5K5PA

Crystal structure of staphylococcal nuclease variant delta+phs i72k l103k at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEVEFDKGQRTDKYGRGLAYIYADGKMVNEAKVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I72K L103K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 37
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5k5pA00
1TT2A 4HTHA 1F2ZA 4KJNA 1KAAA 4N9PA 1NSNS 2ENBA 2WACA 4LAAA 3SK4A 5K5PA 5C6AA 4ZQ3A 1ENAA 1EY8A 1STNA 2EY2A 1STBA 1A3VA 5E3FA 4NMZA 1A3UA 2HQEA 3DHQA 2OEOA 4I65A 4K5XA 3SK6A 5C4HA 1II3A 1A2TA 3OMCA 4PMCA 1TR5A 4NKLA 4E6IA 5IGGA 5CR3A 5ISRA 4QMGA 1A2UA 2F0EA 3HZXA 4K8IA 3TP5A 5IGCA 2EXZA 4G57A 4B9WA 3NHHA 4RKLA 3TP8A 4TRDA 1KABA 3BDLA 5EGTA 3R3OA 4HMIA 5JOBA 5F2DA 3D6CA 3H6MA 2OXPA 3NQTA 4EQPA 5I9OA 1SYGA 3NP8A 3P75A 5KIXA 2M00A 2LKVA 3OWFA 2F0QA 1SNPA 4PMBA 3NK9A 5J1ZA 1EQVA 4NDXA 3HEJA 1SYFA 3BDCA 5KYLA 1RKNA 2F0IA 4KY7A 4YIJA 3C1FA 3MZ5A 3EJIA 5DEHA 2F0LA 3D4WA 3EVQA 4NP5A 1SNMA 3EROA 4ZUJA 3SK5A 2SOBA 1SNOA 2F0WA 2EYFA 1U9RA 1AEXA 4QB4A 2OF1A 2F0FA 2F0UA 1F2MA 2F0DA 4K6DA 1SNQA 4EVOA 4QF4A 3T16A 2F0HA 2F3WA 5IGFA 1SYBA 1EY6A 1STHA 4ZUIA 4WORA 2F0VA 1IHZA 4K2KA 5C5LA 5EKKA 4KJOA 5J39A 2QDBA 2PW7A 2F0SA 2KHSA 2RDFA 3NXWA 4HMJA 4K5WA 1STYA 1STGA 1JOOA 3ITPA 2KQ3A 3MXPA 4KTAA 4KY5A 3TP7A 5HURA 1EY4A 2PQEA 1EY7A 3PMFA 3D4DA 3P1HA 4S3SA 3SXHA 4EQOA 5I6YA 4K14A 1SYDA 5CV8A 3V2TA 1SNCA 3RUZA 2EY6A 5IGDA 2EYOA 4H7BA 2PZWA 4PNYA 1F2YA 4RKBA 2EYHA 3VA5A 4DU9A 2RBMA 5KRUA 3C1EA 4WRDA 3SR1A 3OMGA 4ODGA 3DMUA 4J6HA 5CV5A 5KGUA 2NUCA 3QB3A 5I9PA 1A3TA 1EYDA 4K8JA 5HGTA 2F0PA 5IGEA 5J22A 4MIUA 5KYIA 4J1MA 4F7XA 1SNDA 5I6WA 1EYAA 3QOJA 1TQOA 1EZ8A 5C4ZA 5CV7A 4DGZA 2F3VA 5IIFA 4EQNA 4K2LA 4ID6A 4KHVA 5KEEA 3S9WA 1EY9A 5E1FA 1SYCA 2EY5A 3U9OA 1JOKA 1KDAA 5M9OA 1STAA 5IODA 3SHLA 1EYCA 4ME5A 1ENCA 5CV6A 5C5MA 2F0MA 3T13A 1KDBA 5CGKA 1EY0A 2EYMA 3NUCA 5CV4A 2EYPA 1NUCA 2PYKA 3SK8A 4OL7A 2EYLA 5C3WA 2F0KA 3TMEA 2EYJA 2F0JA 4K5VA 3ERQA 3MEHA 4KD4A 4DF7A 5C3XA 3D8GA 1EZ6A 3QOLA 3OSOA 3LX0A 4IZ8A 4KD3A 4R8NA 5EKLA 4B9XA 4DFAA 5NUCA 5IGBA 5JAVA 1JOQA 2O4XA 2PW5A 2SNSA 2F0NA 4IUNA 4KV6A 1JORA 2EY1A 2PZUA 2F0GA 2RKSA 3MHBA 4N9TA 3TP6A 4F8MA 5DAUA 5IOCA 5CC4A 2SNMA 2F0TA 1KDCA 4IALA 2PZTA 3MVVA 4KY6A 3E5SA 5CV9A 1SYEA 2F0OA 1EY5A
chains in the Genus database with same CATH superfamily
3MEFA 1D7QA 2NB0A 5IWAL 2WACA 3SK4A 1VQCA 3AU7A 1TWCB 3OW7A 3S1RH 1ENFA 2K01A 1PFSA 1GO3E 4C3HG 1S40A 1RTNA 3H15A 4NKLA 1VS0A 4JI2Q 2B2UA 3FHWA 1MSGA 2MO0A 3NHHA 4RKLA 3KK7A 4DUZL 2NWGA 2VS1A 1QG7A 2LKVA 2XNAC 1HUMA 1PVOA 2BDOA 1B3AA 1HUNA 3F1ZA 4B3TL 1RL2A 4KY7A 4YIJA 1NJIC 4ZLTF 2K14A 2E2IH 4L5RC 3JC66 4JI8L 2KHIA 1MKHA 3U9SA 5JVG3 3SDZA 2M2LA 5EJWA 2A68D 1MSHA 3BVGA 3NTHA 2B63G 1F2MA 3RMHA 3K7AB 4I7AA 4IPHA 4DK6C 2F0VA 4TQUS 4JI4L 3TS2A 3I4MG 1PH5A 3HKZB 2VQEQ 4U68A 1VQEA 3K59A 5GAEC 1LT3D 2YU9B 2OQ0A 4FVMA 1EYGA 2XVSA 3RLNA 2V1CC 2C9OA 4GKJQ 3GTQH 1SNCA 4UAIA 4H0LC 1DYQA 2PMZE 1R9TH 1TWGB 3KOJA 4P75A 3SR1A 5FK9C 2L11A 3HOUH 2FJ2A 5LMNL 2JN4A 4QIWE 1S5BD 4JI4Q 3KLWA 5LL6X 4WJ4A 4IPCA 3AB9A 1NNXA 4DV5L 1EFID 2B3GA 1IW7D 3J81i 3MWYW 2MFIA 2K52A 1HHVA 1YZ6A 5C5MA 1Q8IA 3G48A 4LUZA 2PYKA 2K5NA 1E22A 1CHPD 4C3IG 2K6AA 2JA6G 1WCMG 1ONLA 2TSSA 1Y1VH 3HOXG 3RNUA 3LX0A 4DFAA 1JOQA 5JJZA 1MJCA 1GHKA 3P7JA 3W1GA 5EPKA 3CCVA 4F87A 1VQ4A 5IP9G 2G5DA 4BA1I 3HOUB 2PZTA 4A3GH 1ESFA 1BNZA 3J80i 2ENBA 4B3SL 1E1OA 4OHJA 4IJHA 3RZDH 3LNNA 3CKIB 5GAHC 4K0KQ 5E3FA 2WP8J 4I65A 2CQOA 4L5QA 1IYUA 1A2TA 4DA2A 3EBEA 1AE3A 3FVQA 2B2UC 4XT3B 1PH7A 4A93G 5ELNA 4CJ0B 1I6HH 3PGZA 2A6HD 2UU9L 2MNAA 3H0GG 1I4RA 1L2FA 1STEA 1ESRA 2CVRA 1IL8A 5FOBB 1WTXA 3RD4A 4K0KL 4NDXA 3CQZB 1FR3A 1PTOB 2F0LA 5DNFA 3EVQA 4HR7B 1I94Q 5HGQA 4LF9Q 3GV6A 5IP7G 1ASZA 3VR2A 5KNCA 3ZYYX 1LABA 2EZVA 4A76A 3WDNA 4EVOA 1HJPA 3T16A 2F3WA 2I0QA 1B50A 1SYBA 1YVCA 2EJGC 4UPAA 1D5MC 3I56A 2C35B 1Y1VB 4IUPA 3CCLA 4QUCA 4K5WA 4TSSA 3SGIA 4HIDA 1VQFA 5D14A 3H0GH 4G7ZC 2JA5G 4PG3A 4DV3L 5JPMC 2EJMA 1HFNA 1V1PB 5IGEA 1HCZA 2RSOA 4NXMQ 2OCEA 4F7XA 4AH6A 3OYYA 4OEMB 5A35A 4GKKL 3W1BA 1BBWA 3CF5A 2F4VL 1IKLA 4A3MH 1YHQA 4B3RQ 4DV7L 1ZEQX 1ENCA 2PI2A 1GHJA 1NBWA 1PTOH 2YV5A 3BZCA 4Y52H 2VQFL 4A3DH 5LL6S 1DD2A 4UP7A 3M3YH 3S15B 2L0CA 4DAYB 3L3OC 3D8GA 1LTBD 2O2LD 3K0YA 4R8NA 4DK1A 4OWTB 3I4NH 5CMDA 4DV7Q 2F0NA 2PZUA 1X54A 2H4OA 3ULLA 4N9TA 3V96A 3Q24A 4A3IB 5C4JB 1JWSD 1QVCA 1KIXA 4GN3B 4NXNQ 4A3DB 2CH4A 2KCMA 5K5PA 1WJJA 1X65A 2B2WA 4AYBE 5K36G 2MO1A 2MQHA 3RLOA 4WJWA 3OIQA 2JA5B 4CJ2C 1F9SA 1II3A 4PMCA 5ISRA 5JJLA 2K5HA 4JI3Q 1LT6D 3S2DH 3KYHC 1RTOA 3PF4A 4TVAB 4DR3L 3VR3A 2NZOA 2EIFA 3P75A 1IBKQ 5M3FG 1X3FA 3HOYH 1RHPA 2M9VA 3MXGA 4C3JB 3I91A 5IT9E 5CORA 3GP7A 3EJIA 4DPGA 3BJUA 4J8QA 3HOZB 3OTOL 3LGJA 1IYVA 3S14H 2UXCQ 3GTJH 1D5XC 3I4MB 1B2TA 1S5ED 4QB4A 1FGBD 2EQSA 2Q2HA 2D0PA 3CPFA 3G6EA 4R4CA 4QF4A 1QUQA 3TEHB 4POGA 1XX8A 1CKMA 1EFWA 3UDGA 3D3RA 4JYAQ 1UAPA 5DM73 4JI1Q 2NTTA 4QJFA 2BA1A 2RVLA 4GOPA 1CZGA 3BU2A 1SYDA 1E2WA 4K14A 3TZUA 1F2YA 3TREA 2EYHA 4X3TA 1FNUA 3A7LA 3E6ZX 2Y0SB 3DMUA 1MD2D 5FLMH 1R4QB 1EOTA 2NVYB 1XNRL 4KMUC 1MBYA 1VQGA 4BXXH 1DGSA 1QZGA 4IFDI 1PRTF 3F2CA 4BBRB 1EIGA 3NWTA 5I6WA 4MNOA 4HJAA 2K04A 4JI1L 2NVXH 2VUMH 2ZXPA 3K5LA 4ZRZA 2NVYH 1PZJD 3HFZB 2WAQE 1JOKA 3M3YB 4XQQA 2R7ZH 1G8ZD 1AZQA 2F0MA 3KFUA 5FO8B 5HY6A 5KNDA 2IW3A 1HNZQ 2VL6A 3OOCA 5LHY1 2RDGA 4IPGA 1F2LA 4A3GB 2UUCQ 1EWCA 1FNWA 3UE0A 2PCFB 4IZ8A 4QL5A 4GLAC 1CT1D 1I4PA 2JA6B 2L5TA 1HZAA 4X3SA 2PNHA 2Z0SA 2MHVA 3X3NA 4X64Q 1KAAA 4DV6L 2R7ZG 1DOMA 2B2YA 2B2YC 1STNA 2NVTH 1STBA 1JE5A 1PZKD 3SK6A 3CU7A 3U4VA 3VR6A 1J5EQ 3HOYB 5M5YB 4E6IA 5IGGA 3FPUB 2WFWA 4RGTA 4LWCA 4PZ6A 2JYOA 1VQLA 5M5WB 2DN8A 3N52A 2UUBL 4TRDA 4KK7A 4FNFA 5FLMG 2QDLA 5H1SE 1YJNA 4HEDA 1JWMD 4IFDJ 2L55A 1H9MA 1NCVA 3M4OB 1DONA 5COYA 1J5EL 1SDFA 1LTGD 4JI7L 1JJ2A 2N88A 3D4WA 3J80E 2SDFA 4PQXA 3A0JA 5M5XB 3U58A 1ML0D 5C4JH 1K3RA 5IYCG 1YJ9A 4DV2Q 4FF4A 2JEBI 5JVH3 1V43A 4LW1A 1I6HB 4PMWA 1YJWA 3OWEB 4CJ1B 2RDFA 2KHSA 1JOOA 2LFNA 1PH6A 1TU2B 1HR0W 4BBSH 4A3BG 3BVMA 4DV2L 2AHOB 2QKIC 1C9OA 2JEAI 2K03A 3NTIA 3K5MA 3SVMA 5FKAC 4F88A 2B63B 4QQBX 2F0PA 3KLRA 5M3MB 4YY3Q 1PH8A 1VQIA 3BYTB 3I4LA 4K6LA 5C4ZA 1I3QB 4WJ3M 1P8LA 2EXDA 3HKZG 3TN2A 1EU4A 1Q86C 3GTLB 3DWQA 1VMPA 1HNWQ 4MHEA 1KDBA 1X32A 3AMUA 1PYBA 4AQYL 1XJVA 1WTHA 3R8BA 2EYJA 1VQ9A 3S17H 3KLSA 2K7VA 1LTID 2XN9C 3I4NG 3OSOA 5CBAE 5JAVA 2FXQA 3K5OA 1SMYD 2CH4W 1I4QA 1JORA 2NN6I 2EY1A 2RKSA 2LY7A 2NTSA 1JE4A 4OIKA 3TBIB 1PA6A 2IWHA 5M3FB 4J15A 2VW9A 5CV9A 3VA5A 3MAQA 3HOUG 3U50C 3S1QH 3OIPA 4KJNA 2KVMA 1BCPD 3QWNA 5JEAG 3GTKB 2EY2A 2UXBQ 3T1YL 4IFDH 4LF7L 2NN6H 4RGMA 4I7ZC 4JI8Q 4DV4L 1LTSD 4UHVA 4HMIA 1JCKB 3FP9A 3J7A5 4GS3A 2XRQD 3BDOA 3LWEA 2LXKA 3GTOH 4CHTB 2ZJPA 4GLVB 5EPLA 5JEAJ 3HOXH 4DN4M 1BXTA 3KBGA 4POFA 1D6EC 2V4DA 4LF7Q 3H3VC 1PXUA 1A15A 3H09A 4GKJL 1HZBA 2XRSD 2EVBA 2F0DA 1K9MC 1X6OA 4P2CB 1SN8A 4FDBA 1LTLA 1HH2P 2CCZA 2WAQB 1SBBB 1ZXTA 2PNRC 4GNXA 4RMFA 3UI2A 2DJGC 2N55A 2DGYA 2XGTA 3P1HA 4IUQA 2O5IC 1CK1A 4DV5Q 4IN3A 4BBSB 1QILA 2BA0A 3G6JB 2D2CC 4PNYA 4RKBA 1K3BC 1GXDC 3G4SA 1PYSB 1KQSA 4ZAIA 3FKIH 3HOVH 1ICWA 4FO2A 2B39A 5T1IA 3PO3G 1U4RA 1QUQB 3J7YW 3S1NB 2K33A 4JI6Q 3U9OA 2E75C 4ZKBB 1I5FA 1S72A 4GN5A 1H9RA 4BY7G 5AFWA 4JI5Q 1PTOC 2R6GA 5LMNQ 3KBXA 3N6RA 1EWHA 2K5QA 3GQBA 3CCQA 5M3FH 2MGSA 4FYDA 1M90C 1Q46A 3P20A 5EKLA 5EBDA 1IW7C 1K8GA 4A3JH 2Z8LA 2WIIB 3PO2H 1TS5A 1IBML 2E2JH 5CYUA 3TP6A 1I4HA 4DV0L 2F03A 1EY5A 3E0JA 2B2TA 5FO7B 1LV9A 1ILPA 3CCMA 1M8AA 5C0XI 2JJQA 2FFKB 2IT1A 4A3EH 5L37A 3K6OA 1VQ6A 2Q8TA 3T56B 1WVLA 5FLXc 2Q2IA 3TP8A 4DV0Q 2X6LA 2JA8G 2BE5D 1CUKA 3CRKC 4JK1C 4B3SQ 3H91A 2ZJQA 4L5SA 1UE1A 1HFGA 3M4YA 3MZ5A 2ZT9C 1O7ZA 1FD7D 4ZUJA 2AMCB 3I3CA 3NBHB 4DV3Q 2UU9Q 4JV5L 1AW7A 3FEWX 4K6DA 1BR9A 2D5DA 4BA2I 4P73A 3M7NA 2F0HA 4LFBQ 3S1MH 2R92B 1KLUD 1GOZA 4X65Q 4DR5L 1W2BA 3T51B 3QG1A 5C5LA 1GVPA 2I5HA 2QDBA 1O7IA 5GAGC 1HNXL 2B2VA 3PO3H 2NVQH 2GA4B 4HN7A 1TXYA 2F4VQ 2HUGA 3VR4A 2L1BA 5CV8A 2F4IA 5IE8A 3S16H 1VQHA 3NPPA 4JVZA 3M4OH 4X62Q 2Z6KC 4UP9A 3SE0A 2VQFQ 2E76C 3S1NH 4J1MA 1EYAA 2OT2A 3MXNA 1IL2A 1UUPA 5IIFA 1CQFA 1BCPC 2RQXA 1EY9A 3T53B 1CSPA 5M3MG 5M9OA 3NQIA 1E0BA 2RHQB 1HR0Q 4X62L 2R92G 5FLXL 1ZYRD 4B3ML 5DLQE 3TDQA 2R93H 4IURA 4NXML 1J9OA 5A2QE 4X3UA 1LTAD 1QZHA 1BDOA 1EQQA 4JI3L 4DAMA 4HIMA 1EQRA 1H9SB 1BVSA 3E5SA 1TWFH 4EQ5A 1SSOA 3UDFA 1Z9FA 3GV3A 5J3BA 1KNEA 1Q1EA 3J81E 1K73C 5C6AA 3HOWB 1ENAA 5FO9B 1FJGL 5E4WC 4ME3A 2RCFA 1VQOA 