5K5PA

Crystal structure of staphylococcal nuclease variant delta+phs i72k l103k at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEVEFDKGQRTDKYGRGLAYIYADGKMVNEAKVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I72K L103K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 37
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5k5pA00
4HMIA 5CV9A 2EYMA 4KTAA 5IIFA 5CR3A 5C5LA 2RKSA 3OMCA 4IALA 5KGUA 1A3TA 5KYIA 4F7XA 3D8GA 4PMCA 4OL7A 5ISRA 3D4WA 1KDBA 4QMGA 1A3VA 2PZTA 4QF4A 3EROA 1SYFA 1EYAA 1A2TA 3EVQA 3QB3A 5KIXA 2SNSA 4F8MA 2NUCA 5IOCA 5HURA 5IODA 2F0JA 3R3OA 1EY5A 3TP5A 1EY9A 3P75A 1EYCA 5CV6A 4NP5A 5EKLA 2F0SA 4I65A 4K14A 4K5VA 4K2KA 2OF1A 5IGDA 1SNMA 2PW7A 3MXPA 1SNQA 4EQNA 5I6WA 5M9OA 5KEEA 2EXZA 2OEOA 3LX0A 3BDCA 4EVOA 5JOBA 1SNCA 4KHVA 3SHLA 1II3A 1KAAA 5K5PA 3H6MA 2F0WA 4NDXA 5NUCA 4KJNA 5C3WA 1STNA 5IGBA 2F0KA 2F0HA 1JOKA 3ERQA 3OWFA 3OMGA 4B9XA 1F2MA 1STGA 4S3SA 4TRDA 1KABA 3SR1A 3ITPA 4EQPA 4DFAA 5I9OA 3QOLA 4IUNA 3SK6A 1SNDA 4KY7A 2F0GA 5C4HA 5I6YA 2SNMA 2F0QA 3U9OA 1EY8A 1SYCA 2PYKA 4KJOA 4HTHA 3SK5A 4EQOA 4RKLA 2EY2A 2O4XA 4KY5A 3T13A 2KHSA 2F0OA 2EYOA 4HMJA 2F0PA 4LAAA 3DHQA 2F0FA 3NK9A 4K2LA 4KY6A 1EZ8A 4QB4A 4G57A 2SOBA 1KDCA 1SYGA 2PZUA 2WACA 3TP6A 5F2DA 1STBA 3D6CA 2F0LA 4ZUJA 2KQ3A 1JOQA 1A3UA 3SK8A 1JORA 4N9PA 2F0TA 2PZWA 1EY4A 3MEHA 3C1EA 5IGCA 1EY6A 5C5MA 3OSOA 5CV7A 1IHZA 2EYFA 4H7BA 1STHA 3EJIA 2EYHA 1SYDA 1SYEA 2QDBA 5IGGA 5KRUA 2OXPA 2F0EA 3E5SA 4B9WA 2F3WA 2F0NA 4PMBA 1ENCA 3NHHA 2EYPA 3P1HA 4WRDA 4ME5A 5DEHA 3MZ5A 2EY6A 5CGKA 5C3XA 1EQVA 3DMUA 4E6IA 4ZUIA 1ENAA 1EY0A 5EGTA 2F0DA 3PMFA 1STYA 1TR5A 1F2YA 3BDLA 3SK4A 4IZ8A 1NSNS 4ID6A 4R8NA 5J39A 1SYBA 3MHBA 3TP8A 1EZ6A 2RDFA 4K5XA 1KDAA 3D4DA 4KV6A 5JAVA 5KYLA 5DAUA 2F0UA 2EYLA 3TP7A 3NP8A 3TMEA 5EKKA 5CV8A 2M00A 5E3FA 2EYJA 4K8IA 4KD4A 4ODGA 3RUZA 4YIJA 4K5WA 5CV4A 2F0IA 5IGEA 2ENBA 4K6DA 5IGFA 1TT2A 1F2ZA 3HZXA 5E1FA 5CC4A 5I9PA 1EYDA 3HEJA 3V2TA 2RBMA 3SXHA 4DU9A 4RKBA 5J22A 4PNYA 1SNPA 4N9TA 2F0MA 4KD3A 4NMZA 1NUCA 1STAA 3QOJA 4J6HA 1TQOA 2EY1A 2F0VA 4DGZA 1SNOA 5CV5A 1EY7A 2LKVA 4ZQ3A 2F3VA 4WORA 3VA5A 5C4ZA 5HGTA 3S9WA 3MVVA 4MIUA 3C1FA 2PQEA 2EY5A 1RKNA 3NQTA 4K8JA 1U9RA 2PW5A 3T16A 5C6AA 4DF7A 1JOOA 1A2UA 5J1ZA 1AEXA 3NXWA 4NKLA 2HQEA 4J1MA 3NUCA
chains in the Genus database with same CATH superfamily
3CCQA 2CQOA 2FHTA 5FJ8G 1AFPA 4IALA 2Z4IA 2AQ2B 1LTLA 1V9PA 1GO3E 4JI8Q 3J7AV 3L2PA 1OXTA 4GLAC 4KMUC 2ZJRA 2JA6H 2AQ1B 2B29A 3R3OA 2KEEA 3CCMA 1CKNA 2F0SA 3NELA 4P71A 1SNQA 5IYCH 2N8NA 2OEOA 1G91A 1J8IA 1XMOL 1BNZA 4MZ9A 3D3RA 4G7HC 1YI2A 2UUCL 1HZ9A 4Z9CB 1FJGL 1DM0B 4FNFA 1X6OA 3AQQA 5T1IA 3U9SA 1MJCA 2PO4A 4L8JA 4DK3C 1WCMH 4EQPA 1G6PA 4WJWA 4JBMA 4JVZA 1XYIA 2E76C 3M9BA 1HZCA 2B8FA 3IKJA 5IP9H 4MTKA 4LFBQ 3ONAB 1TY2A 3J81L 3FDTA 4X66Q 5BN4A 4BBSG 2F0OA 1I4HA 4UDUC 4HJ5A 1VQBA 1I4RA 3KF8A 3J81c 4DR5Q 4A3KH 3S17B 2F1MA 4X65L 4JOIC 3SK8A 1JC7A 4BA2I 1KL9A 3EJIA 2K03A 1Q7YC 5IGGA 2N78A 1RDPD 4GKJQ 1QZHA 1QCBD 4HCEA 3M4OB 1NR2A 5C3XA 5M5YB 1CM9A 1VMCA 4Y7NB 2VB2X 3HOYB 1E0BA 3EN2A 3I7FA 4C3IH 3J7AF 1Q1BA 3S1QH 3I8ZA 1VQ9A 2WV6D 2F3IA 2A69C 2ENBA 2MO1A 4BWGB 3MWYW 4JPBW 3OW2A 3ERSX 5E1FA 2RBMA 2AMCB 1YHAA 5FO9B 3EBEA 1H9RA 2ZM6L 1STAA 2MUYA 2L4NA 4P72A 4DR5L 1HUMA 2LKVA 2XSCA 3ER0A 3NQTA 2UXDL 1L1OB 3ZJYC 3RN5A 3G48A 4KN4C 2HQEA 4J1MA 1PH2A 1KC8C 5G3LD 2UXBQ 4HMIA 1IYUA 2RSOA 4BY7H 1XJVA 1YNNC 4QMGA 2BA1A 2PZTA 4GKKL 4KN7C 4DK6C 1ZEQX 1SYFA 3M4PA 1HQRD 1SXTA 2QW7A 1BR9A 2XVSA 4CJ0B 2NVYB 3SEBA 1CI3M 1EY9A 4BA1I 3TS2A 4H0LC 1JJCB 1X3PA 2PW7A 3BG3A 4QUFA 4G7ZC 3KBGA 4LF4Q 5IYBH 2NVTB 3GTGB 1Y1VB 1A6XA 3TEHB 2AWOA 1W3SA 1SBBB 3UDIA 2NB0A 1F2MA 1YJ9A 3MFYA 4BBSH 1PRTF 2A1AA 1Q81C 1K83H 2HT1A 2F0GA 2Q8IB 1BCPC 3BVGA 2O4XA 4C3IG 5FLMG 2A68C 4HMJA 2JA8G 4K2LA 1SR3A 5C0XI 4X64Q 3CHBD 3TRZA 1MHWC 3CCEA 1JOQA 2YTVA 1IBMQ 3AMUA 1J9OA 3H3VI 3VYUA 4DV2Q 1W6KA 2L55A 3I91A 3CMAA 3K7AH 3V96A 2EYPA 3D0FA 2O5IC 3S2HB 4IJHA 1ENFA 2HIVA 4JW0A 1KRTA 2ZXPA 3H91A 5FLXL 4DR2L 4R8NA 3LWUA 4BXXG 2R93G 3MHBA 2Z6BA 3K0YA 4OX9Q 3TP7A 3TMEA 3VR4A 5CV8A 1IL2A 1EEFD 5M5XB 3HOXB 1DXMA 4RCNA 4ZK9B 1GUTA 2F0IA 3DEPA 5IGFA 2ICEC 1VF7A 2WKDA 4DV0Q 5IT9c 1YNJC 4IJLA 2Z8LA 1SLJA 4QUCA 2UU9L 1EWHA 3RZOH 3D6WA 4JI7Q 1Y1VG 3C1FA 1Y14B 2EJGC 1OXSC 2B63B 4YY3Q 1TY0A 2PNRC 3GTPH 3HOXG 1HNXL 2VS1A 5KGUA 3H09A 4EQ5A 1A63A 1LV9A 1I4PA 2R3ZA 2X69A 1AZPA 5IOCA 1TWGH 4DR2Q 3S2HH 1EYCA 5C0XG 2A6HC 1HUNA 4JI3Q 2K52A 4IFDI 1CFMA 1L0WA 3STBC 5D14A 4XXEA 5C4XB 1PXUA 4UP8A 4R4OA 4LF5Q 3I4MB 2F0KA 1AE2A 3ERQA 3OWFA 1MSGA 1KABA 3K6OA 3TDQA 4UHVA 1RHPA 1DOMA 2K4KA 3QG1A 1MJEA 1EY8A 2K01A 1SE3A 1PH4A 4JI2L 4YWMA 3STBD 4JI7L 3IRBA 4OHJA 4QIWB 4DR3L 4BY1B 2YYZA 2H1EA 2WACA 3RN2A 5IY0A 3GV3A 5A35A 1SE2A 2F0LA 4ZUJA 3KF6A 4YCUA 3I4NG 4AH6A 2F0TA 1ZKOA 4NPSA 4UP9A 4PG3A 5KRUA 1EWCA 3E5SA 4QL5A 2ZTCA 4ME5A 4R4TA 1ENAA 1ZYRC 1SE4A 5L37A 1RTOA 1WTOA 1TWGB 3H0GG 3BDLA 3SK4A 5IP7G 4HSPA 2DGYA 1B9MA 2UUAQ 1EZ6A 3H3VC 5JAVA 3HKZG 2F0UA 4NXMQ 1UE6A 5E3FA 3K5LA 2FFKB 2FINB 1VQCA 2RSNA 3M3YH 1Y1WG 2XGTA 4RHSA 1F2ZA 1SFOH 4LFCL 2KBNA 1B3QA 1OXXK 4PMWA 3HOZH 2F0MA 4NMZA 1KQSA 1RODA 3G4SA 3CRLC 2EY1A 3R8BA 1FD7D 1HJPA 1R4PB 2A6EC 2EY5A 1RKNA 3AYHB 2PW5A 1VQLA 3PO3H 1YNJD 4DF7A 1EWIA 3I4MG 4OELB 5KYIA 3GV6A 5CV9A 4RWSC 3SDZA 1JCKB 1WD0A 4K0KQ 2B2UA 3GTKH 2NN6H 2NVYH 4MNOA 3CMEA 4A3JG 5LMNW 2QA4A 1A3VA 2B63H 3K58A 1GUGA 3Q22A 2ZJPA 3HOYH 5M3FH 2Y0SE 5EJWA 3M4OH 3A8JE 3X3MA 1TWHB 2NN6G 2I46A 3MXPA 4MN3A 1PYSB 2BDOA 1BBUA 3T4AC 2N88A 1QVGA 1XPUA 1AP0A 4NDXA 2SEBD 1M90C 2JSOA 1K3RA 1G2SA 5EPKA 1F9PA 1DGSA 3RLFA 4CKEA 1HRJA 1YNXA 5FOBB 4A3GG 1ASYA 1X56A 5M3MG 4JI4Q 2F4VL 3OHXC 2Z6KA 2NWGA 3PCOB 3T1HQ 1Z9FA 1Z7TA 3GO5A 4FVMA 1BVSA 3KDFB 4C1NI 1KDCA 4BBRH 4UP7A 1N33Q 1JORA 3I72A 3NWSA 2PZWA 1S3OA 3QWNA 3J81j 3AEVA 1LTRD 3KLWA 4BBRG 1KAWA 1ENCA 1O7IA 5CYUA 4QQBX 3P1HA 4ZRZA 3ND8A 3UI2A 1EQVA 3NBHB 4HJAA 1SN8A 3GQBA 1S5FD 3OIQA 1TR5A 3GP7A 1PFMA 3NE5B 4ID6A 2L5TA 4OWTB 3T51B 3TP8A 4A3EG 4X65Q 1L1OA 5H1SE 5DAUA 4IPGA 3T1YL 1TVXA 2KUMA 2C35B 1EOVA 1IBLQ 1TS2A 2AQ3B 2EYJA 1EQQA 4IN3A 3Q24A 4ZKBB 4CDFC 4L5QA 4K6DA 4C3HG 3CC4A 5FO7B 1N32Q 2KECA 3BDOA 3SXHA 3RNUA 2NVQH 3L7ZC 4X3TA 2EPBA 4A3LG 4X64L 2XIWA 2ZTDA 3BZKA 1A0IA 1HCZA 4GN4B 1SFOB 4LUOA 4LFBL 1U9RA 1H9KA 5C3EG 1FNWA 1NAPA 2BH2A 3AU7A 5FO8B 1CT1D 1V1PA 3LNNA 3TN2A 2B2VA 2VNUD 3CW2C 5LMNL 3GTMH 2A69D 5DLQE 3VYTA 3D4WA 4EGVA 1DYQA 1EYAA 4X3KA 3NWTA 3PUXA 3GTOB 3TP5A 1EY5A 1EU4A 3MFGA 4NP5A 1HR0Q 1WI5A 3W1BA 3K57A 5KNDA 2HHHL 1H9MA 3PUYA 3QR8A 4M1UB 5IYCG 3BDCA 2IL8A 1EIYB 1RL2A 4LWCA 2F0WA 1PRTD 5DM63 3E0EA 4OIJA 1N36L 3T53B 4LF8Q 1M1KC 2KCMA 1DD2A 4BY1H 1SJED 1IBKL 1PVOA 1LTSD 2M9VA 3N6RA 1I6VC 5CBAE 1KRSA 4DAYA 4C2MB 3S14H 3M7GA 3KLRA 3K8AA 1EOTA 2DJGC 2DNEA 3T13A 1IYJB 4AIMA 4OXPA 3N52A 2PNHA 3HOWB 5A2QE 4TSSA 3K59A 1H9JA 1NR4A 4V0BA 4C3JH 1H9SA 3MEHA 4YWKA 5C5MA 3UE1A 1J6QA 3B6YA 3HFZB 3CAMA 4K6LA 3AB9A 1KD1C 3L3OC 4HIOA 1HR0L 1GOZA 1HH2P 1PTOB 3PO2B 4JI3L 3PIO3 3HOUH 2EVBA 4LUVA 2KHJA 1S72A 1J5EQ 1K3BC 3CCUA 4KKUA 3D4RA 3GTQH 5KNCA 3GTLB 4BBSB 1EFID 5J22A 1VQJA 4DA2A 4KD3A 1NUCA 2RF4A 4DAYB 1SNOA 4KHZA 1U0LA 1E2ZA 1S5DD 4NW2A 4KLKA 4DKAC 3EA6A 3V05A 1GUOA 3CC2A 2K1BA 4IPHA 3JAMi 2I07B 3E3XA 1X9NA 4A3MH 4GKJL 2IHEA 2UUCQ 1FJGQ 4XQQA 1NMGA 1PFSA 2Y0SG 3D8GA 4IUPA 2UUBL 1QE6A 4Y7NH 1Z6HA 1IW7C 3K5OA 1XXGA 4RGTA 2LY7A 1GUNA 2DY8A 1RCVD 5IODA 2A6ED 1IYVA 3P75A 1X3QA 1LO5D 5FLMH 2UUAL 2JA8H 3S1QB 3L0OA 4JG2A 2D62A 1SNMA 1TS5A 4OO1H 1M4VA 1Y8NB 2B2YC 2ZXRA 2N49A 4A4IA 3CRKC 2YU9B 5JOBA 1QILA 4OWXB 1WCMB 1C7YA 5K5PA 3L9AX 3H6MA 4DXFA 1RIPA 1Y8PB 5LMNQ 1V1PB 1FL0A 3OMGA 1XX8A 2QCPX 4S3SA 4KHPQ 1I50B 1UNSA 1AH9A 1PTOF 2MHVA 4HJ8A 5JPMC 3QOLA 4IUNA 3DM3A 3KOJA 2VUMH 4CJ1B 2GVBA 3GD7A 3S16B 3SK5A 4ILWA 2E2HB 1UE1A 3MXGA 2EYOA 1EZ8A 3TP6A 1SYGA 4X62Q 4LF5L 1U4LA 1T5EA 1U4PA 2BE5D 3G7LA 2Q2UA 4H44C 1OTCA 3C1EA 1EQRA 1IL8A 2KCNA 2LMCB 4A3FB 4MTNA 2QDBA 4DAVA 3RLNA 1IBKQ 4PMBA 2JA6B 3ICEA 3GTKB 2RDHA 1PZID 3BYTB 4KI0A 1SE8A 5JEAG 4LF4L 3UDGA 1WYDA 1EUJA 4IUUA 1NNXA 4QY7A 2EZVA 1D5MC 4K5XA 5JJLA 1UAPA 2VW9A 1D6EC 1CSPA 4A3MG 2JA7B 2YU9H 4U673 2VQEQ 3NTIA 5LL6X 1EYDA 3I70A 4IQZA 4GOPC 1EL0A 1F9QA 4N9TA 1SROA 3IL8A 5BN3A 5JVH3 1PDQA 3KYHC 2B3GA 3O13A 1KHIA 4LNQA 5C4ZA 3GTLH 5IYBG 4XTCS 3CU7A 4AQYQ 1ML0D 3K81C 5DNFA 5ELCA 1F9SA 3X3NA 2RHQB 1PZKD 2RKSA 3OMCA 3F2DA 1C4QA 3J7A5 3M85A 3KUPA 4PMCA 3PUZA 1V43A 4QF4A 4B3TQ 3QO2A 5E4XA 5KIXA 4IFDG 5HY6A 1FGBD 2F0JA 