Y H;  1F2Z A;  1LTG D;  3KLS A;  3F2D A;  3CD6 A;  3GTO H;  3MXN B;  2B2W A;  4QL5 A;  3S14 H;  3TME A;  3G6E A;  1MD2 D;  5IYB G;  2A8V A;  3TP8 A;  2LKV A;  4NXM L;  1KAW A;  1PYS B;  4BY7 H;  1NBW A;  5K5P A;  2A69 C;  4A3E B;  1NJI C;  2KOL A;  5IGB A;  1AZP A;  4H02 A;  1GUN A;  4DV7 Q;  4OWT B;  4YCU A;  3HOU H;  3LWU A;  2E2I B;  4J1M A;  3FP9 A;  1YJN A;  2OCE A;  2B29 A;  1FYC A;  4JI0 L;  3EVQ A;  3RMH A;  4ZCK A;  2ZTD A;  5HUR A;  2K33 A;  2NBF A;  4L63 B;  2K04 A;  2E76 C;  4A93 H;  1VQG A;  4QUF A;  4DV7 L;  2WIN B;  4DGZ A;  1LTR D;  3J7A F;  5M3M G;  3S1M H;  1DD2 A;  3GTM B;  1PZI D;  1VQH A;  4N8X 1;  1WFQ A;  1K83 B;  3TBI B;  4XQJ A;  2UUC Q;  1ASY A;  3VR3 A;  1I50 B;  5EBC A;  4CHT B;  3ERQ A;  4S3S A;  3I55 A;  1KNA A;  3STB D;  2F0E A;  2QDB A;  4F87 A;  3K58 A;  3QOJ A;  1HH2 P;  1VQK A;  1HA6 A;  1X55 A;  3H3V H;  3ITP A;  4PV1 C;  2RF4 A;  4OEM B;  4A3J G;  1TY0 A;  4P2C B;  2YV5 A;  4HTH A;  1X32 A;  3RLF A;  1PH2 A;  2NVY H;  1HHV A;  3CQZ B;  2UUC L;  1XTD A;  1VQP A;  1A2U A;  1MGS A;  3BZK A;  4NB3 A;  1G2S A;  1H9R A;  3OYY A;  4PMC A;  1YJW A;  2DNC A;  5EJW A;  1N32 L;  3SK4 A;  2B2V A;  1XPR A;  2RSO A;  1VF5 C;  3OOC A;  4DUZ Q;  3BYY B;  2CHB D;  1HA5 A;  3BZD B;  1BCP B;  4YWL A;  3U50 C;  1ENC A;  2AMC B;  1D8L A;  4RA8 A;  1STB A;  1LT5 D;  4DR1 Q;  3G48 A;  4NKL A;  1YHB A;  3MEF A;  5A2Q L;  3I70 A;  1EY6 A;  1CKN A;  4MZ9 A;  1TS3 A;  2PMZ B;  2YU9 H;  1CA6 A;  3K81 C;  2UXB L;  1QB5 D;  4DUZ L;  1JE5 A;  3UDI A;  3ND9 A;  3Q23 A;  2UUA Q;  4Q0F A;  2FXQ A;  3QB3 A;  3M3Y B;  2BH8 A;  1H9J A;  2JA9 A;  4O42 A;  4ME5 A;  3GTO B;  4DAM A;  3PO2 G;  2NTS A;  2AUK A;  4DR6 Q;  2YTX A;  2XIW A;  1QIL A;  1Y69 U;  2A68 C;  2Y0S B;  1S4Z A;  5C4X B;  4ID6 A;  2UUA L;  4IUP A;  1PMR A;  4RHS A;  4HAE A;  4HJ5 A;  3BYT B;  1AE2 A;  1VQC A;  5EQ0 A;  2WKD A;  3HOU G;  1KD1 C;  1II3 A;  4RMF A;  2XRQ D;  4OIJ A;  5CV6 A;  4DR6 L;  4FO2 A;  4C56 C;  1XPO A;  2GVB A;  3GTL B;  3TDQ A;  5J1Z A;  1WD0 A;  1QZH A;  1TWF H;  1RL2 A;  2CH4 A;  4LFA L;  2Z6K C;  3NBH A;  5IE8 A;  1TR5 A;  1OO9 B;  1OTC A;  4KD3 A;  4TRD A;  5AJ3 Q;  3BS1 A;  1HQR D;  3EFX D;  2BDN A;  3AB9 A;  3L3O C;  3DHQ A;  2FJ2 A;  2MP1 A;  1HPC A;  3F1Z A;  1PTO B;  1W6K A;  1JIC A;  5HGT A;  3NSW A;  4A3C H;  1SE2 A;  2N3S A;  5FLM H;  2XN9 C;  5AJ3 L;  1K0R A;  3NQI A;  2UUB Q;  3KLS X;  4GOP A;  5COR A;  2VXW A;  3HFZ B;  5C44 G;  1ESR A;  3V2T A;  5FK9 C;  1D5Z C;  1PH5 A;  3GTK H;  1WCM B;  5C0X I;  1EQR A;  4A3I H;  3TS2 A;  5LMN Q;  1B7Y B;  4NW2 A;  1D7Q A;  4KTA A;  2F0H A;  1LAB A;  3NEN A;  2B2Y A;  2UUB L;  4L5Q A;  5EKL A;  3KF6 B;  1S5E D;  4JK1 C;  2QEJ C;  1NMF A;  4KHZ A;  1LTB D;  1SMY C;  2ZXR A;  5KYL A;  3D4D A;  2D2C C;  3C3L A;  3SXH A;  1I3Q H;  2MGS A;  4MTK A;  3K7U C;  3HOZ B;  1I6V C;  3OSO A;  3A7L A;  3HRZ C;  5CR3 A;  2UXD L;  1QUQ B;  3BDL A;  4UY8 C;  2CVR A;  2YU9 B;  4JV5 Q;  4EVO A;  3Q0A A;  1EZ6 A;  4LNQ A;  2JYO A;  3N52 A;  4FXK C;  1JB3 A;  2HQL A;  2VW9 A;  5HGQ A;  2D0P A;  4C2M B;  5DEH A;  1LTA D;  3JAM L;  1S5B D;  4F8M A;  3CCM A;  4R4O A;  2F0V A;  4A3K G;  2GA4 B;  5IGG A;  3HP3 A;  4JYA Q;  2IX0 A;  4JV5 L;  3ONA B;  4G7Z C;  2WV6 D;  1AH9 A;  3ND8 A;  4RHR A;  4DAP A;  1U5K A;  4N9P A;  4ZUI A;  5I6Y A;  2ZJR A;  1K8M A;  4HSP A;  4BBR H;  1DM0 B;  3RNU A;  1KAB A;  4LF4 Q;  2EY1 A;  4L5T A;  4QUC A;  1P16 A;  5ELF A;  3M9B A;  4JYA L;  2XVS A;  4XT3 B;  1A15 A;  4I7A A;  2PQA A;  1TWF B;  5G3L F;  3TS0 A;  2B2W C;  2E5L L;  5M5X H;  1VQE A;  1YZ6 A;  3D31 A;  1KRT A;  3PMF A;  2D62 A;  4LF5 Q;  1DXM A;  4RCO A;  1MSH A;  1XX8 A;  3J81 E;  1NUC A;  3MA2 B;  1J9O A;  4N8F A;  1IW7 D;  3J81 c;  1C9O A;  1JOR A;  4IUT A;  2EQS A;  2DY7 A;  4PMB A;  3X3N A;  2OQK A;  2VQF Q;  3P20 A;  2Q8R E;  4LF5 L;  2DN8 A;  2H4O A;  4B3S Q;  1B1Z A;  4F7X A;  1O7Z A;  5EPK A;  4QIW E;  3FKI H;  4CDD C;  3HOX G;  4FF2 A;  1X3P A;  1N36 L;  4A3I G;  1IBL L;  2JEB I;  2Z0S A;  4B3S L;  4UP8 A;  1HFN A;  1U4L A;  1K0S A;  3T16 A;  3EIV A;  1V43 A;  2WII B;  4DF7 A;  3QWN A;  4RGT A;  3L9A X;  1PFM A;  1ZYR C;  1K8G A;  1WTX A;  2E2J B;  3NK9 A;  1FJG Q;  4HMI A;  4KMU C;  1ONL A;  2XWJ B;  2Z6B A;  