5K5RA

Aspa-32mer dna,crystal form 2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
89
structure length
89
Chain Sequence
b'STDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AspA
publication title Structures of archaeal DNA segregation machinery reveal bacterial and eukaryotic linkages.
pubmed doi rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Transcription/dna
total genus 26
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5k5rA00
1R23A 2MD5A 5E1ZB 3FM5A 1KU3A 2K4BA 5DDGA 1I5ZA 5HLHA 1FNNA 4LB5A 3HSFA 1WWXA 2VC1A 4MEYF 4M71A 4FX0A 2CYYA 1QNTA 1J7KA 3TOBA 5TRDA 4WXDA 1U3EM 1FYMA 4QWQA 3F8NA 3EETA 2MC3A 1Z7UA 1QQIA 2F5DA 5ILSA 1CGPA 4GCVA 3WTWC 4WX9A 2ZMEA 2O8XA 2E7WA 3JAMK 1Z6TA 3L9FA 1HKSA 2DAOA 3VEPA 2ZMEB 1T39A 1HW2A 3J7AO 3N97A 3ZN1A 1ZYRF 3LFKA 2JT1A 4M6YA 1BC7C 2PLYA 3E3VA 4JBAA 4ZH4F 2V1DA 4I7HA 3HHGA 3SZPA 2H94A 3N4MA 3EUHA 2FOKA 2W57A 2COMA 2RGVA 1HW1A 1KU9A 4Q48A 4EM0B 2NNNA 1EH6A 3O3KA 3ZN0A 1GXPA 2FMLA 1K78B 3BPXA 4L9TA 2YPRA 2L4MA 2MLKA 2H6CA 3F6OA 3GVAA 1FY7A 2KKOA 6PAXA 3E6CC 2D2WA 4PDKA 2PQ8A 2VOOA 2L3DA 1BJAA 4I02A 1SMTA 4WF2A 5E17F 4P55A 1KU7A 2DTRA 2QBYA 5HDNA 3W6KB 5JHUA 2XROA 3J81Z 1FYLA 2O61A 2QBYB 4Q4ZF 2OU2A 1UCRA 3HUGA 3I64A 3LAJA 1BOAA 2IJLA 4L9NA 1GVJA 2QQBA 5LEKA 2QZ8A 3MAJA 5AONA 3KE2A 1C0WA 5HS8A 2DBBA 3ECOA 5A2QZ 4HX8A 2EV6A 2DU9A 4RGXA 1XN7A 2L02A 2VBWA 3GZ5A 3TO7A 3BZ6A 3K69A 2RKHA 4YG2F 1DP7P 2EJRA 5FFZA 2ZO4A 3TO9A 1HXDA 1XGNA 3RYRA 2A69F 1TW2A 1KYZA 2VONA 4HQMA 3JSPA 2LKPA 1P6RA 3FXQA 4PGHA 4ETSA 3D0SA 1FPQA 1J0RA 1LB2A 4AIHA 1AOYA 3CDHA 3JTGA 1USSA 2M30A 2QENA 4G6DA 1FC3A 3FHZA 2B0LA 1J2XA 3ML6A 2XHKA 1ZHFA 1YS6A 3GEZA 1DPUA 1Z05A 1L0OC 1O57A 1ZLKA 1YO5C 4I2OA 1HSTA 1YFHA 2P7VB 1BM9A 2UXXA 3SFZA 4L0ZB 3TDUC 4IVNA 5ICGA 1IAWA 3BJOA 1J75A 5D4SA 1T38A 2Q8KA 2CSOA 4AVPA 2IA2A 2X4HA 1HSJA 1ZRFA 3H3UA 5LLQA 4KIFA 4NHJA 4M73A 3V8LA 5L3EA 1XDSA 3FX3A 3RKXA 4KMFA 4H0EA 1ZREA 1R22A 1E2XA 3CUQC 3MCZA 4N0BA 5HOOA 4M9ZA 3IWZA 1ON2A 2H09A 2LF8A 3I53A 2F2EA 5LRSA 3T8RA 1OKRA 3O6BB 3SZTA 5JFRA 5BOXA 3E5UA 2A07F 2O6GE 1SD5A 2UWMA 4NQWA 4HOBA 2TDXA 1J59A 4A0ZA 5JI6A 2WV0A 1QBJA 1O7FA 2OA4A 4BHBA 3QP5A 5LGTA 2ADUA 3OOPA 3F8CA 2O3FA 1REPC 1W7PA 1KGSA 3P9KA 1IN7A 2M5WA 3V4GA 3D5LA 3NQOA 3J80K 4ZYEA 4I09A 2K4JA 4S04A 3EYIA 3GXOA 2J5OA 3HOSA 1USTA 4PCQA 4LK1F 2HTSA 3U2RA 3DKWA 5DD4A 5BQTA 3ROUA 1R1UA 4A0XA 3GYHX 4EV0A 1B9MA 2KRFA 2O0YA 1WRJA 1MKMA 4EJTA 4K2EA 1XSDA 3MEXA 2FU4A 2P7CB 4OINF 4IHSA 4G7HF 5F64A 1BBYA 1TNTA 2NAZA 3WODF 3HYIA 2XAFA 4KICA 4G94A 2VT3A 1SD4A 2CWEA 2E1CA 3E97A 2R3SA 1A04A 3KP5A 2QUFA 2IRFG 4LLGF 3HTUA 1S7AA 4HF1A 3KP3A 5H20A 4EGZA 3RTRA 3KEQA 1WKMA 1OMIA 4O3MA 2OZ6A 2W25A 5DCFA 5EEHA 5CVUA 2ISZA 1R5HA 3R6SA 4YFKF 3KFWX 4OOIA 1F1ZA 1BIBA 1MJBA 2EA4A 3C3WA 4XSZF 1T2KA 5TJJA 1VTNC 4CYDA 2FXAA 3KLOA 3IKVA 2HKOA 4A0YA 1ON1A 3KP7A 1MJ9A 3ZMZA 4A6EA 1FP2A 1RUNA 2WTEA 1P4XA 3GW2A 1TQMA 1U6GA 2CO5A 3LWFA 4KIGA 5CVIA 4P9FA 4BHCA 1B6AA 4HX7A 4B8XA 3P9CA 4WXHA 3M8EA 1YW7A 3WU0A 2UZKA 3ZMTA 3JW4A 3CO7C 3P9IA 2XRNA 1UB9A 4ZYDA 2DQRA 2YSRA 5FLXK 4KUMA 1O3RA 2XKOA 3FMRA 1ZGAA 3IWFA 5D6EA 3U1DA 4RAYA 3V8JA 4RGUA 3I54A 2J5PA 3ZMSA 1FLIA 4N9HA 3DPLC 3GFJA 1R36A 4BYYA 2BBYA 3DPTA 4NB5A 5DYMA 1R1TA 1G3TA 3V7SA 5BS6A 2XAGA 5K5RA 4OIRF 1TQIA 4L0YB 4XSXF 4MNUA 3MFKA 1XCVA 4HF0A 3VODA 2MLGA 2ZBKA 2YX7A 3BDDA 4HDVA 1V4RA 4S05A 2FMYA 2IP2A 2Y48A 2NYXA 2P6TA 5BPDA 5H6QA 4LD5A 1YG2A 2FRHA 1R7JA 1RNLA 1J5YA 3CUOA 3QOPA 2ESNA 5JR3A 2DPDA 2DK8A 4M74A 5CVRA 4IRGA 2GA1A 1O3QA 5JVTA 2VC0A 1Q1HA 5FO5A 5LHIA 4RB1A 2EFQA 3WTVC 4CHUA 3DV8A 3GZ6A 4IRIA 3SQNA 4U7BA 5AIPA 3BROA 5FLXZ 1S6LA 3ZP5A 1R5GA 4YIFA 3J81K 3BJAA 3I4PA 4CDGA 2RC4A 4YIIA 4G7ZF 2D1HA 1ONVA 4PGGA 1K7AA 4CGZA 4EVIA 2V1UA 