1BO0A 1I50B 1Q90A 3OMCA 5D3DA 1V1OA 3K80C 2VUMB 2NVXB 2AUKA 3K0XA 4EGVA 5IY0A 4AIMA 5C3EG 4A3JB 1Q12A 3R3OA 2KENA 2OXPA 4A3FB 1CM9A 1L1OA 1JQYD 1YITA 3CAMA 3VYRA 1NY4A 1XTCD 4JYAL 2F0IA 5DEHA 1DCZA 3ULJA 4C2MH 1SNOA 5KNBA 1WTVA 3CD6A 5BN4A 3DEPA 1T5XD 4KN7C 4CKEA 1GD7A 2F0UA 3J7ZC 1WD1A 3R2IA 1EUJA 2B2WC 1STHA 3K5NA 3FPPA 2QF7A 3A8JE 3WWVA 5EKKA 2PW7A 1PDQA 3NXWA 2ZJRA 4LF4Q 1PH1A 2UXCL 4OX9L 1G291 3L7ZC 4BS9A 5ELDA 3V2TA 3PCOB 1YNNC 2K32A 2J4XA 4DU9A 4DUYL 4EX5A 2QEXA 3NE5B 1DOLA 3KF6A 1E2ZA 1HTLD 4L6TB 1L1OB 4K8JA 1G2SA 1RDPD 4UP8A 4LF4L 4KLKA 3DM1A 5ELCA 1BQQT 2A5HA 5IYCH 1I6VC 1EWIA 2EDGA 3MXUA 1HZ9A 5ELBA 2JXMB 3STBD 2Y0SG 3NUCA 4JBKA 3RN2A 2EYLA 1QNUA 3TMEA 2HCIA 4RHSA 2NZHA 2JA7B 2A69C 1KD1C 2A1AA 1QJOA 4HSPA 2C5CA 5NUCA 1E2VA 3I4NB 1PH9A 3R93A 4IOCA 4MZ9A 2MP1A 1DZ1A 1KDCA 3G71A 1BCPF 2CWAA 4GOPB 4N9PA 5JJKA 1KTKA 2Y0SE 1N36Q 1GUGA 2AQ2B 4JPBW 1WTPA 4P72A 4C3HB 3KF8A 3UDXA 4A93H 4A3FH 4IUUA 2PO4A 3T4AC 2K28A 3HGBA 1PH3A 3TP5A 1G2TA 2CQAA 3CMEA 4OXPA 3MXNB 5M5WH 4JBJA 1EEFD 5F2DA 3CMAA 3D6CA 2JQOA 1SYGA 3GTPH 4BY1B 1Y8PB 2WB1B 3CPWA 4PMBA 3AQQA 1U4LA 3GTJB 3I4MH 3BDCA 3D4RA 1WTWA 2SEBD 2UXDL 1CSQA 2ZTCA 4RCNA 2F0WA 4LF8L 1Q1BA 2UUBQ 2E2HB 1XPOA 1XNQQ 4GZYC 3FDTA 2WV6D 1KHIA 4OWWB 4HSVA 2Z9HA 1S5CD 2RSNA 5IP7H 5EBCA 5IYBG 4HIKA 4A3EB 1QE6A 4KTAA 2FMCA 4S3SA 1LTRD 3HOXB 5C3EH 2CW0D 3BVZA 3CQZH 2F3IA 1DOKA 5IGDA 1PMRA 2RBMA 3C1EA 1HNWL 3GTMH 4R9WA 1AFPA 1FL0A 5DM63 1EYDA 5J22A 3A5ZB 3VR5A 3NBIA 4A3IG 2EOTA 1TQOA 4X66L 1EZ8A 3K7AH 3HOZG 1VQJA 3CRLC 3S9WA 5E1FA 2N49A 5GROA 2KCNA 5TSSA 1N9WA 3S15H 1WCMB 5M5XH 3H94A 1EYCA 3GTKH 2HDLA 5EKIA 1K0RA 3FRPB 1EY0A 4OELB 3PIPA 5CV4A 4DR1Q 3IRBA 1OTCA 3ONAB 4K5VA 1LT5D 5FJ8H 5IWAQ 1MJEA 2MJ8A 4A3LH 1HZCA 4YHHQ 1Z6HA 3E9IA 3K57A 3I2ZA 2DUDA 3DLLA 4YWLA 1JWUD 4DV4Q 2K75A 1SYEA 4FP5D 1M4VA 3DM3A 4HTHA 4HCEA 4QIWB 1X3QA 1D1KA 2L9HA 4NMZA 1WOCA 2NBFA 5A2QL 4R4OA 3OPOA 2I46A 3NSWA 1PFNA 1PV4A 4MN3A 3L2PA 5I9OA 4FF2A 4R4TA 5KIXA 3A74A 1CA6A 1L1OC 4KKUA 4LFAL 2BH2A 4A3JG 1TWGH 1VQAA 1SYFA 1LACA 3C1FA 1TWHB 3RN5A 3BZDB 1N34Q 3R2TA 2E74C 3S24A 3GTOB 2IY5B 1Y8OB 4R4QA 2HCCA 3J7AF 3V05A 2XIWA 4P71A 2G9DA 3I70A 4ZUIA 4B3TQ 4K2KA 2BH8A 2HT1A 2K50A 2G9HD 2L4NA 1GUWA 3ND8A 2TMPA 1SMXA 3D4DA 3K58A 4EQOA 4CKCA 1K83B 4JC0A 1F9RA 3MC0B 2ID0A 3RUZA 1EIYB 4HJ9A 2WB1E 1PH4A 4ZYSA 3HKZE 5E7NA 4JI5L 4GN4B 5JJIA 2DY8A 5AJ3Q 1JB7A 2RHSB 3Q8DA 5K36H 3QOJA 3QIAA 4PZ7A 3WOFA 3IL8A 4K2LA 2Z4IA 2F52A 1HRJA 1HXYD 2YTXA 3HG9A 1WYDA 3A8KE 2NVTB 2A74C 4ME5A 1IBMQ 1PFBA 5CV6A 1O7YA 4AYBG 4FXKC 2CFMA 2KCCA 3JAME 1A63A 1C4QA 1D5ZC 1V1QA 1YBYA 2B2VC 4KD4A 3I90A 4BY1H 2VXWA 3QOLA 1SJHD 4LFCQ 1JICA 2O4XA 4JI6L 2KUMA 2IL8A 1RJTA 3NBHA 4G7OC 4FF1A 5FLXE 1QVGA 3OHXC 1XPUA 2ZTEA 4OO1H 2FHTA 2R61A 1J6QA 4GLXA 1B53A 1K83H 1TY0A 5ELOA 4A3KG 3CC4A 1A6XA 2R7DA 4LFCL 4MTKA 4A3BH 4BBSG 2IX3A 1PTOF 2B29A 1TR5A 3G7LA 1GKHA 4OONA 4LK1C 4QMGA 1BKBA 3FKIG 1A2UA 1G51A 1F9PA 2F0EA 3HZXA 4V0BA 3HOVG 2PMZB 2ALYB 5EGTA 4DV1Q 3PUWA 2FMMA 2VNUD 3OW2A 1O80A 2CWPA 4RHRA 4X65L 4JBMA 1CI3M 4A3BB 2H1EA 3F2BA 1U5KA 1SNMA 1Z47A 2QGQA 4QUFA 3HOWG 2Q2UA 4XT1B 3J81L 1QCBD 1PFMA 2OF1A 2ZXRA 1I4GA 1K8MA 4QGUA 4A3MB 5GQOA 4DNRB 4DV1L 1N32L 1SFOB 4JI0Q 3Q23A 3PUYA 5C0XG 3UE1A 2P5ZX 2F0SA 4LJZC 5M5YH 3MXPA 4GKKQ 1I94L 2ASBA 2PQEA 3I72A 3PMFA 3PF5A 1Y69U 4B3RL 1UE6A 1LLRD 1WTRA 2EY6A 1FNVA 2EYOA 1SROA 1SJED 1NAPA 2ZXOA 1YEZA 4JV5Q 4DNTB 1S4ZA 3OMGA 4C3JH 1BCPB 1CKNA 4M8AA 4TKOB 4B3MQ 5I9PA 4FXGC 2K4KA 1NR2A 3IFDA 5C44B 1AZPA 1HNXQ 4KHZA 1XMOL 4JBWA 3S2DB 2B63H 1SYCA 4IO9A 4OO1G 1TY2A 1AN8A 1STAA 1X56A 3L9AX 1HQMC 1EL0A 1WI5A 1R4PB 4YCVA 3QO2A 3GO5A 3LWUA 3E3XA 3C2PA 2F1MA 4OL7A 5ELFA 4NXNL 1XPRA 1UEAB 3PIOA 2JK8A 1XMOQ 3F2UA 3E0EA 4DF7A 2WINB 1EZ6A 4XIGS 4DR6L 4YCUA 4BBRH 1TIID 2F0GA 3M85A 1NMGA 3PUVA 3BG3A 1HR0L 4YWKA 4C3IB 5CC4A 3IAYA 2LMCB 4DR4L 1XMQQ 4KY6A 1K0SA 4HJ5A 2F0OA 1SEBD 1YIJA 1TT2A 4PV1C 3D0FA 2HQEA 1YNND 2IHEA 5C4HA 3RZOH 2XWBB 3IFTA 3OTOQ 3PO2G 4N8FA 3HS0C 1EQTA 2EPBA 5C44H 3KDFB 3M9BA 4XQJA 3PSIA 1PRTD 3PIP3 3T1HL 1O78A 2CW0C 2GVAA 3NP8A 3QR8A 1XWEA 2R93B 3S14B 1I4XA 1TWCH 1N8RC 1LM0A 1KL9A 1QB5D 1D8LA 2K05A 2A6EC 3EROA 3W2DA 4ZK9B 3PUXA 1KRSA 5G3LF 2JA6H 1N33Q 4DR7L 1IBKL 4L5TA 4NB3A 4RCOA 1XNRQ 3VDYA 5G3LD 1VQBA 5C0XJ 4A93B 3KJOA 3RZOB 1W6JA 1STYA 4XTCS 5HURA 1EY7A 3DUZA 3SXHA 4IJLA 2JA8H 4UDUC 1MIUA 1GUOA 5KGUA 1X3PA 2GN5A 4C1NI 2VY3A 3DWAA 4AYBB 1OXSC 1VF5C 1YI2A 2D0OA 1OXVA 4RA8A 4Z9CB 5BR8L 4ID6A 1NR4A 3U4ZA 1LYLA 3GTMB 2N3SA 3TS0A 1G6PA 2UUAL 3RZDB 1UWVA 2VB3X 4LF5L 4OWXB 2EYMA 2EYPA 4XDXA 3URYA 4RAUC 1V9PA 2KEEA 1PRTB 1X55A 1N36L 3MEHA 4GNXB 1B7YB 3Q0AA 2OQKA 1BOSA 4L8JA 1M1KC 1RCVD 3NELA 5IGBA 1DXMA 4KV6A 1UE5A 1V8QA 1L0YB 3MHBA 2UUAQ 2R7FA 4IOAA 2SNMA 2AQ1B 2PQAA 3FMCA 5LMUL 4IFDG 2N78A 1VQPA 1HNZL 4IUVA 3DXJC 3HOZH 1RIPA 1QNKA 4LAAA 4H44C 4ZQ3A 4BXXG 1A3VA 5I4DA 1A3UA 3DHQA 4K5XA 3E9HA 2K5WA 3VYUA 2X69A 1YNJD 5CBEE 1VQ5A 2KJXA 1VQMA 1B44D 2D62A 3IKJA 4IUTA 1YHBA 3ER0A 4HAEA 4G57A 1BBXC 1KABA 1X3EA 3BDLA 2E8GA 4HCSA 2KEDA 3MTSA 3F8TA 3A5UA 4DV6Q 3OWFA 1SNPA 3NK9A 1EQVA 1CZWA 1UEBA 4DAVA 3CW2C 3KJPA 3D6WA 1WTOA 3PV0A 1CKNB 1JC7A 2SOBA 3PO3B 3NENA 2OWOA 4IPDA 3J81j 2F0FA 4A3DG 2AWOA 1HQRD 2CHBD 4G7HC 4FXDA 5FJ8G 1OXUA 2Z4HA 5IGFA 3CCUA 1ZKOA 3M4PA 4RFBA 4BY7H 3JAMc 5E4XA 4A75A 4JI7Q 1QVFA 1STGA 4X66Q 3ERSX 4A3CG 4LF8Q 5C44G 4O2DA 5I2XA 1G6ZA 2DNEA 5JPNC 4C3JG 5BN5A 2KECA 4O0AA 4A3FG 1SRUA 1GUTA 2NUCA 1U4PA 2ES2A 2K5VA 5HGTA 3M4QA 3KUPA 4MIUA 1EEID 1PHJA 1OO9B 3UDIA 1B70B 4EQNA 2N8NA 4KHVA 2HD3A 4CKBA 1DM0B 5I2YA 2XSCA 3S1RB 2WB1G 4BBRG 2I5LX 1JB3A 1LTTD 4P74A 3A8IE 1WFQA 3CXCA 1Y1WB 4OO1I 3H0GB 5D65A 4YY3L 2E5LQ 2LS01 4PZ8A 2UXBL 3PO2B 1ICFB 2PW5A 1Q82C 1VCIA 4Q0FA 1SFOH 3X3MA 4IALA 5IT9c 3TQYA 1KNAA 1Q8KA 2Q8IB 2YTVA 4CGYB 4C2MB 2E5LL 3GTQB 3J80c 1G91A 2KBNA 4HJ7A 3H3VI 4RWSC 2NZ1D 1SMYC 4LFAQ 3VYSA 3J80L 1FGUA 2A19A 3HOYG 1LUZA 1Z7TA 3EA6A 4K8IA 5C4XB 3MA2B 4A3GG 4A3CH 1RF2D 5LMNW 1Q3LA 1NE3A 2Z6KA 2XTIA 3O13A 5KYLA 3CP0A 3TSSA 2E2IB 2VQEL 4JI2L 3J81c 3GTLH 1H9KA 2HHHQ 3L0OA 2JSOA 1U9RA 1AEXA 2A6ED 1DJRD 3WOEA 3S2HB 1B9MA 1SE2A 4DUZQ 1O7LA 1I3QH 2Z1CA 3MFGA 1Y1WG 1ZYRC 2I5MX 4Y7NB 2KHJA 1WD0A 1OXTA 4GNXC 3S2HH 5BN3A 3RLFA 2E2HH 4HMJA 1EIFA 3TP7A 3ITPA 3CCJA 4KY5A 3GTGB 2X6GA 2AKWB 2HHHL 1N34L 1SR3A 2R3ZA 4LUVA 2IX0A 4LMQD 3I4OA 2AUJD 2WAQG 5CV5A 1AH9A 3HP3A 3GTPB 4A3MG 1A3TA 4XQNA 2E2JB 4BY7B 1RODA 2J0TD 3KLSX 2VZAA 5C4XH 3F2DA 1CA5A 2RCNA 1IBLL 4IQZA 1XTDA 1TS2A 1PYWD 2EY5A 4OIJA 1MGSA 1TVXA 1R9TB 3Q22A 4RGOS 1YNJC 2LXJA 3T13A 4CDCC 3SK8A 5AJ3L 2YU9H 1XXGA 1KXLA 2QW7A 5IP9H 5C3WA 1CKOA 2F0KA 1WCMH 2JA9A 1ILQA 1EU3A 2QILA 3ERQA 3BYYB 4OGQC 1NMFA 3KF6B 1IBLQ 4JW0A 1TS4A 2PI2E 4NPSA 1Y1VG 4IUNA 5IYDG 3A7AB 4F8MA 1KAWA 4A3EG 4APVA 2JA7H 3AFQA 3I55A 1I50H 3MFYA 3S17B 1L0XB 3KF8B 5GADC 1W3SA 3EQLC 3HOWH 1P16A 1TWHH 5C3EB 1NSNS 2MPMA 1SE4A 4WFN3 2ICIA 1EY8A 4L63B 3EIVA 4O42A 3GTGH 3GDEA 1CTMA 2OTLA 4M1UB 3SEBA 2I07B 2IX1A 4Y7NH 1H9SA 5IGCA 2D9UA 4KHPQ 3K81C 4B9WA 1XYIA 1N32Q 2O5JC 2IJ0A 1PZID 1GUSA 3PUZA 1B9NA 1U0LA 3B6YA 1VDZA 2PQAB 4YCWA 1TWAH 4X6AH 4A3LG 4JCVE 2B8GA 1K28A 3A56A 2R7ZB 3AYHB 1BF4A 5D3IB 4KHPL 1Y14B 1BBUA 4RG1A 1SNQA 4Q5VA 1JR0D 1EOVA 1S5FD 3STBC 1S3OA 2RDHA 4DAYA 2KA7A 3W3AA 2VB2X 2BOSA 3GD7A 4YWMA 2KQ3A 3TZDA 1TS3A 4LF9L 4LNQA 3BS1A 3I8ZA 1Y8NB 2PZWA 5KRUA 2L15A 4KKTA 4XYOA 4LFBL 3W5OA 4JI0L 2KCTA 2CKZB 4DR5Q 2BCOA 3ZJYC 4ULLA 1C48A 1PTOD 1KRTA 5KYIA 1UE7A 1CQVA 3FKIB 3HOVB 1Q7YC 4DR6Q 1T5EA 3CCSA 1PRTC 1T9HA 3PIO3 2WKDA 5IODA 2JA7G 3M7GA 3SHLA 1Y1WH 5IT9L 1FYCA 3HKSA 4DR4Q 1XMQL 2IPKD 2RA4A 3C46A 1C0AA 4LUOA 4CDFC 4HJ8A 3AFPA 1F77A 1EIHA 4KI0A 5EPJA 1SE3A 5C3XA 3EFXD 1Q81C 1AP0A 4HIOA 4ILWA 1QWYA 4JOIA 2Q2TA 1JJCB 2F0TA 3MVVA 4DR3Q 4H13C 4DXFA 3T1HQ 1IZ6A 2A6HC 1HPCA 2A69D 2NN6G 5EAYA 5C4XG 1B4OA 3TRZA 1K8OA 2K5DA 1VQ7A 1HA6A 2E2DC 1QOHA 2K1BA 4V190 2OEOA 2MUYA 3CC7A 4A3IH 1GM5A 1B8AA 4KKSA 4C56C 1VQ8A 2EJFC 3H6MA 1N33L 3NQTA 4DR7Q 4BY1G 2DY7A 2M00A 1W6KA 5IYBH 4C3HH 1A8VA 3BZKA 2AQ3B 3ND9A 1FJGQ 3HEJA 1UNSA 4G4KA 1NTGA 2FINB 3JAML 3H3VH 1VQDA 2BDNA 4NP5A 4UY8C 1B1ZA 3SK5A 4OX9Q 1JJGA 2NVQB 4H02A 4X3KA 4BWGB 2ZTDA 2DJFC 4DUYQ 3KDFA 2JE6I 2A68C 1KLGD 3VYTA 4DNIA 1K8AC 1ET9A 4DKAC 4WORA 4O1NA 5J39A 1E7ZA 1LO5D 4KN4C 4RGNA 4DAPA 4CDDC 1HTPA 1SAPA 5I6YA 4DK3C 4XYQA 4H7BA 1TWFB 4A3KH 1C7YA 4R8IA 4ODGA 4ALPA 4J6HA 4LF5Q 4DR2Q 3QB3A 1L0WA 3VA7A 3Q6SA 1FVIA 2EE1A 2B2TC 5JEAH 2JP1A 1SNDA 2UUCL 2HIXA 1JMCA 1ET6A 3I73A 5CV7A 2HIVA 2F3VA 2GVBA 1ASYA 4R4IA 1KDAA 2JA5H 2QA4A 3CC2A 4A3KB 2ZM6L 2WKCA 1S5DD 2J7ZA 4DR2L 5LMUQ 1NUCA 2LSSA 2RF4A 1C8CA 2F0JA 3I7FA 1D2BA 4C3IH 5BR8Q 2H5XA 2L12A 4KD3A 1V1PA 2SNSA 2YTYA 1MHWC 1U4MA 2ZM6Q 5DAUA 1E3PA 1B3QA 2OTJA 1SLJA 1F2ZA 3A55A 4C1NK 1GUNA 3HRZC 1LT4D 2UXDQ 2HDMA 4FF3A 4NW2A 5CR3A 2QEJC 2ATWA 1E24A 2EXZA 1A0IA 5JOBA 1VF7A 3ICEA 4EQPA 2PPBC 2KOLA 3D31A 4X64L 3CCRA 2F0QA 5J1ZA 1YNXA 2AWNA 1VMCA 1RKNA 2XWJB 1IKMA 1IYJB 1X9NA 2A73B 2ICEC 3EN2A 1TWAB 2IHFA 4JOIC 1HA5A 2EYFA 5C0XH 3ULPA 2A8VA 2HQLA 4ZKCB 3C3LA 1F9QA 4DXGA 2NYZD 4RH6A 1EY6A 5M3MH 4XXEA 4MTNA 1IHZA 1MI2A 3NEMA 1IXRA 4B08A 4KJOA 2VUMG 2BE5C 4LF6Q 1OXXK 2B8FA 4ZCKA 4JG2A 4QY7A 1EY4A 5ELEA 1E1TA 1PH2A 3NWSA 4GOPC 1PLFA 1A62A 1XNQL 4A4IA 3AEVA 3K7UC 3DWPA 4WRDA 4QCLA 1YHAA 1D1IA 4AQYQ 4U673 1H95A 4LF6L 3A54A 4R1JA 5T1GA 4DGZA 5KEEA 5IYDH 1VQKA 4YHHL 1AE2A 3J7AV 1RD9D 4DK0A 1SXTA 4CBVA 3RR5A 2Z6BA 3DEOA 3CCEA 1VQNA 2DNCA 3S16B 5CGKA 1CHQD 3JAMi 1SE8A 2Q8RE 1BUVT 3CHBD 2JA8B 3S1QB 1TKWB 3NTKA 5EQ0A 1CFMA 1KC8C 4N8X1 1WTQA 3K8AA 1JT8A 3T1YQ 4B9XA 1X3GA 2R92H 3S1MB 4ABNA 1H9JA 3QJYA 5IOCA 2R93G 1GJXA 2QCPX 3PQIA 1J8IA 4DR1L 4CDEC 2YYZA