4LMQ D;  4FDB A;  4ILW A;  3SHL A;  3C1F A;  1CI3 M;  4DNR B;  3M7N A;  2JA5 B;  4LF9 Q;  2EYM A;  1JWS D;  4GLX A;  2C35 B;  1I4R A;  3PIP 3;  2A6H D;  3H09 A;  1K9M C;  4HJ7 A;  2LFN A;  2HCI A;  1OXX K;  1VF7 A;  2K03 A;  4DR4 Q;  1I6H H;  1FJG L;  4C3J H;  3CW2 C;  4EQ5 A;  3BVM A;  4LF9 L;  4QIW B;  3VYS A;  1L1O A;  2B2V C;  4AIM A;  4CDF C;  4YCW A;  5ELD A;  4RGM A;  1OXT A;  3TRZ A;  3VDY A;  1CTM A;  4DXF A;  4EX5 A;  3RD4 A;  2A6E D;  3SE0 A;  2KVM A;  4BBR B;  4DR5 Q;  2PCF B;  1ML0 D;  4KJO A;  1Q7Y C;  1STE A;  4QMG A;  4GN3 B;  3HOY H;  2L4N A;  4RAU C;  3HOV G;  5I9P A;  2M2L A;  4HIO A;  4DR5 L;  5DM7 3;  1AN8 A;  1SYG A;  1RD9 D;  3D3R A;  4QJF A;  3S16 B;  3HG9 A;  4KKT A;  3CC4 A;  1EIH A;  2LY7 A;  3QIA A;  2A73 B;  3PO3 H;  1HUN A;  1H9S B;  2Q2H A;  1KHI A;  1Z47 A;  1EWC A;  3J80 E;  2ZM6 Q;  5M3F H;  5EPJ A;  2XGT A;  4YCV A;  4X64 Q;  3SDZ A;  2JQO A;  3V05 A;  5D65 A;  3I4M G;  1IHZ A;  1VS0 A;  1NAP A;  3FKI G;  1EEF D;  3TRE A;  1F9Q A;  1Q8I A;  2RDH A;  4JW0 A;  1T5X D;  4DUY Q;  1H9K A;  3HKS A;  3NBI A;  2E75 C;  4LK1 C;  3J7Z C;  3JC6 6;  2QIL A;  5I6W A;  2ZM6 L;  1BKB A;  4K5W A;  1V1P B;  4X64 L;  2JXM B;  5E4W C;  1JQY D;  1UEB A;  3CCL A;  2QGQ A;  1KLG D;  4IJL A;  4IUN A;  3E9H A;  4J15 A;  2K5H A;  3V96 A;  4DUY L;  4DU9 A;  1ZKO A;  1NCV A;  5CYU A;  4GOP C;  4JI7 Q;  2YYZ A;  2Q2I A;  1UNS A;  1X3Q A;  3PGZ A;  5ELE A;  2K5Q A;  5FOB B;  1SN8 A;  1VQ5 A;  4C3J G;  1I6H B;  3OPO A;  1DYQ A;  2B2Y C;  2F0D A;  2MO1 A;  4N9T A;  4OO1 H;  1XNQ Q;  3ULJ A;  3DWQ A;  4JI7 L;  2VUM H;  3KLR A;  1FGB D;  5IGD A;  1C7Y A;  1YJ9 A;  3A7A B;  4WJ3 M;  5LL6 S;  3RUZ A;  4A3M G;  4OON A;  2YTY A;  2F52 A;  1IL8 A;  4OGQ C;  4HJA A;  2EE1 A;  2JA6 G;  4A3F B;  4X3T A;  3C1E A;  1D2B A;  2F0S A;  2P5Z X;  4DV6 Q;  5IGC A;  5GAD C;  1EYC A;  2R92 G;  3CXC A;  1OXU A;  1XNQ L;  3DM3 A;  3PIO 3;  1TWH H;  3AYH B;  1XNR Q;  4OEL B;  4YY3 Q;  1Q8K A;  4JBJ A;  2TSS A;  3EBE A;  4V0B A;  4KI0 A;  4DV6 L;  2WAQ E;  1Y1V B;  3HOY B;  1Z9F A;  4DNT B;  1J6Q A;  5ELC A;  4CJ1 B;  3WOE A;  4CKE A;  5JJK A;  2O2L D;  1XNR L;  1EQV A;  4XT1 B;  2EJF C;  1N33 Q;  4YY3 L;  2RKS A;  2ICE C;  3MEH A;  4DV1 Q;  1MIU A;  1K3R A;  1HZC A;  2EYO A;  3PO3 G;  3L7Z C;  1Y1W B;  1GHJ A;  1JWM D;  5M3F G;  2K52 A;  1F9S A;  2EDG A;  3KDF B;  3U4Z A;  2DNE A;  4JPB W;  1QNK A;  3DLL A;  1N33 L;  1C0A A;  1U4M A;  1EWI A;  5G3L D;  5K36 G;  1EY7 A;  1D5X C;  5IP9 H;  4V19 0;  5FKA C;  2PZT A;  3NTK A;  4OX9 Q;  1SJE D;  4KK7 A;  5IYB H;  2WAQ B;  2HHH Q;  4B9W A;  5IIF A;  1BCP D;  5C5M A;  3KF8 B;  1LT6 D;  1YVC A;  3I2Z A;  5ISR A;  3RLO A;  2JA7 B;  1EIF A;  3S2D B;  1SDF A;  4K5X A;  4U68 A;  5EAY A;  1WYD A;  3AFQ A;  4IFD J;  4IJH A;  4LFC Q;  4OX9 L;  5M9O A;  4J8Q A;  1CKO A;  2HHH L;  2F1M A;  1IBK Q;  3G6J B;  1PV4 A;  1IKL A;  4X3K A;  1AE3 A;  3KLW A;  5CV5 A;  3NP8 A;  5T1G A;  4BBS G;  2QKI C;  2VUM G;  3ZJY C;  3K5L A;  1TS4 A;  4ZYS A;  1PXU A;  1BOS A;  5M3M H;  1LO5 D;  3TN2 A;  4DNI A;  1M1K C;  3W5O A;  4ALP A;  1IBK L;  4Q5V A;  3GD7 A;  3EQL C;  3D8G A;  2AWN A;  5JJL A;  1CKN B;  1B50 A;  1GD7 A;  1E0B A;  3CMA A;  5GAE C;  3SK8 A;  2KED A;  1O78 A;  1TWH B;  3QR8 A;  4FP5 D;  4R8I A;  1EUJ A;  5JPM C;  3RN2 A;  1E22 A;  3SGI A;  4A3J H;  3SEB A;  1CFM A;  2MFI A;  2Z9H A;  4OL7 A;  2B63 G;  2ZJP A;  1L1O C;  4PZ8 A;  2NVQ H;  2F0L A;  2BOS A;  1KAA A;  4K6L A;  2EY6 A;  2SNM A;  4G4K A;  4GKK Q;  1STN A;  4C3I H;  1KLU D;  4QF4 A;  2B3G A;  5IY0 A;  2R93 H;  2F0T A;  3FMC A;  3VR5 A;  3NUC A;  3G71 A;  1HFG A;  1ICF B;  2R7Z G;  1O7I A;  2E2H B;  1I4X A;  3H0G G;  5C0X J;  4HN7 A;  3NBH B;  3RR5 A;  1D1I A;  4UPA A;  2X6G A;  5IP9 G;  4GKK L;  5IGF A;  3VA5 A;  1JB7 A;  1F9P A;  4HIK A;  1EY8 A;  3EN2 A;  1B2T A;  3PSI A;  4GLV B;  1MSG A;  3I3C A;  4X66 Q;  4KY5 A;  3OTO Q;  4BA2 I;  3PO2 H;  3E0E A;  4DA2 A;  3UE1 A;  2OWO A;  1FNW A;  4JI0 Q;  4GNX A;  1VQD A;  3DM1 A;  1TXY A;  5KND A;  1GO3 E;  1RTN A;  1JJC B;  4GOP B;  1EYA A;  4X66 L;  3OTO L;  3MXP A;  2SDF A;  4KHP Q;  5ELB A;  4EGV A;  1SBB B;  2ALY B;  2JA8 G;  1E1O A;  1QE6 A;  4KD4 A;  1R9T H;  3LGJ A;  3CHB D;  2L0C A;  3M4P A;  1CHP