1F9RA 3U4VA 4OIKA 2L9HA 2R7DA 1CHQD 2K28A 5FKAC 4DR7L 2CW0C 5GADC 2NVXH 2BOSA 4EVOA 1SNCA 5D65A 2E8GA 4ZLTF 2X6GA 4XIGS 5C3WA 1JOKA 3E9IA 2JA5B 2JA7H 2Z6KC 2R92H 4A3BB 1BCPB 3M3YB 2B8GA 1GM5A 4IURA 2R7ZB 2WFWA 1N34L 4JYAL 2D0PA 1S4ZA 3FKIB 3JC66 2EOTA 4YY3L 2B63G 1VQEA 1LABA 2Q8RE 1STBA 5K36G 4XT1B 2UXDQ 4JCVE 1SEBD 3FKIG 1WVLA 2EYHA 1SYDA 3QIAA 4JI1Q 5K36H 4ZUIA 4DV0L 1NCVA 2F0DA 4R4IA 2NBFA 4RGNA 2OCEA 4RCOA 5J39A 2L11A 2NVTH 2C9OA 2EXDA 1E2WA 1HNWL 4A3GH 3GTQB 3J81i 2ZJQA 2NVXB 1WTQA 4K8IA 5IP9G 2EIFA 1B7YB 2R93B 2B2TC 4LJZC 1NY4A 3A5ZB 2K5HA 4JI0L 3PQIA 4CHTB 2NTSA 4R1JA 1SNPA 4XYQA 3MTSA 3J80L 5C0XH 1WJJA 2E5LQ 1DOLA 1H9SB 1HTLD 5CV5A 3T1YQ 2OQKA 1E7ZA 5I2YA 2RA4A 1QB5D 2H4OA 4RGOS 4POFA 1IKMA 2H5XA 3K0XA 3OWEB 1TS3A 2CKZB 2OQ0A 1YNND 1HQMC 1YZ6A 5C5LA 2VZAA 3WDNA 1KNAA 1PYWD 1X32A 1A2TA 3EVQA 4A3IH 1HNZL 1JR0D 1HR0W 3J81E 2K05A 2IX3A 2CW0D 1K8GA 1SRUA 2Z4HA 1VQKA 1W2BA 2D9UA 4X3SA 4EQNA 4A3IB 3CD6A 2DJFC 4Q0FA 2KEDA 3NBHA 1XNQQ 5LL6S 1JICA 4DV1Q 1V1OA 3SR1A 1ONLA 1P8LA 2GVAA 1VQOA 5GAGC 2IX0A 1TWFH 4CJ2C 1EEID 2GN5A 1SYCA 1JT8A 1QNKA 2KHSA 1LLRD 3DHQA 2F0FA 1GUWA 4B3SQ 1R9TH 2ALYB 2X6LA 2KQ3A 3KLSA 1A3UA 4FP5D 1Y8OB 4ZKCB 4FYDA 3KLSX 2E74C 5CV7A 4OEMB 2EYFA 2F52A 1WD1A 2OTLA 2CHBD 5LMUQ 4IFDJ 4Q5VA 1L0YB 4DV7Q 4IUTA 2WB1G 1EY0A 1DJRD 3PMFA 4IUVA 1TS4A 1PH5A 4IZ8A 2NYZD 5FK9C 1BXTA 3RD4A 1S40A 3D4DA 4KV6A 2A73B 5JJKA 4A3EH 2EYLA 1EIFA 4ZYSA 2ASBA 5C4XG 2WAQB 2NTTA 3HOVH 4X3UA 4A3EB 1S5ED 4PV1C 3FPUB 3I4LA 1IKLA 3TZDA 3EQLC 5DM73 4DK0A 3W1GA 1O7LA 3RLOA 4DNTB 4AYBB 1D2BA 4GKKQ 2LXKA 3QOJA 3EIVA 4DUZQ 1IW7D 3J80c 3GDEA 4DGZA 1GVPA 4BBRB 2E2IH 1QG7A 2A68D 2KHIA 4DNIA 1Y69U 3A54A 3I3CA 3J80E 1CSQA 5D3IB 1PRTB 4PZ8A 3NUCA 5E4WC 1BO0A 5M3FB 5IIFA 4IO9A 4OGQC 1FVIA 2RVLA 3A8IE 1XWEA 4OO1I 4F7XA 1WTRA 1TWCB 3FHWA 5EBCA 3EROA 5ELBA 4A76A 2AKWB 2ZXOA 4DK1A 4R9WA 1C48A 1CQFA 4DV4L 2CWAA 3I55A 4JI4L 2F4VQ 1PTOH 3PO2H 3NQIA 2LFNA 1S5CD 1MIUA 4GLVB 5LHY1 1BBWA 1B53A 1STGA 4TRDA 4YCWA 2R61A 3S1NB 2KCTA 2K6AA 2WKCA 2EJFC 4AYBG 4YHHQ 3SK6A 3S17H 5C4HA 1HTPA 1ILPA 1XMQL 1PH9A 2B2WA 2XN9C 3CXCA 4YCVA 4KY5A 1LUZA 2F0PA 1ICWA 3KK7A 1QUQB 4G57A 5AJ3Q 2NZOA 1QNUA 2GA4B 2QEXA 1I4QA 4RA8A 1ESRA 1G8ZD 1EY6A 4V190 2K75A 3SVMA 3HOUG 1MD2D 3W2DA 1QOHA 1N32L 3DEOA 1OXUA 3A56A 4DV3Q 1AN8A 3OOCA 2MPMA 3K5MA 2JP1A 1GUSA 4CBVA 4QIWE 3F2CA 4FF3A 3KDFA 4FXKC 3NP8A 2YTYA 4O42A 4JBKA 2IT1A 4DR3Q 4HIDA 5M3FG 4KD4A 1D8LA 1YVCA 3LGJA 2JYOA 5CV4A 1UEBA 1B70B 1KLUD 4J15A 3K5NA 3NEMA 3IFDA 2MQHA 5CC4A 3HEJA 2VQFQ 3D31A 3KF8B 3RZOB 4PNYA 2PCFB 4KHPL 1G2TA 4A3CH 3F2BA 1D7QA 4FF2A 1KLGD 3KFUA 1PZJD 5GQOA 2K5WA 5IT9E 3S16H 3HOWH 1OXVA 5FLXE 4BY7B 4K8JA 4P75A 1I94Q 3NPPA 1L2FA 3S2DB 4DR4Q 1T9HA 1WOCA 3VYRA 4NXNL 3PUVA 1EIGA 5C3EB 1IBML 2V1CC 5IP7H 1XNRL 1JMCA 1B9NA 1PH8A 2I5MX 4BY1G 2DN8A 2MO0A 1T5XD 3E6ZX 2XRSD 2SNSA 4HJ7A 3C3LA 2R7FA 3S1MB 1BKBA 4K14A 1VQ7A 1PFBA 2E2JB 2R6GA 1D1IA 1JWMD 2AUJD 5M9OA 4DUYL 1JB3A 1QUQA 3LX0A 4XQNA 5ELOA 5LMUL 2K5QA 4O2DA 4L5SA 2E2DC 4B9XA 4GOPB 1PV4A 3DUZA 4B3TL 1Y1VH 1SDFA 1WFQA 3PO3G 1PH1A 1SNDA 4HSVA 3F2UA 4KJOA 4HTHA 2O2LD 1JWSD 2L1BA 4LW1A 1K83B 5ELEA 3I56A 1LACA 1VDZA 2UXCQ 2VQEL 4RFBA 1CK1A 3BS1A 1CA6A 1C8CA 2R7ZH 4ME3A 2Z0SA 3K7UC 2ID0A 3CCRA 3Q6SA 3OSOA 1EU3A 4QJFA 4H7BA 3T56B 1JJGA 1K8OA 2IWHA 1VMPA 5IYDH 1D5ZC 3DLLA 2F3WA 5GROA 1UUPA 1EQTA 5C0XJ 1WTPA 2FMCA 3RZDH 3M4QA 3CCLA 2VY3A 5FJ8H 3OIPA 3BVMA 1Z47A 1VQMA 1XNQL 1F77A 1X55A 2K33A 4M8AA 4O1NA 2Q2HA 1O78A 4XYOA 4X62L 1TU2B 4I7AA 2RQXA 4CDDC 2MP1A 5M5XH 1VS0A 2G5DA 1VQFA 3EFXD 1B2TA 2NZ1D 5ELDA 2KJXA 3W3AA 3S14B 1E3PA 2PI2A 2PQEA 2VL6A 1XPRA 5IWAQ 1G291 3DWAA 4IFDH 1I5FA 1U5KA 3ZYYX 4DV2L 4FO2A 4ABNA 1A3TA 2JE6I 2JA8B 2CWPA 3UDXA 5ISRA 1K0SA 1TWHH 3J7ZC 4JI5Q 2VUMG 2E5LL 2EJMA 1BQQT 1CHPD 1SAPA 1VQDA 3I4OA 4GN3B 1I94L 3VR2A 3PV0A 2Q8TA 2WIIB 5KEEA 3C46A 2QGQA 3DM1A 4HR7B 1OO9B 2B2TA 1VQNA 1KNEA 1STNA 1HNWQ 3HOXH 1HA6A 1P16A 1E1TA 4BXXH 2R93H 3ITPA 4X6AH 4DFAA 5I9OA 1Q8KA 5I6YA 3I4MH 1HZAA 4FF4A 2KCCA 2R7ZG 1VQ6A 1FGUA 1ESFA 2TSSA 5EQ0A 2J0TD 4H02A 1QZGA 3PO3B 1CTMA 4QB4A 1G6ZA 5F2DA 2JA5G 2HHHQ 4A3IG 3A55A 1M8AA 3I4NB 2RCFA 5EPLA 4FF1A 5TSSA 1L1OC 1QWYA 3TSSA 1GJXA 1RTNA 2OTJA 1R9TB 3HKZE 1SYEA 4B9WA 2F0NA 4WRDA 5CORA 5T1GA 4FDBA 4QCLA 1PFNA 2EQSA 3I2ZA 4GNXB 1LTGD 1F2YA 1YJNA 4HJ9A 2QKIC 3BVZA 3H0GH 2IHFA 3A7LA 4JOIA 2RDFA 2MNAA 1ICFB 2DUDA 3TZUA 1EFWA 4LFAL 4ODGA 3RUZA 1Q86C 2NVQB 4K5WA 1PLFA 2XTIA 1RF2D 4DAMA 5EAYA 2K32A 4LF6Q 2A6HD 3HOYG 1I4GA 4FXDA 4JBJA 2HQLA 1I6HH 1ET9A 2LSSA 5C44H 2BDNA 1TWFB 1VQ8A 1TKWB 2F0VA 1Q90A 4DN4M 3S9WA 1YJWA 1W6JA 2F3VA 3VA5A 3MVVA 3M4YA 2E2HH 3H94A 4UAIA 3MXUA 1Q12A 3K80C 1JOOA 4DV1L 2M2LA 3AFPA 3NXWA 1I3QB 2KOLA 4JI1L 1PHJA 2J7ZA 4PZ7A 2J4XA 4DV5Q 3TQYA 4ALPA 1KDBA 3S1RB 1Q8IA 3BZDB 2FMMA 3GTPB 2FXQA 3A74A 2HIXA 5I4DA 1VQPA 3C2PA 4AYBE 5HURA 3BJUA 2G9DA 2MJ8A 4LK1C 4I65A 4LF7Q 4DV7L 2PPBC 4TQUS 3H3VH 1YIJA 4B3MQ 4POGA 5I6WA 1MI2A 4ZCKA 4MHEA 2WAQE 3SHLA 1SMXA 4RH6A 5NUCA 3S15B 2KVMA 1BUVT 2NZHA 3J7YW 4P2CB 4LFCQ 4JI8L 1S5BD 4KKSA 5ELNA 3VDYA 1UE5A 4DXGA 3G6EA 1PH7A 3S15H 2SNMA 4A3BG 4A93H 3NTKA 3KJOA 4B3RQ 1A62A 1Y1WH 1PRTC 3PIOA 4A93B 2UXBL 2K5NA 1AE3A 4JV5Q 4A93G 1J5EL 3S2DH 3PO2G 1IHZA 1B8AA 4DR6L 3NHHA 2L0CA 5DEHA 3F8TA 5CGKA 3W5OA 2N55A 4J8QA 1STYA 4G7OC 4B3ML 1VCIA 3I90A 1HHVA 1MGSA 2L15A 3R2IA 4B3SL 3HKZB 3MA2B 1TXYA 2IX1A 1N36Q 5I9PA 3V2TA 1H95A 4GS3A 4DV3L 2FJ2A 3FPPA 4LF8L 5FLXc 4UY8C 3HG9A 1CA5A 4P74A 2UXCL 3BYYB 3DXJC 4A3LH 1XMOQ 4NXML 3FEWX 4IPDA 4A3MB 2YTXA 3HOZB 3T16A 4L5TA 4FXGC 4CKBA 5BR8Q 1O80A 1BDOA 4DR1L 4RKBA 1WTVA 4A3DG 2EYMA 2A8VA 3ULJA 3CF5A 1X65A 3E9HA 1YITA 2PQAB 4IPCA 3VYSA 1K8MA 3CP0A 3QB3A 2CCZA 1MSHA 2XWBB 3HOUB 3KF6B 5AJ3L 3VR5A 1ET6A 4KK7A 3URYA 2SDFA 1FNVA 5M5WH 3UDFA 2EXZA 5GAHC 1AW7A 1I50H 4RHRA 3S1MH 1K28A 2AWNA 1II3A 2TMPA 3ND9A 1JB7A 1XNRQ 2KENA 4AQYL 3UE0A 3G6JB 4LF9Q 2PMZB 4O0AA 3GTGH 4BY7G 4RAUC 4JBWA 4U68A 4JI0Q 2F0QA 1FR3A 3JAMc 3VR3A 2WINB 2XNAC 3JAML 1STEA 4C3HH 1B4OA 1L0XB 1WCMG 3NK9A 5GAEC 3CCVA 5CMDA 1VQHA 2PZUA 5BR8L 4A3FH 3PF4A 4A75A 4DR1Q 4APVA 2QDLA 3TS0A 1MBYA 2IW3A 3R93A 1N8RC 3A0JA 1KTKA 1CQVA 2CQAA 2VQFL 1EY4A 2HD3A 5A2QL 1WTXA 2JK8A 3HS0C 4OO1G 2EE1A 2HUGA 1PTOC 1LTAD 2EY6A 2B2WC 3DMUA 4C56C 2Y0SB 1K0RA 3CPFA 2LXJA 1PA6A 1HNZQ 2CH4W 3GTOH 5IYDG 5KYLA 1N33L 4RMFA 1E24A 1LYLA 1LT5D 4L63B 4JYAQ 4K0KL 2E2JH 3IFTA 2M00A 4DV5L 4LF9L 2B2YA 5C4XH 1YBYA 2AUKA 3HP3A 5J3BA 1TWAH 4DR6Q 1GHJA 5BN5A 4TVAB 2Q2IA 1VQ5A 1XPOA 2CH4A 4JI2Q 5I2XA 4UPAA 2C5CA 2IPKD 2I0QA 3NTHA 4J6HA 2ZTEA 3CQZH 4WORA 2WAQG 2F03A 4DNRB 4C3HB 4H13C 4DR7Q 5EBDA 1UWVA 2QEJC 2JJQA 2BA0A 1JE5A 1DCZA 1BBXC 4WJ4A 4KKTA 5IE8A 4R8IA 2K50A 5IT9L 3G71A 2JXMB 4A3KG 1XTCD 3DWQA 1X3EA 3NSWA 5JEAJ 5E7NA 5D3DA 1YHBA 2LS01 1PTOD 5EKLA 1Q82C 2BH8A 4XDXA 4JK1C 5IGDA 1CKMA 4OONA 3RZDB 5IWAL 5EKIA 3E0JA 3PIP3 2A5HA 3Q23A 3HOVB 2R92B 1KAAA 1N9WA 2BCOA 4KJNA 1EIHA 4RG1A 3CC7A 1ZXTA 1HA5A 2F0HA 4XT3B 3P7JA 4DR4L 1D1KA 2K14A 1NBWA 3QJYA 4HAEA 2HDMA 3BU2A 4DV6Q 3ULPA 4R4QA 4KY7A 1G51A 3H15A 2PYKA 2V4DA 1FYCA 3HKSA 4OX9L 2D5DA 2EY2A 3VR6A 4DUZL 2MFIA 2PI2E 2SOBA 3U50C 2O5JC 4C2MH 2CFMA 1I3QH 3FMCA 3GTJH 3OTOL 2AHOB 2JEBI 1V8QA 2MGSA 4N9PA 2JA9A 3LWEA 4C1NK 1R4QB 1SMYD 4TKOB 1UEAB 2F0EA 4HEDA 1TWCH 4LF7L 5EGTA 1YHQA 4DUYQ 2WB1B 3WWVA 2ZM6Q 4QGUA 1DONA 1SYBA 2K5DA 1IZ6A 1PYBA 1X3FA 1IXRA 4F87A 1HXYD 3OYYA 2CVRA 3PF5A 4L6TB 2EDGA 1B3AA 5KNBA 1A15A 4NXNQ 2RHSB 1DOKA 1LT3D 3A7AB 1MKHA 2Q2TA 3FP9A 3S1NH 5JVG3 4HIKA 4B3RL 2XWJB 3OPOA 4YHHL 1TQOA 4LMQD 1E1OA 1NE3A 2JQOA 1QJOA 3MC0B 4PQXA 1XMQQ 3PIPA 4OWWB 2B2VC 4MIUA 4RGMA 1NJIC 1Y1WB 4PZ6A 5AFWA 4A3DB 3BZCA 3CQZB 1KXLA 2E2IB 1HPCA 4KTAA 5CR3A 5C4JB 3FVQA 1TIID 2Z1CA 4OL7A 5M5YH 1Q1EA 5G3LF 1HFGA 3ULLA 1GHKA 1LT6D 2E75C 4F88A 5CBEE 2NUCA 2Z9HA 1JQYD 2XRQD 4K5VA 2OF1A 4R4CA 1ZYRD 2JA5H 4ULLA 5JPNC 2UU9Q 1F2LA 1O7YA 1X3GA 1LTBD 4JI6Q 1PH6A 3S24A 5JEAH 1K8AC 2R92G 4LFAQ 2QILA 2OWOA 1VQGA 4GZYC 1HFNA 3PUWA 5M3MH 4YWLA 1B50A 3U9OA 4N8X1 1HZBA 1PH3A 3HRZC 4EQOA 1JE4A 1WTWA 5C44B 4RKLA 2DNCA 2YV5A 3CCSA 3D6CA 2A74C 3K7AB 2B39A 3I73A 1U4MA 3FKIH 1E2VA 2ATWA 1BCPF 1BF4A 3WOEA 3R2TA 1CZWA 2OXPA 3GTJB 1RD9D 3SE0A 4HCSA 3GTMB 4JC0A 5C4JH 1JWUD 5C44G 1SJHD 4E6IA 4A3JB 3S1RH 1WTHA 3CKIB 3RMHA 1GD7A 4GNXA 5M5WB 1D5XC 4DAPA 2K5VA 1A8VA 3J80i 1NSNS 4IOCA 2P5ZX 2NN6I 2RDGA 4CDCC 1LT4D 3Q0AA 2RCNA 4GN5A 4JI6L 4X66L 5EKKA 1LM0A 2QF7A 1VQAA 4WFN3 3MEFA 4DPGA 3MXNB 4YIJA 4XQJA 1LTID 1Q46A 4C3IB 2UUBQ 1LTTD 5IGEA 2PMZE 3A5UA 3HZXA 4DU9A 3PGZA 3TREA 1AZQA 4IOAA 5JJIA 4JI5L 3CPWA 1Q3LA 4I7ZC 4C3JG 1N34Q 2F4IA 2I5LX 5M3MB 5JJZA 3FRPB 3M7NA 1NTGA 2JA7G 5HGTA 4L5RC 5C6AA 2I5HA 1GKHA 1BOSA 1VQIA 5J1ZA 1I4XA 1AEXA 2A19A 3RR5A 3WOFA 1QVFA 4LAAA 1QVCA 1CKNB 3TBIB 2ICIA 1GXDC 3MAQA 3NENA 2JA6G 1X54A 1YEZA 2BE5C 4F8MA 1FNUA 4A3FG 3KBXA 1CUKA 2K7VA 3HGBA 4GOPA 5CV6A 1VQ4A 4K2KA 3OTOQ 3U4ZA 1ILQA 3NBIA 1JJ2A 4A3CG 3F1ZA 4KHVA 4LF6L 5IGBA 2WB1E 1ASZA 4LUZA 3HOWG 1EYGA 1DZ1A 4IUQA 1C9OA 1XTDA 4NB3A 4G4KA 2PQAA 2VB3X 2KA7A 1CKOA 5COYA 2OT2A 2WP8J 4A3BH 3I4NH 2IJ0A 1RJTA 2ES2A 1NMFA 1IBLL 4KY6A 2L12A 3Q8DA 4ZAIA 2B2UC 3HOZG 4P73A 4EX5A 3CCJA 2HDLA 5IGCA 4HN7A 4CDEC 1STHA 4N8FA 4B08A 1HNXQ 2VXWA 4GNXC 2JN4A 3MZ5A 3H0GB 1PMRA 4CGYB 4C3JB 1BCPD 2D2CC 4BS9A 1O7ZA 2JEAI 4WJ3M 1K73C 4Y52H 4HIMA 4DV4Q 3JAME 1B44D 2IY5B 4A3JH 1KDAA 2HCIA 3T1HL 5ELFA 1B1ZA 1I6HB 4CKCA 1E22A 1UE7A 4DV6L 3HOVG 1CZGA 2ZT9C 3AFQA 1TT2A 3U58A 1SMYC 4A3GB 3PSIA 1V1QA 1K9MC 2DY7A 2K04A 1TWAB 3MXNA 3KJPA 3DWPA 2G9HD 2D0OA 2N3SA 4A3DH 2VUMB 5EPJA 4A3KB 1C0AA 3P20A 4ZQ3A 1EY7A 2HCCA 5HGQA 4JV5L 5C3EH 4GLXA 1KIXA 3A8KE 3SGIA 1U4RA 3VA7A 1A2UA 1VF5C 3IAYA 1SSOA 4NKLA 3OW7A