chains in the Genus database with same CATH topology
2NB0A 2WACA 3SK4A 3AU7A 1TWCB 3OW7A 1ENFA 2K01A 4C3HG 1RTNA 4NKLA 2B2UA 1MSGA 3NHHA 4RKLA 3KK7A 2NWGA 1QG7A 2LKVA 2XNAC 1HUMA 2BDOA 1B3AA 1HUNA 4KY7A 4YIJA 4ZLTF 3U9SA 5JVG3 3SDZA 2M2LA 5EJWA 2A68D 1MSHA 3BVGA 3NTHA 1F2MA 3RMHA 3K7AB 2F0VA 4TQUS 3HKZB 4U68A 3K59A 1LT3D 2YU9B 4FVMA 2XVSA 2C9OA 1SNCA 4UAIA 4H0LC 1DYQA 1TWGB 3SR1A 5FK9C 2L11A 2FJ2A 1S5BD 5LL6X 3AB9A 1EFID 1IW7D 3MWYW 1HHVA 5C5MA 1Q8IA 2PYKA 1CHPD 4C3IG 2K6AA 1ONLA 2TSSA 3LX0A 4DFAA 1JOQA 5JJZA 1GHKA 3P7JA 5EPKA 4F87A 4BA1I 3HOUB 2PZTA 1ESFA 1BNZA 2ENBA 4OHJA 3LNNA 3CKIB 5E3FA 2WP8J 4I65A 1IYUA 1A2TA 4DA2A 3FVQA 2B2UC 4XT3B 4CJ0B 2A6HD 1I4RA 1STEA 1ESRA 2CVRA 1IL8A 5FOBB 1WTXA 3RD4A 4NDXA 3CQZB 1FR3A 1PTOB 2F0LA 5DNFA 3EVQA 4HR7B 3GV6A 3VR2A 5KNCA 3ZYYX 1LABA 2EZVA 3WDNA 4EVOA 3T16A 2F3WA 1B50A 1SYBA 2EJGC 1D5MC 1Y1VB 4IUPA 4QUCA 4K5WA 4TSSA 5D14A 4G7ZC 5JPMC 2EJMA 1HFNA 1V1PB 5IGEA 1HCZA 2RSOA 4F7XA 5A35A 1IKLA 1ZEQX 1ENCA 1GHJA 1PTOH 5LL6S 1DD2A 3S15B 2L0CA 3L3OC 3D8GA 1LTBD 2O2LD 3K0YA 4R8NA 4DK1A 5CMDA 2F0NA 2PZUA 2H4OA 4N9TA 3V96A 3Q24A 4A3IB 5C4JB 1JWSD 4A3DB 5K5PA 2B2WA 5K36G 4WJWA 3OIQA 2JA5B 4CJ2C 1F9SA 1II3A 4PMCA 5ISRA 1LT6D 1RTOA 3VR3A 3P75A 1RHPA 2M9VA 3MXGA 4C3JB 3I91A 5IT9E 5CORA 3GP7A 3EJIA 4J8QA 3HOZB 1IYVA 3I4MB 1D5XC 1B2TA 1S5ED 4QB4A 1FGBD 4QF4A 1XX8A 3D3RA 1UAPA 5DM73 2NTTA 2BA1A 2RVLA 1CZGA 4K14A 1SYDA 1E2WA 3TZUA 1F2YA 2EYHA 4X3TA 1FNUA 3A7LA 3E6ZX 2Y0SB 3DMUA 1MD2D 1R4QB 1EOTA 2NVYB 4KMUC 1MBYA 4IFDI 1PRTF 4BBRB 1EIGA 3NWTA 5I6WA 2K04A 2ZXPA 3K5LA 4ZRZA 1PZJD 1JOKA 3M3YB 4XQQA 1G8ZD 1AZQA 2F0MA 5FO8B 5KNDA 2IW3A 3OOCA 5LHY1 2RDGA 1F2LA 4A3GB 1EWCA 1FNWA 2PCFB 4IZ8A 1CT1D 1I4PA 2JA6B 2L5TA 4X3SA 2MHVA 3X3NA 1KAAA 1DOMA 2B2YA 2B2YC 1STNA 1STBA 1PZKD 3SK6A 3CU7A 3VR6A 5M5YB 3HOYB 4E6IA 5IGGA 3FPUB 4RGTA 2JYOA 5M5WB 2DN8A 3N52A 4TRDA 4KK7A 4FNFA 1JWMD 4HEDA 4IFDJ 2L55A 1H9MA 1NCVA 3M4OB 1DONA 5COYA 1SDFA 1LTGD 2N88A 3D4WA 3J80E 2SDFA 4PQXA 5M5XB 1ML0D 4FF4A 2JEBI 5JVH3 1V43A 1I6HB 4PMWA 3OWEB 4CJ1B 2RDFA 2KHSA 1JOOA 2LFNA 1TU2B 3BVMA 2QKIC 2JEAI 2K03A 3NTIA 3K5MA 3SVMA 5FKAC 4F88A 2B63B 2F0PA 3KLRA 5M3MB 3BYTB 3I4LA 4K6LA 5C4ZA 1I3QB 3TN2A 1EU4A 3GTLB 3DWQA 1VMPA 4MHEA 1KDBA 1X32A 3AMUA 3R8BA 2EYJA 3KLSA 2K7VA 1LTID 2XN9C 3OSOA 5CBAE 5JAVA 3K5OA 1SMYD 1I4QA 1JORA 2NN6I 2EY1A 2RKSA 2LY7A 2NTSA 1JE4A 4OIKA 3TBIB 2IWHA 5M3FB 5CV9A 3VA5A 3MAQA 3OIPA 4KJNA 2KVMA 1BCPD 3QWNA 5JEAG 3GTKB 2EY2A 4IFDH 2NN6H 4RGMA 4I7ZC 1LTSD 4HMIA 1JCKB 2XRQD 3BDOA 3LWEA 4CHTB 5EPLA 5JEAJ 4DN4M 1BXTA 3KBGA 1D6EC 2V4DA 3H3VC 1PXUA 1A15A 3H09A 2XRSD 2EVBA 2F0DA 4P2CB 2WAQB 1SBBB 1ZXTA 2PNRC 3UI2A 2N55A 3P1HA 4IUQA 2O5IC 1CK1A 4BBSB 4IN3A 1QILA 2BA0A 3G6JB 2D2CC 4PNYA 4RKBA 1GXDC 4ZAIA 1ICWA 4FO2A 2B39A 5T1IA 1U4RA 3J7YW 3S1NB 2K33A 3U9OA 2E75C 4ZKBB 1H9RA 5AFWA 1PTOC 2R6GA 3KBXA 3N6RA 1EWHA 2K5QA 3GQBA 2MGSA 4FYDA 3P20A 5EKLA 5EBDA 1IW7C 2Z8LA 2WIIB 1TS5A 5CYUA 3TP6A 1I4HA 2F03A 1EY5A 3E0JA 2B2TA 5FO7B 1LV9A 1ILPA 1M8AA 5C0XI 2FFKB 2IT1A 3K6OA 3T56B 2Q8TA 1WVLA 3TP8A 2X6LA 2BE5D 3CRKC 4JK1C 3H91A 1HFGA 3M4YA 3MZ5A 2ZT9C 1O7ZA 1FD7D 4ZUJA 3I3CA 1AW7A 3FEWX 4K6DA 1BR9A 2D5DA 4BA2I 3M7NA 2F0HA 2R92B 1KLUD 1GOZA 3T51B 3QG1A 5C5LA 2QDBA 2B2VA 2GA4B 4HN7A 2HUGA 3VR4A 2L1BA 5CV8A 2F4IA 3NPPA 3SE0A 2E76C 4J1MA 1EYAA 2OT2A 3MXNA 1UUPA 5IIFA 1CQFA 1BCPC 2RQXA 1EY9A 3T53B 5M9OA 3NQIA 1E0BA 5FLXL 1ZYRD 3TDQA 4IURA 1J9OA 5A2QE 4X3UA 1LTAD 1BDOA 1H9SB 3E5SA 1SSOA 3J81E 3GV3A 1KNEA 1Q1EA 5C6AA 3HOWB 1ENAA 5FO9B 5E4WC 1BO0A 1I50B 1Q90A 3OMCA 5D3DA 1V1OA 2VUMB 2NVXB 2AUKA 4EGVA 4A3JB 1Q12A 3R3OA 2OXPA 4A3FB 1CM9A 1JQYD 3VYRA 1XTCD 2F0IA 5DEHA 1DCZA 1SNOA 5KNBA 1WTVA 5BN4A 3DEPA 1T5XD 4KN7C 4CKEA 2F0UA 1WD1A 3R2IA 2B2WC 1STHA 3K5NA 3FPPA 2QF7A 3A8JE 5EKKA 2PW7A 1PDQA 3NXWA 1G291 3L7ZC 4BS9A 5ELDA 3V2TA 1YNNC 2K32A 2J4XA 4DU9A 3NE5B 1DOLA 1E2ZA 1HTLD 4L6TB 1G2SA 4K8JA 1RDPD 3DM1A 5ELCA 1BQQT 2A5HA 1I6VC 2EDGA 3MXUA 5ELBA 2JXMB 3NUCA 2EYLA 1QNUA 3TMEA 2HCIA 4RHSA 2JA7B 2A69C 1QJOA 4HSPA 2C5CA 5NUCA 1E2VA 3I4NB 3R93A 2MP1A 1DZ1A 1KDCA 1BCPF 4N9PA 1KTKA 1GUGA 2AQ2B 1WTPA 4C3HB 3KF8A 4IUUA 2PO4A 3T4AC 2K28A 3HGBA 3TP5A 1G2TA 2CQAA 1EEFD 5F2DA 3D6CA 1SYGA 4BY1B 1Y8PB 2WB1B 4PMBA 1U4LA 3GTJB 3BDCA 3D4RA 1WTWA 2SEBD 4RCNA 2F0WA 1Q1BA 2E2HB 4GZYC 3FDTA 2WV6D 4HSVA 1S5CD 2RSNA 5EBCA 4A3EB 1QE6A 4KTAA 2FMCA 4S3SA 1LTRD 3HOXB 2CW0D 3BVZA 5IGDA 1DOKA 1PMRA 2RBMA 3C1EA 4R9WA 1AFPA 5DM63 1EYDA 5J22A 3VR5A 3NBIA 2EOTA 1TQOA 1EZ8A 3CRLC 3S9WA 5E1FA 2KCNA 5TSSA 1WCMB 3H94A 1EYCA 2HDLA 5EKIA 3FRPB 1EY0A 5CV4A 3ONAB 4K5VA 1LT5D 2MJ8A 1Z6HA 3K57A 1JWUD 1SYEA 4FP5D 1M4VA 4HTHA 4HCEA 4QIWB 1X3QA 1D1KA 2L9HA 4NMZA 2NBFA 5A2QL 3OPOA 2I46A 3NSWA 1PFNA 4MN3A 5I9OA 4FF2A 5KIXA 1CA6A 4KKUA 1SYFA 1LACA 3C1FA 1TWHB 3BZDB 3R2TA 2E74C 3GTOB 1Y8OB 2HCCA 3J7AF 3V05A 2XIWA 2G9DA 3I70A 4ZUIA 4K2KA 2G9HD 2L4NA 1GUWA 3ND8A 2TMPA 3D4DA 3K58A 4EQOA 4CKCA 1K83B 1F9RA 3RUZA 2ID0A 3MC0B 4ZYSA 2DY8A 5K36H 3QOJA 3QIAA 3WOFA 3IL8A 4K2LA 2Z4IA 1HRJA 1HXYD 3HG9A 3A8KE 2NVTB 2A74C 4ME5A 1PFBA 5CV6A 1O7YA 4FXKC 2KCCA 3JAME 1C4QA 1D5ZC 2B2VC 4KD4A 3I90A 2VXWA 3QOLA 1SJHD 1JICA 2O4XA 2KUMA 2IL8A 1RJTA 3NBHA 4G7OC 4FF1A 5FLXE 3OHXC 4OO1H 2FHTA 2R61A 1B53A 1A6XA 1TY0A 2IX3A 1PTOF 3G7LA 1TR5A 4LK1C 4QMGA 1A2UA 2F0EA 1F9PA 3HZXA 4V0BA 2PMZB 5EGTA 3PUWA 2FMMA 2VNUD 1O80A 4RHRA 1CI3M 4A3BB 2H1EA 1SNMA 1Z47A 4QUFA 4XT1B 3J81L 1QCBD 1PFMA 2OF1A 2ZXRA 1I4GA 1K8MA 4A3MB 4DNRB 1SFOB 3Q23A 3PUYA 5C0XG 2F0SA 4LJZC 3MXPA 2PQEA 3I72A 3PMFA 1Y69U 1LLRD 1WTRA 2EY6A 1FNVA 2EYOA 1SJED 1NAPA 2ZXOA 4DNTB 1S4ZA 3OMGA 1BCPB 4M8AA 4TKOB 5I9PA 4FXGC 1NR2A 3IFDA 5C44B 1AZPA 4KHZA 4JBWA 3S2DB 1SYCA 4OO1G 1TY2A 1AN8A 1STAA 3L9AX 1HQMC 1EL0A 1R4PB 3QO2A 3GO5A 3LWUA 3C2PA 2F1MA 4OL7A 5ELFA 1UEAB 3F2UA 4DF7A 2WINB 1EZ6A 4XIGS 1TIID 2F0GA 3M85A 3PUVA 3BG3A 4C3IB 5CC4A 3IAYA 2LMCB 4KY6A 2F0OA 1SEBD 1TT2A 4PV1C 2HQEA 1YNND 5C4HA 2XWBB 3IFTA 3HS0C 1EQTA 2EPBA 4XQJA 1PRTD 3PIP3 1O78A 2CW0C 3NP8A 1XWEA 2R93B 3S14B 1I4XA 1QB5D 2K05A 2A6EC 3EROA 3W2DA 4ZK9B 3PUXA 5G3LF 4RCOA 5G3LD 5C0XJ 4A93B 3RZOB 1W6JA 1STYA 4XTCS 5HURA 1EY7A 3DUZA 3SXHA 4UDUC 1GUOA 5KGUA 1X3PA 4C1NI 3DWAA 4AYBB 1OXSC 1VF5C 1OXVA 4RA8A 4Z9CB 4ID6A 1NR4A 3GTMB 3RZDB 2VB3X 2EYMA 2EYPA 4XDXA 3URYA 4RAUC 2KEEA 1PRTB 3MEHA 3Q0AA 1BOSA 4L8JA 1RCVD 5IGBA 1DXMA 4KV6A 1V8QA 1L0YB 3MHBA 2SNMA 2AQ1B 3FMCA 4IFDG 4IUVA 3DXJC 1QNKA 4LAAA 4H44C 4ZQ3A 1A3VA 5I4DA 1A3UA 3DHQA 4K5XA 2K5WA 3VYUA 2X69A 1YNJD 5CBEE 2KJXA 1B44D 2D62A 3IKJA 4IUTA 4HAEA 4G57A 1BBXC 1KABA 3BDLA 4HCSA 2KEDA 3MTSA 3OWFA 1SNPA 3NK9A 1EQVA 1CZWA 4DAVA 3D6WA 1WTOA 3PV0A 1JC7A 2SOBA 3PO3B 2F0FA 2AWOA 1HQRD 2CHBD 4G7HC 4FXDA 1OXUA 2Z4HA 5IGFA 1ZKOA 4RFBA 5E4XA 1STGA 5I2XA 1G6ZA 2DNEA 5JPNC 4C3JG 5BN5A 2KECA 1GUTA 2NUCA 1U4PA 5HGTA 3KUPA 4MIUA 1EEID 1OO9B 4EQNA 4KHVA 4CKBA 1DM0B 5I2YA 2XSCA 3S1RB 1JB3A 1LTTD 3A8IE 1Y1WB 4OO1I 3H0GB 5D65A 2LS01 3PO2B 2PW5A 1VCIA 4Q0FA 3X3MA 4IALA 1KNAA 2Q8IB 4CGYB 4C2MB 3GTQB 1G91A 4RWSC 2NZ1D 1SMYC 3VYSA 3J80L 1Z7TA 3EA6A 4K8IA 5C4XB 3MA2B 1RF2D 1Q3LA 3O13A 5KYLA 3TSSA 2E2IB 1H9KA 2JSOA 1U9RA 1AEXA 2A6ED 1DJRD 3WOEA 3S2HB 1B9MA 1SE2A 1O7LA 2Z1CA 3MFGA 1ZYRC 4Y7NB 1WD0A 1OXTA 5BN3A 3RLFA 4HMJA 3TP7A 3ITPA 4KY5A 3GTGB 2X6GA 2R3ZA 2IX0A 4LMQD 2AUJD 