D;  4QQB X;  3FEW X;  5EPL A;  4JCV E;  1ILP A;  1LTL A;  4A3E G;  1QVG A;  4IQZ A;  1WTO A;  2EZV A;  1VMP A;  1PH1 A;  4KHP L;  3T53 B;  1JJ2 A;  5M3M B;  3B6Y A;  4LF7 Q;  3GTQ H;  2Q8I B;  5ELO A;  2A69 D;  2FHT A;  1VQM A;  1A6X A;  3MXU A;  3A8I E;  1PRT C;  1RKN A;  1NY4 A;  4IPC A;  4K8I A;  3FVQ A;  3W1B A;  3KFU A;  1N32 Q;  4LF7 L;  3ER0 A;  3J81 L;  4A3J B;  3H3V I;  1LTI D;  5C44 H;  2EOT A;  4L5R C;  1EOV A;  1O80 A;  2DUD A;  1VQ4 A;  2NVQ B;  5J22 A;  4L5S A;  1AW7 A;  2ZXO A;  2RA4 A;  2J0T D;  4LW1 A;  3E9I A;  1F9R A;  1XMO L;  2UXB Q;  2IT1 A;  1G6Z A;  4JBK A;  4C3I G;  2J7Z A;  3A8K E;  4ZAI A;  3S9W A;  5EGT A;  2RBM A;  2R93 G;  1O7Y A;  1N8R C;  3AMU A;  1T9H A;  1EU3 A;  1HJP A;  3FPU B;  1SJH D;  1PH3 A;  2OF1 A;  5CV9 A;  1UE5 A;  1ASZ A;  1WTH A;  2EJM A;  1CT1 D;  5C4Z A;  2KHJ A;  4YWK A;  3CC7 A;  3PIP A;  3BVG A;  2XTI A;  3IL8 A;  1PYB A;  3S14 B;  4ZKC B;  4A3K H;  3PO2 B;  2F0U A;  4WJW A;  4IFD H;  3SR1 A;  1U4R A;  5T1I A;  1HZ9 A;  2N8N A;  4K5V A;  4LFA Q;  1WJJ A;  4BY7 B;  1SYB A;  4POF A;  4A3D H;  1B8A A;  3IFD A;  2K01 A;  2PZW A;  3DXJ C;  1VQ6 A;  1G91 A;  4UDU C;  3HOU B;  5IP7 G;  4DR3 Q;  1S5C D;  3OMC A;  4RH6 A;  1JE4 A;  1SFO H;  2M00 A;  4KY7 A;  2Y0S G;  5D3D A;  1D1K A;  3G4S A;  2F4V Q;  1LAC A;  2B2T A;  3K5O A;  1WTW A;  4A93 B;  2PNR C;  2A68 D;  4BY1 H;  4DR3 L;  2IY5 B;  3S1M B;  4XQN A;  4FF4 A;  2NN6 H;  4H13 C;  3GTJ H;  1WD1 A;  2UXC Q;  1YNJ D;  1B3A A;  1EIY B;  2CCZ A;  1HXY D;  2F4V L;  1CM9 A;  2PW7 A;  1I94 Q;  4MHE A;  3ULP A;  3S1N H;  1B53 A;  3TP7 A;  3UDG A;  1SNP A;  2WB1 G;  1TWC H;  2E74 C;  3CU7 A;  4G7O C;  1LLR D;  2F0I A;  3H6M A;  3S1R H;  2EXD A;  1FD7 D;  2HCC A;  4JG2 A;  2UXC L;  1FNU A;  1GXD C;  2N55 A;  2NVY B;  5C44 B;  3HOX H;  1L1O B;  1CK1 A;  2V4D A;  3K57 A;  3S17 H;  1NR2 A;  4KLK A;  1I94 L;  1X56 A;  2UXD Q;  1QG7 A;  4R4I A;  3J80 L;  2OTL A;  4RKB A;  1YNN C;  4I65 A;  2JE6 I;  4IPH A;  4DV4 Q;  2F0M A;  1WVL A;  3M4O H;  1FR3 A;  4L8J A;  5I4D A;  1B70 B;  4HR7 B;  3DWA A;  1SRU A;  4MNO A;  1WOC A;  2RDF A;  1TS5 A;  3DUZ A;  1JR0 D;  1X6O A;  2IX3 A;  4P75 A;  1I4Q A;  4LFB Q;  4QGU A;  1SNQ A;  4RFB A;  4DV4 L;  4X6A H;  4K6D A;  1BUV T;  4KY6 A;  4XDX A;  4EQP A;  4RWS C;  1E24 A;  3TP5 A;  2K5V A;  4FXG C;  3AU7 A;  2ID0 A;  2WAC A;  4ODG A;  4LFB L;  3HOZ G;  1GJX A;  3PUW A;  1MBY A;  2VB3 X;  3AFP A;  4A3K B;  1SMY D;  4IFD G;  3I91 A;  5JPN C;  3OWE B;  1EL0 A;  3Q8D A;  2NTT A;  1R4P B;  2L11 A;  4ME3 A;  3CCS A;  2E5L Q;  1FGU A;  3CCV A;  1NNX A;  3KK7 A;  5BN5 A;  4JI6 Q;  4A3D G;  3WOF A;  1CZW A;  4DV0 Q;  3CME A;  2CW0 C;  2DJF C;  2IPK D;  1JOQ A;  2GN5 A;  1PDQ A;  3NXW A;  4AYB G;  5FO7 B;  2VL6 A;  4E6I A;  3KBX A;  4A3B H;  2EPB A;  4OIK A;  2NVT H;  4WJ4 A;  5IGE A;  4XQQ A;  4LUV A;  1QNU A;  2AUJ D;  2F3W A;  3BG3 A;  3PIO A;  1W3S A;  3HGB A;  1M90 C;  5C3E G;  4JI6 L;  1ZXT A;  1IW7 C;  5KGU A;  3HOV H;  4DV0 L;  1G51 A;  4BY1 G;  4GNX C;  5KNC A;  3C46 A;  3T13 A;  2NN6 G;  3GQB A;  2D5D A;  4K8J A;  1N36 Q;  3PUX A;  4PNY A;  1IBL Q;  5JAV A;  2F4I A;  1PLF A;  1LYL A;  1JWU D;  1KNE A;  2PI2 A;  4U67 3;  1G6P A;  3CCU A;  3I4M H;  1BBW A;  5JEA J;  4JC0 A;  4C3H G;  3A54 A;  4GS3 A;  5FO9 B;  5HY6 A;  2A5H A;  1GUG A;  3S1R B;  5CV8 A;  3K6O A;  3HOX B;  4JI2 Q;  3GTK B;  3S17 B;  3D0F A;  1WTP A;  2F0K A;  4A3I B;  4UAI A;  3K7A H;  3A55 A;  1TWG H;  1Y8O B;  2G9D A;  3VR4 A;  3GTP H;  3E5S A;  4JI1 L;  5KYI A;  2CFM A;  3MXG A;  3H94 A;  2JSO A;  3BDO A;  5CC4 A;  4IPG A;  4Z9C B;  5AFW A;  1IXR A;  5C0X G;  3M4O B;  3A0J A;  4JI2 L;  4DPG A;  1SYD A;  2JJQ A;  1E1T A;  3I4N H;  1I3Q B;  2F0Q A;  5F2D A;  1S72 A;  1GM5 A;  1PH6 A;  1HNX Q;  4NMZ A;  5IWA Q;  1BXT A;  1VQA A;  3K80 C;  5DM6 3;  1TU2 B;  2EY2 A;  1B4O A;  1B44 D;  2K32 A;  4OWX B;  4A3M H;  2K28 A;  1ZYR D;  3ERS X;  3VYR A;  1HNX L;  1F2L A;  2JA6 H;  1E2W A;  3VA7 A;  1VQO A;  2K50 A;  5IWA L;  1GUW A;  2NB0 A;  4X3S A;  2R92 H;  1HNZ L;  4ULL A;  1FNV A;  3TQY A;  4A3B G;  3AQQ A;  5C6A A;  1OXV A;  2I07 B;  5CMD A;  2L9H A;  2XSC A;  2F03 A;  2NVT B;  3D4W A;  3Q24 A;  2O4X A;  3A8J E;  3CKI B;  3I4O A;  2I5M X;  2B39 A;  4IZ8 