chains in the Genus database with same CATH topology
2FHTA 1AFPA 4IALA 2Z4IA 2AQ2B 3J7AV 1OXTA 4KMUC 2AQ1B 3R3OA 2KEEA 2F0SA 1SNQA 2OEOA 1G91A 1J8IA 1BNZA 4G7HC 3D3RA 4Z9CB 1DM0B 4FNFA 5T1IA 3U9SA 2PO4A 4L8JA 4EQPA 4WJWA 1XYIA 2E76C 2B8FA 3IKJA 3ONAB 1TY2A 3J81L 3FDTA 5BN4A 2F0OA 1I4HA 4UDUC 3S17B 1I4RA 3KF8A 2F1MA 3SK8A 1JC7A 4BA2I 3EJIA 2K03A 5IGGA 1RDPD 1QCBD 4HCEA 3M4OB 1NR2A 5C3XA 5M5YB 1CM9A 1VMCA 4Y7NB 2VB2X 3HOYB 1E0BA 3J7AF 1Q1BA 3I8ZA 2WV6D 2A69C 2ENBA 4BWGB 3MWYW 5E1FA 2RBMA 5FO9B 1H9RA 1STAA 2MUYA 2L4NA 1HUMA 2LKVA 2XSCA 3NQTA 4KN4C 2HQEA 4J1MA 5G3LD 4HMIA 1IYUA 2RSOA 1YNNC 4QMGA 2BA1A 2PZTA 4KN7C 1ZEQX 1SYFA 1HQRD 1SXTA 1BR9A 2XVSA 4CJ0B 2NVYB 3SEBA 1CI3M 1EY9A 4BA1I 4H0LC 4QUFA 1X3PA 2PW7A 3BG3A 4G7ZC 3KBGA 2NVTB 3GTGB 1Y1VB 1A6XA 2AWOA 1SBBB 2NB0A 1F2MA 3MFYA 1PRTF 2F0GA 2Q8IB 1BCPC 3BVGA 2O4XA 4C3IG 2A68C 4HMJA 4K2LA 5C0XI 3CHBD 1JOQA 3AMUA 1J9OA 3VYUA 1W6KA 2L55A 3I91A 3V96A 2EYPA 2O5IC 3S2HB 1ENFA 2ZXPA 3H91A 5FLXL 4R8NA 3LWUA 3MHBA 3K0YA 3TP7A 3TMEA 3VR4A 5CV8A 1EEFD 5M5XB 3HOXB 1DXMA 4RCNA 4ZK9B 1GUTA 2F0IA 3DEPA 5IGFA 2ICEC 1VF7A 2WKDA 1YNJC 2Z8LA 4QUCA 1EWHA 3D6WA 3C1FA 2EJGC 1OXSC 2B63B 1TY0A 2PNRC 5KGUA 3H09A 1LV9A 1AZPA 1I4PA 2R3ZA 2X69A 5IOCA 1EYCA 5C0XG 2A6HC 1HUNA 4IFDI 1CFMA 4XXEA 5D14A 5C4XB 1PXUA 3I4MB 2F0KA 3ERQA 3OWFA 1MSGA 1KABA 3K6OA 3TDQA 1RHPA 1DOMA 3QG1A 1EY8A 2K01A 1SE3A 4OHJA 4QIWB 4BY1B 2YYZA 2H1EA 2WACA 3GV3A 5A35A 1SE2A 2F0LA 4ZUJA 2F0TA 1ZKOA 5KRUA 1EWCA 3E5SA 4ME5A 1ENAA 1ZYRC 1SE4A 1RTOA 1WTOA 1TWGB 3BDLA 3SK4A 4HSPA 1B9MA 1EZ6A 3H3VC 5JAVA 2F0UA 5E3FA 3K5LA 2FFKB 2FINB 2RSNA 4RHSA 1F2ZA 1OXXK 4PMWA 2F0MA 4NMZA 1RODA 3CRLC 2EY1A 3R8BA 1FD7D 1R4PB 2A6EC 2EY5A 1RKNA 2PW5A 1YNJD 4DF7A 5KYIA 3GV6A 5CV9A 4RWSC 3SDZA 1JCKB 1WD0A 2B2UA 2NN6H 1A3VA 3K58A 1GUGA 3Q22A 5EJWA 3A8JE 3X3MA 1TWHB 2NN6G 2I46A 3MXPA 4MN3A 2BDOA 3T4AC 2N88A 1AP0A 4NDXA 2SEBD 2JSOA 1G2SA 5EPKA 1F9PA 3RLFA 4CKEA 1HRJA 5FOBB 3OHXC 2NWGA 1Z7TA 3GO5A 4FVMA 4C1NI 1KDCA 1JORA 3I72A 3NWSA 2PZWA 3QWNA 1LTRD 1ENCA 5CYUA 3P1HA 4ZRZA 3ND8A 3UI2A 1EQVA 3GQBA 1S5FD 3OIQA 1TR5A 3GP7A 1PFMA 3NE5B 4ID6A 2L5TA 3T51B 3TP8A 5DAUA 1TVXA 2KUMA 1TS2A 2AQ3B 2EYJA 4IN3A 3Q24A 4ZKBB 4K6DA 4C3HG 5FO7B 2KECA 3BDOA 3SXHA 3L7ZC 4X3TA 2EPBA 2XIWA 1HCZA 1SFOB 1U9RA 1H9KA 1FNWA 1NAPA 3AU7A 5FO8B 1CT1D 1V1PA 3LNNA 3TN2A 2B2VA 2VNUD 2A69D 3VYTA 3D4WA 4EGVA 1DYQA 1EYAA 4X3KA 3NWTA 3PUXA 3GTOB 3TP5A 1EY5A 1EU4A 3MFGA 4NP5A 3K57A 5KNDA 1H9MA 3PUYA 4M1UB 3BDCA 2IL8A 2F0WA 1PRTD 5DM63 4OIJA 3T53B 1DD2A 1SJED 1LTSD 2M9VA 3N6RA 1I6VC 5CBAE 4DAYA 4C2MB 3M7GA 3KLRA 1EOTA 2DNEA 3T13A 3N52A 3HOWB 5A2QE 4TSSA 3K59A 1H9JA 1NR4A 4V0BA 1H9SA 3MEHA 5C5MA 4K6LA 3AB9A 3L3OC 1GOZA 1PTOB 3PO2B 3PIO3 2EVBA 4KKUA 3D4RA 5KNCA 3GTLB 4BBSB 1EFID 5J22A 4DA2A 4KD3A 1NUCA 1SNOA 4KHZA 1E2ZA 1S5DD 4NW2A 3EA6A 3V05A 1GUOA 2K1BA 2I07B 4XQQA 3D8GA 4IUPA 1QE6A 1Z6HA 1IW7C 3K5OA 4RGTA 1XXGA 2LY7A 1GUNA 2DY8A 1RCVD 5IODA 2A6ED 1IYVA 3P75A 1X3QA 1LO5D 3S1QB 2D62A 1SNMA 1TS5A 4OO1H 1M4VA 1Y8NB 2B2YC 2ZXRA 3CRKC 2YU9B 5JOBA 1QILA 1WCMB 5K5PA 3L9AX 3H6MA 4DXFA 1Y8PB 1V1PB 3OMGA 1XX8A 2QCPX 4S3SA 1I50B 1UNSA 1PTOF 2MHVA 5JPMC 3QOLA 4IUNA 4CJ1B 3GD7A 3S16B 3SK5A 4ILWA 2E2HB 3MXGA 2EYOA 1EZ8A 3TP6A 1SYGA 1U4LA 1T5EA 1U4PA 2BE5D 3G7LA 4H44C 3C1EA 1IL8A 2KCNA 2LMCB 4A3FB 4DAVA 2QDBA 4PMBA 2JA6B 3GTKB 2RDHA 1PZID 3BYTB 4KI0A 5JEAG 4IUUA 2EZVA 1D5MC 4K5XA 1UAPA 1D6EC 2JA7B 4U673 3NTIA 5LL6X 1EYDA 3I70A 4IQZA 1EL0A 1F9QA 4N9TA 3IL8A 5BN3A 5JVH3 1PDQA 3O13A 5C4ZA 4XTCS 3CU7A 1ML0D 5DNFA 5ELCA 1F9SA 3X3NA 1PZKD 2RKSA 3OMCA 1C4QA 3M85A 3KUPA 4PMCA 3PUZA 1V43A 4QF4A 3QO2A 5E4XA 5KIXA 4IFDG 1FGBD 2F0JA 1F9RA 4OIKA 2L9HA 1CHQD 2K28A 5FKAC 2CW0C 2BOSA 4EVOA 1SNCA 5D65A 4ZLTF 2X6GA 4XIGS 5C3WA 1JOKA 2JA5B 4A3BB 1BCPB 3M3YB 2B8GA 4IURA 2R7ZB 1S4ZA 3FKIB 2EOTA 1LABA 2Q8RE 1STBA 5K36G 4XT1B 1SEBD 1WVLA 2EYHA 1SYDA 3QIAA 5K36H 4ZUIA 1NCVA 2F0DA 2NBFA 4RGNA 4RCOA 5J39A 2L11A 2C9OA 1E2WA 3GTQB 2NVXB 1WTQA 4K8IA 2R93B 2B2TC 4LJZC 4CHTB 2NTSA 1SNPA 4XYQA 3MTSA 3J80L 5C0XH 1DOLA 1H9SB 1HTLD 5CV5A 5I2YA 2RA4A 1QB5D 2H4OA 4RGOS 1IKMA 3OWEB 1TS3A 1YNND 1HQMC 5C5LA 3WDNA 1KNAA 1PYWD 1X32A 1A2TA 3EVQA 1JR0D 3J81E 2K05A 2IX3A 2CW0D 2Z4HA 2D9UA 4X3SA 4EQNA 4A3IB 4Q0FA 2KEDA 3NBHA 5LL6S 1JICA 1V1OA 3SR1A 1ONLA 2IX0A 4CJ2C 1EEID 1SYCA 1QNKA 2KHSA 1LLRD 3DHQA 2F0FA 1GUWA 2X6LA 2KQ3A 3KLSA 1A3UA 4FP5D 1Y8OB 4ZKCB 4FYDA 3KLSX 2E74C 5CV7A 1WD1A 2EYFA 2CHBD 4IFDJ 4Q5VA 1L0YB 4IUTA 1EY0A 1DJRD 3PMFA 4IUVA 1TS4A 4IZ8A 2NYZD 5FK9C 1BXTA 3RD4A 3D4DA 4KV6A 2A73B 2EYLA 4ZYSA 2WAQB 2NTTA 4X3UA 4A3EB 1S5ED 4PV1C 3FPUB 3I4LA 1IKLA 3TZDA 3EQLC 5DM73 4DK0A 1O7LA 4DNTB 1D2BA 4AYBB 3QOJA 1IW7D 4DGZA 4BBRB 1QG7A 2A68D 1Y69U 3A54A 3I3CA 3J80E 5D3IB 1PRTB 3NUCA 5E4WC 5M3FB 1BO0A 5IIFA 4OGQC 2RVLA 3A8IE 1XWEA 4OO1I 4F7XA 1WTRA 1TWCB 5EBCA 3EROA 5ELBA 2ZXOA 4DK1A 4R9WA 1C48A 1CQFA 1PTOH 3NQIA 2LFNA 1S5CD 5LHY1 1B53A 1STGA 4TRDA 2R61A 3S1NB 2K6AA 2WKCA 2EJFC 3SK6A 5C4HA 1HTPA 1ILPA 2B2WA 2XN9C 4KY5A 2F0PA 1ICWA 3KK7A 4G57A 1QNUA 2GA4B 1I4QA 4RA8A 1ESRA 1G8ZD 1EY6A 4V190 3SVMA 1MD2D 3W2DA 1QOHA 3DEOA 1OXUA 3A56A 1AN8A 3OOCA 2MPMA 3K5MA 2JP1A 1GUSA 4CBVA 4FF3A 4FXKC 3NP8A 4O42A 2IT1A 4KD4A 2JYOA 5CV4A 1KLUD 3K5NA 3IFDA 5CC4A 3HEJA 3D31A 3RZOB 4PNYA 2PCFB 1G2TA 4FF2A 1KLGD 1PZJD 2K5WA 5IT9E 1OXVA 5FLXE 4BY7B 4K8JA 3NPPA 3S2DB 3VYRA 3PUVA 1EIGA 5C3EB 1B9NA 2DN8A 1T5XD 3E6ZX 2XRSD 2SNSA 3C3LA 3S1MB 4K14A 1PFBA 2E2JB 2R6GA 1D1IA 5M9OA 1JWMD 2AUJD 1JB3A 3LX0A 4XQNA 2K5QA 4B9XA 2E2DC 3DUZA 1SDFA 1SNDA 4HSVA 3F2UA 4KJOA 4HTHA 2O2LD 1JWSD 2L1BA 5ELEA 1K83B 1LACA 1VDZA 4RFBA 1CK1A 3BS1A 1CA6A 1C8CA 2ID0A 3Q6SA 3OSOA 1EU3A 1K8OA 4H7BA 3T56B 2IWHA 1VMPA 1D5ZC 2F3WA 1UUPA 1EQTA 5C0XJ 1WTPA 2FMCA 3OIPA 3BVMA 1Z47A 1F77A 2K33A 4M8AA 4O1NA 1O78A 4XYOA 1TU2B 2RQXA 2MP1A 3EFXD 1B2TA 2NZ1D 5ELDA 2KJXA 3W3AA 3S14B 2PQEA 1G291 3DWAA 4IFDH 3ZYYX 4FO2A 4ABNA 1A3TA 2JE6I 2JA8B 5ISRA 2EJMA 1BQQT 1CHPD 1SAPA 3VR2A 3PV0A 2Q8TA 2WIIB 5KEEA 3C46A 3DM1A 4HR7B 1OO9B 2B2TA 1KNEA 1STNA 1HA6A 3ITPA 4DFAA 5I9OA 5I6YA 4FF4A 2KCCA 1ESFA 2TSSA 5EQ0A 2J0TD 3PO3B 1CTMA 4QB4A 1G6ZA 5F2DA 3A55A 1M8AA 3I4NB 5EPLA 4FF1A 5TSSA 1QWYA 3TSSA 1GJXA 1RTNA 1R9TB 1SYEA 4B9WA 2F0NA 4WRDA 5CORA 5T1GA 4QCLA 1PFNA 1LTGD 1F2YA 2QKIC 3BVZA 3A7LA 2RDFA 3TZUA 4ODGA 3RUZA 2NVQB 4K5WA 1PLFA 1RF2D 2K32A 2A6HD 1I4GA 4FXDA 1ET9A 2BDNA 1TWFB 1TKWB 2F0VA 1Q90A 4DN4M 3S9WA 1W6JA 2F3VA 3VA5A 3MVVA 3M4YA 3H94A 4UAIA 3MXUA 1Q12A 1JOOA 2M2LA 3NXWA 1I3QB 2KOLA 2J7ZA 2J4XA 1KDBA 3S1RB 1Q8IA 3BZDB 2FMMA 3GTPB 3C2PA 5I4DA 5HURA 2G9DA 2MJ8A 4LK1C 4I65A 2PPBC 4TQUS 5I6WA 1MI2A 4MHEA 3SHLA 4RH6A 5NUCA 3S15B 2KVMA 1BUVT 3J7YW 4P2CB 1S5BD 4KKSA 4DXGA 2SNMA 3NTKA 1PRTC 4A93B 1IHZA 3NHHA 2L0CA 5DEHA 5CGKA 2N55A 4J8QA 1STYA 4G7OC 1VCIA 3I90A 1HHVA 1MGSA 3R2IA 3HKZB 3MA2B 2IX1A 5I9PA 3V2TA 2FJ2A 3FPPA 3HG9A 1CA5A 3BYYB 3DXJC 3FEWX 4A3MB 3HOZB 3T16A 4FXGC 4CKBA 1O80A 1BDOA 1WTVA 4RKBA 2EYMA 3VYSA 1K8MA 3QB3A 1MSHA 2XWBB 3HOUB 3VR5A 1ET6A 4KK7A 3URYA 2SDFA 1FNVA 2EXZA 1AW7A 4RHRA 2AWNA 1II3A 2TMPA 3ND9A 3G6JB 2PMZB 4RAUC 4JBWA 4U68A 2F0QA 1FR3A 3VR3A 2WINB 2XNAC 3JAML 1STEA 1B4OA 1L0XB 3NK9A 5CMDA 2PZUA 1MBYA 2IW3A 3R93A 1WTXA 1KTKA 1CQVA 2CQAA 1EY4A 5A2QL 3HS0C 4OO1G 2EE1A 2HUGA 1PTOC 1LTAD 2EY6A 2B2WC 