5CV5A 3HP3A 3GTPB 1A3TA 4XQNA 2E2JB 4BY7B 1RODA 2J0TD 3KLSX 1CA5A 4IQZA 1TS2A 1PYWD 2EY5A 4OIJA 1MGSA 1TVXA 1R9TB 3Q22A 4RGOS 1YNJC 3T13A 3SK8A 1XXGA 5C3WA 2F0KA 1ILQA 1EU3A 2QILA 3BYYB 3ERQA 4OGQC 1TS4A 4IUNA 3A7AB 4F8MA 3MFYA 3S17B 1L0XB 3EQLC 5C3EB 1NSNS 2MPMA 1SE4A 4WFN3 2ICIA 1EY8A 4L63B 4O42A 1CTMA 4M1UB 2IX1A 2I07B 3SEBA 1H9SA 5IGCA 2D9UA 4B9WA 1XYIA 2O5JC 2IJ0A 1PZID 1GUSA 3PUZA 1B9NA 1VDZA 2B8GA 3A56A 2R7ZB 1BF4A 5D3IB 1SNQA 4Q5VA 1JR0D 1S5FD 2RDHA 4DAYA 2KA7A 3W3AA 2VB2X 2BOSA 3GD7A 2KQ3A 3TZDA 1TS3A 3BS1A 3I8ZA 1Y8NB 2PZWA 5KRUA 4KKTA 4XYOA 2BCOA 4ULLA 1C48A 1PTOD 5KYIA 1CQVA 3FKIB 3HOVB 1T5EA 1PRTC 3PIO3 2WKDA 5IODA 3M7GA 3SHLA 5IT9L 1FYCA 2IPKD 2RA4A 3C46A 1F77A 1EIHA 4KI0A 5EPJA 1SE3A 5C3XA 3EFXD 1AP0A 4ILWA 1QWYA 2F0TA 3MVVA 4H13C 4DXFA 2A6HC 1HPCA 2A69D 2NN6G 1B4OA 1K8OA 2K5DA 1HA6A 2E2DC 1QOHA 2K1BA 4V190 2OEOA 2MUYA 4KKSA 4C56C 2EJFC 3H6MA 3NQTA 2DY7A 2M00A 1W6KA 2AQ3B 3ND9A 3HEJA 1UNSA 4G4KA 2FINB 3JAML 2BDNA 4NP5A 1B1ZA 3SK5A 2NVQB 4X3KA 4BWGB 2JE6I 2A68C 1KLGD 3VYTA 1ET9A 4WORA 4O1NA 5J39A 1LO5D 4KN4C 4RGNA 4DAPA 1HTPA 1SAPA 5I6YA 4XYQA 4H7BA 1TWFB 4R8IA 4ODGA 4J6HA 3QB3A 3VA7A 3Q6SA 2EE1A 2B2TC 5JEAH 2JP1A 1SNDA 1ET6A 3I73A 5CV7A 2F3VA 1KDAA 4A3KB 2WKCA 1S5DD 2J7ZA 1NUCA 1C8CA 2F0JA 1D2BA 2L12A 4KD3A 1V1PA 2SNSA 1U4MA 5DAUA 1F2ZA 3A55A 4C1NK 1GUNA 3HRZC 1LT4D 2HDMA 4FF3A 4NW2A 5CR3A 2QEJC 2EXZA 5JOBA 1VF7A 4EQPA 2PPBC 2KOLA 3D31A 2F0QA 5J1ZA 2AWNA 1VMCA 1RKNA 2XWJB 1IKMA 2A73B 2ICEC 1TWAB 1HA5A 2EYFA 5C0XH 4ZKCB 3C3LA 1F9QA 4DXGA 2NYZD 4RH6A 1EY6A 4XXEA 1IHZA 1MI2A 4B08A 4KJOA 2BE5C 1OXXK 2B8FA 1EY4A 5ELEA 3NWSA 1PLFA 3DWPA 4WRDA 4QCLA 1D1IA 4U673 3A54A 5T1GA 4DGZA 5KEEA 3J7AV 1RD9D 4DK0A 1SXTA 4CBVA 3DEOA 2DNCA 3S16B 5CGKA 1CHQD 2Q8RE 1BUVT 3CHBD 2JA8B 3S1QB 1TKWB 3NTKA 5EQ0A 1CFMA 1WTQA 4B9XA 3S1MB 4ABNA 1H9JA 3QJYA 5IOCA 1GJXA 2QCPX 1J8IA 2YYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TT2 A;  4HTH A;  1F2Z A;  4KJN A;  1KAA A;  4N9P A;  1NSN S;  2ENB A;  2WAC A;  4LAA A;  3SK4 A;  5K5P A;  5C6A A;  4ZQ3 A;  1ENA A;  1EY8 A;  1STN A;  2EY2 A;  1STB A;  1A3V A;  5E3F A;  4NMZ A;  1A3U A;  2HQE A;  3DHQ A;  2OEO A;  4I65 A;  4K5X A;  3SK6 A;  5C4H A;  1II3 A;  1A2T A;  3OMC A;  4PMC A;  1TR5 A;  4NKL A;  4E6I A;  5IGG A;  5CR3 A;  5ISR A;  4QMG A;  1A2U A;  2F0E A;  3HZX A;  4K8I A;  3TP5 A;  5IGC A;  2EXZ A;  4G57 A;  4B9W A;  3NHH A;  4RKL A;  3TP8 A;  4TRD A;  1KAB A;  3BDL A;  5EGT A;  3R3O A;  4HMI A;  5JOB A;  5F2D A;  3D6C A;  3H6M A;  2OXP A;  3NQT A;  4EQP A;  5I9O A;  1SYG A;  3NP8 A;  3P75 A;  5KIX A;  2M00 A;  2LKV A;  3OWF A;  2F0Q A;  1SNP A;  4PMB A;  3NK9 A;  5J1Z A;  1EQV A;  4NDX A;  3HEJ A;  1SYF A;  3BDC A;  5KYL A;  1RKN A;  2F0I A;  4KY7 A;  4YIJ A;  3C1F A;  3MZ5 A;  3EJI A;  5DEH A;  2F0L A;  3D4W A;  3EVQ A;  4NP5 A;  1SNM A;  3ERO A;  4ZUJ A;  3SK5 A;  2SOB A;  1SNO A;  2F0W A;  2EYF A;  1U9R A;  1AEX A;  4QB4 A;  2OF1 A;  2F0F A;  2F0U A;  1F2M A;  2F0D A;  4K6D A;  1SNQ A;  4EVO A;  4QF4 A;  3T16 A;  2F0H A;  2F3W A;  5IGF A;  1SYB A;  1EY6 A;  1STH A;  4ZUI A;  4WOR A;  2F0V A;  1IHZ A;  4K2K A;  5C5L A;  5EKK A;  4KJO A;  5J39 A;  2QDB A;  2PW7 A;  2F0S A;  2KHS A;  2RDF A;  3NXW A;  4HMJ A;  4K5W A;  1STY A;  1STG A;  1JOO A;  3ITP A;  2KQ3 A;  3MXP A;  4KTA A;  4KY5 A;  3TP7 A;  5HUR A;  1EY4 A;  2PQE A;  1EY7 A;  3PMF A;  3D4D A;  3P1H A;  4S3S A;  3SXH A;  4EQO A;  5I6Y A;  4K14 A;  1SYD A;  5CV8 A;  3V2T A;  1SNC A;  3RUZ A;  2EY6 A;  5IGD A;  2EYO A;  4H7B A;  2PZW A;  4PNY A;  1F2Y A;  4RKB A;  2EYH A;  3VA5 A;  4DU9 A;  2RBM A;  5KRU A;  3C1E A;  4WRD A;  3SR1 A;  3OMG A;  4ODG A;  3DMU A;  4J6H A;  5CV5 A;  5KGU A;  2NUC A;  3QB3 A;  5I9P A;  1A3T A;  1EYD A;  4K8J A;  5HGT A;  2F0P A;  5IGE A;  5J22 A;  4MIU A;  5KYI A;  4J1M A;  4F7X A;  1SND A;  5I6W A;  1EYA A;  3QOJ A;  1TQO A;  1EZ8 A;  5C4Z A;  5CV7 A;  4DGZ A;  2F3V A;  5IIF A;  4EQN A;  4K2L A;  4ID6 A;  4KHV A;  5KEE A;  3S9W A;  1EY9 A;  5E1F A;  1SYC A;  2EY5 A;  3U9O A;  1JOK A;  1KDA A;  5M9O A;  1STA A;  5IOD A;  3SHL A;  1EYC A;  4ME5 A;  1ENC A;  5CV6 A;  5C5M A;  2F0M A;  3T13 A;  1KDB A;  5CGK A;  1EY0 A;  2EYM A;  3NUC A;  5CV4 A;  2EYP A;  1NUC A;  2PYK A;  3SK8 A;  4OL7 A;  2EYL A;  5C3W A;  2F0K A;  3TME A;  2EYJ A;  2F0J A;  4K5V A;  3ERQ A;  3MEH A;  4KD4 A;  4DF7 A;  5C3X A;  3D8G A;  1EZ6 A;  3QOL A;  3OSO A;  3LX0 A;  4IZ8 A;  4KD3 A;  4R8N A;  5EKL A;  4B9X A;  4DFA A;  5NUC A;  5IGB A;  5JAV A;  1JOQ A;  2O4X A;  2PW5 A;  2SNS A;  2F0N A;  4IUN A;  4KV6 A;  1JOR A;  2EY1 A;  2PZU A;  2F0G A;  2RKS A;  3MHB A;  4N9T A;  3TP6 A;  4F8M A;  5DAU A;  5IOC A;  5CC4 A;  2SNM A;  2F0T A;  1KDC A;  4IAL A;  2PZT A;  3MVV A;  4KY6 A;  3E5S A;  5CV9 A;  1SYE A;  2F0O A;  1EY5 A; 
#chains in the Genus database with same CATH topology
 3MEF A;  1D7Q A;  2NB0 A;  5IWA L;  2WAC A;  3SK4 A;  1VQC A;  3AU7 A;  1TWC B;  3OW7 A;  3S1R H;  1ENF A;  2K01 A;  1PFS A;  1GO3 E;  4C3H G;  1S40 A;  1RTN A;  3H15 A;  4NKL A;  1VS0 A;  4JI2 Q;  2B2U A;  3FHW A;  1MSG A;  2MO0 A;  3NHH A;  4RKL A;  3KK7 A;  4DUZ L;  2NWG A;  2VS1 A;  1QG7 A;  2LKV A;  2XNA C;  1HUM A;  1PVO A;  2BDO A;  1B3A A;  1HUN A;  3F1Z A;  4B3T L;  1RL2 A;  4KY7 A;  4YIJ A;  1NJI C;  4ZLT F;  2K14 A;  2E2I H;  4L5R C;  3JC6 6;  4JI8 L;  2KHI A;  1MKH A;  3U9S A;  5JVG 3;  3SDZ A;  2M2L A;  5EJW A;  2A68 D;  1MSH A;  3BVG A;  3NTH A;  2B63 G;  1F2M A;  3RMH A;  3K7A B;  4I7A A;  4IPH A;  4DK6 C;  2F0V A;  4TQU S;  4JI4 L;  3TS2 A;  3I4M G;  1PH5 A;  3HKZ B;  2VQE Q;  4U68 A;  1VQE A;  3K59 A;  5GAE C;  1LT3 D;  2YU9 B;  2OQ0 A;  4FVM A;  1EYG A;  2XVS A;  3RLN A;  2V1C C;  2C9O A;  4GKJ Q;  3GTQ H;  1SNC A;  4UAI A;  4H0L C;  1DYQ A;  2PMZ E;  1R9T H;  1TWG B;  3KOJ A;  4P75 A;  3SR1 A;  5FK9 C;  2L11 A;  3HOU H;  2FJ2 A;  5LMN L;  2JN4 A;  4QIW E;  1S5B D;  4JI4 Q;  3KLW A;  5LL6 X;  4WJ4 A;  4IPC A;  3AB9 A;  1NNX A;  4DV5 L;  1EFI D;  2B3G A;  1IW7 D;  3J81 i;  3MWY W;  2MFI A;  2K52 A;  1HHV A;  1YZ6 A;  5C5M A;  1Q8I A;  3G48 A;  4LUZ A;  2PYK A;  2K5N A;  1E22 A;  1CHP D;  4C3I G;  2K6A A;  2JA6 G;  1WCM G;  1ONL A;  2TSS A;  1Y1V H;  3HOX G;  3RNU A;  3LX0 A;  4DFA A;  1JOQ A;  5JJZ A;  1MJC A;  1GHK A;  3P7J A;  3W1G A;  5EPK A;  3CCV A;  4F87 A;  1VQ4 A;  5IP9 G;  2G5D A;  4BA1 I;  3HOU B;  2PZT A;  4A3G H;  1ESF A;  1BNZ A;  3J80 i;  2ENB A;  4B3S L;  1E1O A;  4OHJ A;  4IJH A;  3RZD H;  3LNN A;  3CKI B;  5GAH C;  4K0K Q;  5E3F A;  2WP8 J;  4I65 A;  2CQO A;  4L5Q A;  1IYU A;  1A2T A;  4DA2 A;  3EBE A;  1AE3 A;  3FVQ A;  2B2U C;  4XT3 B;  1PH7 A;  4A93 G;  5ELN A;  4CJ0 B;  1I6H H;  3PGZ A;  2A6H D;  2UU9 L;  2MNA A;  3H0G G;  1I4R A;  1L2F A;  1STE A;  1ESR A;  2CVR A;  1IL8 A;  5FOB B;  1WTX A;  3RD4 A;  4K0K L;  4NDX A;  3CQZ B;  1FR3 A;  1PTO B;  2F0L A;  5DNF A;  3EVQ A;  4HR7 B;  1I94 Q;  5HGQ A;  4LF9 Q;  3GV6 A;  5IP7 G;  1ASZ A;  3VR2 A;  5KNC A;  3ZYY X;  1LAB A;  2EZV A;  4A76 A;  3WDN A;  4EVO A;  1HJP A;  3T16 A;  2F3W A;  2I0Q A;  1B50 A;  1SYB A;  1YVC A;  2EJG C;  4UPA A;  1D5M C;  3I56 A;  2C35 B;  1Y1V B;  4IUP A;  3CCL A;  4QUC A;  4K5W A;  4TSS A;  3SGI A;  4HID A;  1VQF A;  5D14 A;  3H0G H;  4G7Z C;  2JA5 G;  4PG3 A;  4DV3 L;  5JPM C;  2EJM A;  1HFN A;  1V1P B;  5IGE A;  1HCZ A;  2RSO A;  4NXM Q;  2OCE A;  4F7X A;  4AH6 A;  3OYY A;  4OEM B;  5A35 A;  4GKK L;  3W1B A;  1BBW A;  3CF5 A;  2F4V L;  1IKL A;  4A3M H;  1YHQ A;  4B3R Q;  4DV7 L;  1ZEQ X;  1ENC A;  2PI2 A;  1GHJ A;  1NBW A;  1PTO H;  2YV5 A;  3BZC A;  4Y52 H;  2VQF L;  4A3D H;  5LL6 S;  1DD2 A;  4UP7 A;  3M3Y H;  3S15 B;  2L0C A;  4DAY B;  3L3O C;  3D8G A;  1LTB D;  2O2L D;  3K0Y A;  4R8N A;  4DK1 A;  4OWT B;  3I4N H;  5CMD A;  4DV7 Q;  2F0N A;  2PZU A;  1X54 A;  2H4O A;  3ULL A;  4N9T A;  3V96 A;  3Q24 A;  4A3I B;  5C4J B;  1JWS D;  1QVC A;  1KIX A;  4GN3 B;  4NXN Q;  4A3D B;  2CH4 A;  2KCM A;  5K5P A;  1WJJ A;  1X65 A;  2B2W A;  4AYB E;  5K36 G;  2MO1 A;  2MQH A;  3RLO A;  4WJW A;  3OIQ A;  2JA5 B;  4CJ2 C;  1F9S A;  1II3 A;  4PMC A;  5ISR A;  5JJL A;  2K5H A;  4JI3 Q;  1LT6 D;  3S2D H;  3KYH C;  1RTO A;  3PF4 A;  4TVA B;  4DR3 L;  3VR3 A;  2NZO A;  2EIF A;  3P75 A;  1IBK Q;  5M3F G;  1X3F A;  3HOY H;  1RHP A;  2M9V A;  3MXG A;  4C3J B;  3I91 A;  5IT9 E;  5COR A;  3GP7 A;  3EJI A;  4DPG A;  3BJU A;  4J8Q A;  3HOZ B;  3OTO