2XIGA 4HV6A 4Q47A 3PQJA 4Y13A 1UHMA 2M45A 3WTUC 3FZVA 2GZWA 4M9XA 1YW8A 3W6JB 5A2QK 2L4AA 2EFWA 4CO8A 3KZYA 4ZYHA 3QU3A 5ILUA 2OAZA 2ETHA 2HDCA 4OMZA 1HKQA 3KETA 4YFNF 3I5UA 1D5VA 2LDUA 4CICA 3IL2A 4HDUA 2LF7A 2EFPA 3IHUA 1MD0A 1G4DA 2FNPA 2ZXJA 5D5WB 4M72A 1IXRC 4HAMA 2O03A 5CLSA 5L3BA 5E8IA 4KDPA 1IN5A 2MA3A 5E20A 4MHGA 3SHFA 3TGNA 3QPHA 4JQFA 3SXYA 1STZA 4L18B 1BN5A 1ZARA 3R60A 4ENJA 2Y0MA 1YQAA 4HX4A 1TLHB 3IRRA 4FHTA 1XGSA 2IPQX 4BAYA 4ON0A 2Z3YA 5KVRA 4UNOA 2DFIA 4R8HA 3DF8A 3R61A 1ULYA 3FXUA 3VB2A 2JTVA 3RKYA 1KYWA 2V9VA 1FBQA 1X3UA 4L5JA 3LQRA 3R0AA 4ENKA 4EJWA 2D1VA 4G9YA 2M1BA 3BPVA 1FWZA 2FE3A 3RI4A 3TQNA 2A3SA 4RB3C 4RGRA 3S2WA 1B4AA 4MQVA 1T98A 4M9SA 1W4MA 1K79A 5LBQA 1KU2A 1JGSA 2HOEA 4IPAA 2ELHA 3HOTA 3BOQA 1XMAA 4I0BA 5LGNA 1GHCA 2EA2A 2P8TA 3FM3A 3PQKA 5L3FA 2FNAA 4AWXB 5HVQC 1TBXA 4A2UA 1DUXC 4UV9A 4ZZDA 1FBUA 1XB4A 1SD6A 2JSCA 2NS0A 1WQ2A 3WGIA 1PP7U 2KIFA 2RDPA 1FT9A 1R1VA 3TDZC 2BV6A 2E7XA 2A6HF 4P5OA 2HFHA 3DXJF 3CLOA 3QU6A 2PMUA 4GXOA 1G3WA 3TKYA 2CG4A 1B1BA 1RIOH 4A5MA 3F8MA 1YS7A 5HDKA 3ULQB 1G3SA 4AIKA 3K0LA 3BP8A 2FBIA 3LA2A 2XVCA 3IC7A 2K02A 2VXZA 2HEOA 1H9GA 2VBZA 3BY6A 4BNCA 1BIAA 2JZYA 4HQEA 4UHTA 1SFXA 1ZLJA 3I58A 1W7PD 3ABTA 2HTJA 4HZFA 4E70A 1OYYA 3B73A 2G9WA 5HS7A 1E17A 5LRRA 2DPUA 5ICEA 2RVCA 3COAC 3EQLF 2W84A 5KK1A 3WE2A 5ED4A 3ELKA 1W7PB 2STWA 1WI9A 3R4KA 4O6JA 2DW4A 4BH9A 4RB2C 4G6QA 4IHTA 1ODDA 3HIFA 1V3FA 2PMHA 5EEGA 3HRUA 3FMQA 2C6YA 2XGXA 5AIQA 2Q0OA 3H92A 3M1EA 2EWNA 2BEOA 1TNSA 2XASA 3KCCA 1IN8A 2E1NA 1SFUA 4KFCA 5HLIA 4I98B 4UVCA 1ZAOA 4HLXA 1OYIA 4HW0A 2PFBA 3GFIA 3GUDA 1RZ4A 4Q5SF 4EMSA 3K1PA 1KQ9A 3HHHA 4ESJA 2ISYA 3F23A 2EFNA 2F5CA 4R79A 2KJBA 5DUIA 1O3SA 3O2PE 1DDNA 2BGCA 2GAUA 1ZG5A 5LGUA 3ABUA 2JPCA 3WGGA 1PDNC 2A68F 5ICCA 4WWCA 3FWEA 3KLNA 3LSTA 5FB2A 2ZJ2A 1U78A 1JHHA 1IXSB 2YU3A 2JRTA 3FXRA 4G7OF 2GQQA 1LJ9A 2PN6A 2H6BA 1XCBA 4BHPA 4HA8A 4U0YA 2G7HA 3C1DA 2G7UA 2FEZA 3MWMA 1FZPB 1MJAA 1L3LA 1KQ0A 4R1HA 2Z5UA 1ZGJA 1BI2A 4CZZA 4LLLA 1RI7A 3WTTC 1W5TA 3Q9VA 5ERIA 2R7FA 2MBFA 1XDUA 3ZPLA 1D8KA 1B59A 3KEOA 2M87A 2HQNA 1LDDA 2Y75A 1EH7A 4EQQA 3I59A 2GXBA 2GWRA 2A6EF 4HLYA 3WG9A 3CJNA 5CYVA 3C7JA 5DUKA 2MH2A 1YTYA 3RYPA 2K27A 3KP6A 2JPBA 3JTHA 2QVOA 3LAPA 4LGWA 3AAFA 1SFEA 3RKWA 4CXFA 1TTYA 2CW0F 4GO1A 4RGSA 5FGMA 3REOA 2LSOA 2ZNZA 3BWGA 4BQAA 1FSEA 4EGYA 4TV7A 4KYWA 3GLXA 3U9GA 5CVVA 1G6NA 2QYOA 3LQQA 3VFZA 2OQGA 4N9IA 2EFOA 4HYEA 4OIQF 1B9NA 1SAXA 1HW5A 3I0TA 1P92A 2XAJA 1U2WA 4EJOA 1KQ8A 4EM2A 3CO6C 3IRQA 4ENMA 2XAQA 3RJPA 3F3XA 1ZN2A 1P2FA 3GX4X 2D45A 3M9AA 3EYYA 3WTZA 3HRMA 3WTSC 4KN4X 4JK1X 3HSRA 2FQ3A 1DPRA 3K1NA 4RS8A 3P7NA 1I1SA 4U0VA 3F72A 3L7WA 3T0YA 4U88A 5CVJA 2GXGA 4Y17A 2XUBA 2P5LC 5DV5A 2KIMA 3WU1B 3TO6A 2ZNYA 1IF1A 1YLFA 2DO7A 3F8BA 3EDPA 1LDJA 1PUEE 2L01A 4GYIA 2HYGD 3FF5A 5HLGA 1IUYA 1LVAA 2UXNA 1FBSA 3T1BA 1HBXG 2HQRA 3F6VA 4ZYGA 5DEQA 1U5TC 4GYGA 2XV4S 2ESHA 5CJ9A 4MQ9F 4PZJA 1Z6RA 3NRVA 4XLPF 1IN4A 3F8FA 2DQLA 5BPIA 2QWWA 1FSHA 1K78A 2HGCA 1I27A 2VE9A 1FP1D 3WTYC 2HS5A 5FD5A 4L5IA 1P4WA 2FBHA 1H9TA 4OIPF 5J6XA 5DD8A 2A61A 4LFUA 4A6DA 4F7ZA 1YYVA 4UVBA 2RV8A 5F6FA 2XAHA 4WK8F 5H6RA 3HRSA 2YR2A 5D5UB 1KA8A 5HS9A 3CTAA 4Y15A 1ZG1A 5D4RA 4KA4A 2FBKA 4BXUA 1TQPA 2QM3A 4KIBA 1XSXA 1O7LA 2HKXA 3K1MA 1BC8C 1IRGA 2QLZA 2V6CA 5BMZA 3M7GA 1IZ1A 4EJUA 2LNBA 2HR3A 4U0WA 3M8FA 1XMKA 3JAMZ 4P96A 2RNJA 3RDIA 1T0FA 2F5EA 2K86A 4A5NA 3MQ0A 3K2ZA 1XSVA 3LA7A 3QPTA 2VT2A 2FF4A 4ASNA 4DNCA 3RPUA 2IT0A 1T6SA 3C18A 5LHGA 3HSEA 1JHFA 2DLLA 3WTXC 2VE8A 5E18F 2V79A 5FD6A 4IRHA 5L3CA 3MZHA 1OPCA 3BJ6A 1S7OA 4EM1A 3T8TA 1LEBA 5K5QA 4ESBA 3QAHA 2K7LA 3DEUA 4OU0A 5FFXA 2BE5F 3MZYA 1H0MA 2V1XA 1U8RA 5L3GA 4LK0F 4HF2A 5ILVA 2HZTA 5E1WA 5LHHA 1D8JA 4IXAA 3ZMUA 3ERED 1K6OA 