A;  5M5X B;  4IPD A;  2XWB B;  2JEA I;  3PUV A;  2AQ2 B;  4JI8 L;  1PTO F;  1PH8 A;  2QEX A;  3CCR A;  5JJI A;  4CGY B;  4IN3 A;  4B9X A;  4DR7 Q;  1L2F A;  4PZ6 A;  1SRO A;  1S3O A;  3L0O A;  4IUR A;  5JVH 3;  4J6H A;  2Z1C A;  4B08 A;  4QB4 A;  4CJ2 C;  1Q1B A;  4ZK9 B;  3T56 B;  3J80 c;  3FRP B;  2CWA A;  1Z7T A;  3I4M B;  3CCQ A;  1BVS A;  2B2T C;  2PZU A;  3FKI B;  1V8Q A;  4DR7 L;  4R4C A;  3URY A;  2MNA A;  5K36 H;  2MPM A;  3HKZ E;  1L0Y B;  4WFN 3;  2CKZ B;  2HUG A;  2X6L A;  1CSP A;  4HSV A;  2K14 A;  4M1U B;  1QVC A;  2GVA A;  3SK6 A;  4JI4 Q;  3T4A C;  1RJT A;  2R6G A;  1TS2 A;  1X54 A;  4FYD A;  3CPF A;  2BE5 C;  1HZA A;  1VQI A;  1HCZ A;  3U9O A;  1D5M C;  2ASB A;  3I4N G;  1HQM C;  1LM0 A;  2ES2 A;  3E3X A;  1KQS A;  5C4H A;  3FDT A;  2I5H A;  4JI4 L;  1YHQ A;  1DZ1 A;  3LX0 A;  3R3O A;  4FNF A;  1W6J A;  1EY4 A;  1UE7 A;  2IW3 A;  1YBY A;  1PHJ A;  2QA4 A;  1PA6 A;  1JMC A;  3R93 A;  4C3J B;  4R4T A;  4BBS H;  2KEE A;  2KEN A;  3FHW A;  4RG1 A;  2QF7 A;  3HKZ G;  2ICI A;  4OO1 I;  4A3M B;  3OIP A;  5C4J H;  2LSS A;  1I5F A;  3KYH C;  3KUP A;  5EKK A;  1K73 C;  2A19 A;  2JA6 B;  4B3R Q;  5EBD A;  4DAY A;  4LWC A;  2D0O A;  1VMC A;  2AKW B;  1RCV D;  5C3X A;  1PRT F;  4YIJ A;  1WTQ A;  1LTS D;  1HTP A;  3SVM A;  4DR2 Q;  1HR0 L;  5M5Y H;  4EQN A;  2G5D A;  1YI2 A;  3LWE A;  4G7H C;  3MFY A;  2B63 H;  4B3R L;  4X62 Q;  4A3F G;  1SE3 A;  1C48 A;  1SXT A;  5D3I B;  3IRB A;  4DN4 M;  5E1F A;  5IT9 L;  4Y7N H;  1VQJ A;  5GAG C;  4DR2 L;  4F88 A;  4M8A A;  2K6A A;  4LJZ C;  3MZ5 A;  3WWV A;  1JCK B;  5CBA E;  2Z4I A;  1BR9 A;  1ROD A;  4IUQ A;  4X62 L;  3PO3 B;  2Z4H A;  2MUY A;  4A4I A;  3HOW G;  2K05 A;  5DLQ E;  2EYH A;  2K4K A;  3S15 H;  2L5T A;  1BF4 A;  2BA0 A;  1Y1V G;  5M3F B;  1BBX C;  3JAM i;  2R7Z H;  1NSN S;  2KCT A;  3H0G H;  3PF5 A;  4NDX A;  1WI5 A;  4XXE A;  3IFT A;  1LT4 D;  3K0X A;  4R8N A;  2ATW A;  3GV3 A;  3WDN A;  1I4P A;  1FVI A;  1MHW C;  4PMW A;  2Z8L A;  1EEI D;  1WTV A;  5COY A;  1PFS A;  1EFW A;  3UI2 A;  3NPP A;  1ESF A;  2N78 A;  5CGK A;  1GHK A;  1Y8N B;  2RHQ B;  4CKB A;  2EJG C;  3J81 j;  2N49 A;  2QCP X;  3K8A A;  3D6W A;  3GP7 A;  5IYC H;  1BO0 A;  4O2D A;  1AEX A;  3J7A V;  3FPP A;  2ZTC A;  2DGY A;  2F3I A;  4OXP A;  1RDP D;  2JA8 H;  1PH9 A;  1Q12 A;  3R2I A;  1PVO A;  4BBS B;  2VUM B;  4JBW A;  4A3E H;  2SOB A;  3KJP A;  1GVP A;  5CV7 A;  1GKH A;  4B3T L;  5C4J B;  1L0X B;  3UDF A;  2KCM A;  3GDE A;  3IAY A;  1B9N A;  3GTG H;  1SND A;  4BXX G;  3CRL C;  1JOO A;  1QJO A;  3QO2 A;  4ZUJ A;  4C1N K;  3BU2 A;  4AQY Q;  1SR3 A;  3F2U A;  1UUP A;  4DV5 Q;  1Y14 B;  2OTJ A;  5M5Y B;  2K5D A;  3MWY W;  2B63 B;  1SYF A;  1V1P A;  2RSN A;  1DJR D;  1K3B C;  3I7F A;  2H1E A;  4AQY L;  1PTO C;  1KL9 A;  2RVL A;  4DV5 L;  2N88 A;  2FMC A;  3VYT A;  2NVX H;  5BN3 A;  1CQF A;  2KHS A;  5JEA G;  1PFN A;  4A3G G;  1SEB D;  3T1H Q;  5JOB A;  5FLX E;  2AQ1 B;  3NWT A;  3S15 B;  2Q2U A;  2HQE A;  1KDC A;  2R7Z B;  1EY0 A;  3CRK C;  1NR4 A;  4HJ8 A;  2RCN A;  1H9M A;  4DK1 A;  3T1H L;  3A5Z B;  2EY5 A;  3BZC A;  3MVV A;  2KJX A;  2OXP A;  4RKL A;  2FFK B;  3S1Q H;  4OHJ A;  4TKO B;  4XIG S;  5IOC A;  2VS1 A;  2JK8 A;  1L0W A;  1QZG A;  1KC8 C;  4XYQ A;  4YHH Q;  1N34 Q;  2K5N A;  5IYC G;  1CKM A;  5FJ8 H;  3TEH B;  1OXS C;  2I46 A;  1DGS A;  3PCO B;  5IP7 H;  2B2U A;  1Q81 C;  3CC2 A;  1VQ8 A;  1YEZ A;  1XPU A;  2JA8 B;  1XWE A;  4YHH L;  3MFG A;  1N34 L;  5C4X H;  1E3P A;  1FL0 A;  2YTV A;  1QWY A;  2EYF A;  3NEL A;  3L2P A;  2QDL A;  5EKI A;  5A35 A;  1S5F D;  3CCE A;  4LAA A;  1CHQ D;  1TVX A;  1AFP A;  4IAL A;  1PYW D;  3STB C;  4WRD A;  3PUZ A;  3GTG B;  3KDF A;  3GTL H;  5IT9 E;  4KKS A;  1A8V A;  1EOT A;  3NHH A;  2CH4 W;  5IT9 c;  3MC0 B;  1DOM A;  1YNX A;  3W1G A;  4O1N A;  1SE4 A;  2PYK A;  4X3U A;  4IO9 A;  3J7A 5;  1DOL A;  4KKU A;  1XMO Q;  1I4H A;  4JOI A;  3U4V A;  5H1S E;  4HED A;  2HDM A;  3OW7 A;  5FO8 B;  1SAP A;  5KRU A;  3OMG A;  2EYP A;  1PTO H;  3U9S A;  2X69 A;  2PI2 E;  2PMZ E;  4KN7 C;  3PV0 A;  1LTT D;  3KF8 A;  1C4Q A;  2BDO A;  4O0A A;  4QCL A;  4KV6 A;  1JOK A;  1VQN A;  1JC7 A;  1A0I A;  2NVX B;  1CSQ A;  4C3I B;  1PRT D;  4ZKB B;  1TII D;  3S2H H;  3E6Z X;  2F0P A;  