3DMUA 4C56C 2Y0SB 5KYLA 1LT5D 4L63B 3IFTA 2M00A 2B2YA 2AUKA 3HP3A 1GHJA 5BN5A 5I2XA 2C5CA 2IPKD 3NTHA 4J6HA 4WORA 2F03A 4DNRB 4C3HB 4H13C 5EBDA 2QEJC 2BA0A 1DCZA 1BBXC 4KKTA 4R8IA 5IT9L 2JXMB 1XTCD 3DWQA 3NSWA 5JEAJ 5D3DA 2LS01 5EKLA 1PTOD 4XDXA 4JK1C 5IGDA 3RZDB 5EKIA 3E0JA 3PIP3 2A5HA 3Q23A 3HOVB 2R92B 1KAAA 2BCOA 4KJNA 1EIHA 1ZXTA 1HA5A 2F0HA 4XT3B 3P7JA 1D1KA 3QJYA 4HAEA 2HDMA 4KY7A 2PYKA 2V4DA 1FYCA 2D5DA 2EY2A 3VR6A 2SOBA 2O5JC 3FMCA 2JEBI 1V8QA 2MGSA 4N9PA 3LWEA 4C1NK 1R4QB 1SMYD 4TKOB 1UEAB 2F0EA 4HEDA 5EGTA 2WB1B 1DONA 1SYBA 2K5DA 4F87A 1HXYD 2CVRA 4L6TB 2EDGA 1B3AA 5KNBA 1A15A 1DOKA 1LT3D 3A7AB 5JVG3 2XWJB 3OPOA 1TQOA 4LMQD 1QJOA 3MC0B 4PQXA 2B2VC 4MIUA 4RGMA 1Y1WB 5AFWA 4A3DB 3CQZB 2E2IB 1HPCA 4KTAA 5CR3A 5C4JB 3FVQA 1TIID 2Z1CA 4OL7A 1Q1EA 5G3LF 1HFGA 1GHKA 1LT6D 2E75C 4F88A 5CBEE 2NUCA 1JQYD 2XRQD 4K5VA 2OF1A 1ZYRD 4ULLA 5JPNC 1F2LA 1O7YA 1LTBD 5JEAH 2QILA 4GZYC 1HFNA 3PUWA 1B50A 3U9OA 3HRZC 4EQOA 1JE4A 1WTWA 5C44B 4RKLA 2DNCA 3D6CA 2A74C 3K7AB 2B39A 3I73A 1U4MA 1E2VA 1BF4A 1BCPF 3WOEA 3R2TA 1CZWA 2OXPA 3GTJB 1RD9D 3SE0A 4HCSA 3GTMB 1JWUD 1SJHD 4E6IA 4A3JB 3CKIB 3RMHA 5M5WB 1D5XC 4DAPA 1NSNS 2NN6I 2RDGA 1LT4D 3Q0AA 5EKKA 2QF7A 4WFN3 4YIJA 4XQJA 1LTID 4C3IB 1LTTD 5IGEA 3HZXA 4DU9A 1AZQA 1Q3LA 4I7ZC 4C3JG 2F4IA 5M3MB 5JJZA 3FRPB 3M7NA 5HGTA 5C6AA 1BOSA 5J1ZA 1I4XA 1AEXA 3WOFA 4LAAA 3TBIB 2ICIA 1GXDC 3MAQA 2BE5C 4F8MA 1FNUA 3KBXA 2K7VA 3HGBA 5CV6A 4K2KA 1ILQA 3NBIA 4KHVA 5IGBA 1DZ1A 4IUQA 4G4KA 2VB3X 2KA7A 5COYA 2OT2A 2WP8J 2IJ0A 1RJTA 4KY6A 2L12A 4ZAIA 2B2UC 2HDLA 5IGCA 4HN7A 1STHA 4B08A 2VXWA 3MZ5A 3H0GB 1PMRA 4CGYB 4C3JB 1BCPD 2D2CC 4BS9A 1O7ZA 2JEAI 3JAME 1B44D 1KDAA 2HCIA 5ELFA 1B1ZA 1I6HB 4CKCA 1CZGA 2ZT9C 1TT2A 1SMYC 4A3GB 2DY7A 2K04A 1TWAB 3MXNA 3DWPA 2G9HD 2VUMB 5EPJA 4A3KB 3P20A 4ZQ3A 1EY7A 2HCCA 3A8KE 1U4RA 3VA7A 1A2UA 1VF5C 3IAYA 1SSOA 4NKLA 3OW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HMI A;  5CV9 A;  2EYM A;  4KTA A;  5IIF A;  5CR3 A;  5C5L A;  2RKS A;  3OMC A;  4IAL A;  5KGU A;  1A3T A;  5KYI A;  4F7X A;  3D8G A;  4PMC A;  4OL7 A;  5ISR A;  3D4W A;  1KDB A;  4QMG A;  1A3V A;  2PZT A;  4QF4 A;  3ERO A;  1SYF A;  1EYA A;  1A2T A;  3EVQ A;  3QB3 A;  5KIX A;  2SNS A;  4F8M A;  2NUC A;  5IOC A;  5HUR A;  5IOD A;  2F0J A;  3R3O A;  1EY5 A;  3TP5 A;  1EY9 A;  3P75 A;  1EYC A;  5CV6 A;  4NP5 A;  5EKL A;  2F0S A;  4I65 A;  4K14 A;  4K5V A;  4K2K A;  2OF1 A;  5IGD A;  1SNM A;  2PW7 A;  3MXP A;  1SNQ A;  4EQN A;  5I6W A;  5M9O A;  5KEE A;  2EXZ A;  2OEO A;  3LX0 A;  3BDC A;  4EVO A;  5JOB A;  1SNC A;  4KHV A;  3SHL A;  1II3 A;  1KAA A;  5K5P A;  3H6M A;  2F0W A;  4NDX A;  5NUC A;  4KJN A;  5C3W A;  1STN A;  5IGB A;  2F0K A;  2F0H A;  1JOK A;  3ERQ A;  3OWF A;  3OMG A;  4B9X A;  1F2M A;  1STG A;  4S3S A;  4TRD A;  1KAB A;  3SR1 A;  3ITP A;  4EQP A;  4DFA A;  5I9O A;  3QOL A;  4IUN A;  3SK6 A;  1SND A;  4KY7 A;  2F0G A;  5C4H A;  5I6Y A;  2SNM A;  2F0Q A;  3U9O A;  1EY8 A;  1SYC A;  2PYK A;  4KJO A;  4HTH A;  3SK5 A;  4EQO A;  4RKL A;  2EY2 A;  2O4X A;  4KY5 A;  3T13 A;  2KHS A;  2F0O A;  2EYO A;  4HMJ A;  2F0P A;  4LAA A;  3DHQ A;  2F0F A;  3NK9 A;  4K2L A;  4KY6 A;  1EZ8 A;  4QB4 A;  4G57 A;  2SOB A;  1KDC A;  1SYG A;  2PZU A;  2WAC A;  3TP6 A;  5F2D A;  1STB A;  3D6C A;  2F0L A;  4ZUJ A;  2KQ3 A;  1JOQ A;  1A3U A;  3SK8 A;  1JOR A;  4N9P A;  2F0T A;  2PZW A;  1EY4 A;  3MEH A;  3C1E A;  5IGC A;  1EY6 A;  5C5M A;  3OSO A;  5CV7 A;  1IHZ A;  2EYF A;  4H7B A;  1STH A;  3EJI A;  2EYH A;  1SYD A;  1SYE A;  2QDB A;  5IGG A;  5KRU A;  2OXP A;  2F0E A;  3E5S A;  4B9W A;  2F3W A;  2F0N A;  4PMB A;  1ENC A;  3NHH A;  2EYP A;  3P1H A;  4WRD A;  4ME5 A;  5DEH A;  3MZ5 A;  2EY6 A;  5CGK A;  5C3X A;  1EQV A;  3DMU A;  4E6I A;  4ZUI A;  1ENA A;  1EY0 A;  5EGT A;  2F0D A;  3PMF A;  1STY A;  1TR5 A;  1F2Y A;  3BDL A;  3SK4 A;  4IZ8 A;  1NSN S;  4ID6 A;  4R8N A;  5J39 A;  1SYB A;  3MHB A;  3TP8 A;  1EZ6 A;  2RDF A;  4K5X A;  1KDA A;  3D4D A;  4KV6 A;  5JAV A;  5KYL A;  5DAU A;  2F0U A;  2EYL A;  3TP7 A;  3NP8 A;  3TME A;  5EKK A;  5CV8 A;  2M00 A;  5E3F A;  2EYJ A;  4K8I A;  4KD4 A;  4ODG A;  3RUZ A;  4YIJ A;  4K5W A;  5CV4 A;  2F0I A;  5IGE A;  2ENB A;  4K6D A;  5IGF A;  1TT2 A;  1F2Z A;  3HZX A;  5E1F A;  5CC4 A;  5I9P A;  1EYD A;  3HEJ A;  3V2T A;  2RBM A;  3SXH A;  4DU9 A;  4RKB A;  5J22 A;  4PNY A;  1SNP A;  4N9T A;  2F0M A;  4KD3 A;  4NMZ A;  1NUC A;  1STA A;  3QOJ A;  4J6H A;  1TQO A;  2EY1 A;  2F0V A;  4DGZ A;  1SNO A;  5CV5 A;  1EY7 A;  2LKV A;  4ZQ3 A;  2F3V A;  4WOR A;  3VA5 A;  5C4Z A;  5HGT A;  3S9W A;  3MVV A;  4MIU A;  3C1F A;  2PQE A;  2EY5 A;  1RKN A;  3NQT A;  4K8J A;  1U9R A;  2PW5 A;  3T16 A;  5C6A A;  4DF7 A;  1JOO A;  1A2U A;  5J1Z A;  1AEX A;  3NXW A;  4NKL A;  2HQE A;  4J1M A;  3NUC A; 
#chains in the Genus database with same CATH topology
 3CCQ A;  2CQO A;  2FHT A;  5FJ8 G;  1AFP A;  4IAL A;  2Z4I A;  2AQ2 B;  1LTL A;  1V9P A;  1GO3 E;  4JI8 Q;  3J7A V;  3L2P A;  1OXT A;  4GLA C;  4KMU C;  2ZJR A;  2JA6 H;  2AQ1 B;  2B29 A;  3R3O A;  2KEE A;  3CCM A;  1CKN A;  2F0S A;  3NEL A;  4P71 A;  1SNQ A;  5IYC H;  2N8N A;  2OEO A;  1G91 A;  1J8I A;  1XMO L;  1BNZ A;  4MZ9 A;  3D3R A;  4G7H C;  1YI2 A;  2UUC L;  1HZ9 A;  4Z9C B;  1FJG L;  1DM0 B;  4FNF A;  1X6O A;  3AQQ A;  5T1I A;  3U9S A;  1MJC A;  2PO4 A;  4L8J A;  4DK3 C;  1WCM H;  4EQP A;  1G6P A;  4WJW A;  4JBM A;  4JVZ A;  1XYI A;  2E76 C;  3M9B A;  1HZC A;  2B8F A;  3IKJ A;  5IP9 H;  4MTK A;  4LFB Q;  3ONA B;  1TY2 A;  3J81 L;  3FDT A;  4X66 Q;  5BN4 A;  4BBS G;  2F0O A;  1I4H A;  4UDU C;  4HJ5 A;  1VQB A;  1I4R A;  3KF8 A;  3J81 c;  4DR5 Q;  4A3K H;  3S17 B;  2F1M A;  4X65 L;  4JOI C;  3SK8 A;  1JC7 A;  4BA2 I;  1KL9 A;  3EJI A;  2K03 A;  1Q7Y C;  5IGG A;  2N78 A;  1RDP D;  4GKJ Q;  1QZH A;  1QCB D;  4HCE A;  3M4O B;  1NR2 A;  5C3X A;  5M5Y B;  1CM9 A;  1VMC A;  4Y7N B;  2VB2 X;  3HOY B;  1E0B A;  3EN2 A;  3I7F A;  4C3I H;  3J7A F;  1Q1B A;  3S1Q H;  3I8Z A;  1VQ9 A;  2WV6 D;  2F3I A;  2A69 C;  2ENB A;  2MO1 A;  4BWG B;  3MWY W;  4JPB W;  3OW2 A;  3ERS X;  5E1F A;  2RBM A;  2AMC B;  1YHA A;  5FO9 B;  3EBE A;  1H9R A;  2ZM6 L;  1STA A;  2MUY A;  2L4N A;  4P72 A;  4DR5 L;  1HUM A;  2LKV A;  2XSC A;  3ER0 A;  3NQT A;  2UXD L;  1L1O B;  3ZJY C;  3RN5 A;  3G48 A;  4KN4 C;  2HQE A;  4J1M A;  1PH2 A;  1KC8 C;  5G3L D;  2UXB Q;  4HMI A;  1IYU A;  2RSO A;  4BY7 H;  1XJV A;  1YNN C;  4QMG A;  2BA1 A;  2PZT A;  4GKK L;  4KN7 C;  4DK6 C;  1ZEQ X;  1SYF A;  3M4P A;  1HQR D;  1SXT A;  2QW7 A;  1BR9 A;  2XVS A;  4CJ0 B;  2NVY B;  3SEB A;  1CI3 M;  1EY9 A;  4BA1 I;  3TS2 A;  4H0L C;  1JJC B;  1X3P A;  2PW7 A;  3BG3 A;  4QUF A;  4G7Z C;  3KBG A;  4LF4 Q;  5IYB H;  2NVT B;  3GTG B;  1Y1V B;  1A6X A;  3TEH B;  2AWO A;  1W3S A;  1SBB B;  3UDI A;  2NB0 A;  1F2M A;  1YJ9 A;  3MFY A;  4BBS H;  1PRT F;  2A1A A;  1Q81 C;  1K83 H;  2HT1 A;  2F0G A;  2Q8I B;  1BCP C;  3BVG A;  2O4X A;  4C3I G;  5FLM G;  2A68 C;  4HMJ A;  2JA8 G;  4K2L A;  1SR3 A;  5C0X I;  4X64 Q;  3CHB D;  3TRZ A;  1MHW C;  3CCE A;  1JOQ A;  2YTV A;  1IBM Q;  3AMU A;  1J9O A;  3H3V I;  3VYU A;  4DV2 Q;  1W6K A;  2L55 A;  3I91 A;  3CMA A;  3K7A H;  3V96 A;  2EYP A;  3D0F A;  2O5I C;  3S2H B;  4IJH A;  1ENF A;  2HIV A;  4JW0 A;  1KRT A;  2ZXP A;  3H91 A;  5FLX L;  4DR2 L;  4R8N A;  3LWU A;  4BXX G;  2R93 G;  3MHB A;  2Z6B A;  3K0Y A;  4OX9 Q;  3TP7 A;  3TME A;  3VR4 A;  5CV8 A;  1IL2 A;  1EEF D;  5M5X B;  3HOX B;  1DXM A;  4RCN A;  4ZK9 B;  1GUT A;  2F0I A;  3DEP A;  5IGF A;  2ICE C;  1VF7 A;  2WKD A;  4DV0 Q;  5IT9 c;  1YNJ C;  4IJL A;  2Z8L A;  1SLJ A;  4QUC A;  2UU9 L;  1EWH A;  3RZO H;  3D6W A;  4JI7 Q;  1Y1V G;  3C1F A;  1Y14 B;  2EJG C;  1OXS C;  2B63 B;  4YY3 Q;  1TY0 A;  2PNR C;  3GTP H;  3HOX G;  1HNX L;  2VS1 A;  5KGU A;  3H09 A;  4EQ5 A;  1A63 A;  1LV9 A;  1I4P A;  2R3Z A;  2X69 A;  1AZP A;  5IOC A;  1TWG H;  4DR2 Q;  3S2H H;  1EYC A;  5C0X G;  2A6H C;  1HUN A;  4JI3 Q;  2K52 A;  4IFD I;  1CFM A;  1L0W A;  3STB C;  5D14 A;  4XXE A;  5C4X B;  1PXU A;  4UP8 A;  4R4O A;  4LF5 Q;  3I4M B;  2F0K A;  1AE2 A;  3ERQ A;  3OWF A;  1MSG A;  1KAB A;  3K6O A;  3TDQ A;  4UHV A;  1RHP A;  1DOM A;  2K4K A;  3QG1 A;  1MJE A;  1EY8 A;  2K01 A;  1SE3 A;  1PH4 A;  4JI2 L;  4YWM A;  3STB D;  4JI7 L;  3IRB A;  4OHJ A;  4QIW B;  4DR3 L;  4BY1 B;  2YYZ A;  2H1E A;  2WAC A;  3RN2 A;  5IY0 A;  3GV3 