L;  3LGJ A;  1IYV A;  3S14 H;  2UXC Q;  3GTJ H;  1D5X C;  3I4M B;  1B2T A;  1S5E D;  4QB4 A;  1FGB D;  2EQS A;  2Q2H A;  2D0P A;  3CPF A;  3G6E A;  4R4C A;  4QF4 A;  1QUQ A;  3TEH B;  4POG A;  1XX8 A;  1CKM A;  1EFW A;  3UDG A;  3D3R A;  4JYA Q;  1UAP A;  5DM7 3;  4JI1 Q;  2NTT A;  4QJF A;  2BA1 A;  2RVL A;  4GOP A;  1CZG A;  3BU2 A;  1SYD A;  1E2W A;  4K14 A;  3TZU A;  1F2Y A;  3TRE A;  2EYH A;  4X3T A;  1FNU A;  3A7L A;  3E6Z X;  2Y0S B;  3DMU A;  1MD2 D;  5FLM H;  1R4Q B;  1EOT A;  2NVY B;  1XNR L;  4KMU C;  1MBY A;  1VQG A;  4BXX H;  1DGS A;  1QZG A;  4IFD I;  1PRT F;  3F2C A;  4BBR B;  1EIG A;  3NWT A;  5I6W A;  4MNO A;  4HJA A;  2K04 A;  4JI1 L;  2NVX H;  2VUM H;  2ZXP A;  3K5L A;  4ZRZ A;  2NVY H;  1PZJ D;  3HFZ B;  2WAQ E;  1JOK A;  3M3Y B;  4XQQ A;  2R7Z H;  1G8Z D;  1AZQ A;  2F0M A;  3KFU A;  5FO8 B;  5HY6 A;  5KND A;  2IW3 A;  1HNZ Q;  2VL6 A;  3OOC A;  5LHY 1;  2RDG A;  4IPG A;  1F2L A;  4A3G B;  2UUC Q;  1EWC A;  1FNW A;  3UE0 A;  2PCF B;  4IZ8 A;  4QL5 A;  4GLA C;  1CT1 D;  1I4P A;  2JA6 B;  2L5T A;  1HZA A;  4X3S A;  2PNH A;  2Z0S A;  2MHV A;  3X3N A;  4X64 Q;  1KAA A;  4DV6 L;  2R7Z G;  1DOM A;  2B2Y A;  2B2Y C;  1STN A;  2NVT H;  1STB A;  1JE5 A;  1PZK D;  3SK6 A;  3CU7 A;  3U4V A;  3VR6 A;  1J5E Q;  3HOY B;  5M5Y B;  4E6I A;  5IGG A;  3FPU B;  2WFW A;  4RGT A;  4LWC A;  4PZ6 A;  2JYO A;  1VQL A;  5M5W B;  2DN8 A;  3N52 A;  2UUB L;  4TRD A;  4KK7 A;  4FNF A;  5FLM G;  2QDL A;  5H1S E;  1YJN A;  4HED A;  1JWM D;  4IFD J;  2L55 A;  1H9M A;  1NCV A;  3M4O B;  1DON A;  5COY A;  1J5E L;  1SDF A;  1LTG D;  4JI7 L;  1JJ2 A;  2N88 A;  3D4W A;  3J80 E;  2SDF A;  4PQX A;  3A0J A;  5M5X B;  3U58 A;  1ML0 D;  5C4J H;  1K3R A;  5IYC G;  1YJ9 A;  4DV2 Q;  4FF4 A;  2JEB I;  5JVH 3;  1V43 A;  4LW1 A;  1I6H B;  4PMW A;  1YJW A;  3OWE B;  4CJ1 B;  2RDF A;  2KHS A;  1JOO A;  2LFN A;  1PH6 A;  1TU2 B;  1HR0 W;  4BBS H;  4A3B G;  3BVM A;  4DV2 L;  2AHO B;  2QKI C;  1C9O A;  2JEA I;  2K03 A;  3NTI A;  3K5M A;  3SVM A;  5FKA C;  4F88 A;  2B63 B;  4QQB X;  2F0P A;  3KLR A;  5M3M B;  4YY3 Q;  1PH8 A;  1VQI A;  3BYT B;  3I4L A;  4K6L A;  5C4Z A;  1I3Q B;  4WJ3 M;  1P8L A;  2EXD A;  3HKZ G;  3TN2 A;  1EU4 A;  1Q86 C;  3GTL B;  3DWQ A;  1VMP A;  1HNW Q;  4MHE A;  1KDB A;  1X32 A;  3AMU A;  1PYB A;  4AQY L;  1XJV A;  1WTH A;  3R8B A;  2EYJ A;  1VQ9 A;  3S17 H;  3KLS A;  2K7V A;  1LTI D;  2XN9 C;  3I4N G;  3OSO A;  5CBA E;  5JAV A;  2FXQ A;  3K5O A;  1SMY D;  2CH4 W;  1I4Q A;  1JOR A;  2NN6 I;  2EY1 A;  2RKS A;  2LY7 A;  2NTS A;  1JE4 A;  4OIK A;  3TBI B;  1PA6 A;  2IWH A;  5M3F B;  4J15 A;  2VW9 A;  5CV9 A;  3VA5 A;  3MAQ A;  3HOU G;  3U50 C;  3S1Q H;  3OIP A;  4KJN A;  2KVM A;  1BCP D;  3QWN A;  5JEA G;  3GTK B;  2EY2 A;  2UXB Q;  3T1Y L;  4IFD H;  4LF7 L;  2NN6 H;  4RGM A;  4I7Z C;  4JI8 Q;  4DV4 L;  1LTS D;  4UHV A;  4HMI A;  1JCK B;  3FP9 A;  3J7A 5;  4GS3 A;  2XRQ D;  3BDO A;  3LWE A;  2LXK A;  3GTO H;  4CHT B;  2ZJP A;  4GLV B;  5EPL A;  5JEA J;  3HOX H;  4DN4 M;  1BXT A;  3KBG A;  4POF A;  1D6E C;  2V4D A;  4LF7 Q;  3H3V C;  1PXU A;  1A15 A;  3H09 A;  4GKJ L;  1HZB A;  2XRS D;  2EVB A;  2F0D A;  1K9M C;  1X6O A;  4P2C B;  1SN8 A;  4FDB A;  1LTL A;  1HH2 P;  2CCZ A;  2WAQ B;  1SBB B;  1ZXT A;  2PNR C;  4GNX A;  4RMF A;  3UI2 A;  2DJG C;  2N55 A;  2DGY A;  2XGT A;  3P1H A;  4IUQ A;  2O5I C;  1CK1 A;  4DV5 Q;  4IN3 A;  4BBS B;  1QIL A;  2BA0 A;  3G6J B;  2D2C C;  4PNY A;  4RKB A;  1K3B C;  1GXD C;  3G4S A;  1PYS B;  1KQS A;  4ZAI A;  3FKI H;  3HOV H;  1ICW A;  4FO2 A;  2B39 A;  5T1I A;  3PO3 G;  1U4R A;  1QUQ B;  3J7Y W;  3S1N B;  2K33 A;  4JI6 Q;  3U9O A;  2E75 C;  4ZKB B;  1I5F A;  1S72 A;  4GN5 A;  1H9R A;  4BY7 G;  5AFW A;  4JI5 Q;  1PTO C;  2R6G A;  5LMN Q;  3KBX A;  3N6R A;  1EWH A;  2K5Q A;  3GQB A;  3CCQ A;  5M3F H;  2MGS A;  4FYD A;  1M90 C;  1Q46 A;  3P20 A;  5EKL A;  5EBD A;  1IW7 C;  1K8G A;  4A3J H;  2Z8L A;  2WII B;  3PO2 H;  1TS5 A;  1IBM L;  2E2J H;  5CYU A;  3TP6 A;  1I4H A;  4DV0 L;  2F03 A;  1EY5 A;  3E0J A;  2B2T A;  5FO7 B;  1LV9 A;  1ILP A;  3CCM A;  1M8A A;  5C0X I;  2JJQ A;  2FFK B;  2IT1 A;  4A3E H;  5L37 A;  3K6O A;  1VQ6 A;  2Q8T A;  3T56 B;  1WVL A;  5FLX c;  2Q2I A;  3TP8 A;  4DV0 Q;  2X6L A;  2JA8 G;  2BE5 D;  1CUK A;  3CRK C;  4JK1 C;  4B3S Q;  3H91 A;  2ZJQ A;  4L5S A;  1UE1 A;  1HFG A;  3M4Y A;  3MZ5 A;  2ZT9 C;  1O7Z A;  1FD7 D;  4ZUJ A;  2AMC B;  3I3C A;  3NBH B;  4DV3 Q;  2UU9 Q;  4JV5 L;  1AW7 A;  3FEW X;  4K6D A;  1BR9 A;  2D5D A;  4BA2 I;  4P73 A;  3M7N A;  2F0H A;  4LFB Q;  3S1M H;  2R92 B;  1KLU D;  1GOZ A;  4X65 Q;  4DR5 L;  1W2B A;  3T51 B;  3QG1 A;  5C5L A;  1GVP A;  2I5H A;  2QDB A;  1O7I A;  5GAG C;  1HNX L;  2B2V A;  3PO3 H;  2NVQ H;  2GA4 B;  4HN7 A;  1TXY A;  2F4V Q;  2HUG A;  3VR4 A;  2L1B A;  5CV8 A;  2F4I A;  5IE8 A;  3S16 H;  1VQH A;  3NPP A;  4JVZ A;  3M4O H;  4X62 Q;  2Z6K C;  4UP9 A;  3SE0 A;  2VQF Q;  2E76 C;  3S1N H;  4J1M A;  1EYA A;  2OT2 A;  3MXN A;  1IL2 A;  1UUP A;  5IIF A;  1CQF A;  1BCP C;  2RQX A;  1EY9 A;  3T53 B;  1CSP A;  5M3M G;  5M9O A;  3NQI A;  1E0B A;  2RHQ B;  1HR0 Q;  4X62 L;  2R92 G;  5FLX L;  1ZYR D;  4B3M L;  5DLQ E;  3TDQ A;  2R93 H;  4IUR A;  4NXM L;  1J9O A;  5A2Q E;  4X3U A;  1LTA D;  1QZH A;  1BDO A;  1EQQ A;  4JI3 L;  4DAM A;  4HIM A;  1EQR A;  1H9S B;  1BVS A;  3E5S A;  1TWF H;  4EQ5 A;  1SSO A;  3UDF A;  1Z9F A;  3GV3 A;  5J3B A;  1KNE A;  1Q1E A;  3J81 E;  1K73 C;  5C6A A;  3HOW B;  1ENA A;  5FO9 B;  1FJG L;  5E4W C;  4ME3 A;  2RCF A;  1VQO A;  1BO0 A;  1I50 B;  1Q90 A;  3OMC A;  5D3D A;  1V1O A;  3K80 C;  2VUM B;  2NVX B;  2AUK A;  3K0X A;  4EGV A;  5IY0 A;  4AIM A;  5C3E G;  4A3J B;  1Q12 A;  3R3O A;  2KEN A;  2OXP A;  4A3F B;  1CM9 A;  1L1O A;  1JQY D;  1YIT A;  3CAM A;  3VYR A;  1NY4 A;  1XTC D;  4JYA L;  2F0I A;  5DEH A;  1DCZ A;  3ULJ A;  4C2M H;  1SNO A;  5KNB A;  1WTV A;  3CD6 A;  5BN4 A;  3DEP A;  1T5X D;  4KN7 C;  4CKE A;  1GD7 A;  2F0U A;  3J7Z C;  1WD1 A;  3R2I A;  1EUJ A;  2B2W C;  1STH A;  3K5N A;  3FPP A;  2QF7 A;  3A8J E;  3WWV A;  5EKK A;  2PW7 A;  1PDQ A;  3NXW A;  2ZJR A;  4LF4 Q;  1PH1 A;  2UXC L;  4OX9 L;  1G29 1;  3L7Z C;  4BS9 A;  5ELD A;  3V2T A;  3PCO B;  1YNN C;  2K32 A;  2J4X A;  4DU9 A;  4DUY L;  4EX5 A;  2QEX A;  3NE5 B;  1DOL A;  3KF6 A;  1E2Z A;  1HTL D;  4L6T B;  1L1O B;  4K8J A;  1G2S A;  1RDP D;  4UP8 A;  4LF4 L;  4KLK A;  3DM1 A;  5ELC A;  1BQQ T;  2A5H A;  5IYC H;  1I6V C;  1EWI A;  2EDG A;  3MXU A;  1HZ9 A;  5ELB A;  2JXM B;  3STB D;  2Y0S G;  3NUC A;  4JBK A;  3RN2 A;  2EYL A;  1QNU A;  3TME A;  2HCI A;  4RHS A;  2NZH A;  2JA7 B;  2A69 C;  1KD1 C;  2A1A A;  1QJO A;  4HSP A;  2C5C A;  5NUC A;  1E2V A;  3I4N B;  1PH9 A;  3R93 A;  4IOC A;  4MZ9 A;  2MP1 A;  1DZ1 A;  1KDC A;  3G71 A;  1BCP F;  2CWA A;  4GOP B;  4N9P A;  5JJK A;  1KTK A;  2Y0S E;  1N36 Q;  1GUG A;  2AQ2 B;  4JPB W;  1WTP A;  4P72 A;  4C3H B;  3KF8 A;  3UDX A;  4A93 H;  4A3F H;  4IUU A;  2PO4 A;  3T4A C;  2K28 A;  3HGB A;  1PH3 A;  3TP5 A;  1G2T A;  2CQA A;  3CME A;  4OXP A;  3MXN B;  5M5W H;  4JBJ A;  1EEF D;  5F2D A;  3CMA A;  3D6C A;  2JQO A;  1SYG A;  3GTP H;  4BY1 B;  1Y8P B;  2WB1 B;  3CPW A;  4PMB A;  3AQQ A;  1U4L A;  3GTJ B;  3I4M H;  3BDC A;  3D4R A;  1WTW A;  2SEB D;  2UXD L;  1CSQ A;  2ZTC A;  4RCN A;  2F0W A;  4LF8 L;  1Q1B A;  2UUB Q;  2E2H B;  1XPO A;  1XNQ Q;  4GZY C;  3FDT A;  2WV6 D;  1KHI A;  4OWW B;  4HSV A;  2Z9H A;  1S5C D;  2RSN A;  5IP7 H;  5EBC A;  5IYB G;  4HIK A;  4A3E B;  1QE6 A;  4KTA A;  2FMC A;  4S3S A;  1LTR D;  3HOX B;  5C3E H;  2CW0 D;  3BVZ A;  3CQZ H;  2F3I A;  1DOK A;  5IGD A;  1PMR A;  2RBM A;  3C1E A;  1HNW L;  3GTM H;  4R9W A;  1AFP A;  1FL0 A;  5DM6 3;  1EYD A;  5J22 A;  3A5Z B;  3VR5 A;  3NBI A;  4A3I G;  2EOT A;  1TQO A;  4X66 L;  1EZ8 A;  3K7A H;  3HOZ G;  1VQJ A;  3CRL C;  3S9W A;  5E1F A;  2N49 A;  5GRO A;  2KCN A;  5TSS A;  1N9W A;  3S15 H;  1WCM B;  5M5X H;  3H94 A;  1EYC A;  3GTK H;  2HDL A;  5EKI A;  1K0R A;  3FRP B;  1EY0 A;  4OEL B;  3PIP A;  5CV4 A;  4DR1 Q;  3IRB A;  1OTC A;  3ONA B;  4K5V A;  1LT5 D;  5FJ8 H;  5IWA Q;  1MJE A;  2MJ8 A;  4A3L H;  1HZC A;  4YHH Q;  1Z6H A;  3E9I A;  3K57 A;  3I2Z A;  2DUD A;  3DLL A;  4YWL A;  1JWU D;  4DV4 Q;  2K75 A;  1SYE A;  4FP5 D;  1M4V A;  3DM3 A;  4HTH A;  4HCE A;  4QIW B;  1X3Q A;  1D1K A;  2L9H A;  4NMZ A;  1WOC A;  2NBF A;  5A2Q