2R93 B;  1WCM H;  3D6C A;  5E7N A;  2ZJQ A;  5GQO A;  1SNC A;  2Y0S E;  3EA6 A;  1BNZ A;  1E7Z A;  1HZB A;  1GOZ A;  2PQA B;  2KHI A;  1F2M A;  4I7Z C;  1K28 A;  4ZLT F;  4LF6 Q;  3F2C A;  4K14 A;  1G2T A;  1K8A C;  2NYZ D;  3NTH A;  3OHX C;  1M4V A;  2C5C A;  3S1Q B;  3HOZ H;  1IYJ B;  2IX1 A;  4IUV A;  2K7V A;  5I2Y A;  1LUZ A;  3BVZ A;  3OWF A;  4LF6 L;  4POG A;  4A3L H;  2J4X A;  1HTL D;  2WB1 E;  4IFD I;  1B9M A;  5FJ8 G;  4HJ9 A;  2NZO A;  3T51 B;  1CZG A;  4DR1 L;  4K2K A;  4C2M H;  5KNB A;  1QCB D;  1R9T B;  2BH2 A;  5C4X G;  2XRS D;  1SNM A;  2KCN A;  2SNS A;  4MIU A;  5C3E H;  3RZD H;  2CQO A;  1XMQ Q;  4GZY C;  1T5E A;  4BY7 G;  4ZQ3 A;  1D6E C;  1VQB A;  1PZK D;  4H7B A;  1YNJ C;  4DXG A;  1HR0 W;  2F0G A;  3GTQ B;  2VB2 X;  4XYO A;  3O13 A;  4PQX A;  2NN6 I;  5C3W A;  3J7Y W;  2K5W A;  2E2D C;  3I73 A;  2IWH A;  4CBV A;  5BN4 A;  1AP0 A;  1XMQ L;  1J5E Q;  3Q6S A;  2ZT9 C;  2F0J A;  5L37 A;  1KIX A;  4A93 G;  4DV2 Q;  2H5X A;  1KDA A;  4FF3 A;  4P74 A;  2PQE A;  4C3H H;  2WB1 B;  4QY7 A;  3KBG A;  1N9W A;  4A76 A;  1G8Z D;  1F2Y A;  3MXN A;  1Z6H A;  4IOA A;  1J5E L;  1IZ6 A;  4TQU S;  4UP9 A;  1LT3 D;  4DV2 L;  1W2B A;  1STY A;  1Q90 A;  3GV6 A;  2D9U A;  5IYD H;  3KJO A;  5JVG 3;  3K0Y A;  2MO0 A;  1BBU A;  4AYB E;  5C0X H;  1WCM G;  5JJZ A;  3S2H B;  4TVA B;  5BR8 Q;  1X3F A;  4GLA C;  3TP6 A;  1JJG A;  3ERO A;  2EIF A;  5KIX A;  1ICW A;  4P72 A;  2R7F A;  2E2J H;  2L12 A;  4BS9 A;  5BR8 L;  1YNN D;  3H91 A;  2EXZ A;  2JA5 H;  5LMN L;  3C2P A;  3OIQ A;  1R4Q B;  4H0L C;  4PG3 A;  1S5D D;  3M85 A;  1KTK A;  1KDB A;  3I8Z A;  1RIP A;  4A3L G;  3VYU A;  2MJ8 A;  1EY9 A;  2F3V A;  1YHA A;  2I0Q A;  3DWP A;  1K8O A;  4A3D B;  5KEE A;  1LV9 A;  2RHS B;  3M4Q A;  4DAV A;  1EZ8 A;  4AYB B;  1Q46 A;  3K5M A;  2PO4 A;  3OW2 A;  3MAQ A;  1SFO B;  4NP5 A;  3P7J A;  1EY5 A;  3UDX A;  1SYC A;  5C3E B;  3RZD B;  3IKJ A;  1E2V A;  1S40 A;  2SEB D;  2XNA C;  1X65 A;  4BY1 B;  3P75 A;  2JN4 A;  3KOJ A;  3GTJ B;  1C8C A;  1XTC D;  2MQH A;  2WKC A;  4G57 A;  2CW0 D;  2LMC B;  1VQF A;  5LMU Q;  1CUK A;  1PRT B;  2A1A A;  2NZ1 D;  3W3A A;  2B2U C;  1Q86 C;  2HT1 A;  1IKM A;  3S1N B;  4FF1 A;  1SYE A;  1TWC B;  4JI1 Q;  4C3H B;  5J3B A;  4LF4 L;  5NUC A;  3S16 H;  4LF8 Q;  2IHF A;  4HID A;  3I90 A;  3R8B A;  1UE1 A;  2V1C C;  3G7L A;  5LMU L;  2AQ3 B;  1XJV A;  2I5L X;  1BCP F;  1U4P A;  1VCI A;  4A3C G;  1EYD A;  5IYD G;  4DAY B;  5FLM G;  1A2T A;  4LF8 L;  1J8I A;  1STH A;  1TY2 A;  2A6H C;  2OEO A;  1MJE A;  3RZO H;  2MHV A;  1EFI D;  5A2Q E;  5CBE E;  3BDC A;  2EVB A;  2M9V A;  4JOI C;  4CDE C;  2VQF L;  4YWM A;  2LXJ A;  1V9P A;  1ENF A;  1MI2 A;  5I9O A;  1U0L A;  2AWO A;  5IOD A;  3VR6 A;  4HCS A;  3ULL A;  1TQO A;  1A62 A;  1STG A;  1HNZ Q;  2KBN A;  2JA5 G;  4IOC A;  1SMX A;  3CP0 A;  1ENA A;  2Q8T A;  2Q2T A;  1UE6 A;  3J81 i;  2A6E C;  5M5W H;  2QW7 A;  4FVM A;  4JI3 Q;  2PPB C;  4KN4 C;  4JI8 Q;  4UHV A;  4CKC A;  3DMU A;  4R9W A;  3I4L A;  4OWW B;  1DON A;  4A3B B;  4GN5 A;  4MTN A;  1IYU A;  2CQA A;  1PH4 A;  3PUY A;  4A3F H;  4X65 Q;  4JI3 L;  1DCZ A;  4DR4 L;  3KF6 A;  3HOV B;  1RTO A;  3BJU A;  1TT2 A;  2LS0 1;  2NWG A;  4IUU A;  2FMM A;  4BBR G;  1X9N A;  3NTI A;  1XYI A;  4CDC C;  3HS0 C;  1RHP A;  1V1O A;  5LL6 X;  2ZXP A;  5J39 A;  4ABN A;  1VQ7 A;  3QJY A;  4X65 L;  1QUQ A;  3HOW H;  4HMJ A;  1Y1V H;  4HCE A; 
#chains in the Genus database with same CATH homology
 2KCC A;  5I2X A;  2R3Z A;  4C1N I;  4XTC S;  2NUC A;  4DFA A;  4BA1 I;  1A3U A;  1WTR A;  3NE5 B;  3K7A B;  5FLX L;  1TWG B;  2RQX A;  3GO5 A;  3GTP B;  3TSS A;  1VDZ A;  5D14 A;  2BCO A;  3R2T A;  1G29 1;  1CA5 A;  1EQT A;  1Q1E A;  1ET6 A;  3RZO B;  1TKW B;  3I4N B;  3M4Y A;  5DNF A;  3W2D A;  2IL8 A;  1U9R A;  3HEJ A;  4KJN A;  3JAM E;  3HKZ B;  2BE5 D;  2A74 C;  5M5W B;  2B8F A;  2R92 B;  1DOK A;  2DY8 A;  1Q3L A;  1I4G A;  1GUS A;  3K5N A;  2KA7 A;  4KHV A;  2O5I C;  1EU4 A;  4FXD A;  5E3F A;  3K59 A;  3D4R A;  4WOR A;  5JEA H;  1PZJ D;  2PW5 A;  1SNO A;  3HOW B;  2ENB A;  2KQ3 A;  2BA1 A;  2F0W A;  2IJ0 A;  2F0F A;  3EJI A;  3NWS A;  3N6R A;  1ET9 A;  3I72 A;  4RGO S;  4CJ0 B;  1GUT A;  3ZYY X;  1BCP C;  5LHY 1;  4ZRZ A;  2HDL A;  1XXG A;  1A3T