2ZFWA 1RUOA 1QPMA 4LJZF 1HKTA 4DQ2A 2X0LA 5D5VB 4KMUX 2RN7A 3V7RA 1R58A 3ECHA 2VN2A 5J8FA 1Z1DA 2EV0A 5D6FA 2KJCA 5K5OA 1J9IA 1LEAA 3LA3A 4HV5A 1LQ1A 3G3ZA 4XBFA 2DK5A 2P5VA 1OR7A 1S8NA 5ICFA 4RB0A 2IA0A 2H27A 3KP2A 1XGOA 2OZUA 4KNYA 3DFGA 4FX4A 3JSOA 1SMYF 3GFLA 3E5XA 1Y0UA 2M8EA 4KT5C 4HBLA 3TOAA 4XLNF 4Z2YA 2L54A 2VODA 4WXCA 4LMYA 3RPQA 1BI0A 2Z99A 2Z33A 1QGPA 2AXLA 3ZMDA 4G8XA 5K1YA 1JXSA 3WGHA 3KP4A 4I01A 3QRFF 2CGPA 4UV8A 1U5TA 3E6BA 1R00A 3GFMA 4FT8A 2P5KA 1U5TB 1W5SA 3NEUA 2PI0A 2W85A 4ENNA 2EK5A 4KN7X 2GIVA 3L09A 3OV8A 2AS5F 4IJAA 4GGGA 1OYWA 5L3DA 3F22A 1HQCA 2OBPA 1BI3A 1NHAA 2KIUA 1GXQA 1ZG3A 3KZZA 2R7DA 3HRTA 5IT9K 1F9NA 3E6DA 4RAZA 5IT3A 1S3JA 3ISPA 2GA2A 4ZZLA 1Z91A 2IW5A 3ZMVA 1YW9A 2PEXA 2ACJA 2YX4A 4UVAA 3B02A 1MGTA 3DP7A 5E8GA 4UUVA 4B09A 2IVMA 2OQRA 1UHWA 1AWCA 4O5VA 1FX7A 1MZBA 4OMYA 4LLNA 1D3YA 2CFXA 2WWYA 1Z9CA 2PJPA 3I71A 4D0PA 1I6XA 2EV5A 2ZKZA 5HDGA 3RIRA 1O3TA 2FSWA 3G73A 4MTDA 4I0AA 3Q9SA 4L9VA 4WCGA 1IXCA 1IW7F 1PP8F 1LDKB 2VOPA 1CF7A 2P4WA 4UXNA 3L00A 3J80Z 2STTA 1F5TA 2OD5A 3Q5FA 1JE8A 2VBYA 4MGRA 1XD7A 4AIJA 1CF7B 1F4KA 3IKTA 2EB7A 4EJVA 4A12A 2PBIA 4LB6B 1QZYA 5D8KB 5IT9Z 2F5FA 1MDMA 4LG0A 2WC2A 3R0JA 3V7CA 1BI1A 5DCMA 1IN6A 3HTSB 1S29A 3VOEA 5D5XB 1MDMB 4LG0B 3T5XA 1FYKA 2W24A 5DCMB 3V8KA 1WSUA 2PG4A 5D8LB 4XRFA 3I59B 4P9UA 1ZRDA 2HYFA 1ZH5A 1FOKA 1YIOA 2Z9OA 1SD7A 4IF4A 2IA1A 1XGMA 3E6MA 2MH9A 1P4AA 2QQAA 1ZRCA 2XKPA 2QQ9A 3CUQA 3GF2A 2BYVE 1TW3A 2HWVA 2VBXA 3PFIA 2ZCWA 4YFXF 2NRAC 3CUQB 5J8CA 5LEJA 2RQPA 4MTEA 2Q2EA 1UFMA 2FA5A 4OIOF 4U7DA 4MEXF 1QO0D 3ZQ7A 2A5YB 3DQVC 2CQKA 3WE3A 3H3ZA 1QZZA 1G3YA 1I1GA 3GWZA 1LNWA 2DI3A 3QP6A 2NNYA 5F1RA 1IRFA 3E5QA 2DT5A 4M6XA 3K9TA 5E1XA 3F21A 3FMSA 4L9JA 4QLCU 1EV7A 1EH8A 3GO5A 4ESFA 3L2CA 2P6SA 4AD9A
chains in the Genus database with same CATH superfamily
1R23A 2MD5A 5E1ZB 3FM5A 1LFUP 1KU3A 2K4BA 5DDGA 3PJRA 3AKZA 4XOTA 1I5ZA 5HLHA 1FNNA 2ZXIA 4A69C 4MFEA 4LB5A 2E71A 1DGRM 3HSFA 1WWXA 3GTQJ 3JRFA 3OR2C 2VC1A 2JA5J 1SAUA 3OIOA 1MBGA 1W0UA 4MEYF 4M71A 4FX0A 2CYYA 2M4GA 1QNTA 4CZCA 4AC0A 1J7KA 1LFPA 3TOBA 2P81A 5TRDA 4WXDA 2TRTA 1U3EM 2DMNA 2FX0A 1FYMA 5KHDA 4QWQA 3F8NA 4JX4A 3EETA 3A1YA 2MC3A 1Z7UA 1QQIA 2F5DA 5IP6A 3JRCA 5ILSA 1CGPA 1BOBA 4PJJA 4GCVA 2IBDA 3WTWC 4DOZA 4WX9A 2ZMEA 2O8XA 3I4MJ 1W36C 2E7WA 3RCOA 3JAMK 1Z6TA 2X48A 3L9FA 4XNFA 2X6XA 1HKSA 2DAOA 3VEPA 2ZMEB 3GMEA 1T39A 1HW2A 3J7AO 3J7YJ 3SEZA 1Y0NA 3N97A 3ZN1A 1MBKA 1ZYRF 2R0QC 1TWGJ 2CV0A 2VXDA 5IYCJ 3LFKA 2JT1A 4ITVA 4M6YA 2R7TA 1BC7C 2PLYA 3MKYB 3E3VA 4JBAA 4ZH4F 1IUFA 2V1DA 1IGNA 3H9GA 4I7HA 4BQOA 1ACIA 3HHGA 3SZPA 2L9NA 2H94A 3N4MA 3L2WA 2VKDA 3EUHA 2FOKA 2W57A 3S3NA 4DYQA 2COMA 2RGVA 1HW1A 1KU9A 4E7LA 4Q48A 4HRIA 3CCLI 4EM0B 4AUXA 2BY2A 2NNNA 4II2A 1EH6A 1OJLA 3O3KA 2YUSA 3ZN0A 1GXPA 3S2DJ 3V42A 2FMLA 3PO2J 1MNMC 2GOMA 1K78B 3BPXA 4L9TA 2YPRA 2L4MA 2MLKA 1TWAJ 2EIMH 2H6CA 3F6OA 3GVAA 1FY7A 2A05A 1X19A 2KKOA 6PAXA 2MGQA 2D2WA 3E6CC 4PDKA 2PQ8A 2VOOA 2L3DA 3HOWJ 4CUGA 1YHQI 4XL9A 1U9OA 2HOTA 1ETQA 1MMDA 4CCOA 1BJAA 3EUAA 4I02A 1SMTA 3W2WA 4WF2A 2E36A 5E17F 4KT6A 4P55A 1KU7A 3H5RA 2LMDA 1N77A 4C9YA 2DTRA 2QBYA 3H9JA 4H4KC 3DKYA 5HDNA 4V2GA 3W6KB 5JHUA 4S0HB 2DT7B 1WJDA 2XROA 3J81Z 1FYLA 3HKZA 2O61A 3IAS2 3CF5F 4FE7A 1MMNA 2QBYB 4Q4ZF 2OU2A 3I9V2 1UCRA 3HUGA 4I76A 3I64A 3LAJA 5JHFA 1GT0C 1BOAA 2R7VA 2IJLA 4BS9A 4L9NA 1GVJA 2QQBA 3LSJA 5LEKA 2QZ8A 3CDIA 3MAJA 5AONA 3KE2A 3RPUD 5KNLA 1C0WA 5HS8A 3X2QH 2X6YA 3CCJI 2DBBA 3ECOA 1G2HA 5EGOA 5A2QZ 4HX8A 2EV6A 1POGA 4HNUA 2DU9A 2E5ZA 4RGXA 1XG1A 1XN7A 1Y6IA 2UUZA 2IS6A 2X6WA 2L02A 2VBWA 3WU2C 2OTJI 3GZ5A 1TT5B 3TO7A 3BZ6A 4AIDA 2EZKA 3K69A 1ENHA 4DBQA 2RKHA 3DBHB 5EGOB 4YG2F 1DP7P 2EJRA 1MNEA 5BNGA 5FFZA 4BJTA 2ZO4A 3TO9A 1HXDA 