A;  5A35 A;  1SE2 A;  2F0L A;  4ZUJ A;  3KF6 A;  4YCU A;  3I4N G;  4AH6 A;  2F0T A;  1ZKO A;  4NPS A;  4UP9 A;  4PG3 A;  5KRU A;  1EWC A;  3E5S A;  4QL5 A;  2ZTC A;  4ME5 A;  4R4T A;  1ENA A;  1ZYR C;  1SE4 A;  5L37 A;  1RTO A;  1WTO A;  1TWG B;  3H0G G;  3BDL A;  3SK4 A;  5IP7 G;  4HSP A;  2DGY A;  1B9M A;  2UUA Q;  1EZ6 A;  3H3V C;  5JAV A;  3HKZ G;  2F0U A;  4NXM Q;  1UE6 A;  5E3F A;  3K5L A;  2FFK B;  2FIN B;  1VQC A;  2RSN A;  3M3Y H;  1Y1W G;  2XGT A;  4RHS A;  1F2Z A;  1SFO H;  4LFC L;  2KBN A;  1B3Q A;  1OXX K;  4PMW A;  3HOZ H;  2F0M A;  4NMZ A;  1KQS A;  1ROD A;  3G4S A;  3CRL C;  2EY1 A;  3R8B A;  1FD7 D;  1HJP A;  1R4P B;  2A6E C;  2EY5 A;  1RKN A;  3AYH B;  2PW5 A;  1VQL A;  3PO3 H;  1YNJ D;  4DF7 A;  1EWI A;  3I4M G;  4OEL B;  5KYI A;  3GV6 A;  5CV9 A;  4RWS C;  3SDZ A;  1JCK B;  1WD0 A;  4K0K Q;  2B2U A;  3GTK H;  2NN6 H;  2NVY H;  4MNO A;  3CME A;  4A3J G;  5LMN W;  2QA4 A;  1A3V A;  2B63 H;  3K58 A;  1GUG A;  3Q22 A;  2ZJP A;  3HOY H;  5M3F H;  2Y0S E;  5EJW A;  3M4O H;  3A8J E;  3X3M A;  1TWH B;  2NN6 G;  2I46 A;  3MXP A;  4MN3 A;  1PYS B;  2BDO A;  1BBU A;  3T4A C;  2N88 A;  1QVG A;  1XPU A;  1AP0 A;  4NDX A;  2SEB D;  1M90 C;  2JSO A;  1K3R A;  1G2S A;  5EPK A;  1F9P A;  1DGS A;  3RLF A;  4CKE A;  1HRJ A;  1YNX A;  5FOB B;  4A3G G;  1ASY A;  1X56 A;  5M3M G;  4JI4 Q;  2F4V L;  3OHX C;  2Z6K A;  2NWG A;  3PCO B;  3T1H Q;  1Z9F A;  1Z7T A;  3GO5 A;  4FVM A;  1BVS A;  3KDF B;  4C1N I;  1KDC A;  4BBR H;  4UP7 A;  1N33 Q;  1JOR A;  3I72 A;  3NWS A;  2PZW A;  1S3O A;  3QWN A;  3J81 j;  3AEV A;  1LTR D;  3KLW A;  4BBR G;  1KAW A;  1ENC A;  1O7I A;  5CYU A;  4QQB X;  3P1H A;  4ZRZ A;  3ND8 A;  3UI2 A;  1EQV A;  3NBH B;  4HJA A;  1SN8 A;  3GQB A;  1S5F D;  3OIQ A;  1TR5 A;  3GP7 A;  1PFM A;  3NE5 B;  4ID6 A;  2L5T A;  4OWT B;  3T51 B;  3TP8 A;  4A3E G;  4X65 Q;  1L1O A;  5H1S E;  5DAU A;  4IPG A;  3T1Y L;  1TVX A;  2KUM A;  2C35 B;  1EOV A;  1IBL Q;  1TS2 A;  2AQ3 B;  2EYJ A;  1EQQ A;  4IN3 A;  3Q24 A;  4ZKB B;  4CDF C;  4L5Q A;  4K6D A;  4C3H G;  3CC4 A;  5FO7 B;  1N32 Q;  2KEC A;  3BDO A;  3SXH A;  3RNU A;  2NVQ H;  3L7Z C;  4X3T A;  2EPB A;  4A3L G;  4X64 L;  2XIW A;  2ZTD A;  3BZK A;  1A0I A;  1HCZ A;  4GN4 B;  1SFO B;  4LUO A;  4LFB L;  1U9R A;  1H9K A;  5C3E G;  1FNW A;  1NAP A;  2BH2 A;  3AU7 A;  5FO8 B;  1CT1 D;  1V1P A;  3LNN A;  3TN2 A;  2B2V A;  2VNU D;  3CW2 C;  5LMN L;  3GTM H;  2A69 D;  5DLQ E;  3VYT A;  3D4W A;  4EGV A;  1DYQ A;  1EYA A;  4X3K A;  3NWT A;  3PUX A;  3GTO B;  3TP5 A;  1EY5 A;  1EU4 A;  3MFG A;  4NP5 A;  1HR0 Q;  1WI5 A;  3W1B A;  3K57 A;  5KND A;  2HHH L;  1H9M A;  3PUY A;  3QR8 A;  4M1U B;  5IYC G;  3BDC A;  2IL8 A;  1EIY B;  1RL2 A;  4LWC A;  2F0W A;  1PRT D;  5DM6 3;  3E0E A;  4OIJ A;  1N36 L;  3T53 B;  4LF8 Q;  1M1K C;  2KCM A;  1DD2 A;  4BY1 H;  1SJE D;  1IBK L;  1PVO A;  1LTS D;  2M9V A;  3N6R A;  1I6V C;  5CBA E;  1KRS A;  4DAY A;  4C2M B;  3S14 H;  3M7G A;  3KLR A;  3K8A A;  1EOT A;  2DJG C;  2DNE A;  3T13 A;  1IYJ B;  4AIM A;  4OXP A;  3N52 A;  2PNH A;  3HOW B;  5A2Q E;  4TSS A;  3K59 A;  1H9J A;  1NR4 A;  4V0B A;  4C3J H;  1H9S A;  3MEH A;  4YWK A;  5C5M A;  3UE1 A;  1J6Q A;  3B6Y A;  3HFZ B;  3CAM A;  4K6L A;  3AB9 A;  1KD1 C;  3L3O C;  4HIO A;  1HR0 L;  1GOZ A;  1HH2 P;  1PTO B;  3PO2 B;  4JI3 L;  3PIO 3;  3HOU H;  2EVB A;  4LUV A;  2KHJ A;  1S72 A;  1J5E Q;  1K3B C;  3CCU A;  4KKU A;  3D4R A;  3GTQ H;  5KNC A;  3GTL B;  4BBS B;  1EFI D;  5J22 A;  1VQJ A;  4DA2 A;  4KD3 A;  1NUC A;  2RF4 A;  4DAY B;  1SNO A;  4KHZ A;  1U0L A;  1E2Z A;  1S5D D;  4NW2 A;  4KLK A;  4DKA C;  3EA6 A;  3V05 A;  1GUO A;  3CC2 A;  2K1B A;  4IPH A;  3JAM i;  2I07 B;  3E3X A;  1X9N A;  4A3M H;  4GKJ L;  2IHE A;  2UUC Q;  1FJG Q;  4XQQ A;  1NMG A;  1PFS A;  2Y0S G;  3D8G A;  4IUP A;  2UUB L;  1QE6 A;  4Y7N H;  1Z6H A;  1IW7 C;  3K5O A;  1XXG A;  4RGT A;  2LY7 A;  1GUN A;  2DY8 A;  1RCV D;  5IOD A;  2A6E D;  1IYV A;  3P75 A;  1X3Q A;  1LO5 D;  5FLM H;  2UUA L;  2JA8 H;  3S1Q B;  3L0O A;  4JG2 A;  2D62 A;  1SNM A;  1TS5 A;  4OO1 H;  1M4V A;  1Y8N B;  2B2Y C;  2ZXR A;  2N49 A;  4A4I A;  3CRK C;  2YU9 B;  5JOB A;  1QIL A;  4OWX B;  1WCM B;  1C7Y A;  5K5P A;  3L9A X;  3H6M A;  4DXF A;  1RIP A;  1Y8P B;  5LMN Q;  1V1P B;  1FL0 A;  3OMG A;  1XX8 A;  2QCP X;  4S3S A;  4KHP Q;  1I50 B;  1UNS A;  1AH9 A;  1PTO F;  2MHV A;  4HJ8 A;  5JPM C;  3QOL A;  4IUN A;  3DM3 A;  3KOJ A;  2VUM H;  4CJ1 B;  2GVB A;  3GD7 A;  3S16 B;  3SK5 A;  4ILW A;  2E2H B;  1UE1 A;  3MXG A;  2EYO A;  1EZ8 A;  3TP6 A;  1SYG A;  4X62 Q;  4LF5 L;  1U4L A;  1T5E A;  1U4P A;  2BE5 D;  3G7L A;  2Q2U A;  4H44 C;  1OTC A;  3C1E A;  1EQR A;  1IL8 A;  2KCN A;  2LMC B;  4A3F B;  4MTN A;  2QDB A;  4DAV A;  3RLN A;  1IBK Q;  4PMB A;  2JA6 B;  3ICE A;  3GTK B;  2RDH A;  1PZI D;  3BYT B;  4KI0 A;  1SE8 A;  5JEA G;  4LF4 L;  3UDG A;  1WYD A;  1EUJ A;  4IUU A;  1NNX A;  4QY7 A;  2EZV A;  1D5M C;  4K5X A;  5JJL A;  1UAP A;  2VW9 A;  1D6E C;  1CSP A;  4A3M G;  2JA7 B;  2YU9 H;  4U67 3;  2VQE Q;  3NTI A;  5LL6 X;  1EYD A;  3I70 A;  4IQZ A;  4GOP C;  1EL0 A;  1F9Q A;  4N9T A;  1SRO A;  3IL8 A;  5BN3 A;  5JVH 3;  1PDQ A;  3KYH C;  2B3G A;  3O13 A;  1KHI A;  4LNQ A;  5C4Z A;  3GTL H;  5IYB G;  4XTC S;  3CU7 A;  4AQY Q;  1ML0 D;  3K81 C;  5DNF A;  5ELC A;  1F9S A;  3X3N A;  2RHQ B;  1PZK D;  2RKS A;  3OMC A;  3F2D A;  1C4Q A;  3J7A 5;  3M85 A;  3KUP A;  4PMC A;  3PUZ A;  1V43 A;  4QF4 A;  4B3T Q;  3QO2 A;  5E4X A;  5KIX A;  4IFD G;  5HY6 A;  1FGB D;  2F0J A;  1F9R A;  3U4V A;  4OIK A;  2L9H A;  2R7D A;  1CHQ D;  2K28 A;  5FKA C;  4DR7 L;  2CW0 C;  5GAD C;  2NVX H;  2BOS A;  4EVO A;  1SNC A;  5D65 A;  2E8G A;  4ZLT F;  2X6G A;  4XIG S;  5C3W A;  1JOK A;  3E9I A;  2JA5 B;  2JA7 H;  2Z6K C;  2R92 H;  4A3B B;  1BCP B;  3M3Y B;  2B8G A;  1GM5 A;  4IUR A;  2R7Z B;  2WFW A;  1N34 L;  4JYA L;  2D0P A;  1S4Z A;  3FKI B;  3JC6 6;  2EOT A;  4YY3 L;  2B63 G;  1VQE A;  1LAB A;  2Q8R E;  1STB A;  5K36 G;  4XT1 B;  2UXD Q;  4JCV E;  1SEB D;  3FKI G;  1WVL A;  2EYH A;  1SYD A;  3QIA A;  4JI1 Q;  5K36 H;  4ZUI A;  4DV0 L;  1NCV A;  2F0D A;  4R4I A;  2NBF A;  4RGN A;  2OCE A;  4RCO A;  5J39 A;  2L11 A;  2NVT H;  2C9O A;  2EXD A;  1E2W A;  1HNW L;  4A3G H;  3GTQ B;  3J81 i;  2ZJQ A;  2NVX B;  1WTQ A;  4K8I A;  5IP9 G;  2EIF A;  1B7Y B;  2R93 B;  2B2T C;  4LJZ C;  1NY4 A;  3A5Z B;  2K5H A;  4JI0 L;  3PQI A;  4CHT B;  2NTS A;  4R1J A;  1SNP A;  4XYQ A;  3MTS A;  3J80 L;  5C0X H;  1WJJ A;  2E5L Q;  1DOL A;  1H9S B;  1HTL D;  5CV5 A;  3T1Y Q;  2OQK A;  1E7Z A;  5I2Y A;  2RA4 A;  1QB5 D;  2H4O A;  4RGO S;  4POF A;  1IKM A;  2H5X A;  3K0X A;  3OWE B;  1TS3 A;  2CKZ B;  2OQ0 A;  1YNN D;  1HQM C;  1YZ6 A;  5C5L A;  2VZA A;  3WDN A;  1KNA A;  1PYW D;  1X32 A;  1A2T A;  3EVQ A;  4A3I H;  1HNZ L;  1JR0 D;  1HR0 W;  3J81 E;  2K05 A;  2IX3 A;  2CW0 D;  1K8G A;  1SRU A;  2Z4H A;  1VQK A;  1W2B A;  2D9U A;  4X3S A;  4EQN A;  4A3I B;  3CD6 A;  2DJF C;  4Q0F A;  2KED A;  3NBH A;  1XNQ Q;  5LL6 S;  1JIC A;  4DV1 Q;  1V1O A;  3SR1 A;  1ONL A;  1P8L A;  2GVA A;  1VQO A;  5GAG C;  2IX0 A;  1TWF H;  4CJ2 C;  1EEI D;  2GN5 A;  1SYC A;  1JT8 A;  1QNK A;  2KHS A;  1LLR D;  3DHQ A;  2F0F A;  1GUW A;  4B3S Q;  1R9T H;  2ALY B;  2X6L A;  2KQ3 A;  3KLS A;  1A3U A;  4FP5 D;  1Y8O B;  4ZKC B;  4FYD A;  3KLS X;  2E74 C;  5CV7 A;  4OEM B;  2EYF A;  2F52 A;  1WD1 A;  2OTL A;  2CHB D;  5LMU Q;  4IFD J;  4Q5V A;  1L0Y B;  4DV7 Q;  4IUT A;  2WB1 G;  1EY0 A;  1DJR D;  3PMF A;  4IUV A;  1TS4 A;  1PH5 A;  4IZ8 A;  2NYZ D;  5FK9 C;  1BXT A;  3RD4 A;  1S40 A;  3D4D A;  4KV6 A;  2A73 B;  5JJK A;  4A3E H;  2EYL A;  1EIF A;  4ZYS A;  2ASB A;  5C4X G;  2WAQ B;  2NTT A;  3HOV H;  4X3U A;  4A3E B;  1S5E D;  4PV1 C;  3FPU B;  3I4L A;  1IKL A;  3TZD A;  3EQL C;  5DM7 3;  4DK0 A;  3W1G A;  1O7L A;  3RLO A;  4DNT B;  4AYB B;  1D2B A;  4GKK Q;  2LXK A;  3QOJ A;  3EIV A;  4DUZ Q;  1IW7 D;  3J80 c;  3GDE A;  4DGZ A;  1GVP A;  4BBR B;  2E2I H;  1QG7 A;  2A68 D;  2KHI A;  4DNI A;  1Y69 U;  3A54 A;  3I3C A;  3J80 E;  1CSQ A;  5D3I B;  1PRT B;  4PZ8 A;  3NUC A;  5E4W C;  1BO0 A;  5M3F B;  5IIF A;  4IO9 A;  4OGQ C;  1FVI A;  2RVL A;  3A8I E;  1XWE A;  4OO1 I;  4F7X A;  1WTR A;  1TWC B;  3FHW A;  5EBC A;  3ERO A;  5ELB A;  4A76 A;  2AKW B;  2ZXO A;  4DK1 A;  4R9W A;  1C48 A;  1CQF A;  4DV4 L;  2CWA A;  3I55 A;  4JI4 