A;  2WP8 J;  2EYL A;  4K2L A;  5E4X A;  1UEA B;  3QOL A;  5TSS A;  1ZEQ X;  2O5J C;  3A56 A;  2OT2 A;  3TZD A;  2F0O A;  1BDO A;  1GUO A;  1EIG A;  3MHB A;  4BWG B;  3E0J A;  2EYJ A;  1O7L A;  3SK5 A;  2TMP A;  1H9S A;  4H44 C;  1ILQ A;  2L55 A;  1TWA B;  3TZU A;  1HRJ A;  4RGN A;  2VNU D;  4OO1 G;  3DEO A;  1STA A;  1EWH A;  3NQT A;  3P1H A;  5CV4 A;  3X3M A;  4MN3 A;  4Y7N B;  3DEP A;  4EQO A;  3LNN A;  4TSS A;  5DAU A;  3MTS A;  2JP1 A;  3VR2 A;  4L6T B;  1QOH A;  1SSO A;  3M7G A;  2L1B A;  1UAP A;  3H3V C;  1IYV A;  4A3G B;  4DK0 A;  2RDG A;  2KEC A;  2G9H D;  3QG1 A;  1BQQ T;  1AZQ A;  3H0G B;  5C5L A;  2K1B A;  1Y8P B;  2KUM A;  3HZX A;  1A3V A;  1PTO D;  2B8G A;  2FIN B;  3Q22 A;  1F77 A;  1E2Z A;  2R61 A;  1HUM A;  1M8A A;  4RCN A;  1PFB A;  1CQV A;  2F0N A;  1RF2 D;  2C9O A;  1F2Z A;  1LTG D;  3KLS A;  2B2W A;  3TME A;  1MD2 D;  3TP8 A;  2LKV A;  5K5P A;  2A69 C;  4A3E B;  2KOL A;  5IGB A;  1AZP A;  1GUN A;  3LWU A;  2E2I B;  4J1M A;  1FYC A;  3EVQ A;  3RMH A;  5HUR A;  2K33 A;  2NBF A;  4L63 B;  2K04 A;  2E76 C;  4QUF A;  2WIN B;  4DGZ A;  1LTR D;  3J7A F;  1DD2 A;  3GTM B;  1PZI D;  1K83 B;  3TBI B;  4XQJ A;  3VR3 A;  1I50 B;  5EBC A;  4CHT B;  3ERQ A;  4S3S A;  1KNA A;  2F0E A;  2QDB A;  4F87 A;  3K58 A;  3QOJ A;  1HA6 A;  3ITP A;  4PV1 C;  1TY0 A;  4P2C B;  4HTH A;  1X32 A;  3RLF A;  1HHV A;  3CQZ B;  1A2U A;  1MGS A;  1G2S A;  1H9R A;  4PMC A;  2DNC A;  5EJW A;  3SK4 A;  2B2V A;  2RSO A;  1VF5 C;  3OOC A;  3BYY B;  2CHB D;  1HA5 A;  3BZD B;  1BCP B;  1ENC A;  4RA8 A;  1STB A;  1LT5 D;  4NKL A;  5A2Q L;  3I70 A;  1EY6 A;  1TS3 A;  2PMZ B;  1CA6 A;  1QB5 D;  3ND9 A;  3Q23 A;  4Q0F A;  3QB3 A;  3M3Y B;  1H9J A;  4O42 A;  4ME5 A;  3GTO B;  2NTS A;  2AUK A;  2XIW A;  1QIL A;  1Y69 U;  2A68 C;  2Y0S B;  1S4Z A;  5C4X B;  4ID6 A;  4IUP A;  1PMR A;  4RHS A;  4HAE A;  3BYT B;  5EQ0 A;  2WKD A;  1II3 A;  2XRQ D;  4OIJ A;  5CV6 A;  4FO2 A;  4C56 C;  3GTL B;  3TDQ A;  5J1Z A;  1WD0 A;  3NBH A;  1TR5 A;  1OO9 B;  4KD3 A;  4TRD A;  3BS1 A;  1HQR D;  3EFX D;  2BDN A;  3AB9 A;  3L3O C;  3DHQ A;  2FJ2 A;  2MP1 A;  1HPC A;  1PTO B;  1W6K A;  1JIC A;  5HGT A;  3NSW A;  1SE2 A;  2XN9 C;  3NQI A;  3KLS X;  5COR A;  2VXW A;  1ESR A;  3V2T A;  5FK9 C;  1D5Z C;  1WCM B;  5C0X I;  4NW2 A;  4KTA A;  2F0H A;  1LAB A;  2B2Y A;  5EKL A;  1S5E D;  4JK1 C;  2QEJ C;  4KHZ A;  1LTB D;  1SMY C;  2ZXR A;  5KYL A;  3D4D A;  2D2C C;  3C3L A;  3SXH A;  2MGS A;  3HOZ B;  1I6V C;  3OSO A;  3A7L A;  3HRZ C;  5CR3 A;  3BDL A;  2CVR A;  2YU9 B;  4EVO A;  3Q0A A;  1EZ6 A;  2JYO A;  3N52 A;  4FXK C;  1JB3 A;  4C2M B;  5DEH A;  1LTA D;  3JAM L;  1S5B D;  4F8M A;  2F0V A;  2GA4 B;  5IGG A;  3HP3 A;  2IX0 A;  3ONA B;  4G7Z C;  2WV6 D;  3ND8 A;  4RHR A;  4DAP A;  4N9P A;  4ZUI A;  5I6Y A;  1K8M A;  4HSP A;  1DM0 B;  1KAB A;  2EY1 A;  4QUC A;  5ELF A;  2XVS A;  4XT3 B;  1A15 A;  1TWF B;  5G3L F;  2B2W C;  3D31 A;  3PMF A;  2D62 A;  1DXM A;  4RCO A;  1MSH A;  1XX8 A;  3J81 E;  1NUC A;  3MA2 B;  1J9O A;  1IW7 D;  1JOR A;  4IUT A;  2DY7 A;  4PMB A;  3X3N A;  3P20 A;  2Q8R E;  2DN8 A;  2H4O A;  1B1Z A;  4F7X A;  1O7Z A;  5EPK A;  4FF2 A;  1X3P A;  2JEB I;  1HFN A;  1U4L A;  3T16 A;  1V43 A;  2WII B;  4DF7 A;  3QWN A;  4RGT A;  3L9A X;  1PFM A;  1ZYR C;  1WTX A;  2E2J B;  3NK9 A;  4HMI A;  4KMU C;  1ONL A;  2XWJ B;  3M7N A;  4LMQ D;  4ILW A;  3SHL A;  3C1F A;  1CI3 M;  4DNR B;  2JA5 B;  2EYM A;  1JWS D;  1I4R A;  3PIP 3;  2A6H D;  3H09 A;  2LFN A;  2HCI A;  1OXX K;  1VF7 A;  2K03 A;  3BVM A;  4QIW B;  3VYS A;  2B2V C;  5ELD A;  4RGM A;  1OXT A;  1CTM A;  4DXF A;  3RD4 A;  2A6E D;  3SE0 A;  2KVM A;  4BBR B;  2PCF B;  1ML0 D;  4KJO A;  1STE A;  4QMG A;  2L4N A;  4RAU C;  5I9P A;  2M2L A;  5DM7 3;  1AN8 A;  1SYG A;  1RD9 D;  3D3R A;  3S16 B;  3HG9 A;  4KKT A;  1EIH A;  2LY7 A;  3QIA A;  2A73 B;  1HUN A;  1H9S B;  1Z47 A;  3J80 E;  1EWC A;  5EPJ A;  3SDZ A;  3V05 A;  5D65 A;  1IHZ A;  1NAP A;  1EEF D;  1F9Q A;  1Q8I A;  2RDH A;  1T5X D;  1H9K A;  4LK1 C;  3NBI A;  2E75 C;  2QIL A;  5I6W A;  4K5W A;  1V1P B;  2JXM B;  5E4W C;  1JQY D;  1KLG D;  4IUN A;  3V96 A;  4DU9 A;  1ZKO A;  1NCV A;  5CYU A;  2YYZ A;  1UNS A;  1X3Q A;  5ELE A;  2K5Q A;  5FOB B;  4C3J G;  1I6H B;  