2CMPA 1HF0A 3LSRA 1XGNA 2ECCA 3RYRA 2A69F 3SJMA 4IL6C 3PNVA 1TW2A 1KYZA 3CESA 3HB9A 4HQMA 2VONA 3JSPA 2LKPA 1P6RA 1WGXA 1AKHA 3FXQA 4PGHA 4ETSA 3D0SA 1FPQA 3DCFA 1J0RA 1LB2A 2Y0SA 4AIHA 1AOYA 2DJIA 3G71I 3CDHA 3BQYA 2K9LA 4BUPA 3JTGA 4E7ZA 2OPTA 1USSA 3C2BA 1AKHB 2H1KA 3CC7I 2M30A 3CCQI 4HPQA 2QENA 4G6DA 2JA2A 1FC3A 3FHZA 2B0LA 1J2XA 3ML6A 2R5ZA 2E1OA 4DGWB 3ASNH 2XHKA 1ZHFA 1YS6A 3GEZA 1DPUA 1Z05A 2HDWA 2DXIA 1L0OC 1O57A 4IHYA 5IYBJ 1ZLKA 2H1LA 1VI0A 1YO5C 3GCMA 3L2UA 1HSTA 2EQRA 2E35A 4I2OA 1YFHA 2P7VB 1BM9A 2R5ZB 1YE9A 2UXXA 4AYBN 4C3JJ 1VQ7I 3SFZA 4L0ZB 3HOXJ 3TDUC 5CQEA 4IVNA 5ICGA 1IAWA 3BJOA 1J75A 3M8JA 1ITYA 4HEA2 5D4SA 1VF9A 1T38A 2Q8KA 2CSOA 2F4OB 3HPGA 4AVPA 2IA2A 2HXIA 2X4HA 5F08A 1HSJA 1ZRFA 3H3UA 1FOWA 5LLQA 2B9SA 1MNDA 4KIFA 4NHJA 4M73A 3V8LA 5L3EA 4XLCA 4QTRA 2JA8J 1XDSA 5B1AH 4XONA 2MW8A 3FX3A 3RKXA 4KMFA 4H0EA 1ZREA 2WY8Q 1R22A 4Z6YA 2XDVA 2G0EA 1E2XA 4BBSJ 3CLQA 3CUQC 1Z21A 3S8PA 3MCZA 3IAM2 2GOXB 4X0GA 1YX3A 4N0BA 5HOOA 3FIWA 4M9ZA 5DTDA 3IWZA 3WHCA 5KCMA 2MYSA 3EUKL 1ON2A 2H09A 3KEYA 4DYRA 2LF8A 4A3CJ 3I53A 3RSNA 2F2EA 5LRSA 3T8RA 1OKRA 3O6BB 2M2EA 3B6CA 3SZTA 3OYNA 2OCCH 5JFRA 3GLLA 2HZDA 4JX6A 1XMXA 2CW8A 3E5UA 5BOXA 2A07F 2X1EA 2O6GE 3QPSA 4A3GJ 1SD5A 2HVSA 2KIQA 3OL3A 3OS0A 2UWMA 2DA6A 3GTKJ 4NQWA 3ZR8X 5IYDJ 1QU3A 3OYLA 4HOBA 2K85A 2TDXA 4BL0B 1J59A 4A0ZA 5JI6A 2WV0A 1GLNA 4A3JJ 1QBJA 1O7FA 4NQWB 5FKKA 4DZJA 2OA4A 4BHBA 1OISA 4RDUA 3LSGA 4F3QA 1MSFC 3QP5A 5LGTA 2CW7A 2LKXA 2ADUA 3OOPA 2O8KA 3GTOJ 3F8CA 2O3FA 1REPC 1W7PA 2PJRA 1KGSA 3P9KA 3F0CA 1IN7A 2M5WA 3V4GA 3D5LA 3NQOA 4XKWA 2EILH 3J80K 4ZYEA 4I09A 2GBYA 2K4JA 4M3EA 3GXOA 4S04A 2J5OA 3EYIA 3ZXSA 3HOSA 1USTA 1YIJI 4M3GA 2ZSHB 4PCQA 5GP9A 4LK1F 2PJRB 2HTSA 3U2RA 3DKWA 3BR1A 2WB1A 3AL0C 5DD4A 5BQTA 4IX7A 3SFIA 3ROUA 3J7ZI 3PIOF 1R1UA 4G6TB 2XGCA 5F27A 3OMYA 4IKFA 4A0XA 3GYHX 4EV0A 3S15J 1ZQ3P 1QVTA 1B9MA 4D5CA 2KRFA 2O0YA 1WRJA 5J4VA 4EEFG 1MKMA 2KMUA 4EJTA 4OWRB 4K2EA 3H5AA 1XSDA 3MEXA 2FU4A 2P7CB 4BY7J 4OINF 4IHSA 4G7HF 4PK4A 5F64A 4CSWA 1BBYA 1TNTA 3I3LA 3DPUA 1QRYA 3UNGC 2W82A 2NAZA 3WODF 3HYIA 2DFFA 1X4OA 2XAFA 1YOVB 2XB0X 1X2NA 4XRSA 2E2JJ 4JYKA 4KICA 4G94A 2VT3A 1SD4A 2CWEA 2E1CA 2GXAA 3E97A 2R3SA 1A04A 4AVZA 3GBGA 3KP5A 1OQYA 2IXSA 1SVLA 3OWTA 1HOMA 2QUFA 2IRFG 1NK2P 4LLGF 3LSMA 3HTUA 1S7AA 3HOYJ 4HF1A 3E7LA 3S1QJ 3KP3A 2HOAA 3KX2A 5H20A 4EGZA 2B7EA 2KISA 5F0FA 2WA0A 3RTRA 3ABMH 3KEQA 4ZC3A 2R7UA 3O8GA 1WKMA 1OMIA 4O3MA 4I99C 3WG7H 2OZ6A 3KYDB 2W25A 4J19A 1Y1VJ 5DCFA 1T33A 5EEHA 5CVUA 2V1NA 3CF2A 1K4SA 1U9NA 5J1UA 2DCEA 1R5HA 4RMNA 2ISZA 2ZB9A 3LSIA 3R6SA 4MFDA 2NVQJ 4YFKF 3KFWX 4OOIA 4BBRJ 3ZQLA 1B8IB 3VDXA 1F1ZA 2AXTC 1RR7A 3SZGA 2HOSA 1NH3A 1JUPA 3GTMJ 4B48A 4A3KJ 3LSPA 1BIBA 1MJBA 2EA4A 3G1LA 3C3WA 4XSZF 1T2KA 5LFAA 5TJJA 1VTNC 3A02A 2KP6A 2CH0A 3PNYA 3BT9A 4CYDA 3G2BA 3OS2A 1ETVA 2FXAA 3KLOA 2H8RA 3IKVA 2WAQA 1NK3P 1VQ4I 1T95A 2HKOA 1WH5A 4A0YA 3MKZA 2E2IJ 1ON1A 1J09A 2W00A 3KP7A 1MJ9A 2L7MP 3OYGA 1MMSA 3ZMZA 3MVPA 4A6EA 1FP2A 1RUNA 3H9QA 3TL4X 2WTEA 4JP0A 1P4XA 5F1JA 2R7RA 1TWCJ 3BC8A 3CJRB 3GW2A 1JT0A 1UJ8A 2XB5A 1TQMA 1U6GA 3ZQCA 1D1AA 2CO5A 3LWFA 4KIGA 1P7IA 5CVIA 1RETA 4P9FA 5J3LA 3CJQB 4BHCA 1A6QA 1VQOI 1B6AA 4HX7A 4B8XA 1HA8A 3P9CA 3JRIA 4WXHA 1Y56A 4LOCA 1NG7A 2K9QA 2M9HA 3JRDA 2M0CA 3M8EA 1E0EA 1IC8A 3BTJA 1YW7A 2NVYJ 3WU0A 1UG0A 5FKNA 2UZKA 3ZMTA 5K7ZA 3JW4A 3OS1A 3BG6A 3CO7C 3P9IA 2XRNA 9ANTA 1UB9A 4PSWA 4ZYDA 4PFOA 3PIPF 2KZVA 3A01A 3OYCA 2DQRA 1A6IA 2YSRA 3H5NA 3K4MA 4KUMA 1O3RA 5FLXK 4CH7A 2XKOA 1Z67A 3BZKA 2EH3A 3CDLA 3VYTB 5GTHC 3FMRA 1ZGAA 3EPZA 3IWFA 5D6EA 3U1DA 4RAYA 3CC2I 3V8JA 3SDBA 3A01B 3KZIC 4RGUA 4BDZA 3I54A 1DU0A 2J5PA 3ZMSA 1FLIA 5JLWA 3CCRI 2Y0SN 4N9HA 5DS9A 3DPLC 3GFJA 2EPFA 1BR2A 1R36A 1RKTA 