L;  2F4V Q;  1PTO H;  3PO2 H;  3NQI A;  2LFN A;  1S5C D;  1MIU A;  4GLV B;  5LHY 1;  1BBW A;  1B53 A;  1STG A;  4TRD A;  4YCW A;  2R61 A;  3S1N B;  2KCT A;  2K6A A;  2WKC A;  2EJF C;  4AYB G;  4YHH Q;  3SK6 A;  3S17 H;  5C4H A;  1HTP A;  1ILP A;  1XMQ L;  1PH9 A;  2B2W A;  2XN9 C;  3CXC A;  4YCV A;  4KY5 A;  1LUZ A;  2F0P A;  1ICW A;  3KK7 A;  1QUQ B;  4G57 A;  5AJ3 Q;  2NZO A;  1QNU A;  2GA4 B;  2QEX A;  1I4Q A;  4RA8 A;  1ESR A;  1G8Z D;  1EY6 A;  4V19 0;  2K75 A;  3SVM A;  3HOU G;  1MD2 D;  3W2D A;  1QOH A;  1N32 L;  3DEO A;  1OXU A;  3A56 A;  4DV3 Q;  1AN8 A;  3OOC A;  2MPM A;  3K5M A;  2JP1 A;  1GUS A;  4CBV A;  4QIW E;  3F2C A;  4FF3 A;  3KDF A;  4FXK C;  3NP8 A;  2YTY A;  4O42 A;  4JBK A;  2IT1 A;  4DR3 Q;  4HID A;  5M3F G;  4KD4 A;  1D8L A;  1YVC A;  3LGJ A;  2JYO A;  5CV4 A;  1UEB A;  1B70 B;  1KLU D;  4J15 A;  3K5N A;  3NEM A;  3IFD A;  2MQH A;  5CC4 A;  3HEJ A;  2VQF Q;  3D31 A;  3KF8 B;  3RZO B;  4PNY A;  2PCF B;  4KHP L;  1G2T A;  4A3C H;  3F2B A;  1D7Q A;  4FF2 A;  1KLG D;  3KFU A;  1PZJ D;  5GQO A;  2K5W A;  5IT9 E;  3S16 H;  3HOW H;  1OXV A;  5FLX E;  4BY7 B;  4K8J A;  4P75 A;  1I94 Q;  3NPP A;  1L2F A;  3S2D B;  4DR4 Q;  1T9H A;  1WOC A;  3VYR A;  4NXN L;  3PUV A;  1EIG A;  5C3E B;  1IBM L;  2V1C C;  5IP7 H;  1XNR L;  1JMC A;  1B9N A;  1PH8 A;  2I5M X;  4BY1 G;  2DN8 A;  2MO0 A;  1T5X D;  3E6Z X;  2XRS D;  2SNS A;  4HJ7 A;  3C3L A;  2R7F A;  3S1M B;  1BKB A;  4K14 A;  1VQ7 A;  1PFB A;  2E2J B;  2R6G A;  1D1I A;  1JWM D;  2AUJ D;  5M9O A;  4DUY L;  1JB3 A;  1QUQ A;  3LX0 A;  4XQN A;  5ELO A;  5LMU L;  2K5Q A;  4O2D A;  4L5S A;  2E2D C;  4B9X A;  4GOP B;  1PV4 A;  3DUZ A;  4B3T L;  1Y1V H;  1SDF A;  1WFQ A;  3PO3 G;  1PH1 A;  1SND A;  4HSV A;  3F2U A;  4KJO A;  4HTH A;  2O2L D;  1JWS D;  2L1B A;  4LW1 A;  1K83 B;  5ELE A;  3I56 A;  1LAC A;  1VDZ A;  2UXC Q;  2VQE L;  4RFB A;  1CK1 A;  3BS1 A;  1CA6 A;  1C8C A;  2R7Z H;  4ME3 A;  2Z0S A;  3K7U C;  2ID0 A;  3CCR A;  3Q6S A;  3OSO A;  1EU3 A;  4QJF A;  4H7B A;  3T56 B;  1JJG A;  1K8O A;  2IWH A;  1VMP A;  5IYD H;  1D5Z C;  3DLL A;  2F3W A;  5GRO A;  1UUP A;  1EQT A;  5C0X J;  1WTP A;  2FMC A;  3RZD H;  3M4Q A;  3CCL A;  2VY3 A;  5FJ8 H;  3OIP A;  3BVM A;  1Z47 A;  1VQM A;  1XNQ L;  1F77 A;  1X55 A;  2K33 A;  4M8A A;  4O1N A;  2Q2H A;  1O78 A;  4XYO A;  4X62 L;  1TU2 B;  4I7A A;  2RQX A;  4CDD C;  2MP1 A;  5M5X H;  1VS0 A;  2G5D A;  1VQF A;  3EFX D;  1B2T A;  2NZ1 D;  5ELD A;  2KJX A;  3W3A A;  3S14 B;  1E3P A;  2PI2 A;  2PQE A;  2VL6 A;  1XPR A;  5IWA Q;  1G29 1;  3DWA A;  4IFD H;  1I5F A;  1U5K A;  3ZYY X;  4DV2 L;  4FO2 A;  4ABN A;  1A3T A;  2JE6 I;  2JA8 B;  2CWP A;  3UDX A;  5ISR A;  1K0S A;  1TWH H;  3J7Z C;  4JI5 Q;  2VUM G;  2E5L L;  2EJM A;  1BQQ T;  1CHP D;  1SAP A;  1VQD A;  3I4O A;  4GN3 B;  1I94 L;  3VR2 A;  3PV0 A;  2Q8T A;  2WII B;  5KEE A;  3C46 A;  2QGQ A;  3DM1 A;  4HR7 B;  1OO9 B;  2B2T A;  1VQN A;  1KNE A;  1STN A;  1HNW Q;  3HOX H;  1HA6 A;  1P16 A;  1E1T A;  4BXX H;  2R93 H;  3ITP A;  4X6A H;  4DFA A;  5I9O A;  1Q8K A;  5I6Y A;  3I4M H;  1HZA A;  4FF4 A;  2KCC A;  2R7Z G;  1VQ6 A;  1FGU A;  1ESF A;  2TSS A;  5EQ0 A;  2J0T D;  4H02 A;  1QZG A;  3PO3 B;  1CTM A;  4QB4 A;  1G6Z A;  5F2D A;  2JA5 G;  2HHH Q;  4A3I G;  3A55 A;  1M8A A;  3I4N B;  2RCF A;  5EPL A;  4FF1 A;  5TSS A;  1L1O C;  1QWY A;  3TSS A;  1GJX A;  1RTN A;  2OTJ A;  1R9T B;  3HKZ E;  1SYE A;  4B9W A;  2F0N A;  4WRD A;  5COR A;  5T1G A;  4FDB A;  4QCL A;  1PFN A;  2EQS A;  3I2Z A;  4GNX B;  1LTG D;  1F2Y A;  1YJN A;  4HJ9 A;  2QKI C;  3BVZ A;  3H0G H;  2IHF A;  3A7L A;  4JOI A;  2RDF A;  2MNA A;  1ICF B;  2DUD A;  3TZU A;  1EFW A;  4LFA L;  4ODG A;  3RUZ A;  1Q86 C;  2NVQ B;  4K5W A;  1PLF A;  2XTI A;  1RF2 D;  4DAM A;  5EAY A;  2K32 A;  4LF6 Q;  2A6H D;  3HOY G;  1I4G A;  4FXD A;  4JBJ A;  2HQL A;  1I6H H;  1ET9 A;  2LSS A;  5C44 H;  2BDN A;  1TWF B;  1VQ8 A;  1TKW B;  2F0V A;  1Q90 A;  4DN4 M;  3S9W A;  1YJW A;  1W6J A;  2F3V A;  3VA5 A;  3MVV A;  3M4Y A;  2E2H H;  3H94 A;  4UAI A;  3MXU A;  1Q12 A;  3K80 C;  1JOO A;  4DV1 L;  2M2L A;  3AFP A;  3NXW A;  1I3Q B;  2KOL A;  4JI1 L;  1PHJ A;  2J7Z A;  4PZ7 A;  2J4X A;  4DV5 Q;  3TQY A;  4ALP A;  1KDB A;  3S1R B;  1Q8I A;  3BZD B;  2FMM A;  3GTP B;  2FXQ A;  3A74 A;  2HIX A;  5I4D A;  1VQP A;  3C2P A;  4AYB E;  5HUR A;  3BJU A;  2G9D A;  2MJ8 A;  4LK1 C;  4I65 A;  4LF7 Q;  4DV7 L;  2PPB C;  4TQU S;  3H3V H;  1YIJ A;  4B3M Q;  4POG A;  5I6W A;  1MI2 A;  4ZCK A;  4MHE A;  2WAQ E;  3SHL A;  1SMX A;  4RH6 A;  5NUC A;  3S15 B;  2KVM A;  1BUV T;  2NZH A;  3J7Y W;  4P2C B;  4LFC Q;  4JI8 L;  1S5B D;  4KKS A;  5ELN A;  3VDY A;  1UE5 A;  4DXG A;  3G6E A;  1PH7 A;  3S15 H;  2SNM A;  4A3B G;  4A93 H;  3NTK A;  3KJO A;  4B3R Q;  1A62 A;  1Y1W H;  1PRT C;  3PIO A;  4A93 B;  2UXB L;  2K5N A;  1AE3 A;  4JV5 Q;  4A93 G;  1J5E L;  3S2D H;  3PO2 G;  1IHZ A;  1B8A A;  4DR6 L;  3NHH A;  2L0C A;  5DEH A;  3F8T A;  5CGK A;  3W5O A;  2N55 A;  4J8Q A;  1STY A;  4G7O C;  4B3M L;  1VCI A;  3I90 A;  1HHV A;  1MGS A;  2L15 A;  3R2I A;  4B3S L;  3HKZ B;  3MA2 B;  1TXY A;  2IX1 A;  1N36 Q;  5I9P A;  3V2T A;  1H95 A;  4GS3 A;  4DV3 L;  2FJ2 A;  3FPP A;  4LF8 L;  5FLX c;  4UY8 C;  3HG9 A;  1CA5 A;  4P74 A;  2UXC L;  3BYY B;  3DXJ C;  4A3L H;  1XMO Q;  4NXM L;  3FEW X;  4IPD A;  4A3M B;  2YTX A;  3HOZ B;  3T16 A;  4L5T A;  4FXG C;  4CKB A;  5BR8 Q;  1O80 A;  1BDO A;  4DR1 L;  4RKB A;  1WTV A;  4A3D G;  2EYM A;  2A8V A;  3ULJ A;  3CF5 A;  1X65 A;  3E9H A;  1YIT A;  2PQA B;  4IPC A;  3VYS A;  1K8M A;  3CP0 A;  3QB3 A;  2CCZ A;  1MSH A;  2XWB B;  3HOU B;  3KF6 B;  5AJ3 L;  3VR5 A;  1ET6 A;  4KK7 A;  3URY A;  2SDF A;  1FNV A;  5M5W H;  3UDF A;  2EXZ A;  5GAH C;  1AW7 A;  1I50 H;  4RHR A;  3S1M H;  1K28 A;  2AWN A;  1II3 A;  2TMP A;  3ND9 A;  1JB7 A;  1XNR Q;  2KEN A;  4AQY L;  3UE0 A;  3G6J B;  4LF9 Q;  2PMZ B;  4O0A A;  3GTG H;  4BY7 G;  4RAU C;  4JBW A;  4U68 A;  4JI0 Q;  2F0Q A;  1FR3 A;  3JAM c;  3VR3 A;  2WIN B;  2XNA C;  3JAM L;  1STE A;  4C3H H;  1B4O A;  1L0X B;  1WCM G;  3NK9 A;  5GAE C;  3CCV A;  5CMD A;  1VQH A;  2PZU A;  5BR8 L;  4A3F H;  3PF4 A;  4A75 A;  4DR1 Q;  4APV A;  2QDL A;  3TS0 A;  1MBY A;  2IW3 A;  3R93 A;  1N8R C;  3A0J A;  1KTK A;  1CQV A;  2CQA A;  2VQF L;  1EY4 A;  2HD3 A;  5A2Q L;  1WTX A;  2JK8 A;  3HS0 C;  4OO1 G;  2EE1 A;  2HUG A;  1PTO C;  1LTA D;  2EY6 A;  2B2W C;  3DMU A;  4C56 C;  2Y0S B;  1K0R A;  3CPF A;  2LXJ A;  1PA6 A;  1HNZ Q;  2CH4 W;  3GTO H;  5IYD G;  5KYL A;  1N33 L;  4RMF A;  1E24 A;  1LYL A;  1LT5 D;  4L63 B;  4JYA Q;  4K0K L;  2E2J H;  3IFT A;  2M00 A;  4DV5 L;  4LF9 L;  2B2Y A;  5C4X H;  1YBY A;  2AUK A;  3HP3 A;  5J3B A;  1TWA H;  4DR6 Q;  1GHJ A;  5BN5 A;  4TVA B;  2Q2I A;  1VQ5 A;  1XPO A;  2CH4 A;  4JI2 Q;  5I2X A;  4UPA A;  2C5C A;  2IPK D;  2I0Q A;  3NTH A;  4J6H A;  2ZTE A;  3CQZ H;  4WOR A;  2WAQ G;  2F03 A;  4DNR B;  4C3H B;  4H13 C;  4DR7 Q;  5EBD A;  1UWV A;  2QEJ C;  2JJQ A;  2BA0 A;  1JE5 A;  1DCZ A;  1BBX C;  4WJ4 A;  4KKT A;  5IE8 A;  4R8I A;  2K50 A;  5IT9 L;  3G71 A;  2JXM B;  4A3K G;  1XTC D;  3DWQ A;  1X3E A;  3NSW A;  5JEA J;  5E7N A;  5D3D A;  1YHB A;  2LS0 1;  1PTO D;  5EKL A;  1Q82 C;  2BH8 A;  4XDX A;  4JK1 C;  5IGD A;  1CKM A;  4OON A;  3RZD B;  5IWA L;  5EKI A;  3E0J A;  3PIP 3;  2A5H A;  3Q23 A;  3HOV B;  2R92 B;  1KAA A;  1N9W A;  2BCO A;  4KJN A;  1EIH A;  4RG1 A;  3CC7 A;  1ZXT A;  1HA5 A;  2F0H A;  4XT3 B;  3P7J A;  4DR4 L;  1D1K A;  2K14 A;  1NBW A;  3QJY A;  4HAE A;  2HDM A;  3BU2 A;  4DV6 Q;  3ULP A;  4R4Q A;  4KY7 A;  1G51 A;  3H15 A;  2PYK A;  2V4D A;  1FYC A;  3HKS A;  4OX9 L;  2D5D A;  2EY2 A;  3VR6 A;  4DUZ L;  2MFI A;  2PI2 E;  2SOB A;  3U50 C;  2O5J C;  4C2M H;  2CFM A;  1I3Q H;  3FMC A;  3GTJ H;  3OTO L;  2AHO B;  2JEB I;  1V8Q A;  2MGS A;  4N9P A;  2JA9 A;  3LWE A;  4C1N K;  1R4Q B;  1SMY D;  4TKO B;  1UEA B;  2F0E A;  4HED A;  1TWC H;  4LF7 L;  5EGT A;  1YHQ A;  4DUY Q;  2WB1 B;  3WWV A;  2ZM6 Q;  4QGU A;  1DON A;  1SYB A;  2K5D A;  1IZ6 A;  1PYB A;  1X3F A;  1IXR A;  4F87 A;  1HXY D;  3OYY A;  2CVR A;  3PF5 A;  4L6T B;  2EDG A;  1B3A A;  5KNB A;  1A15 A;  4NXN Q;  2RHS B;  1DOK A;  1LT3 D;  3A7A B;  1MKH A;  2Q2T A;  3FP9 A;  3S1N H;  5JVG 3;  4HIK A;  4B3R L;  2XWJ B;  3OPO A;  4YHH L;  1TQO A;  4LMQ D;  1E1O A;  1NE3 A;  2JQO A;  1QJO A;  3MC0 B;  4PQX A;  