L;  4R4O A;  3OPO A;  2I46 A;  3NSW A;  1PFN A;  1PV4 A;  4MN3 A;  3L2P A;  5I9O A;  4FF2 A;  4R4T A;  5KIX A;  3A74 A;  1CA6 A;  1L1O C;  4KKU A;  4LFA L;  2BH2 A;  4A3J G;  1TWG H;  1VQA A;  1SYF A;  1LAC A;  3C1F A;  1TWH B;  3RN5 A;  3BZD B;  1N34 Q;  3R2T A;  2E74 C;  3S24 A;  3GTO B;  2IY5 B;  1Y8O B;  4R4Q A;  2HCC A;  3J7A F;  3V05 A;  2XIW A;  4P71 A;  2G9D A;  3I70 A;  4ZUI A;  4B3T Q;  4K2K A;  2BH8 A;  2HT1 A;  2K50 A;  2G9H D;  2L4N A;  1GUW A;  3ND8 A;  2TMP A;  1SMX A;  3D4D A;  3K58 A;  4EQO A;  4CKC A;  1K83 B;  4JC0 A;  1F9R A;  3MC0 B;  2ID0 A;  3RUZ A;  1EIY B;  4HJ9 A;  2WB1 E;  1PH4 A;  4ZYS A;  3HKZ E;  5E7N A;  4JI5 L;  4GN4 B;  5JJI A;  2DY8 A;  5AJ3 Q;  1JB7 A;  2RHS B;  3Q8D A;  5K36 H;  3QOJ A;  3QIA A;  4PZ7 A;  3WOF A;  3IL8 A;  4K2L A;  2Z4I A;  2F52 A;  1HRJ A;  1HXY D;  2YTX A;  3HG9 A;  1WYD A;  3A8K E;  2NVT B;  2A74 C;  4ME5 A;  1IBM Q;  1PFB A;  5CV6 A;  1O7Y A;  4AYB G;  4FXK C;  2CFM A;  2KCC A;  3JAM E;  1A63 A;  1C4Q A;  1D5Z C;  1V1Q A;  1YBY A;  2B2V C;  4KD4 A;  3I90 A;  4BY1 H;  2VXW A;  3QOL A;  1SJH D;  4LFC Q;  1JIC A;  2O4X A;  4JI6 L;  2KUM A;  2IL8 A;  1RJT A;  3NBH A;  4G7O C;  4FF1 A;  5FLX E;  1QVG A;  3OHX C;  1XPU A;  2ZTE A;  4OO1 H;  2FHT A;  2R61 A;  1J6Q A;  4GLX A;  1B53 A;  1K83 H;  1TY0 A;  5ELO A;  4A3K G;  3CC4 A;  1A6X A;  2R7D A;  4LFC L;  4MTK A;  4A3B H;  4BBS G;  2IX3 A;  1PTO F;  2B29 A;  1TR5 A;  3G7L A;  1GKH A;  4OON A;  4LK1 C;  4QMG A;  1BKB A;  3FKI G;  1A2U A;  1G51 A;  1F9P A;  2F0E A;  3HZX A;  4V0B A;  3HOV G;  2PMZ B;  2ALY B;  5EGT A;  4DV1 Q;  3PUW A;  2FMM A;  2VNU D;  3OW2 A;  1O80 A;  2CWP A;  4RHR A;  4X65 L;  4JBM A;  1CI3 M;  4A3B B;  2H1E A;  3F2B A;  1U5K A;  1SNM A;  1Z47 A;  2QGQ A;  4QUF A;  3HOW G;  2Q2U A;  4XT1 B;  3J81 L;  1QCB D;  1PFM A;  2OF1 A;  2ZXR A;  1I4G A;  1K8M A;  4QGU A;  4A3M B;  5GQO A;  4DNR B;  4DV1 L;  1N32 L;  1SFO B;  4JI0 Q;  3Q23 A;  3PUY A;  5C0X G;  3UE1 A;  2P5Z X;  2F0S A;  4LJZ C;  5M5Y H;  3MXP A;  4GKK Q;  1I94 L;  2ASB A;  2PQE A;  3I72 A;  3PMF A;  3PF5 A;  1Y69 U;  4B3R L;  1UE6 A;  1LLR D;  1WTR A;  2EY6 A;  1FNV A;  2EYO A;  1SRO A;  1SJE D;  1NAP A;  2ZXO A;  1YEZ A;  4JV5 Q;  4DNT B;  1S4Z A;  3OMG A;  4C3J H;  1BCP B;  1CKN A;  4M8A A;  4TKO B;  4B3M Q;  5I9P A;  4FXG C;  2K4K A;  1NR2 A;  3IFD A;  5C44 B;  1AZP A;  1HNX Q;  4KHZ A;  1XMO L;  4JBW A;  3S2D B;  2B63 H;  1SYC A;  4IO9 A;  4OO1 G;  1TY2 A;  1AN8 A;  1STA A;  1X56 A;  3L9A X;  1HQM C;  1EL0 A;  1WI5 A;  1R4P B;  4YCV A;  3QO2 A;  3GO5 A;  3LWU A;  3E3X A;  3C2P A;  2F1M A;  4OL7 A;  5ELF A;  4NXN L;  1XPR A;  1UEA B;  3PIO A;  2JK8 A;  1XMO Q;  3F2U A;  3E0E A;  4DF7 A;  2WIN B;  1EZ6 A;  4XIG S;  4DR6 L;  4YCU A;  4BBR H;  1TII D;  2F0G A;  3M85 A;  1NMG A;  3PUV A;  3BG3 A;  1HR0 L;  4YWK A;  4C3I B;  5CC4 A;  3IAY A;  2LMC B;  4DR4 L;  1XMQ Q;  4KY6 A;  1K0S A;  4HJ5 A;  2F0O A;  1SEB D;  1YIJ A;  1TT2 A;  4PV1 C;  3D0F A;  2HQE A;  1YNN D;  2IHE A;  5C4H A;  3RZO H;  2XWB B;  3IFT A;  3OTO Q;  3PO2 G;  4N8F A;  3HS0 C;  1EQT A;  2EPB A;  5C44 H;  3KDF B;  3M9B A;  4XQJ A;  3PSI A;  1PRT D;  3PIP 3;  3T1H L;  1O78 A;  2CW0 C;  2GVA A;  3NP8 A;  3QR8 A;  1XWE A;  2R93 B;  3S14 B;  1I4X A;  1TWC H;  1N8R C;  1LM0 A;  1KL9 A;  1QB5 D;  1D8L A;  2K05 A;  2A6E C;  3ERO A;  3W2D A;  4ZK9 B;  3PUX A;  1KRS A;  5G3L F;  2JA6 H;  1N33 Q;  4DR7 L;  1IBK L;  4L5T A;  4NB3 A;  4RCO A;  1XNR Q;  3VDY A;  5G3L D;  1VQB A;  5C0X J;  4A93 B;  3KJO A;  3RZO B;  1W6J A;  1STY A;  4XTC S;  5HUR A;  1EY7 A;  3DUZ A;  3SXH A;  4IJL A;  2JA8 H;  4UDU C;  1MIU A;  1GUO A;  5KGU A;  1X3P A;  2GN5 A;  4C1N I;  2VY3 A;  3DWA A;  4AYB B;  1OXS C;  1VF5 C;  1YI2 A;  2D0O A;  1OXV A;  4RA8 A;  4Z9C B;  5BR8 L;  4ID6 A;  1NR4 A;  3U4Z A;  1LYL A;  3GTM B;  2N3S A;  3TS0 A;  1G6P A;  2UUA L;  3RZD B;  1UWV A;  2VB3 X;  4LF5 L;  4OWX B;  2EYM A;  2EYP A;  4XDX A;  3URY A;  4RAU C;  1V9P A;  2KEE A;  1PRT B;  1X55 A;  1N36 L;  3MEH A;  4GNX B;  1B7Y B;  3Q0A A;  2OQK A;  1BOS A;  4L8J A;  1M1K C;  1RCV D;  3NEL A;  5IGB A;  1DXM A;  4KV6 A;  1UE5 A;  1V8Q A;  1L0Y B;  3MHB A;  2UUA Q;  2R7F A;  4IOA A;  2SNM A;  2AQ1 B;  2PQA A;  3FMC A;  5LMU L;  4IFD G;  2N78 A;  1VQP A;  1HNZ L;  4IUV A;  3DXJ C;  3HOZ H;  1RIP A;  1QNK A;  4LAA A;  4H44 C;  4ZQ3 A;  4BXX G;  1A3V A;  5I4D A;  1A3U A;  3DHQ A;  4K5X A;  3E9H A;  2K5W A;  3VYU A;  2X69 A;  1YNJ D;  5CBE E;  1VQ5 A;  2KJX A;  1VQM A;  1B44 D;  2D62 A;  3IKJ A;  4IUT A;  1YHB A;  3ER0 A;  4HAE A;  4G57 A;  1BBX C;  1KAB A;  1X3E A;  3BDL A;  2E8G A;  4HCS A;  2KED A;  3MTS A;  3F8T A;  3A5U A;  4DV6 Q;  3OWF A;  1SNP A;  3NK9 A;  1EQV A;  1CZW A;  1UEB A;  4DAV A;  3CW2 C;  3KJP A;  3D6W A;  1WTO A;  3PV0 A;  1CKN B;  1JC7 A;  2SOB A;  3PO3 B;  3NEN A;  2OWO A;  4IPD A;  3J81 j;  2F0F A;  4A3D G;  2AWO A;  1HQR D;  2CHB D;  4G7H C;  4FXD A;  5FJ8 G;  1OXU A;  2Z4H A;  5IGF A;  3CCU A;  1ZKO A;  3M4P A;  4RFB A;  4BY7 H;  3JAM c;  5E4X A;  4A75 A;  4JI7 Q;  1QVF A;  1STG A;  4X66 Q;  3ERS X;  4A3C G;  4LF8 Q;  5C44 G;  4O2D A;  5I2X A;  1G6Z A;  2DNE A;  5JPN C;  4C3J G;  5BN5 A;  2KEC A;  4O0A A;  4A3F G;  1SRU A;  1GUT A;  2NUC A;  1U4P A;  2ES2 A;  2K5V A;  5HGT A;  3M4Q A;  3KUP A;  4MIU A;  1EEI D;  1PHJ A;  1OO9 B;  3UDI A;  1B70 B;  4EQN A;  2N8N A;  4KHV A;  2HD3 A;  4CKB A;  1DM0 B;  5I2Y A;  2XSC A;  3S1R B;  2WB1 G;  4BBR G;  2I5L X;  1JB3 A;  1LTT D;  4P74 A;  3A8I E;  1WFQ A;  3CXC A;  1Y1W B;  4OO1 I;  3H0G B;  5D65 A;  4YY3 L;  2E5L Q;  2LS0 1;  4PZ8 A;  2UXB L;  3PO2 B;  1ICF B;  2PW5 A;  1Q82 C;  1VCI A;  4Q0F A;  1SFO H;  3X3M A;  4IAL A;  5IT9 c;  3TQY A;  1KNA A;  1Q8K A;  2Q8I B;  2YTV A;  4CGY B;  4C2M B;  2E5L L;  3GTQ B;  3J80 c;  1G91 A;  2KBN A;  4HJ7 A;  3H3V I;  4RWS C;  2NZ1 D;  1SMY C;  4LFA Q;  3VYS A;  3J80 L;  1FGU A;  2A19 A;  3HOY G;  1LUZ A;  1Z7T A;  3EA6 A;  4K8I A;  5C4X B;  3MA2 B;  4A3G G;  4A3C H;  1RF2 D;  5LMN W;  1Q3L A;  1NE3 A;  2Z6K A;  2XTI A;  3O13 A;  5KYL A;  3CP0 A;  3TSS A;  2E2I B;  2VQE L;  4JI2 L;  3J81 c;  3GTL H;  1H9K A;  2HHH Q;  3L0O A;  2JSO A;  1U9R A;  1AEX A;  2A6E D;  1DJR D;  3WOE A;  3S2H B;  1B9M A;  1SE2 A;  4DUZ Q;  1O7L A;  1I3Q H;  2Z1C A;  3MFG A;  1Y1W G;  1ZYR C;  2I5M X;  4Y7N B;  2KHJ A;  1WD0 A;  1OXT A;  4GNX C;  3S2H H;  5BN3 A;  3RLF A;  2E2H H;  4HMJ A;  1EIF A;  3TP7 A;  3ITP A;  3CCJ A;  4KY5 A;  3GTG B;  2X6G A;  2AKW B;  2HHH L;  1N34 L;  1SR3 A;  2R3Z A;  4LUV A;  2IX0 A;  4LMQ D;  3I4O A;  2AUJ D;  2WAQ G;  5CV5 A;  1AH9 A;  3HP3 A;  3GTP B;  4A3M G;  1A3T A;  4XQN A;  2E2J B;  4BY7 B;  1ROD A;  2J0T D;  3KLS X;  2VZA A;  5C4X H;  3F2D A;  1CA5 A;  2RCN A;  1IBL L;  4IQZ A;  1XTD A;  1TS2 A;  1PYW D;  2EY5 A;  4OIJ A;  1MGS A;  1TVX A;  1R9T B;  3Q22 A;  4RGO S;  1YNJ C;  2LXJ A;  3T13 A;  4CDC C;  3SK8 A;  5AJ3 L;  2YU9 H;  1XXG A;  1KXL A;  2QW7 A;  5IP9 H;  5C3W A;  1CKO A;  2F0K A;  1WCM H;  2JA9 A;  1ILQ A;  1EU3 A;  2QIL A;  3ERQ A;  3BYY B;  4OGQ C;  1NMF A;  3KF6 B;  1IBL Q;  4JW0 A;  1TS4 A;  2PI2 E;  4NPS A;  1Y1V G;  4IUN A;  5IYD G;  3A7A B;  4F8M A;  1KAW A;  4A3E G;  4APV A;  2JA7 H;  3AFQ A;  3I55 A;  1I50 H;  3MFY A;  3S17 B;  1L0X B;  3KF8 B;  5GAD C;  1W3S A;  3EQL C;  3HOW H;  1P16 A;  1TWH H;  5C3E B;  1NSN S;  2MPM A;  1SE4 A;  4WFN 3;  2ICI A;  1EY8 A;  4L63 B;  3EIV A;  4O42 A;  3GTG H;  3GDE A;  1CTM A;  2OTL A;  4M1U B;  3SEB A;  2I07 B;  2IX1 A;  4Y7N H;  1H9S A;  5IGC A;  2D9U A;  4KHP Q;  3K81 C;  4B9W A;  1XYI A;  1N32 Q;  2O5J C;  2IJ0 A;  1PZI D;  1GUS A;  3PUZ A;  1B9N A;  1U0L A;  3B6Y A;  1VDZ A;  2PQA B;  4YCW A;  1TWA H;  4X6A H;  4A3L G;  4JCV E;  2B8G A;  1K28 A;  3A56 A;  2R7Z B;  3AYH B;  1BF4 A;  5D3I B;  4KHP L;  1Y14 B;  1BBU A;  4RG1 A;  1SNQ A;  4Q5V A;  1JR0 D;  1EOV A;  1S5F D;  3STB C;  1S3O A;  2RDH A;  4DAY A;  2KA7 A;  3W3A A;  2VB2 X;  2BOS A;  3GD7 A;  4YWM A;  2KQ3 A;  3TZD A;  1TS3 A;  4LF9 L;  4LNQ A;  3BS1 A;  3I8Z A;  1Y8N B;  2PZW A;  5KRU A;  2L15 A;  4KKT A;  4XYO A;  4LFB L;  3W5O A;  4JI0 L;  2KCT A;  2CKZ B;  4DR5 Q;  2BCO A;  3ZJY C;  4ULL A;  1C48 A;  1PTO D;  1KRT A;  5KYI A;  1UE7 A;  1CQV A;  3FKI B;  3HOV B;  1Q7Y C;  4DR6 Q;  1T5E A;  3CCS A;  1PRT C;  1T9H A;  3PIO 3;  2WKD A;  5IOD A;  2JA7 G;  3M7G A;  3SHL A;  1Y1W H;  5IT9 L;  