2BBYA 4BYYA 5C4JJ 1LE8A 3DPTA 4NB5A 5DYMA 1R1TA 3Q0VA 3TMOA 4D7NA 1G3TA 2K3FA 2I10A 3V7SA 2CU7A 1E3HA 3B6AA 5BS6A 1ETXA 2XAGA 5K5RA 4OIRF 1TQIA 1LE8B 2Y2ZA 4L0YB 4XSXF 1JTYA 2HQ5A 4MNUA 3MFKA 4N4NB 1XCVA 1EJ9A 2X6OA 2Y9YA 1Z77A 4HF0A 3QYFA 3VODA 2MLGA 2ZBKA 3FXMA 1T8IA 3S17J 2YX7A 3DBRB 2ZXHA 3W3CA 1BR1A 1KONA 5GPCA 4PUSA 4HSTA 3BDDA 3LMMA 4HDVA 1V4RA 4S05A 2N8GA 2FMYA 2IP2A 2Y48A 1I3AA 2HNHA 1XPXA 2NYXA 4E7SA 2P6TA 1H89C 2R92J 2W7NA 5BPDA 3VSKA 3CZ6A 5B5EC 3I55I 1R6RA 5H6QA 3K70C 4LD5A 2DODA 1YG2A 2FRHA 1UG2A 3TEDA 3DWLE 1R7JA 1JKPC 5EG0A 1RNLA 1J5YA 1D0YA 4OAZA 1X3ZB 2MFZA 3CUOA 1TL8A 2LD5A 3QOPA 2ESNA 3OSGA 5JR3A 4A3EJ 2M4KA 4XN0A 2ZJQF 2DK8A 3OYBA 2DPDA 5JLXA 3W2AA 4M74A 5CVRA 2NVTJ 4IRGA 1K4TA 2GA1A 1O3QA 2BHZA 1WH7A 5JVTA 2VC0A 1Q1HA 5EG0B 2DDBA 5FO5A 5LHIA 5JVGF 2R7WA 4RB1A 1A31A 2EFQA 3WTVC 1XS9A 2HPIA 4CHUA 3DV8A 2LREA 3GZ6A 4RBOA 4IRIA 2R5YA 3SQNA 4U7BA 5AIPA 3VYRB 1MH4A 3BROA 5FLXZ 1W1WE 3CMAI 1VQ5I 3CJTB 1S6LA 3RZDJ 3ZP5A 1R5GA 4YIFA 2A5WA 3J81K 3BJAA 3I4PA 5M5YJ 2VIXA 3OYIA 4CDGA 2RC4A 3QYEA 4YIIA 4G7ZF 2D1HA 2R5YB 1ONVA 3AL0B 4PGGA 1K7AA 5FLVA 4CGZA 4IHXA 4B1RA 4BQNA 3HDDA 4EVIA 5GAGJ 2V1UA 3SDGA 2XIGA 4HV6A 4Q47A 1BL0A 4BEHA 3PQJA 4Y13A 1WJ5A 2KLOA 4NUBA 1UHMA 4RM2A 2IS1A 2M45A 3WTUC 3HOZJ 3FZVA 3HG9A 2GZWA 4BEHB 4D5FA 3PUBA 3DU6A 4M9XA 2IGKA 1YW8A 4XKBA 3W6JB 5A2QK 4A3DJ 5EZGA 2L4AA 1ERDA 3VYSB 5H2FC 2EFWA 4CO8A 3KZYA 1ZELA 4ZYHA 2H8WA 3QU3A 5ILUA 3TP0A 2JQ7A 5IOYA 2OAZA 3BR2A 4IO9F 2ETHA 2DA5A 1G59A 3BG5A 3U21A 4UY8I 4QPOA 2HDCA 4OMZA 2OF7A 4CCJA 2KT0A 1HKQA 2FUG2 3KETA 4YFNF 3I5UA 5LD2C 1D5VA 4ZDLA 2LDUA 2BXZA 1A5JA 4ZYAA 2CRGA 4CICA 4PJ0C 3ZQIA 3IL2A 2LF7A 4HDUA 1X1BA 2EFPA 1MMGA 2XSJC 3IHUA 2WB1N 4UUTA 4ANJA 1JKRC 1MD0A 1G4DA 3FKJA 2JVHA 4AU7A 2FNPA 4B4CA 1KZHA 2ZXJA 4NC8A 5D5WB 4I6ZA 3W6VA 3D1NI 5CKTA 3H35A 4M72A 1IXRC 2HVQA 4HAMA 1S5LC 2X1CA 5IP7J 2O03A 2LRDA 3DLAA 5CLSA 5E8IA 3AG2H 5L3BA 4KDPA 1IN5A 3GTPJ 2MA3A 5E20A 4MHGA 2O9LA 3SHFA 3ZGKA 3KPHA 2WV1A 3TGNA 3QPHA 2BHYA 4JQFA 4JX5A 3SXYA 4HG2A 3LOCA 3G4SI 3S1RJ 1STZA 5J47A 4L18B 2RREA 1BN5A 1ETKA 1ZARA 4ZTJA 4Y52J 3CCUI 3R60A 1V5EA 2LY2A 2Y0MA 3ZQGA 1YQAA 4ENJA 4HX4A 1TLHB 2R4GA 5IOZA 3IRRA 1VQKI 4FHTA 1YI2I 1XGSA 2IPQX 1EF4A 2DA1A 4BAYA 1IRZA 2QSFX 4ON0A 2Z3YA 3NWSA 3O8HA 1Y8QB 5KVRA 4UNOA 3HUGB 1VQ6I 1XX5A 2DMPA 1IJWC 2BZTA 2DFIA 3CMMA 4XK4A 2QEXI 3JRAA 4R8HA 3DF8A 3R61A 1ULYA 3FXUA 4C3IJ 3VB2A 2JTVA 3RKYA 1KYWA 3AFHA 2V9VA 1FBQA 3DEWA 2IS2A 1X3UA 1RPWA 1FMVA 4C30A 1P9QC 4L5JA 3LQRA 3R0AA 2JRMA 2XPUA 4ENKA 4EJWA 1GDTA 2D1VA 3BG9A 4G9YA 2M1BA 3BPVA 1SEUA 2MSYA 4BE1A 1FWZA 1YX5A 3FK7A 1ETWA 3S1MJ 4C3HJ 2DYSH 2FE3A 2K5CA 3L2RA 3TQNA 3L1PA 2A3SA 3RI4A 4RB3C 3G6EI 4RGRA 3S2WA 1FTTA 1B4AA 4MQVA 1T98A 2FQ4A 4M9SA 1W4MA 1K79A 2DOAA 2WAEA 5LBQA 1ZK8A 1Y8RB 2FJ1A 3M4OJ 1KU2A 2RNGA 1JGSA 1OLTA 1IV8A 3JRBA 1MBEA 2HOEA 3S1NJ 4DIQA 4IPAA 2ELHA 3OR1C 3HOTA 1TT0A 2WAQN 3BOQA 3J7AY 4A3FJ 1OCTC 4E7IA 1JJ8C 1XMAA 2I8DA 1BW5A 4I0BA 3MN2A 3QPLA 2XC7A 1S9HA 2ZC2A 4U87A 5LGNA 1GHCA 2VQCA 2VJIA 3K70D 2EA2A 2P8TA 4QPQA 5E3NA 1VZ0A 2EIKH 3FM3A 4B47A 3PQKA 5L3FA 2FNAA 4AWXB 5HVQC 1TBXA 5B3SH 4A2UA 1DUXC 2GLOA 4UV9A 4ZZDA 1U8BA 1FBUA 1XB4A 1WHUA 5HNFA 1SD6A 2CV1A 2JSCA 1YITI 2NS0A 1WQ2A 4XRSG 5C3EJ 1OCCH 3G1OA 3OOUA 2CQ7A 3WGIA 4NBQA 2XF6A 1PP7U 4GFBA 1JKQC 4L5EA 2KIFA 2RDPA 2R7OA 2LBFA 1LFBA 1FT9A 1R1VA 3TDZC 2BV6A 4IEJA 2E7XA 2A6HF 3K4NA 4E7KA 4P5OA 2HFHA 5IY5H 3DXJF 3CLOA 3OYKA 3UR3C 3QU6A 2PMUA 2WADA 2HI3A 4GXOA 1G3WA 4BJ5C 3H0GJ 3TKYA 2LBFB 2CG4A 1B1BA 1RIOH 1UELB 5M5WJ 4A5MA 3F8MA 1X1AA 2K9NA 1W36D 1YS7A 2F48A 2CQQA 2L9SA 3BG7A 1ZR2A 4C2MJ 1M1EB 3K10A 5HDKA 3ULQB 1R49A 2Y69H 2QKMB 2ELKA 2LG4A 1WI3A 2OTLI 1G3SA 3DTEA 3K4LA 4AIKA 3K0LA 3BP8A 2FBIA 3W2VA 