1XMQ Q;  3PIP A;  4OWW B;  2B2V C;  4MIU A;  4RGM A;  1NJI C;  1Y1W B;  4PZ6 A;  5AFW A;  4A3D B;  3BZC A;  3CQZ B;  1KXL A;  2E2I B;  1HPC A;  4KTA A;  5CR3 A;  5C4J B;  3FVQ A;  1TII D;  2Z1C A;  4OL7 A;  5M5Y H;  1Q1E A;  5G3L F;  1HFG A;  3ULL A;  1GHK A;  1LT6 D;  2E75 C;  4F88 A;  5CBE E;  2NUC A;  2Z9H A;  1JQY D;  2XRQ D;  4K5V A;  2OF1 A;  4R4C A;  1ZYR D;  2JA5 H;  4ULL A;  5JPN C;  2UU9 Q;  1F2L A;  1O7Y A;  1X3G A;  1LTB D;  4JI6 Q;  1PH6 A;  3S24 A;  5JEA H;  1K8A C;  2R92 G;  4LFA Q;  2QIL A;  2OWO A;  1VQG A;  4GZY C;  1HFN A;  3PUW A;  5M3M H;  4YWL A;  1B50 A;  3U9O A;  4N8X 1;  1HZB A;  1PH3 A;  3HRZ C;  4EQO A;  1JE4 A;  1WTW A;  5C44 B;  4RKL A;  2DNC A;  2YV5 A;  3CCS A;  3D6C A;  2A74 C;  3K7A B;  2B39 A;  3I73 A;  1U4M A;  3FKI H;  1E2V A;  2ATW A;  1BCP F;  1BF4 A;  3WOE A;  3R2T A;  1CZW A;  2OXP A;  3GTJ B;  1RD9 D;  3SE0 A;  4HCS A;  3GTM B;  4JC0 A;  5C4J H;  1JWU D;  5C44 G;  1SJH D;  4E6I A;  4A3J B;  3S1R H;  1WTH A;  3CKI B;  3RMH A;  1GD7 A;  4GNX A;  5M5W B;  1D5X C;  4DAP A;  2K5V A;  1A8V A;  3J80 i;  1NSN S;  4IOC A;  2P5Z X;  2NN6 I;  2RDG A;  4CDC C;  1LT4 D;  3Q0A A;  2RCN A;  4GN5 A;  4JI6 L;  4X66 L;  5EKK A;  1LM0 A;  2QF7 A;  1VQA A;  4WFN 3;  3MEF A;  4DPG A;  3MXN B;  4YIJ A;  4XQJ A;  1LTI D;  1Q46 A;  4C3I B;  2UUB Q;  1LTT D;  5IGE A;  2PMZ E;  3A5U A;  3HZX A;  4DU9 A;  3PGZ A;  3TRE A;  1AZQ A;  4IOA A;  5JJI A;  4JI5 L;  3CPW A;  1Q3L A;  4I7Z C;  4C3J G;  1N34 Q;  2F4I A;  2I5L X;  5M3M B;  5JJZ A;  3FRP B;  3M7N A;  1NTG A;  2JA7 G;  5HGT A;  4L5R C;  5C6A A;  2I5H A;  1GKH A;  1BOS A;  1VQI A;  5J1Z A;  1I4X A;  1AEX A;  2A19 A;  3RR5 A;  3WOF A;  1QVF A;  4LAA A;  1QVC A;  1CKN B;  3TBI B;  2ICI A;  1GXD C;  3MAQ A;  3NEN A;  2JA6 G;  1X54 A;  1YEZ A;  2BE5 C;  4F8M A;  1FNU A;  4A3F G;  3KBX A;  1CUK A;  2K7V A;  3HGB A;  4GOP A;  5CV6 A;  1VQ4 A;  4K2K A;  3OTO Q;  3U4Z A;  1ILQ A;  3NBI A;  1JJ2 A;  4A3C G;  3F1Z A;  4KHV A;  4LF6 L;  5IGB A;  2WB1 E;  1ASZ A;  4LUZ A;  3HOW G;  1EYG A;  1DZ1 A;  4IUQ A;  1C9O A;  1XTD A;  4NB3 A;  4G4K A;  2PQA A;  2VB3 X;  2KA7 A;  1CKO A;  5COY A;  2OT2 A;  2WP8 J;  4A3B H;  3I4N H;  2IJ0 A;  1RJT A;  2ES2 A;  1NMF A;  1IBL L;  4KY6 A;  2L12 A;  3Q8D A;  4ZAI A;  2B2U C;  3HOZ G;  4P73 A;  4EX5 A;  3CCJ A;  2HDL A;  5IGC A;  4HN7 A;  4CDE C;  1STH A;  4N8F A;  4B08 A;  1HNX Q;  2VXW A;  4GNX C;  2JN4 A;  3MZ5 A;  3H0G B;  1PMR A;  4CGY B;  4C3J B;  1BCP D;  2D2C C;  4BS9 A;  1O7Z A;  2JEA I;  4WJ3 M;  1K73 C;  4Y52 H;  4HIM A;  4DV4 Q;  3JAM E;  1B44 D;  2IY5 B;  4A3J H;  1KDA A;  2HCI A;  3T1H L;  5ELF A;  1B1Z A;  1I6H B;  4CKC A;  1E22 A;  1UE7 A;  4DV6 L;  3HOV G;  1CZG A;  2ZT9 C;  3AFQ A;  1TT2 A;  3U58 A;  1SMY C;  4A3G B;  3PSI A;  1V1Q A;  1K9M C;  2DY7 A;  2K04 A;  1TWA B;  3MXN A;  3KJP A;  3DWP A;  2G9H D;  2D0O A;  2N3S A;  4A3D H;  2VUM B;  5EPJ A;  4A3K B;  1C0A A;  3P20 A;  4ZQ3 A;  1EY7 A;  2HCC A;  5HGQ A;  4JV5 L;  5C3E H;  4GLX A;  1KIX A;  3A8K E;  3SGI A;  1U4R A;  3VA7 A;  1A2U A;  1VF5 C;  3IAY A;  1SSO A;  4NKL A;  3OW7 A; 
#chains in the Genus database with same CATH homology
 2FHT A;  1AFP A;  4IAL A;  2Z4I A;  2AQ2 B;  3J7A V;  1OXT A;  4KMU C;  2AQ1 B;  3R3O A;  2KEE A;  2F0S A;  1SNQ A;  2OEO A;  1G91 A;  1J8I A;  1BNZ A;  4G7H C;  3D3R A;  4Z9C B;  1DM0 B;  4FNF A;  5T1I A;  3U9S A;  2PO4 A;  4L8J A;  4EQP A;  4WJW A;  1XYI A;  2E76 C;  2B8F A;  3IKJ A;  3ONA B;  1TY2 A;  3J81 L;  3FDT A;  5BN4 A;  2F0O A;  1I4H A;  4UDU C;  3S17 B;  1I4R A;  3KF8 A;  2F1M A;  3SK8 A;  1JC7 A;  4BA2 I;  3EJI A;  2K03 A;  5IGG A;  1RDP D;  1QCB D;  4HCE A;  3M4O B;  1NR2 A;  5C3X A;  5M5Y B;  1CM9 A;  1VMC A;  4Y7N B;  2VB2 X;  3HOY B;  1E0B A;  3J7A F;  1Q1B A;  3I8Z A;  2WV6 D;  2A69 C;  2ENB A;  4BWG B;  3MWY W;  5E1F A;  2RBM A;  5FO9 B;  1H9R A;  1STA A;  2MUY A;  2L4N A;  1HUM A;  2LKV A;  2XSC A;  3NQT A;  4KN4 C;  2HQE A;  4J1M A;  5G3L D;  4HMI A;  1IYU A;  2RSO A;  1YNN C;  4QMG A;  2BA1 A;  2PZT A;  4KN7 C;  1ZEQ X;  1SYF A;  1HQR D;  1SXT A;  1BR9 A;  2XVS A;  4CJ0 B;  2NVY B;  3SEB A;  1CI3 M;  1EY9 A;  4BA1 I;  4H0L C;  4QUF A;  1X3P A;  2PW7 A;  3BG3 A;  4G7Z C;  3KBG A;  2NVT B;  3GTG B;  1Y1V B;  1A6X A;  2AWO A;  1SBB B;  2NB0 A;  1F2M A;  3MFY A;  1PRT F;  2F0G A;  2Q8I B;  1BCP C;  3BVG A;  2O4X A;  4C3I G;  2A68 C;  4HMJ A;  4K2L A;  5C0X I;  3CHB D;  1JOQ A;  3AMU A;  1J9O A;  3VYU A;  1W6K A;  2L55 A;  3I91 A;  3V96 A;  2EYP A;  2O5I C;  3S2H B;  1ENF A;  2ZXP A;  3H91 A;  5FLX L;  4R8N A;  3LWU A;  3MHB A;  3K0Y A;  3TP7 A;  3TME A;  3VR4 A;  5CV8 A;  1EEF D;  5M5X B;  3HOX B;  1DXM A;  4RCN A;  4ZK9 B;  1GUT A;  2F0I A;  3DEP A;  5IGF A;  2ICE C;  1VF7 A;  2WKD A;  1YNJ C;  2Z8L A;  4QUC A;  1EWH A;  3D6W A;  3C1F A;  2EJG C;  1OXS C;  2B63 B;  1TY0 A;  2PNR C;  5KGU A;  3H09 A;  1LV9 A;  1AZP A;  1I4P A;  2R3Z A;  2X69 A;  5IOC A;  1EYC A;  5C0X G;  2A6H C;  1HUN A;  4IFD I;  1CFM A;  4XXE A;  5D14 A;  5C4X B;  1PXU A;  3I4M B;  2F0K A;  3ERQ A;  3OWF A;  1MSG A;  1KAB A;  3K6O A;  3TDQ A;  1RHP A;  1DOM A;  3QG1 A;  1EY8 A;  2K01 A;  1SE3 A;  4OHJ A;  4QIW B;  4BY1 B;  2YYZ A;  2H1E A;  2WAC A;  3GV3 A;  5A35 A;  1SE2 A;  2F0L A;  4ZUJ A;  2F0T A;  1ZKO A;  5KRU A;  1EWC A;  3E5S A;  4ME5 A;  1ENA A;  1ZYR C;  1SE4 A;  1RTO A;  1WTO A;  1TWG B;  3BDL A;  3SK4 A;  4HSP A;  1B9M A;  1EZ6 A;  3H3V C;  5JAV A;  2F0U A;  5E3F A;  3K5L A;  2FFK B;  2FIN B;  2RSN A;  4RHS A;  1F2Z A;  1OXX K;  4PMW A;  2F0M A;  4NMZ A;  1ROD A;  3CRL C;  2EY1 A;  3R8B A;  1FD7 D;  1R4P B;  2A6E C;  2EY5 A;  1RKN A;  2PW5 A;  1YNJ D;  4DF7 A;  5KYI A;  3GV6 A;  5CV9 A;  4RWS C;  3SDZ A;  1JCK B;  1WD0 A;  2B2U A;  2NN6 H;  1A3V A;  3K58 A;  1GUG A;  3Q22 A;  5EJW A;  3A8J E;  3X3M A;  1TWH B;  2NN6 G;  2I46 A;  3MXP A;  4MN3 A;  2BDO A;  3T4A C;  2N88 A;  1AP0 A;  4NDX A;  2SEB D;  2JSO A;  1G2S A;  5EPK A;  1F9P A;  3RLF A;  4CKE A;  1HRJ A;  5FOB B;  3OHX C;  2NWG A;  1Z7T A;  3GO5 A;  4FVM A;  4C1N I;  1KDC A;  1JOR A;  3I72 A;  3NWS A;  2PZW A;  3QWN A;  1LTR D;  1ENC A;  5CYU A;  3P1H A;  4ZRZ A;  3ND8 A;  3UI2 A;  1EQV A;  3GQB A;  1S5F D;  3OIQ A;  1TR5 A;  3GP7 A;  1PFM A;  3NE5 B;  4ID6 A;  2L5T A;  3T51 B;  3TP8 A;  5DAU A;  1TVX A;  2KUM A;  1TS2 A;  2AQ3 B;  2EYJ A;  4IN3 A;  3Q24 A;  4ZKB B;  4K6D A;  4C3H G;  5FO7 B;  2KEC A;  3BDO A;  3SXH A;  3L7Z C;  4X3T A;  2EPB A;  2XIW A;  1HCZ A;  1SFO B;  1U9R A;  1H9K A;  1FNW A;  1NAP A;  3AU7 A;  5FO8 B;  1CT1 D;  1V1P A;  3LNN A;  3TN2 A;  2B2V A;  2VNU D;  2A69 D;  3VYT A;  3D4W A;  4EGV A;  1DYQ A;  1EYA A;  4X3K A;  3NWT A;  3PUX A;  3GTO B;  3TP5 A;  1EY5 A;  1EU4 A;  3MFG A;  4NP5 A;  3K57 A;  5KND A;  1H9M A;  3PUY A;  4M1U B;  3BDC A;  2IL8 A;  2F0W A;  1PRT D;  5DM6 3;  4OIJ A;  3T53 B;  1DD2 A;  1SJE D;  1LTS D;  2M9V A;  3N6R A;  1I6V C;  5CBA E;  4DAY A;  4C2M B;  3M7G A;  3KLR A;  1EOT A;  2DNE A;  3T13 A;  3N52 A;  3HOW B;  5A2Q E;  4TSS A;  3K59 A;  1H9J A;  1NR4 A;  4V0B A;  1H9S A;  3MEH A;  5C5M A;  4K6L A;  3AB9 A;  3L3O C;  1GOZ A;  1PTO B;  3PO2 B;  3PIO 3;  2EVB A;  4KKU A;  3D4R A;  5KNC A;  3GTL B;  4BBS B;  1EFI D;  5J22 A;  4DA2 A;  4KD3 A;  1NUC A;  1SNO A;  4KHZ A;  1E2Z A;  1S5D D;  4NW2 A;  3EA6 A;  3V05 A;  1GUO A;  2K1B A;  2I07 B;  4XQQ A;  3D8G A;  4IUP A;  1QE6 A;  1Z6H A;  1IW7 C;  3K5O A;  4RGT A;  1XXG A;  2LY7 A;  1GUN A;  2DY8 A;  1RCV D;  5IOD A;  2A6E D;  1IYV A;  3P75 A;  1X3Q A;  1LO5 D;  3S1Q B;  2D62 A;  1SNM A;  1TS5 A;  4OO1 H;  1M4V A;  1Y8N B;  2B2Y C;  2ZXR A;  3CRK C;  2YU9 B;  5JOB A;  1QIL A;  1WCM B;  5K5P A;  3L9A X;  3H6M A;  4DXF A;  1Y8P B;  1V1P B;  3OMG A;  1XX8 A;  2QCP X;  4S3S A;  1I50 B;  1UNS A;  1PTO F;  2MHV A;  5JPM C;  3QOL A;  4IUN A;  4CJ1 B;  3GD7 A;  3S16 B;  3SK5 A;  4ILW A;  2E2H B;  3MXG A;  2EYO A;  1EZ8 A;  3TP6 A;  1SYG A;  1U4L A;  1T5E A;  1U4P A;  2BE5 D;  3G7L A;  4H44 C;  3C1E A;  1IL8 A;  2KCN A;  2LMC B;  4A3F B;  4DAV A;  2QDB A;  4PMB A;  2JA6 B;  3GTK B;  2RDH A;  1PZI D;  3BYT B;  4KI0 A;  5JEA G;  4IUU A;  2EZV A;  1D5M C;  4K5X A;  1UAP A;  1D6E C;  2JA7 B;  4U67 3;  3NTI A;  5LL6 X;  1EYD A;  3I70 A;  4IQZ A;  1EL0 A;  1F9Q A;  4N9T A;  3IL8 A;  5BN3 A;  5JVH 3;  1PDQ A;  3O13 A;  5C4Z A;  4XTC S;  3CU7 A;  1ML0 D;  5DNF A;  5ELC A;  1F9S A;  