3OPO A;  1DYQ A;  2B2Y C;  2F0D A;  4N9T A;  4OO1 H;  3DWQ A;  3KLR A;  1FGB D;  5IGD A;  3A7A B;  5LL6 S;  3RUZ A;  1IL8 A;  4OGQ C;  2EE1 A;  4A3F B;  4X3T A;  3C1E A;  1D2B A;  2F0S A;  5IGC A;  1EYC A;  1OXU A;  3PIO 3;  2TSS A;  4V0B A;  4KI0 A;  1Y1V B;  3HOY B;  4DNT B;  5ELC A;  4CJ1 B;  3WOE A;  4CKE A;  2O2L D;  1EQV A;  4XT1 B;  2EJF C;  2RKS A;  2ICE C;  3MEH A;  2EYO A;  3L7Z C;  1Y1W B;  1GHJ A;  1JWM D;  1F9S A;  2EDG A;  2DNE A;  1QNK A;  1U4M A;  5G3L D;  5K36 G;  1EY7 A;  1D5X C;  4V19 0;  5FKA C;  2PZT A;  3NTK A;  1SJE D;  4KK7 A;  2WAQ B;  4B9W A;  5IIF A;  1BCP D;  5C5M A;  1LT6 D;  5ISR A;  2JA7 B;  3S2D B;  1SDF A;  4K5X A;  4U68 A;  4IFD J;  5M9O A;  4J8Q A;  2F1M A;  3G6J B;  1IKL A;  4X3K A;  5CV5 A;  3NP8 A;  5T1G A;  2QKI C;  3K5L A;  1TS4 A;  4ZYS A;  1PXU A;  1BOS A;  1LO5 D;  3TN2 A;  4Q5V A;  3GD7 A;  3EQL C;  3D8G A;  2AWN A;  1B50 A;  1E0B A;  3SK8 A;  2KED A;  1O78 A;  1TWH B;  4FP5 D;  4R8I A;  5JPM C;  3SEB A;  1CFM A;  4OL7 A;  2F0L A;  2BOS A;  1KAA A;  4K6L A;  2EY6 A;  2SNM A;  4G4K A;  1STN A;  1KLU D;  4QF4 A;  2F0T A;  3FMC A;  3VR5 A;  3NUC A;  1HFG A;  2E2H B;  1I4X A;  5C0X J;  4HN7 A;  1D1I A;  2X6G A;  5IGF A;  3VA5 A;  1F9P A;  1EY8 A;  1B2T A;  1MSG A;  3I3C A;  4KY5 A;  4BA2 I;  4DA2 A;  1FNW A;  3DM1 A;  5KND A;  1RTN A;  1EYA A;  3MXP A;  2SDF A;  5ELB A;  4EGV A;  1SBB B;  4KD4 A;  1QE6 A;  3CHB D;  2L0C A;  1CHP D;  3FEW X;  5EPL A;  1ILP A;  4IQZ A;  1WTO A;  2EZV A;  1VMP A;  3T53 B;  5M3M B;  2Q8I B;  2A69 D;  2FHT A;  1A6X A;  3MXU A;  3A8I E;  1PRT C;  1RKN A;  4K8I A;  3FVQ A;  3J81 L;  4A3J B;  1LTI D;  2EOT A;  1O80 A;  2NVQ B;  5J22 A;  1AW7 A;  2ZXO A;  2RA4 A;  2J0T D;  1F9R A;  2IT1 A;  1G6Z A;  4C3I G;  2J7Z A;  3A8K E;  4ZAI A;  3S9W A;  5EGT A;  2RBM A;  1O7Y A;  3AMU A;  1EU3 A;  3FPU B;  1SJH D;  2OF1 A;  5CV9 A;  2EJM A;  1CT1 D;  5C4Z A;  3BVG A;  3IL8 A;  3S14 B;  4ZKC B;  3PO2 B;  2F0U A;  4WJW A;  4IFD H;  3SR1 A;  1U4R A;  5T1I A;  4K5V A;  4BY7 B;  1SYB A;  3IFD A;  2K01 A;  2PZW A;  3DXJ C;  1G91 A;  4UDU C;  3HOU B;  1S5C D;  3OMC A;  4RH6 A;  1JE4 A;  2M00 A;  4KY7 A;  5D3D A;  1D1K A;  1LAC A;  2B2T A;  3K5O A;  1WTW A;  4A93 B;  2PNR C;  2A68 D;  3S1M B;  4XQN A;  4FF4 A;  2NN6 H;  4H13 C;  1WD1 A;  1YNJ D;  1B3A A;  1HXY D;  1CM9 A;  2PW7 A;  4MHE A;  1B53 A;  3TP7 A;  1SNP A;  2E74 C;  3CU7 A;  4G7O C;  1LLR D;  2F0I A;  3H6M A;  1FD7 D;  2HCC A;  1FNU A;  1GXD C;  2N55 A;  2NVY B;  5C44 B;  1CK1 A;  2V4D A;  3K57 A;  1NR2 A;  1QG7 A;  3J80 L;  4RKB A;  1YNN C;  4I65 A;  2JE6 I;  2F0M A;  1WVL A;  1FR3 A;  4L8J A;  5I4D A;  4HR7 B;  3DWA A;  2RDF A;  1TS5 A;  3DUZ A;  1JR0 D;  2IX3 A;  1I4Q A;  1SNQ A;  4RFB A;  4K6D A;  1BUV T;  4KY6 A;  4XDX A;  4EQP A;  4RWS C;  3TP5 A;  4FXG C;  3AU7 A;  2ID0 A;  2WAC A;  4ODG A;  1GJX A;  3PUW A;  1MBY A;  2VB3 X;  4A3K B;  4IFD G;  1SMY D;  5JPN C;  3I91 A;  3OWE B;  1EL0 A;  2NTT A;  1R4P B;  2L11 A;  3KK7 A;  5BN5 A;  3WOF A;  1CZW A;  2CW0 C;  1JOQ A;  2IPK D;  1PDQ A;  3NXW A;  5FO7 B;  4E6I A;  3KBX A;  2EPB A;  4OIK A;  5IGE A;  4XQQ A;  1QNU A;  2AUJ D;  2F3W A;  3BG3 A;  3HGB A;  1ZXT A;  1IW7 C;  5KGU A;  5KNC A;  3C46 A;  3T13 A;  2NN6 G;  3GQB A;  2D5D A;  4K8J A;  3PUX A;  4PNY A;  5JAV A;  2F4I A;  1PLF A;  1JWU D;  1KNE A;  4U67 3;  5JEA J;  4C3H G;  3A54 A;  5FO9 B;  2A5H A;  1GUG A;  3S1R B;  5CV8 A;  3K6O A;  3HOX B;  3GTK B;  3S17 B;  1WTP A;  2F0K A;  4A3I B;  4UAI A;  3A55 A;  1Y8O B;  2G9D A;  3VR4 A;  3E5S A;  5KYI A;  3MXG A;  3H94 A;  2JSO A;  3BDO A;  5CC4 A;  3M4O B;  4Z9C B;  5AFW A;  5C0X G;  1SYD A;  1I3Q B;  2F0Q A;  5F2D A;  4NMZ A;  1BXT A;  5DM6 3;  1TU2 B;  2EY2 A;  1B4O A;  1B44 D;  2K32 A;  2K28 A;  1ZYR D;  3VYR A;  1F2L A;  1E2W A;  3VA7 A;  1GUW A;  2NB0 A;  4X3S A;  4ULL A;  1FNV A;  5C6A A;  1OXV A;  2I07 B;  5CMD A;  2L9H A;  2XSC A;  2F03 A;  2NVT B;  3D4W A;  3Q24 A;  2O4X A;  3A8J E;  3CKI B;  2B39 A;  4IZ8 A;  5M5X B;  2JEA I;  2XWB B;  3PUV A;  2AQ2 B;  1PTO F;  4CGY B;  4IN3 A;  4B9X A;  4IUR A;  5JVH 3;  4J6H A;  2Z1C A;  4B08 A;  4QB4 A;  4CJ2 C;  1Q1B A;  4ZK9 B;  3T56 B;  3FRP B;  1Z7T A;  3I4M B;  2B2T C;  2PZU A;  3FKI B;  1V8Q A;  3URY A;  5K36 H;  