1SVOA 3LA2A 4XOPA 2XF5A 2XVCA 3IC7A 2K02A 2VXZA 2LOOA 2HEOA 1H9GA 2VBZA 3BY6A 4BNCA 1BIAA 2M8GX 2QGUA 1VQLI 2BW3A 2JZYA 4HQEA 4UHTA 1EKEA 1SFXA 1ZLJA 2CS3A 3I58A 3OYMA 1W7PD 3ABTA 2QSHX 3JREA 3S3MA 2EZHA 2HTJA 5EDNA 2LK2A 1NTCA 4XM3A 4ZDOA 4HZFA 4E70A 2BW3B 3FXLA 1OYYA 5FKMA 3B73A 2G9WA 5HS7A 1E17A 5LRRA 3K4KA 1DQUA 2DPUA 5ICEA 3PSFA 1JTXA 2RVCA 4EATA 3COAC 3EQLF 2W84A 5KK1A 3WE2A 4F92B 1DU6A 2JUGA 5ED4A 2HYJA 4D1QA 4BY1J 3ELKA 1QA6A 1IDYA 1W7PB 3KYCB 2STWA 1WI9A 4A3LJ 3R4KA 4CCKA 4BE2A 4NC6A 2DTZA 3FISA 2DW4A 4O6JA 4BH9A 4XIDA 4RB2C 4G6QA 4YEJA 4IHTA 1ODDA 3HIFA 1V3FA 5TISC 2PMHA 5EEGA 2Z1DA 3HRUA 3FMQA 2CFOA 2C6YA 2XGXA 5AIQA 4B44A 3N05A 4M3BA 2Q0OA 3K7AJ 2W1OA 2JVGA 1Y1WJ 3H92A 3M1EA 2DA7A 2EWNA 2BEOA 1TNSA 3LSHA 1ZTRA 2XASA 3KCCA 2VI6A 1IN8A 4DW6A 5E79C 4QIWN 2E1NA 1SFUA 4KFCA 5HLIA 3RQ4A 4I98B 1ETYA 4UVCA 2HVRA 1ZAOA 1ZGWA 4HLXA 1OYIA 4HW0A 2PFBA 3SYTA 3GFIA 3GUDA 2IGMA 1YRNA 1RZ4A 4Q5SF 1K83J 2E34A 2IGOA 1U0JA 3NWTA 4EMSA 4AM3A 3K1PA 2VQHA 1EA3A 3M07A 1KQ9A 1OCRH 3HHHA 3IUOA 5FJ8J 2OV7A 5KAIC 5EF6A 4ESJA 2ISYA 1YRNB 4X6AJ 1JKOC 1VFCA 3F23A 3LL7A 2VL8A 2EFNA 5FLMJ 2F5CA 2JWTA 3JRHA 1BJZA 3Q0UA 4R79A 2KJBA 5DUIA 1O3SA 2L7KA 2P0WA 4BGDA 3O2PE 1DDNA 2BGCA 2VUMJ 2GAUA 2X51A 3ASOH 1ZG5A 5LGUA 3ABUA 4Y3OA 1FJLA 3CP2A 2JPCA 3FKIJ 3WGGA 1PDNC 2A68F 2CV2A 5ICCA 4WWCA 3FWEA 4YIRX 3D5SC 1WFXA 2X9DA 3KLNA 2MC4A 3LSTA 2ZJ2A 3PFYA 4LITA 5FB2A 1U78A 1JHHA 1IXSB 3BZCA 4F93B 5K7FA 2YU3A 2GIZA 2JRTA 3QQAA 3A0BC 3FXRA 4G7OF 5FKOA 2GQQA 2Y31A 1LJ9A 2W4SA 1SFOJ 2VKHA 2PN6A 1TZLA 2M34A 1FOYA 1X4PA 3PNTA 1HDDC 2VPRA 4A3BJ 2H6BA 1RRJA 2AQFA 1XCBA 3H3VK 4BHPA 2DA2A 2R7QA 4HA8A 4N4OB 1VQMI 1B72A 2RQQA 4U0YA 2WBMA 4M6VA 2G7HA 3C1DA 2G7UA 3CCYA 1CQTA 5E3LA 2IEKA 3CCMI 1QZEA 2FEZA 3HKZN 3MWMA 1S72I 1FZPB 1MJAA 1L3LA 1KQ0A 1SFKA 4R1HA 2Z5UA 4BE0A 1B72B 4D9JA 4GDFA 1ZGJA 1OFCX 1BI2A 4PSXA 2DFHA 4NNJA 3MZ8A 3OIQA 1K6YA 2JJ7A 4CZZA 4LLLA 4DYCA 4ZDPA 1RI7A 3WTTC 4CA0A 1W5TA 4XMYA 3Q9VA 5ERIA 2R7FA 4CCMA 5FRMA 2MBFA 4RA2A 2F4MB 1XDUA 2NXNB 3ZPLA 1D8KA 4V19K 1IG7A 3HGYA 1B59A 3ZQQA 3CC4I 1MBHA 2HQAA 2M3AA 3KEOA 2Z2SB 2L5QA 3UKGA 2M87A 2DMUA 2HQNA 1I50J 1LDDA 2Y75A 1F43A 1W0TA 4LIUA 2YU9J 3JRGA 3VSLA 1EH7A 2M0MA 4KITB 2BOLA 2KQRA 2O7OA 3D5RC 3I59A 4EQQA 2GXBA 2GWRA 2A6EF 4HLYA 3WG9A 4P1WA 1V5FA 3CJNA 2QF7A 5CYVA 3C7JA 2LH9A 2NVXJ 3BLYA 5DUKA 2MH2A 1YTYA 3RYPA 1SVMA 2K27A 3OYFA 3JCUC 3KP6A 2QQ8A 2JPBA 2AQEA 4PJLA 5F04A 2XF7A 3LFUA 3JTHA 1VNDA 2QVOA 1IDZA 4C2UA 1WCMJ 4IQJA 3FBIB 3LAPA 4LGWA 4ZTFA 1ETOA 2XRLA 5J1RA 3DTIA 3AAFA 2D5VA 1SFEA 3RKWA 4CXFA 3S14J 4GRIA 1TTYA 2CW0F 4GO1A 4MO7A 4RGSA 5FGMA 4XLEA 3REOA 3VPRA 2LSOA 4IHVA 3I4NJ 2E2HJ 2M7AA 3PL8A 2ZNZA 3BWGA 4BQAA 1FSEA 2X85A 4EGYA 4TV7A 4KYWA 1PUFA 3GLXA 5EJCA 2L9RA 4B43A 3VWBA 3U9GA 3K2AA 4E4HA 2ID3A 3K4BA 5CVVA 4LIVA 1G6NA 3DKXA 3GZNB 2QYOA 3AG3H 3LQQA 5GADJ 4HNTA 2NOGA 5GAHJ 1PUFB 4XKCA 3VFZA 2OQGA 4N9IA 2EFOA 2K9MA 4G12A 4HYEA 1BR4A 1MIJA 3S3OA 2YS9A 3G1MA 1JUSA 1GUUA 4OIQF 3S32A 1B9NA 4F91B 1SAXA 2I5UA 1HW5A 3I0TA 4XLFA 1P92A 2XAJA 1U2WA 4F52A 4EJOA 1FEXA 4YRVA 3M1CA 1KQ8A 1YJNI 4CCNA 2OJED 2CUEA 2DDAA 1X1CA 3CP8A 4EM2A 3CO6C 3IRQA 4ENMA 2XAQA 1VQNI 2XAUA 1MH3A 3RJPA 3F3XA 1ZN2A 1P2FA 3GX4X 2V9KA 4BXFA 3HBLA 3FK6A 2D45A 3M9AA 1ZKGA 3EYYA 3WTZA 1Q1VA 3TW7A 3AG1H 3HRMA 3WTSC 4KN4X 4XICA 3DU5A 4JK1X 3HSRA 3OYJA 5FRNA 2FQ3A 1DPRA 1VQ8I 3K1NA 4RS8A 2JMWA 4PFPA 2F5VA 1HC8A 3P7NA 4E6KG 1OR7C 3IV5A 1MSEC 2LP0A 1I1SA 4U0VA 3F72A 3L7WA 4CYCA 3T0YA 4U88A 5CVJA 5DM6F 2GXGA 4Y17A 2R7SA 2XUBA 2P5LC 5DV5A 3A0HC 3CQZJ 1GVDA 2XPVA 2KIMA 4A3MJ 3DEEA 3WU1B 1I39A 3TO6A 2ZNYA 4CYCB 1IF1A 4XR6A 2DT6A 4BJ6C 2JA6J 1YLFA 2DO7A 3F8BA 3TP3A 3EDPA 1LDJA 3GTJJ 1PUEE 2BY3A 2L01A 4GYIA 2VPLA 2HYGD 3K6GA 3FF5A 1DP3A 