1FYC A;  3HKS A;  4DR4 Q;  1XMQ L;  2IPK D;  2RA4 A;  3C46 A;  1C0A A;  4LUO A;  4CDF C;  4HJ8 A;  3AFP A;  1F77 A;  1EIH A;  4KI0 A;  5EPJ A;  1SE3 A;  5C3X A;  3EFX D;  1Q81 C;  1AP0 A;  4HIO A;  4ILW A;  1QWY A;  4JOI A;  2Q2T A;  1JJC B;  2F0T A;  3MVV A;  4DR3 Q;  4H13 C;  4DXF A;  3T1H Q;  1IZ6 A;  2A6H C;  1HPC A;  2A69 D;  2NN6 G;  5EAY A;  5C4X G;  1B4O A;  3TRZ A;  1K8O A;  2K5D A;  1VQ7 A;  1HA6 A;  2E2D C;  1QOH A;  2K1B A;  4V19 0;  2OEO A;  2MUY A;  3CC7 A;  4A3I H;  1GM5 A;  1B8A A;  4KKS A;  4C56 C;  1VQ8 A;  2EJF C;  3H6M A;  1N33 L;  3NQT A;  4DR7 Q;  4BY1 G;  2DY7 A;  2M00 A;  1W6K A;  5IYB H;  4C3H H;  1A8V A;  3BZK A;  2AQ3 B;  3ND9 A;  1FJG Q;  3HEJ A;  1UNS A;  4G4K A;  1NTG A;  2FIN B;  3JAM L;  3H3V H;  1VQD A;  2BDN A;  4NP5 A;  4UY8 C;  1B1Z A;  3SK5 A;  4OX9 Q;  1JJG A;  2NVQ B;  4H02 A;  4X3K A;  4BWG B;  2ZTD A;  2DJF C;  4DUY Q;  3KDF A;  2JE6 I;  2A68 C;  1KLG D;  3VYT A;  4DNI A;  1K8A C;  1ET9 A;  4DKA C;  4WOR A;  4O1N A;  5J39 A;  1E7Z A;  1LO5 D;  4KN4 C;  4RGN A;  4DAP A;  4CDD C;  1HTP A;  1SAP A;  5I6Y A;  4DK3 C;  4XYQ A;  4H7B A;  1TWF B;  4A3K H;  1C7Y A;  4R8I A;  4ODG A;  4ALP A;  4J6H A;  4LF5 Q;  4DR2 Q;  3QB3 A;  1L0W A;  3VA7 A;  3Q6S A;  1FVI A;  2EE1 A;  2B2T C;  5JEA H;  2JP1 A;  1SND A;  2UUC L;  2HIX A;  1JMC A;  1ET6 A;  3I73 A;  5CV7 A;  2HIV A;  2F3V A;  2GVB A;  1ASY A;  4R4I A;  1KDA A;  2JA5 H;  2QA4 A;  3CC2 A;  4A3K B;  2ZM6 L;  2WKC A;  1S5D D;  2J7Z A;  4DR2 L;  5LMU Q;  1NUC A;  2LSS A;  2RF4 A;  1C8C A;  2F0J A;  3I7F A;  1D2B A;  4C3I H;  5BR8 Q;  2H5X A;  2L12 A;  4KD3 A;  1V1P A;  2SNS A;  2YTY A;  1MHW C;  1U4M A;  2ZM6 Q;  5DAU A;  1E3P A;  1B3Q A;  2OTJ A;  1SLJ A;  1F2Z A;  3A55 A;  4C1N K;  1GUN A;  3HRZ C;  1LT4 D;  2UXD Q;  2HDM A;  4FF3 A;  4NW2 A;  5CR3 A;  2QEJ C;  2ATW A;  1E24 A;  2EXZ A;  1A0I A;  5JOB A;  1VF7 A;  3ICE A;  4EQP A;  2PPB C;  2KOL A;  3D31 A;  4X64 L;  3CCR A;  2F0Q A;  5J1Z A;  1YNX A;  2AWN A;  1VMC A;  1RKN A;  2XWJ B;  1IKM A;  1IYJ B;  1X9N A;  2A73 B;  2ICE C;  3EN2 A;  1TWA B;  2IHF A;  4JOI C;  1HA5 A;  2EYF A;  5C0X H;  3ULP A;  2A8V A;  2HQL A;  4ZKC B;  3C3L A;  1F9Q A;  4DXG A;  2NYZ D;  4RH6 A;  1EY6 A;  5M3M H;  4XXE A;  4MTN A;  1IHZ A;  1MI2 A;  3NEM A;  1IXR A;  4B08 A;  4KJO A;  2VUM G;  2BE5 C;  4LF6 Q;  1OXX K;  2B8F A;  4ZCK A;  4JG2 A;  4QY7 A;  1EY4 A;  5ELE A;  1E1T A;  1PH2 A;  3NWS A;  4GOP C;  1PLF A;  1A62 A;  1XNQ L;  4A4I A;  3AEV A;  3K7U C;  3DWP A;  4WRD A;  4QCL A;  1YHA A;  1D1I A;  4AQY Q;  4U67 3;  1H95 A;  4LF6 L;  3A54 A;  4R1J A;  5T1G A;  4DGZ A;  5KEE A;  5IYD H;  1VQK A;  4YHH L;  1AE2 A;  3J7A V;  1RD9 D;  4DK0 A;  1SXT A;  4CBV A;  3RR5 A;  2Z6B A;  3DEO A;  3CCE A;  1VQN A;  2DNC A;  3S16 B;  5CGK A;  1CHQ D;  3JAM i;  1SE8 A;  2Q8R E;  1BUV T;  3CHB D;  2JA8 B;  3S1Q B;  1TKW B;  3NTK A;  5EQ0 A;  1CFM A;  1KC8 C;  4N8X 1;  1WTQ A;  3K8A A;  1JT8 A;  3T1Y Q;  4B9X A;  1X3G A;  2R92 H;  3S1M B;  4ABN A;  1H9J A;  3QJY A;  5IOC A;  2R93 G;  1GJX A;  2QCP X;  3PQI A;  1J8I A;  4DR1 L;  4CDE C;  2YYZ A; 
#chains in the Genus database with same CATH homology
 2NB0 A;  2WAC A;  3SK4 A;  3AU7 A;  1TWC B;  3OW7 A;  1ENF A;  2K01 A;  4C3H G;  1RTN A;  4NKL A;  2B2U A;  1MSG A;  3NHH A;  4RKL A;  3KK7 A;  2NWG A;  1QG7 A;  2LKV A;  2XNA C;  1HUM A;  2BDO A;  1B3A A;  1HUN A;  4KY7 A;  4YIJ A;  4ZLT F;  3U9S A;  5JVG 3;  3SDZ A;  2M2L A;  5EJW A;  2A68 D;  1MSH A;  3BVG A;  3NTH A;  1F2M A;  3RMH A;  3K7A B;  2F0V A;  4TQU S;  3HKZ B;  4U68 A;  3K59 A;  1LT3 D;  2YU9 B;  4FVM A;  2XVS A;  2C9O A;  1SNC A;  4UAI A;  4H0L C;  1DYQ A;  1TWG B;  3SR1 A;  5FK9 C;  2L11 A;  2FJ2 A;  1S5B D;  5LL6 X;  3AB9 A;  1EFI D;  1IW7 D;  3MWY W;  1HHV A;  5C5M A;  1Q8I A;  2PYK A;  1CHP D;  4C3I G;  2K6A A;  1ONL A;  2TSS A;  3LX0 A;  4DFA A;  1JOQ A;  5JJZ A;  1GHK A;  3P7J A;  5EPK A;  4F87 A;  4BA1 I;  3HOU B;  2PZT A;  1ESF A;  1BNZ A;  2ENB A;  4OHJ A;  3LNN A;  3CKI B;  5E3F A;  2WP8 J;  4I65 A;  1IYU A;  1A2T A;  4DA2 A;  3FVQ A;  2B2U C;  4XT3 B;  4CJ0 B;  2A6H D;  1I4R A;  1STE A;  1ESR A;  2CVR A;  1IL8 A;  5FOB B;  1WTX A;  3RD4 A;  4NDX A;  3CQZ B;  1FR3 A;  1PTO B;  2F0L A;  5DNF A;  3EVQ A;  4HR7 B;  3GV6 A;  3VR2 A;  5KNC A;  3ZYY X;  1LAB A;  2EZV A;  3WDN A;  4EVO A;  3T16 A;  2F3W A;  1B50 A;  1SYB A;  2EJG C;  1D5M C;  1Y1V B;  4IUP A;  4QUC A;  4K5W A;  4TSS A;  5D14 A;  4G7Z C;  5JPM C;  2EJM A;  1HFN A;  1V1P B;  5IGE A;  1HCZ A;  2RSO A;  4F7X A;  5A35 A;  1IKL A;  1ZEQ X;  1ENC A;  1GHJ A;  1PTO H;  5LL6 S;  1DD2 A;  3S15 B;  2L0C A;  3L3O C;  3D8G A;  1LTB D;  2O2L D;  3K0Y A;  4R8N A;  4DK1 A;  5CMD A;  2F0N A;  2PZU A;  2H4O A;  4N9T A;  3V96 A;  3Q24 A;  4A3I B;  5C4J B;  1JWS D;  4A3D B;  5K5P A;  2B2W A;  5K36 G;  4WJW A;  3OIQ A;  2JA5 B;  4CJ2 C;  1F9S A;  1II3 A;  4PMC A;  5ISR A;  1LT6 D;  1RTO A;  3VR3 A;  3P75 A;  1RHP A;  2M9V A;  3MXG A;  4C3J B;  3I91 A;  5IT9 E;  5COR A;  3GP7 A;  3EJI A;  4J8Q A;  3HOZ B;  1IYV A;  3I4M B;  1D5X C;  1B2T A;  1S5E D;  4QB4 A;  1FGB D;  4QF4 A;  1XX8 A;  3D3R A;  1UAP A;  5DM7 3;  2NTT A;  2BA1 A;  2RVL A;  1CZG A;  4K14 A;  1SYD A;  1E2W A;  3TZU A;  1F2Y A;  2EYH A;  4X3T A;  1FNU A;  3A7L A;  3E6Z X;  2Y0S B;  3DMU A;  1MD2 D;  1R4Q B;  1EOT A;  2NVY B;  4KMU C;  1MBY A;  4IFD I;  1PRT F;  4BBR B;  1EIG A;  3NWT A;  5I6W A;  2K04 A;  2ZXP A;  3K5L A;  4ZRZ A;  1PZJ D;  1JOK A;  3M3Y B;  4XQQ A;  1G8Z D;  1AZQ A;  2F0M A;  5FO8 B;  5KND A;  2IW3 A;  3OOC A;  5LHY 1;  2RDG A;  1F2L A;  4A3G B;  1EWC A;  1FNW A;  2PCF B;  4IZ8 A;  1CT1 D;  1I4P A;  2JA6 B;  2L5T A;  4X3S A;  2MHV A;  3X3N A;  1KAA A;  1DOM A;  2B2Y A;  2B2Y C;  1STN A;  1STB A;  1PZK D;  3SK6 A;  3CU7 A;  3VR6 A;  5M5Y B;  3HOY B;  4E6I A;  5IGG A;  3FPU B;  4RGT A;  2JYO A;  5M5W B;  2DN8 A;  3N52 A;  4TRD A;  4KK7 A;  4FNF A;  1JWM D;  4HED A;  4IFD J;  2L55 A;  1H9M A;  1NCV A;  3M4O B;  1DON A;  5COY A;  1SDF A;  1LTG D;  2N88 A;  3D4W A;  3J80 E;  2SDF A;  4PQX A;  5M5X B;  1ML0 D;  4FF4 A;  2JEB I;  5JVH 3;  1V43 A;  1I6H B;  4PMW A;  3OWE B;  4CJ1 B;  2RDF A;  2KHS A;  1JOO A;  2LFN A;  1TU2 B;  3BVM A;  2QKI C;  2JEA I;  2K03 A;  3NTI A;  3K5M A;  3SVM A;  5FKA C;  4F88 A;  2B63 B;  2F0P A;  3KLR A;  5M3M B;  3BYT B;  3I4L A;  4K6L A;  5C4Z A;  1I3Q B;  3TN2 A;  1EU4 A;  3GTL B;  3DWQ A;  1VMP A;  4MHE A;  1KDB A;  1X32 A;  3AMU A;  3R8B A;  2EYJ A;  3KLS A;  2K7V A;  1LTI D;  2XN9 C;  3OSO A;  5CBA E;  5JAV A;  3K5O A;  1SMY D;  1I4Q A;  1JOR A;  2NN6 I;  2EY1 A;  2RKS A;  2LY7 A;  2NTS A;  1JE4 A;  4OIK A;  3TBI B;  2IWH A;  5M3F B;  5CV9 A;  3VA5 A;  3MAQ A;  3OIP A;  4KJN A;  2KVM A;  1BCP D;  3QWN A;  5JEA G;  3GTK B;  2EY2 A;  4IFD H;  2NN6 H;  4RGM A;  4I7Z C;  1LTS D;  4HMI A;  1JCK B;  2XRQ D;  3BDO A;  3LWE A;  4CHT B;  5EPL A;  5JEA J;  4DN4 M;  1BXT A;  3KBG A;  1D6E C;  2V4D A;  3H3V C;  1PXU A;  1A15 A;  3H09 A;  2XRS D;  2EVB A;  2F0D A;  4P2C B;  2WAQ B;  1SBB B;  1ZXT A;  2PNR C;  3UI2 A;  2N55 A;  3P1H A;  4IUQ A;  2O5I C;  1CK1 A;  4BBS B;  4IN3 A;  1QIL A;  2BA0 A;  3G6J B;  2D2C C;  4PNY A;  4RKB A;  1GXD C;  4ZAI A;  1ICW A;  4FO2 A;  2B39 A;  5T1I A;  1U4R A;  3J7Y W;  3S1N B;  2K33 A;  3U9O A;  2E75 C;  4ZKB B;  1H9R A;  5AFW A;  1PTO C;  2R6G A;  3KBX A;  3N6R A;  1EWH A;  2K5Q A;  3GQB A;  2MGS A;  4FYD A;  3P20 A;  5EKL A;  5EBD A;  1IW7 C;  2Z8L A;  2WII B;  1TS5 A;  5CYU A;  3TP6 A;  1I4H A;  2F03 A;  1EY5 A;  3E0J A;  2B2T A;  5FO7 B;  1LV9 A;  1ILP A;  1M8A A;  5C0X I;  2FFK B;  2IT1 A;  3K6O A;  3T56 B;  2Q8T A;  1WVL A;  3TP8 A;  2X6L A;  2BE5 D;  3CRK C;  4JK1 C;  3H91 A;  1HFG A;  3M4Y A;  3MZ5 A;  2ZT9 C;  1O7Z A;  1FD7 D;  4ZUJ A;  3I3C A;  1AW7 A;  3FEW X;  4K6D A;  1BR9 A;  2D5D A;  4BA2 I;  3M7N A;  2F0H A;  2R92 B;  1KLU D;  1GOZ A;  3T51 B;  3QG1 A;  5C5L A;  2QDB A;  2B2V A;  2GA4 B;  4HN7 A;  2HUG A;  3VR4 A;  2L1B A;  5CV8 A;  2F4I A;  3NPP A;  3SE0 A;  2E76 C;  4J1M A;  1EYA A;  2OT2 A;  3MXN A;  1UUP A;  5IIF A;  1CQF A;  1BCP C;  2RQX A;  1EY9 A;  3T53 B;  5M9O A;  3NQI A;  1E0B A;  5FLX L;  1ZYR D;  3TDQ A;  4IUR A;  1J9O A;  5A2Q E;  4X3U A;  1LTA D;  1BDO A;  1H9S B;  3E5S A;  1SSO A;  3J81 E;  3GV3 A;  1KNE A;  1Q1E A;  5C6A A;  3HOW B;  1ENA A;  5FO9 B;  5E4W C;  1BO0 A;  1I50 B;  1Q90 A;  