2MPM A;  1L0Y B;  4WFN 3;  2HUG A;  2X6L A;  4HSV A;  4M1U B;  3SK6 A;  3T4A C;  1RJT A;  2R6G A;  1TS2 A;  4FYD A;  2BE5 C;  1HCZ A;  3U9O A;  1D5M C;  1HQM C;  5C4H A;  3FDT A;  1DZ1 A;  3LX0 A;  3R3O A;  4FNF A;  1W6J A;  1EY4 A;  2IW3 A;  3R93 A;  4C3J B;  2KEE A;  2QF7 A;  2ICI A;  4OO1 I;  4A3M B;  3OIP A;  3KUP A;  5EKK A;  2JA6 B;  5EBD A;  4DAY A;  1VMC A;  1RCV D;  5C3X A;  1PRT F;  4YIJ A;  1WTQ A;  1LTS D;  1HTP A;  3SVM A;  4EQN A;  3LWE A;  4G7H C;  3MFY A;  1SE3 A;  1C48 A;  1SXT A;  5D3I B;  4DN4 M;  5E1F A;  5IT9 L;  4F88 A;  4M8A A;  2K6A A;  4LJZ C;  3MZ5 A;  1JCK B;  5CBA E;  2Z4I A;  1BR9 A;  1ROD A;  4IUQ A;  3PO3 B;  2Z4H A;  2MUY A;  2K05 A;  2EYH A;  2L5T A;  1BF4 A;  2BA0 A;  5M3F B;  1BBX C;  1NSN S;  4NDX A;  4XXE A;  3IFT A;  1LT4 D;  4R8N A;  3GV3 A;  3WDN A;  1I4P A;  4PMW A;  2Z8L A;  1EEI D;  1WTV A;  5COY A;  3UI2 A;  3NPP A;  1ESF A;  5CGK A;  1GHK A;  1Y8N B;  4CKB A;  2EJG C;  2QCP X;  3D6W A;  3GP7 A;  1BO0 A;  1AEX A;  3J7A V;  3FPP A;  1RDP D;  1Q12 A;  3R2I A;  4BBS B;  2VUM B;  4JBW A;  2SOB A;  5CV7 A;  3IAY A;  5C4J B;  1L0X B;  1B9N A;  1SND A;  3CRL C;  1JOO A;  1QJO A;  3QO2 A;  4ZUJ A;  4C1N K;  3F2U A;  1UUP A;  5M5Y B;  2K5D A;  3MWY W;  2B63 B;  1SYF A;  1V1P A;  2RSN A;  1DJR D;  2H1E A;  1PTO C;  2RVL A;  2N88 A;  2FMC A;  3VYT A;  5BN3 A;  1CQF A;  2KHS A;  5JEA G;  1PFN A;  1SEB D;  5JOB A;  5FLX E;  2AQ1 B;  3NWT A;  3S15 B;  2HQE A;  1KDC A;  2R7Z B;  1EY0 A;  3CRK C;  1NR4 A;  1H9M A;  4DK1 A;  2EY5 A;  3MVV A;  2KJX A;  2OXP A;  4RKL A;  2FFK B;  4OHJ A;  4TKO B;  4XIG S;  5IOC A;  4XYQ A;  1OXS C;  2I46 A;  2B2U A;  2JA8 B;  1XWE A;  3MFG A;  1QWY A;  2EYF A;  5EKI A;  5A35 A;  1S5F D;  4LAA A;  1CHQ D;  1TVX A;  1AFP A;  4IAL A;  1PYW D;  4WRD A;  3PUZ A;  3GTG B;  5IT9 E;  4KKS A;  1EOT A;  3NHH A;  3MC0 B;  1DOM A;  4O1N A;  1SE4 A;  2PYK A;  4X3U A;  1DOL A;  4KKU A;  1I4H A;  4HED A;  2HDM A;  3OW7 A;  5FO8 B;  1SAP A;  5KRU A;  3OMG A;  2EYP A;  1PTO H;  3U9S A;  2X69 A;  4KN7 C;  3PV0 A;  1LTT D;  3KF8 A;  1C4Q A;  2BDO A;  4QCL A;  4KV6 A;  1JOK A;  1JC7 A;  2NVX B;  4C3I B;  1PRT D;  4ZKB B;  1TII D;  3E6Z X;  2F0P A;  2R93 B;  3D6C A;  1SNC A;  3EA6 A;  1BNZ A;  1GOZ A;  1F2M A;  4I7Z C;  4ZLT F;  4K14 A;  1G2T A;  2NYZ D;  3NTH A;  3OHX C;  1M4V A;  2C5C A;  3S1Q B;  2IX1 A;  4IUV A;  2K7V A;  5I2Y A;  3BVZ A;  3OWF A;  2J4X A;  1HTL D;  4IFD I;  1B9M A;  3T51 B;  1CZG A;  4K2K A;  5KNB A;  1QCB D;  1R9T B;  2XRS D;  1SNM A;  2KCN A;  2SNS A;  4MIU A;  4GZY C;  1T5E A;  4ZQ3 A;  1D6E C;  1PZK D;  4H7B A;  1YNJ C;  4DXG A;  2F0G A;  3GTQ B;  2VB2 X;  4XYO A;  3O13 A;  4PQX A;  2NN6 I;  5C3W A;  3J7Y W;  2K5W A;  2E2D C;  3I73 A;  2IWH A;  4CBV A;  5BN4 A;  1AP0 A;  3Q6S A;  2ZT9 C;  2F0J A;  1KDA A;  4FF3 A;  2PQE A;  2WB1 B;  3KBG A;  1G8Z D;  1F2Y A;  3MXN A;  1Z6H A;  4TQU S;  1LT3 D;  1STY A;  1Q90 A;  3GV6 A;  2D9U A;  5JVG 3;  3K0Y A;  5C0X H;  5JJZ A;  3S2H B;  3TP6 A;  3ERO A;  5KIX A;  1ICW A;  2L12 A;  4BS9 A;  1YNN D;  3H91 A;  2EXZ A;  3C2P A;  3OIQ A;  1R4Q B;  4H0L C;  1S5D D;  3M85 A;  1KTK A;  1KDB A;  3I8Z A;  3VYU A;  2MJ8 A;  1EY9 A;  2F3V A;  3DWP A;  1K8O A;  4A3D B;  5KEE A;  1LV9 A;  4DAV A;  1EZ8 A;  4AYB B;  3K5M A;  2PO4 A;  3MAQ A;  1SFO B;  4NP5 A;  3P7J A;  1EY5 A;  1SYC A;  5C3E B;  3RZD B;  3IKJ A;  1E2V A;  2SEB D;  2XNA C;  4BY1 B;  3P75 A;  3GTJ B;  1C8C A;  1XTC D;  2WKC A;  4G57 A;  2CW0 D;  2LMC B;  1PRT B;  1IKM A;  2NZ1 D;  3W3A A;  2B2U C;  3S1N B;  4FF1 A;  1SYE A;  1TWC B;  4C3H B;  5NUC A;  3I90 A;  3R8B A;  3G7L A;  2AQ3 B;  1BCP F;  1U4P A;  1VCI A;  1EYD A;  1A2T A;  1J8I A;  1STH A;  1TY2 A;  2A6H C;  2OEO A;  2MHV A;  1EFI D;  5A2Q E;  5CBE E;  3BDC A;  2EVB A;  2M9V A;  1ENF A;  1MI2 A;  5I9O A;  2AWO A;  5IOD A;  3VR6 A;  4HCS A;  1TQO A;  1STG A;  1ENA A;  2Q8T A;  2A6E C;  4FVM A;  2PPB C;  4KN4 C;  4CKC A;  3DMU A;  4R9W A;  3I4L A;  1DON A;  4A3B B;  1IYU A;  2CQA A;  3PUY A;  1DCZ A;  3HOV B;  1RTO A;  1TT2 A;  2LS0 1;  2NWG A;  4IUU A;  2FMM A;  3NTI A;  1XYI A;  3HS0 C;  1RHP A;  1V1O A;  5LL6 X;  2ZXP A;  5J39 A;  4ABN A;  3QJY A;  4HMJ A;  4HCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...