5HLGA 1IUYA 1LVAA 5B66C 2UXNA 1E3PA 1FBSA 4J01A 1K61A 2DA4A 2LKSA 3T1BA 1FIAA 1HBXG 5J1YA 3H36A 4IZZA 2HQRA 3F6VA 4FQGA 2PMZA 4DZPA 4FETA 1JGGA 5HLTA 2W48A 2KZGA 4ZYGA 5DEQA 2V4JC 3S16J 5HODA 4A3IJ 1U5TC 4GYGA 1FOXA 2WY7Q 2XV4S 2ESHA 2Z16A 5CJ9A 4BXXJ 1V54H 2HU9A 4MQ9F 4PZJA 1VQ9I 1Z6RA 3NRVA 2OC6A 4XLPF 1IN4A 3F8FA 4XRMA 1D0XA 3C2GA 2DQLA 5BPIA 2QWWA 1FSHA 2L9VA 4F55A 1K78A 3BTLA 2HGCA 1I27A 2KRCA 4BU2A 3HL2A 2VE9A 3PUFA 1QPIA 1IO2A 1FP1D 3WTYC 2B63J 4IQ4A 2HS5A 1FIPA 4DBRA 5FD5A 4L5IA 1P4WA 4FE4A 2FBHA 4PJNA 1H9TA 4ZJZA 2M7BA 2L7FP 4OIPF 5J6XA 1Z3XA 1X1PA 3CCEI 1PJRA 5DD8A 3ZOBA 1APLC 2A61A 5FKLA 4LFUA 5J40A 4A6DA 2NS7A 4F7ZA 1YYVA 2VJ5A 4UVBA 2RV8A 3P5JA 5F6FA 2XAHA 2LR8A 3OYEA 4WK8F 3K4CA 1WJBA 4NC7A 3HZJA 3E0JB 5H6RA 3HRSA 4W1UA 2YR2A 5D5UB 1KA8A 1IV6A 5HS9A 3CTAA 3E1SA 4Y15A 2IS4A 1ZG1A 2R93J 5D4RA 4KA4A 2FBKA 4E7HA 4BXUA 3NAUA 3I56I 1TQPA 2ICWG 5M5XJ 2QM3A 5IPAA 4KIBA 1XSXA 2R7ZJ 1AA7A 4ABZA 1O7LA 1V55H 2HKXA 2JUCA 1ZR4A 1X2MA 1Z0XA 3K1MA 1BC8C 2TCTA 1IRGA 1R5ID 2QLZA 2V6CA 3IP4B 1HLVA 5BMZA 3M7GA 1IZ1A 4EJUA 1MW7A 3LNQA 2LNBA 3ABLH 1TWHJ 2HR3A 3Q3SA 2VB6A 4U0WA 3M8FA 1XMKA 3JAMZ 4P96A 2RNJA 3RDIA 1T0FA 3PM1A 3ZQFA 2F5EA 3CCSI 2K86A 4A5NA 3MQ0A 1HDPA 3BR6A 2BXYA 3K2ZA 1XSVA 3LA7A 3QPTA 2VT2A 2VJJA 4XLHA 2FF4A 4ASNA 4DNCA 3RPUA 1W5CC 2K40A 2IT0A 3MD2A 3A2KA 2CQNA 3RZOJ 5J4YA 2A6TA 2ECBA 1T6SA 2GM4A 3C18A 1RKWA 5LHGA 4FASD 1UHSA 3HSEA 2VJ4A 2E1MC 4XORA 1JHFA 2DLLA 2EZIA 1R9TJ 3WTXC 1TWFJ 4M3FA 4QSHA 4HNVA 5M3MJ 3OYHA 2VE8A 1TP4A 1WZ2A 5E18F 2V79A 3K4JA 3MMYB 5FD6A 3DLLF 4IRHA 1E3OC 5L3CA 3MZHA 1OPCA 3QOEA 5F0CA 3BJ6A 1S7OA 4EM1A 3T8TA 1LEBA 1LUJB 5K5QA 4ESBA 1XC5A 3QAHA 3ONQA 2HXOA 2K7LA 1D1BA 3DEUA 4OU0A 4MIMA 5FFXA 3FHNA 2LC2A 2DA3A 3DTKA 2BE5F 4BQQA 2PX9A 3MZYA 5E3OA 1H0MA 2OUMA 2V1XA 1U8RA 5L3GA 4LK0F 4HF2A 5ILVA 2HZTA 5E1WA 5LHHA 1D8JA 4IXAA 2HDDA 3ZMUA 3TW6A 3ERED 3BCBA 2K9SA 1GV5A 2XGDA 1K6OA 2ZFWA 2ME0A 1RUOA 2V7FA 1D1CA 1QPMA 2BY0A 2UV1A 1UZCA 4LJZF 1SANA 5EYRA 1HKTA 4DQ2A 2X0LA 5D5VB 3F9KA 3FDYA 3HGGA 4KMUX 2RN7A 2VKEA 3V7RA 1R58A 3ECHA 4XLAA 4C2TA 2FD5A 4XKVA 2DMQA 2VN2A 2KDZA 5J8FA 2ZSIB 1Z1DA 2EV0A 5D6FA 2R7XA 2KJCA 2Q1ZB 3AG4H 3BG3A 4RLFA 5K5OA 1MMAA 1J9IA 1R4NB 1LEAA 3LA3A 5K7HA 4HV5A 1LQ1A 1AHDP 3G3ZA 1TC3C 4Y4RA 4YELA 3TBIA 1Y39A 4XBFA 2QCOA 2DK5A 2P5VA 1OR7A 1S8NA 5ICFA 3IH4A 4RB0A 3HM5A 4CCLA 1R4MB 2CUJA 2IA0A 3OYDA 3VYUB 2Y9ZA 2H27A 3KP2A 3BCAA 5GAEJ 3CCVI 2L0KA 1XGOA 2OZUA 4KNYA 3DFGA 3MKWB 4IOAF 2IGNA 4FX4A 3FXKA 2VQGA 3JSOA 1SMYF 3GFLA 3E5XA 1Y0UA 2M8EA 5C4XJ 3BR5A 4KT5C 2EINH 4HBLA 4BDYA 2BVMA 3HEFA 4MLOA 4OAYA 3TOAA 1P7JA 4JOMA 4W97A 4XLNF 4Z2YA 2CJJA 2L54A 1N75A 2VODA 1VQPI 5GTIC 5M3FJ 4WXCA 3QODA 4LMYA 3RPQA 3ZCOA 3Q0WA 3BQZA 1BI0A 3HOVJ 2Z99A 2Z33A 1QGPA 2AXLA 2X1DA 1RC9A 1N25A 2JSPA 2CQXA 4G8XA 4PJMA 3ZMDA 5K1YA 1FTZA 2ME6A 4XQFA 1JXSA 3WGHA 4IHWA 2MG4A 3KP4A 4I01A 3QRFF 2CGPA 2ZFUA 4UV8A 2LYCA 1U5TA 3ZQHA 3OSFA 3E6BA 3RKQA 1R00A 3GFMA 4FT8A 2VQLA 1Z7LA 3OY9A 2CUFA 2EBIA 1LKXA 2P5KA 1U5TB 1W5SA 3NEUA 5CPRB 2PI0A 2W85A 1UAAA 5C44J 3U1KA 4BACA 4ENNA 3HOUJ 2EK5A 4KN7X 2GIVA 1RR8C 3L09A 3OV8A 3QWLA 2AS5F 4IJAA 4GGGA 3HC7A 3QYBA 1OYWA 1HCRA 5L3DA 2QSGX 3F22A 3FXJA 5FROA 1HQCA 1OCPA 2OBPA 4HSRA 4UUSA 4FISA 2ELJA 1BI3A 1X58A 1F36A 1S7EA 1NHAA 4FCYA 1D0ZA 4LG3A 2XPWA 2KIUA 1GXQA 4Y33A 4UUSB 3S93A 1R71A 1ZG3A 1JI8A 2LFBA 2NVUB 3KZZA 5HNHA 2R7DA 3HRTA 2XSDC 2VLAA 3HXLA 1NG6A 2E19A 3CMEI 5IT9K 5CQGA 1F9NA 1BA5A 1XTAA 3E6DA 2ZXWH 5DM7F 4RAZA 5KAFC 5IT3A 2ZMEC 1S3JA 2K3PA 5F0HA 3H1CA 3ISPA 2GA2A 1A35A 1N78A 1LPQA 4X1EA 4ZZLA 3IH3A 2LTPA 1Z91A 3CMYA 2IW5A 3ZMVA 1YW9A 2PEXA 4XN3A 2AHQA 2PMZN 2ACJA 2EIJH 1I3QJ 2YX4A 3BR3A 4UVAA 5EEAA 3B02A 3CD6I 2ZJPF 1MGTA 3DP7A 3PSIA 1PYVA 5E8GA 4UUVA 4B09A 