3X3N A;  1PZK D;  2RKS A;  3OMC A;  1C4Q A;  3M85 A;  3KUP A;  4PMC A;  3PUZ A;  1V43 A;  4QF4 A;  3QO2 A;  5E4X A;  5KIX A;  4IFD G;  1FGB D;  2F0J A;  1F9R A;  4OIK A;  2L9H A;  1CHQ D;  2K28 A;  5FKA C;  2CW0 C;  2BOS A;  4EVO A;  1SNC A;  5D65 A;  4ZLT F;  2X6G A;  4XIG S;  5C3W A;  1JOK A;  2JA5 B;  4A3B B;  1BCP B;  3M3Y B;  2B8G A;  4IUR A;  2R7Z B;  1S4Z A;  3FKI B;  2EOT A;  1LAB A;  2Q8R E;  1STB A;  5K36 G;  4XT1 B;  1SEB D;  1WVL A;  2EYH A;  1SYD A;  3QIA A;  5K36 H;  4ZUI A;  1NCV A;  2F0D A;  2NBF A;  4RGN A;  4RCO A;  5J39 A;  2L11 A;  2C9O A;  1E2W A;  3GTQ B;  2NVX B;  1WTQ A;  4K8I A;  2R93 B;  2B2T C;  4LJZ C;  4CHT B;  2NTS A;  1SNP A;  4XYQ A;  3MTS A;  3J80 L;  5C0X H;  1DOL A;  1H9S B;  1HTL D;  5CV5 A;  5I2Y A;  2RA4 A;  1QB5 D;  2H4O A;  4RGO S;  1IKM A;  3OWE B;  1TS3 A;  1YNN D;  1HQM C;  5C5L A;  3WDN A;  1KNA A;  1PYW D;  1X32 A;  1A2T A;  3EVQ A;  1JR0 D;  3J81 E;  2K05 A;  2IX3 A;  2CW0 D;  2Z4H A;  2D9U A;  4X3S A;  4EQN A;  4A3I B;  4Q0F A;  2KED A;  3NBH A;  5LL6 S;  1JIC A;  1V1O A;  3SR1 A;  1ONL A;  2IX0 A;  4CJ2 C;  1EEI D;  1SYC A;  1QNK A;  2KHS A;  1LLR D;  3DHQ A;  2F0F A;  1GUW A;  2X6L A;  2KQ3 A;  3KLS A;  1A3U A;  4FP5 D;  1Y8O B;  4ZKC B;  4FYD A;  3KLS X;  2E74 C;  5CV7 A;  1WD1 A;  2EYF A;  2CHB D;  4IFD J;  4Q5V A;  1L0Y B;  4IUT A;  1EY0 A;  1DJR D;  3PMF A;  4IUV A;  1TS4 A;  4IZ8 A;  2NYZ D;  5FK9 C;  1BXT A;  3RD4 A;  3D4D A;  4KV6 A;  2A73 B;  2EYL A;  4ZYS A;  2WAQ B;  2NTT A;  4X3U A;  4A3E B;  1S5E D;  4PV1 C;  3FPU B;  3I4L A;  1IKL A;  3TZD A;  3EQL C;  5DM7 3;  4DK0 A;  1O7L A;  4DNT B;  1D2B A;  4AYB B;  3QOJ A;  1IW7 D;  4DGZ A;  4BBR B;  1QG7 A;  2A68 D;  1Y69 U;  3A54 A;  3I3C A;  3J80 E;  5D3I B;  1PRT B;  3NUC A;  5E4W C;  5M3F B;  1BO0 A;  5IIF A;  4OGQ C;  2RVL A;  3A8I E;  1XWE A;  4OO1 I;  4F7X A;  1WTR A;  1TWC B;  5EBC A;  3ERO A;  5ELB A;  2ZXO A;  4DK1 A;  4R9W A;  1C48 A;  1CQF A;  1PTO H;  3NQI A;  2LFN A;  1S5C D;  5LHY 1;  1B53 A;  1STG A;  4TRD A;  2R61 A;  3S1N B;  2K6A A;  2WKC A;  2EJF C;  3SK6 A;  5C4H A;  1HTP A;  1ILP A;  2B2W A;  2XN9 C;  4KY5 A;  2F0P A;  1ICW A;  3KK7 A;  4G57 A;  1QNU A;  2GA4 B;  1I4Q A;  4RA8 A;  1ESR A;  1G8Z D;  1EY6 A;  4V19 0;  3SVM A;  1MD2 D;  3W2D A;  1QOH A;  3DEO A;  1OXU A;  3A56 A;  1AN8 A;  3OOC A;  2MPM A;  3K5M A;  2JP1 A;  1GUS A;  4CBV A;  4FF3 A;  4FXK C;  3NP8 A;  4O42 A;  2IT1 A;  4KD4 A;  2JYO A;  5CV4 A;  1KLU D;  3K5N A;  3IFD A;  5CC4 A;  3HEJ A;  3D31 A;  3RZO B;  4PNY A;  2PCF B;  1G2T A;  4FF2 A;  1KLG D;  1PZJ D;  2K5W A;  5IT9 E;  1OXV A;  5FLX E;  4BY7 B;  4K8J A;  3NPP A;  3S2D B;  3VYR A;  3PUV A;  1EIG A;  5C3E B;  1B9N A;  2DN8 A;  1T5X D;  3E6Z X;  2XRS D;  2SNS A;  3C3L A;  3S1M B;  4K14 A;  1PFB A;  2E2J B;  2R6G A;  1D1I A;  5M9O A;  1JWM D;  2AUJ D;  1JB3 A;  3LX0 A;  4XQN A;  2K5Q A;  4B9X A;  2E2D C;  3DUZ A;  1SDF A;  1SND A;  4HSV A;  3F2U A;  4KJO A;  4HTH A;  2O2L D;  1JWS D;  2L1B A;  5ELE A;  1K83 B;  1LAC A;  1VDZ A;  4RFB A;  1CK1 A;  3BS1 A;  1CA6 A;  1C8C A;  2ID0 A;  3Q6S A;  3OSO A;  1EU3 A;  1K8O A;  4H7B A;  3T56 B;  2IWH A;  1VMP A;  1D5Z C;  2F3W A;  1UUP A;  1EQT A;  5C0X J;  1WTP A;  2FMC A;  3OIP A;  3BVM A;  1Z47 A;  1F77 A;  2K33 A;  4M8A A;  4O1N A;  1O78 A;  4XYO A;  1TU2 B;  2RQX A;  2MP1 A;  3EFX D;  1B2T A;  2NZ1 D;  5ELD A;  2KJX A;  3W3A A;  3S14 B;  2PQE A;  1G29 1;  3DWA A;  4IFD H;  3ZYY X;  4FO2 A;  4ABN A;  1A3T A;  2JE6 I;  2JA8 B;  5ISR A;  2EJM A;  1BQQ T;  1CHP D;  1SAP A;  3VR2 A;  3PV0 A;  2Q8T A;  2WII B;  5KEE A;  3C46 A;  3DM1 A;  4HR7 B;  1OO9 B;  2B2T A;  1KNE A;  1STN A;  1HA6 A;  3ITP A;  4DFA A;  5I9O A;  5I6Y A;  4FF4 A;  2KCC A;  1ESF A;  2TSS A;  5EQ0 A;  2J0T D;  3PO3 B;  1CTM A;  4QB4 A;  1G6Z A;  5F2D A;  3A55 A;  1M8A A;  3I4N B;  5EPL A;  4FF1 A;  5TSS A;  1QWY A;  3TSS A;  1GJX A;  1RTN A;  1R9T B;  1SYE A;  4B9W A;  2F0N A;  4WRD A;  5COR A;  5T1G A;  4QCL A;  1PFN A;  1LTG D;  1F2Y A;  2QKI C;  3BVZ A;  3A7L A;  2RDF A;  3TZU A;  4ODG A;  3RUZ A;  2NVQ B;  4K5W A;  1PLF A;  1RF2 D;  2K32 A;  2A6H D;  1I4G A;  4FXD A;  1ET9 A;  2BDN A;  1TWF B;  1TKW B;  2F0V A;  1Q90 A;  4DN4 M;  3S9W A;  1W6J A;  2F3V A;  3VA5 A;  3MVV A;  3M4Y A;  3H94 A;  4UAI A;  3MXU A;  1Q12 A;  1JOO A;  2M2L A;  3NXW A;  1I3Q B;  2KOL A;  2J7Z A;  2J4X A;  1KDB A;  3S1R B;  1Q8I A;  3BZD B;  2FMM A;  3GTP B;  3C2P A;  5I4D A;  5HUR A;  2G9D A;  2MJ8 A;  4LK1 C;  4I65 A;  2PPB C;  4TQU S;  5I6W A;  1MI2 A;  4MHE A;  3SHL A;  4RH6 A;  5NUC A;  3S15 B;  2KVM A;  1BUV T;  3J7Y W;  4P2C B;  1S5B D;  4KKS A;  4DXG A;  2SNM A;  3NTK A;  1PRT C;  4A93 B;  1IHZ A;  3NHH A;  2L0C A;  5DEH A;  5CGK A;  2N55 A;  4J8Q A;  1STY A;  4G7O C;  1VCI A;  3I90 A;  1HHV A;  1MGS A;  3R2I A;  3HKZ B;  3MA2 B;  2IX1 A;  5I9P A;  3V2T A;  2FJ2 A;  3FPP A;  3HG9 A;  1CA5 A;  3BYY B;  3DXJ C;  3FEW X;  4A3M B;  3HOZ B;  3T16 A;  4FXG C;  4CKB A;  1O80 A;  1BDO A;  1WTV A;  4RKB A;  2EYM A;  3VYS A;  1K8M A;  3QB3 A;  1MSH A;  2XWB B;  3HOU B;  3VR5 A;  1ET6 A;  4KK7 A;  3URY A;  2SDF A;  1FNV A;  2EXZ A;  1AW7 A;  4RHR A;  2AWN A;  1II3 A;  2TMP A;  3ND9 A;  3G6J B;  2PMZ B;  4RAU C;  4JBW A;  4U68 A;  2F0Q A;  1FR3 A;  3VR3 A;  2WIN B;  2XNA C;  3JAM L;  1STE A;  1B4O A;  1L0X B;  3NK9 A;  5CMD A;  2PZU A;  1MBY A;  2IW3 A;  3R93 A;  1WTX A;  1KTK A;  1CQV A;  2CQA A;  1EY4 A;  5A2Q L;  3HS0 C;  4OO1 G;  2EE1 A;  2HUG A;  1PTO C;  1LTA D;  2EY6 A;  2B2W C;  3DMU A;  4C56 C;  2Y0S B;  5KYL A;  1LT5 D;  4L63 B;  3IFT A;  2M00 A;  2B2Y A;  2AUK A;  3HP3 A;  1GHJ A;  5BN5 A;  5I2X A;  2C5C A;  2IPK D;  3NTH A;  4J6H A;  4WOR A;  2F03 A;  4DNR B;  4C3H B;  4H13 C;  5EBD A;  2QEJ C;  2BA0 A;  1DCZ A;  1BBX C;  4KKT A;  4R8I A;  5IT9 L;  2JXM B;  1XTC D;  3DWQ A;  3NSW A;  5JEA J;  5D3D A;  2LS0 1;  5EKL A;  1PTO D;  4XDX A;  4JK1 C;  5IGD A;  3RZD B;  5EKI A;  3E0J A;  3PIP 3;  2A5H A;  3Q23 A;  3HOV B;  2R92 B;  1KAA A;  2BCO A;  4KJN A;  1EIH A;  1ZXT A;  1HA5 A;  2F0H A;  4XT3 B;  3P7J A;  1D1K A;  3QJY A;  4HAE A;  2HDM A;  4KY7 A;  2PYK A;  2V4D A;  1FYC A;  2D5D A;  2EY2 A;  3VR6 A;  2SOB A;  2O5J C;  3FMC A;  2JEB I;  1V8Q A;  2MGS A;  4N9P A;  3LWE A;  4C1N K;  1R4Q B;  1SMY D;  4TKO B;  1UEA B;  2F0E A;  4HED A;  5EGT A;  2WB1 B;  1DON A;  1SYB A;  2K5D A;  4F87 A;  1HXY D;  2CVR A;  4L6T B;  2EDG A;  1B3A A;  5KNB A;  1A15 A;  1DOK A;  1LT3 D;  3A7A B;  5JVG 3;  2XWJ B;  3OPO A;  1TQO A;  4LMQ D;  1QJO A;  3MC0 B;  4PQX A;  2B2V C;  4MIU A;  4RGM A;  1Y1W B;  5AFW A;  4A3D B;  3CQZ B;  2E2I B;  1HPC A;  4KTA A;  5CR3 A;  5C4J B;  3FVQ A;  1TII D;  2Z1C A;  4OL7 A;  1Q1E A;  5G3L F;  1HFG A;  1GHK A;  1LT6 D;  2E75 C;  4F88 A;  5CBE E;  2NUC A;  1JQY D;  2XRQ D;  4K5V A;  2OF1 A;  1ZYR D;  4ULL A;  5JPN C;  1F2L A;  1O7Y A;  1LTB D;  5JEA H;  2QIL A;  4GZY C;  1HFN A;  3PUW A;  1B50 A;  3U9O A;  3HRZ C;  4EQO A;  1JE4 A;  1WTW A;  5C44 B;  4RKL A;  2DNC A;  3D6C A;  2A74 C;  3K7A B;  2B39 A;  3I73 A;  1U4M A;  1E2V A;  1BF4 A;  1BCP F;  3WOE A;  3R2T A;  1CZW A;  2OXP A;  3GTJ B;  1RD9 D;  3SE0 A;  4HCS A;  3GTM B;  1JWU D;  1SJH D;  4E6I A;  4A3J B;  3CKI B;  3RMH A;  5M5W B;  1D5X C;  4DAP A;  1NSN S;  2NN6 I;  2RDG A;  1LT4 D;  3Q0A A;  5EKK A;  2QF7 A;  4WFN 3;  4YIJ A;  4XQJ A;  1LTI D;  4C3I B;  1LTT D;  5IGE A;  3HZX A;  4DU9 A;  1AZQ A;  1Q3L A;  4I7Z C;  4C3J G;  2F4I A;  5M3M B;  5JJZ A;  3FRP B;  3M7N A;  5HGT A;  5C6A A;  1BOS A;  5J1Z A;  1I4X A;  1AEX A;  3WOF A;  4LAA A;  3TBI B;  2ICI A;  1GXD C;  3MAQ A;  2BE5 C;  4F8M A;  1FNU A;  3KBX A;  2K7V A;  3HGB A;  5CV6 A;  4K2K A;  1ILQ A;  3NBI A;  4KHV A;  5IGB A;  1DZ1 A;  4IUQ A;  4G4K A;  2VB3 X;  2KA7 A;  5COY A;  2OT2 A;  2WP8 J;  2IJ0 A;  1RJT A;  4KY6 A;  2L12 A;  4ZAI A;  2B2U C;  2HDL A;  5IGC A;  4HN7 A;  1STH A;  4B08 A;  2VXW A;  3MZ5 A;  3H0G B;  1PMR A;  4CGY B;  4C3J B;  1BCP D;  2D2C C;  4BS9 A;  1O7Z A;  2JEA I;  3JAM E;  1B44 D;  1KDA A;  2HCI A;  5ELF A;  1B1Z A;  1I6H B;  4CKC A;  1CZG A;  2ZT9 C;  1TT2 A;  1SMY C;  4A3G B;  2DY7 A;  2K04 A;  1TWA B;  3MXN A;  3DWP A;  2G9H D;  2VUM B;  5EPJ A;  4A3K B;  3P20 A;  4ZQ3 A;  1EY7 A;  2HCC A;  3A8K E;  1U4R A;  3VA7 A;  1A2U A;  1VF5 C;  3IAY A;  1SSO A;  4NKL A;  3OW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...