3OMC A;  5D3D A;  1V1O A;  2VUM B;  2NVX B;  2AUK A;  4EGV A;  4A3J B;  1Q12 A;  3R3O A;  2OXP A;  4A3F B;  1CM9 A;  1JQY D;  3VYR A;  1XTC D;  2F0I A;  5DEH A;  1DCZ A;  1SNO A;  5KNB A;  1WTV A;  5BN4 A;  3DEP A;  1T5X D;  4KN7 C;  4CKE A;  2F0U A;  1WD1 A;  3R2I A;  2B2W C;  1STH A;  3K5N A;  3FPP A;  2QF7 A;  3A8J E;  5EKK A;  2PW7 A;  1PDQ A;  3NXW A;  1G29 1;  3L7Z C;  4BS9 A;  5ELD A;  3V2T A;  1YNN C;  2K32 A;  2J4X A;  4DU9 A;  3NE5 B;  1DOL A;  1E2Z A;  1HTL D;  4L6T B;  1G2S A;  4K8J A;  1RDP D;  3DM1 A;  5ELC A;  1BQQ T;  2A5H A;  1I6V C;  2EDG A;  3MXU A;  5ELB A;  2JXM B;  3NUC A;  2EYL A;  1QNU A;  3TME A;  2HCI A;  4RHS A;  2JA7 B;  2A69 C;  1QJO A;  4HSP A;  2C5C A;  5NUC A;  1E2V A;  3I4N B;  3R93 A;  2MP1 A;  1DZ1 A;  1KDC A;  1BCP F;  4N9P A;  1KTK A;  1GUG A;  2AQ2 B;  1WTP A;  4C3H B;  3KF8 A;  4IUU A;  2PO4 A;  3T4A C;  2K28 A;  3HGB A;  3TP5 A;  1G2T A;  2CQA A;  1EEF D;  5F2D A;  3D6C A;  1SYG A;  4BY1 B;  1Y8P B;  2WB1 B;  4PMB A;  1U4L A;  3GTJ B;  3BDC A;  3D4R A;  1WTW A;  2SEB D;  4RCN A;  2F0W A;  1Q1B A;  2E2H B;  4GZY C;  3FDT A;  2WV6 D;  4HSV A;  1S5C D;  2RSN A;  5EBC A;  4A3E B;  1QE6 A;  4KTA A;  2FMC A;  4S3S A;  1LTR D;  3HOX B;  2CW0 D;  3BVZ A;  5IGD A;  1DOK A;  1PMR A;  2RBM A;  3C1E A;  4R9W A;  1AFP A;  5DM6 3;  1EYD A;  5J22 A;  3VR5 A;  3NBI A;  2EOT A;  1TQO A;  1EZ8 A;  3CRL C;  3S9W A;  5E1F A;  2KCN A;  5TSS A;  1WCM B;  3H94 A;  1EYC A;  2HDL A;  5EKI A;  3FRP B;  1EY0 A;  5CV4 A;  3ONA B;  4K5V A;  1LT5 D;  2MJ8 A;  1Z6H A;  3K57 A;  1JWU D;  1SYE A;  4FP5 D;  1M4V A;  4HTH A;  4HCE A;  4QIW B;  1X3Q A;  1D1K A;  2L9H A;  4NMZ A;  2NBF A;  5A2Q L;  3OPO A;  2I46 A;  3NSW A;  1PFN A;  4MN3 A;  5I9O A;  4FF2 A;  5KIX A;  1CA6 A;  4KKU A;  1SYF A;  1LAC A;  3C1F A;  1TWH B;  3BZD B;  3R2T A;  2E74 C;  3GTO B;  1Y8O B;  2HCC A;  3J7A F;  3V05 A;  2XIW A;  2G9D A;  3I70 A;  4ZUI A;  4K2K A;  2G9H D;  2L4N A;  1GUW A;  3ND8 A;  2TMP A;  3D4D A;  3K58 A;  4EQO A;  4CKC A;  1K83 B;  1F9R A;  3RUZ A;  2ID0 A;  3MC0 B;  4ZYS A;  2DY8 A;  5K36 H;  3QOJ A;  3QIA A;  3WOF A;  3IL8 A;  4K2L A;  2Z4I A;  1HRJ A;  1HXY D;  3HG9 A;  3A8K E;  2NVT B;  2A74 C;  4ME5 A;  1PFB A;  5CV6 A;  1O7Y A;  4FXK C;  2KCC A;  3JAM E;  1C4Q A;  1D5Z C;  2B2V C;  4KD4 A;  3I90 A;  2VXW A;  3QOL A;  1SJH D;  1JIC A;  2O4X A;  2KUM A;  2IL8 A;  1RJT A;  3NBH A;  4G7O C;  4FF1 A;  5FLX E;  3OHX C;  4OO1 H;  2FHT A;  2R61 A;  1B53 A;  1A6X A;  1TY0 A;  2IX3 A;  1PTO F;  3G7L A;  1TR5 A;  4LK1 C;  4QMG A;  1A2U A;  2F0E A;  1F9P A;  3HZX A;  4V0B A;  2PMZ B;  5EGT A;  3PUW A;  2FMM A;  2VNU D;  1O80 A;  4RHR A;  1CI3 M;  4A3B B;  2H1E A;  1SNM A;  1Z47 A;  4QUF A;  4XT1 B;  3J81 L;  1QCB D;  1PFM A;  2OF1 A;  2ZXR A;  1I4G A;  1K8M A;  4A3M B;  4DNR B;  1SFO B;  3Q23 A;  3PUY A;  5C0X G;  2F0S A;  4LJZ C;  3MXP A;  2PQE A;  3I72 A;  3PMF A;  1Y69 U;  1LLR D;  1WTR A;  2EY6 A;  1FNV A;  2EYO A;  1SJE D;  1NAP A;  2ZXO A;  4DNT B;  1S4Z A;  3OMG A;  1BCP B;  4M8A A;  4TKO B;  5I9P A;  4FXG C;  1NR2 A;  3IFD A;  5C44 B;  1AZP A;  4KHZ A;  4JBW A;  3S2D B;  1SYC A;  4OO1 G;  1TY2 A;  1AN8 A;  1STA A;  3L9A X;  1HQM C;  1EL0 A;  1R4P B;  3QO2 A;  3GO5 A;  3LWU A;  3C2P A;  2F1M A;  4OL7 A;  5ELF A;  1UEA B;  3F2U A;  4DF7 A;  2WIN B;  1EZ6 A;  4XIG S;  1TII D;  2F0G A;  3M85 A;  3PUV A;  3BG3 A;  4C3I B;  5CC4 A;  3IAY A;  2LMC B;  4KY6 A;  2F0O A;  1SEB D;  1TT2 A;  4PV1 C;  2HQE A;  1YNN D;  5C4H A;  2XWB B;  3IFT A;  3HS0 C;  1EQT A;  2EPB A;  4XQJ A;  1PRT D;  3PIP 3;  1O78 A;  2CW0 C;  3NP8 A;  1XWE A;  2R93 B;  3S14 B;  1I4X A;  1QB5 D;  2K05 A;  2A6E C;  3ERO A;  3W2D A;  4ZK9 B;  3PUX A;  5G3L F;  4RCO A;  5G3L D;  5C0X J;  4A93 B;  3RZO B;  1W6J A;  1STY A;  4XTC S;  5HUR A;  1EY7 A;  3DUZ A;  3SXH A;  4UDU C;  1GUO A;  5KGU A;  1X3P A;  4C1N I;  3DWA A;  4AYB B;  1OXS C;  1VF5 C;  1OXV A;  4RA8 A;  4Z9C B;  4ID6 A;  1NR4 A;  3GTM B;  3RZD B;  2VB3 X;  2EYM A;  2EYP A;  4XDX A;  3URY A;  4RAU C;  2KEE A;  1PRT B;  3MEH A;  3Q0A A;  1BOS A;  4L8J A;  1RCV D;  5IGB A;  1DXM A;  4KV6 A;  1V8Q A;  1L0Y B;  3MHB A;  2SNM A;  2AQ1 B;  3FMC A;  4IFD G;  4IUV A;  3DXJ C;  1QNK A;  4LAA A;  4H44 C;  4ZQ3 A;  1A3V A;  5I4D A;  1A3U A;  3DHQ A;  4K5X A;  2K5W A;  3VYU A;  2X69 A;  1YNJ D;  5CBE E;  2KJX A;  1B44 D;  2D62 A;  3IKJ A;  4IUT A;  4HAE A;  4G57 A;  1BBX C;  1KAB A;  3BDL A;  4HCS A;  2KED A;  3MTS A;  3OWF A;  1SNP A;  3NK9 A;  1EQV A;  1CZW A;  4DAV A;  3D6W A;  1WTO A;  3PV0 A;  1JC7 A;  2SOB A;  3PO3 B;  2F0F A;  2AWO A;  1HQR D;  2CHB D;  4G7H C;  4FXD A;  1OXU A;  2Z4H A;  5IGF A;  1ZKO A;  4RFB A;  5E4X A;  1STG A;  5I2X A;  1G6Z A;  2DNE A;  5JPN C;  4C3J G;  5BN5 A;  2KEC A;  1GUT A;  2NUC A;  1U4P A;  5HGT A;  3KUP A;  4MIU A;  1EEI D;  1OO9 B;  4EQN A;  4KHV A;  4CKB A;  1DM0 B;  5I2Y A;  2XSC A;  3S1R B;  1JB3 A;  1LTT D;  3A8I E;  1Y1W B;  4OO1 I;  3H0G B;  5D65 A;  2LS0 1;  3PO2 B;  2PW5 A;  1VCI A;  4Q0F A;  3X3M A;  4IAL A;  1KNA A;  2Q8I B;  4CGY B;  4C2M B;  3GTQ B;  1G91 A;  4RWS C;  2NZ1 D;  1SMY C;  3VYS A;  3J80 L;  1Z7T A;  3EA6 A;  4K8I A;  5C4X B;  3MA2 B;  1RF2 D;  1Q3L A;  3O13 A;  5KYL A;  3TSS A;  2E2I B;  1H9K A;  2JSO A;  1U9R A;  1AEX A;  2A6E D;  1DJR D;  3WOE A;  3S2H B;  1B9M A;  1SE2 A;  1O7L A;  2Z1C A;  3MFG A;  1ZYR C;  4Y7N B;  1WD0 A;  1OXT A;  5BN3 A;  3RLF A;  4HMJ A;  3TP7 A;  3ITP A;  4KY5 A;  3GTG B;  2X6G A;  2R3Z A;  2IX0 A;  4LMQ D;  2AUJ D;  5CV5 A;  3HP3 A;  3GTP B;  1A3T A;  4XQN A;  2E2J B;  4BY7 B;  1ROD A;  2J0T D;  3KLS X;  1CA5 A;  4IQZ A;  1TS2 A;  1PYW D;  2EY5 A;  4OIJ A;  1MGS A;  1TVX A;  1R9T B;  3Q22 A;  4RGO S;  1YNJ C;  3T13 A;  3SK8 A;  1XXG A;  5C3W A;  2F0K A;  1ILQ A;  1EU3 A;  2QIL A;  3BYY B;  3ERQ A;  4OGQ C;  1TS4 A;  4IUN A;  3A7A B;  4F8M A;  3MFY A;  3S17 B;  1L0X B;  3EQL C;  5C3E B;  1NSN S;  2MPM A;  1SE4 A;  4WFN 3;  2ICI A;  1EY8 A;  4L63 B;  4O42 A;  1CTM A;  4M1U B;  2IX1 A;  2I07 B;  3SEB A;  1H9S A;  5IGC A;  2D9U A;  4B9W A;  1XYI A;  2O5J C;  2IJ0 A;  1PZI D;  1GUS A;  3PUZ A;  1B9N A;  1VDZ A;  2B8G A;  3A56 A;  2R7Z B;  1BF4 A;  5D3I B;  1SNQ A;  4Q5V A;  1JR0 D;  1S5F D;  2RDH A;  4DAY A;  2KA7 A;  3W3A A;  2VB2 X;  2BOS A;  3GD7 A;  2KQ3 A;  3TZD A;  1TS3 A;  3BS1 A;  3I8Z A;  1Y8N B;  2PZW A;  5KRU A;  4KKT A;  4XYO A;  2BCO A;  4ULL A;  1C48 A;  1PTO D;  5KYI A;  1CQV A;  3FKI B;  3HOV B;  1T5E A;  1PRT C;  3PIO 3;  2WKD A;  5IOD A;  3M7G A;  3SHL A;  5IT9 L;  1FYC A;  2IPK D;  2RA4 A;  3C46 A;  1F77 A;  1EIH A;  4KI0 A;  5EPJ A;  1SE3 A;  5C3X A;  3EFX D;  1AP0 A;  4ILW A;  1QWY A;  2F0T A;  3MVV A;  4H13 C;  4DXF A;  2A6H C;  1HPC A;  2A69 D;  2NN6 G;  1B4O A;  1K8O A;  2K5D A;  1HA6 A;  2E2D C;  1QOH A;  2K1B A;  4V19 0;  2OEO A;  2MUY A;  4KKS A;  4C56 C;  2EJF C;  3H6M A;  3NQT A;  2DY7 A;  2M00 A;  1W6K A;  2AQ3 B;  3ND9 A;  3HEJ A;  1UNS A;  4G4K A;  2FIN B;  3JAM L;  2BDN A;  4NP5 A;  1B1Z A;  3SK5 A;  2NVQ B;  4X3K A;  4BWG B;  2JE6 I;  2A68 C;  1KLG D;  3VYT A;  1ET9 A;  4WOR A;  4O1N A;  5J39 A;  1LO5 D;  4KN4 C;  4RGN A;  4DAP A;  1HTP A;  1SAP A;  5I6Y A;  4XYQ A;  4H7B A;  1TWF B;  4R8I A;  4ODG A;  4J6H A;  3QB3 A;  3VA7 A;  3Q6S A;  2EE1 A;  2B2T C;  5JEA H;  2JP1 A;  1SND A;  1ET6 A;  3I73 A;  5CV7 A;  2F3V A;  1KDA A;  4A3K B;  2WKC A;  1S5D D;  2J7Z A;  1NUC A;  1C8C A;  2F0J A;  1D2B A;  2L12 A;  4KD3 A;  1V1P A;  2SNS A;  1U4M A;  5DAU A;  1F2Z A;  3A55 A;  4C1N K;  1GUN A;  3HRZ C;  1LT4 D;  2HDM A;  4FF3 A;  4NW2 A;  5CR3 A;  2QEJ C;  2EXZ A;  5JOB A;  1VF7 A;  4EQP A;  2PPB C;  2KOL A;  3D31 A;  2F0Q A;  5J1Z A;  2AWN A;  1VMC A;  1RKN A;  2XWJ B;  1IKM A;  2A73 B;  2ICE C;  1TWA B;  1HA5 A;  2EYF A;  5C0X H;  4ZKC B;  3C3L A;  1F9Q A;  4DXG A;  2NYZ D;  4RH6 A;  1EY6 A;  4XXE A;  1IHZ A;  1MI2 A;  4B08 A;  4KJO A;  2BE5 C;  1OXX K;  2B8F A;  1EY4 A;  5ELE A;  3NWS A;  1PLF A;  3DWP A;  4WRD A;  4QCL A;  1D1I A;  4U67 3;  3A54 A;  5T1G A;  4DGZ A;  5KEE A;  3J7A V;  1RD9 D;  4DK0 A;  1SXT A;  4CBV A;  3DEO A;  2DNC A;  3S16 B;  5CGK A;  1CHQ D;  2Q8R E;  1BUV T;  3CHB D;  2JA8 B;  3S1Q B;  1TKW B;  3NTK A;  5EQ0 A;  1CFM A;  1WTQ A;  4B9X A;  3S1M B;  4ABN A;  1H9J A;  3QJY A;  5IOC A;  1GJX A;  2QCP X;  1J8I A;  2YYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...