3LSKA 2IVMA 2V9PA 1O4XA 3BTCA 2OQRA 1UHWA 1AWCA 4O5VA 1BW6A 1OCOH 3WHBA 1FX7A 1MZBA 4RM3A 4E7JA 2ZJRF 2LY9A 4OMYA 4LLNA 1D3YA 2CFXA 4B3AA 4BKXA 2WWYA 1Z9CA 2PJPA 1AU7A 3EUHC 3I71A 4D0PA 2AO9A 3FXOA 4RLQA 1WPKA 2LY1A 4DJAA 1I6XA 3A03A 3DBLB 2EV5A 3C2HA 1Z3YA 2ZKZA 5HDGA 3RIRA 1O3TA 1B8IA 2FSWA 3G73A 4MTDA 4I0AA 1JT6A 3Q9SA 4L9VA 1GV2A 3SEQA 4WCGA 3L2QA 1QHGA 1IXCA 1IW7F 1PP8F 2LVSA 4KISA 4A93J 1LDKB 2VOPA 1CF7A 5B1BH 4UB6C 2OCEA 2P4WA 2FOWA 2E5NA 2Y30A 4UXNA 3L00A 2O5RA 3J80Z 3MKLA 4NDLA 1F5TA 3FBNB 2STTA 3NARA 2QA4I 2OD5A 4RAFA 3Q5FA 2E1MB 1YJ9I 1JE8A 2VBYA 4IOCF 2NS8A 2DOEA 4MGRA 1XD7A 4AIJA 1CF7B 1A36A 1F4KA 1JJ6C 2VKVA 3IKTA 2EB7A 4EJVA 2V6EA 4A12A 2PBIA 4LB6B 3KIOA 1QZYA 4UB8C 5D8KB 1T08B 3HJEA 5IT9Z 2DJNA 2F5FA 2RAEA 1MDMA 3ERMA 4LG0A 1QHHD 2WC2A 1WJFA 2LLKA 3R0JA 3V7CA 1BI1A 4AYBA 3L2VA 2KHMA 4V2FA 1MBFA 1IN6A 5DCMA 3HTSB 3GTGJ 1OCZH 1S29A 4KJZA 1V5GA 3VOEA 1FMWA 5D5XB 1MDMB 4LG0B 3T5XA 1FYKA 1RESA 3OL4A 4B3XA 3JR9A 1T0FC 3BTIA 2KL4A 2W24A 5DCMB 3V8KA 1WSUA 1D5YA 1WVRA 2PG4A 2E60A 1H88C 1X3WB 5D8LB 2JK3A 4XRFA 2QKLB 3I59B 4P9UA 1ZRDA 1WJCA 2HYFA 5TGTA 3H0DA 2KFDA 2EZLA 4J00A 1ZH5A 1FOKA 1YIOA 2Z9OA 1SD7A 1G8XA 2NOJB 2VASA 4Y7NJ 2XGEA 4IF4A 2L2OA 2IA1A 2JN6A 2HPMA 1H8AC 1XGMA 3E6MA 2MH9A 1P4AA 2QQAA 2DFEA 1ZRCA 2XKPA 2QQ9A 3CUQA 2CUZA 3GF2A 2BYVE 3OIPA 1TW3A 3IH2A 2V26A 2HWVA 2DOFA 2DYRH 5GPAA 1PVEA 2DMTA 2VBXA 3PFIA 2ZCWA 4YFXF 2KDOA 2KRHA 2IAIA 3CUQB 2NRAC 5J8CA 5LEJA 3ZRGA 2RQPA 4MTEA 1WJAA 2Q2EA 1UFMA 2FA5A 4OIOF 1X1DA 5E3MA 1DGWY 4U7DA 4MEXF 1QO0D 2MABA 3ZQ7A 3A4CA 3HPHA 4M3DA 2A5YB 2BVLA 4D7MA 3DQVC 3KYLA 1LVKA 2Q2EB 2BY1A 2KPMA 4FTHA 2CQKA 3WE3A 3H3ZA 1QZZA 1G3YA 1T56A 1I1GA 1IRXA 3GWZA 1LNWA 2DI3A 3QP6A 2NNYA 5EZHA 1QVUA 2F4IA 2DN0A 1ORKA 1WJEA 1IRFA 3E5QA 5F1RA 3S2HJ 3OYAA 2COBA 1UMQA 2DT5A 4M6XA 3K9TA 3ESWB 4II3A 5E1XA 1MBJA 3F21A 1YJWI 3FMSA 4L9JA 3GTLJ 2JA7J 5IP9J 4QLCU 1JUMA 2WAFA 3M3YJ 1I6HJ 1EV7A 3ABKH 1EH8A 2F6CA 3RQIA 2L7ZA 3GO5A 4ESFA 4RAGA 3L2CA 2ID6A 3PO3J 3BR0A 1SC7A 2P6SA 4AD9A 2MD0A
chains in the Genus database with same CATH topology
1R23A 2MD5A 5E1ZB 3FM5A 1KU3A 2K4BA 5DDGA 1I5ZA 5HLHA 1FNNA 4LB5A 3HSFA 1WWXA 2VC1A 4MEYF 4M71A 4FX0A 2CYYA 1QNTA 1J7KA 3TOBA 5TRDA 4WXDA 1U3EM 1FYMA 4QWQA 3F8NA 3EETA 2MC3A 1Z7UA 1QQIA 2F5DA 5ILSA 1CGPA 4GCVA 3WTWC 4WX9A 2ZMEA 2O8XA 2E7WA 3JAMK 1Z6TA 3L9FA 1HKSA 2DAOA 3VEPA 2ZMEB 1T39A 1HW2A 3J7AO 3N97A 3ZN1A 1ZYRF 3LFKA 2JT1A 4M6YA 1BC7C 2PLYA 3E3VA 4JBAA 4ZH4F 2V1DA 4I7HA 3HHGA 3SZPA 2H94A 3N4MA 3EUHA 2FOKA 2W57A 2COMA 2RGVA 1HW1A 1KU9A 4Q48A 4EM0B 2NNNA 1EH6A 3O3KA 3ZN0A 1GXPA 2FMLA 1K78B 3BPXA 4L9TA 2YPRA 2L4MA 2MLKA 2H6CA 3F6OA 3GVAA 1FY7A 2KKOA 6PAXA 3E6CC 2D2WA 4PDKA 2PQ8A 2VOOA 2L3DA 1BJAA 4I02A 1SMTA 4WF2A 5E17F 4P55A 1KU7A 2DTRA 2QBYA 5HDNA 3W6KB 5JHUA 2XROA 3J81Z 1FYLA 2O61A 2QBYB 4Q4ZF 2OU2A 1UCRA 3HUGA 3I64A 3LAJA 1BOAA 2IJLA 4L9NA 1GVJA 2QQBA 5LEKA 2QZ8A 3MAJA 5AONA 3KE2A 1C0WA 5HS8A 2DBBA 3ECOA 5A2QZ 4HX8A 2EV6A 2DU9A 4RGXA 1XN7A 2L02A 2VBWA 3GZ5A 3TO7A 3BZ6A 3K69A 2RKHA 4YG2F 1DP7P 2EJRA 5FFZA 2ZO4A 3TO9A 1HXDA 1XGNA 3RYRA 2A69F 1TW2A 1KYZA 2VONA 4HQMA 3JSPA 2LKPA 1P6RA 3FXQA 4PGHA 4ETSA 3D0SA 1FPQA 1J0RA 1LB2A 4AIHA 1AOYA 3CDHA 3JTGA 1USSA 2M30A 2QENA 4G6DA 1FC3A 3FHZA 2B0LA 1J2XA 3ML6A 2XHKA 1ZHFA 1YS6A 3GEZA 1DPUA 1Z05A 1L0OC 1O57A 1ZLKA 1YO5C 4I2OA 1HSTA 1YFHA 2P7VB 1BM9A 2UXXA 3SFZA 4L0ZB 3TDUC 4IVNA 5ICGA 1IAWA 3BJOA 1J75A 5D4SA 1T38A 2Q8KA 2CSOA 4AVPA 2IA2A 2X4HA 1HSJA 1ZRFA 3H3UA 5LLQA 4KIFA 4NHJA 4M73A 3V8LA 5L3EA 1XDSA 3FX3A 3RKXA 4KMFA 4H0EA 1ZREA 1R22A 1E2XA 3CUQC 3MCZA 4N0BA 5HOOA 4M9ZA 3IWZA 1ON2A 2H09A 2LF8A 3I53A 2F2EA 5LRSA 3T8RA 1OKRA 3O6BB 3SZTA 5JFRA 5BOXA 3E5UA 2A07F 2O6GE 1SD5A 2UWMA 4NQWA 4HOBA 2TDXA 1J59A 4A0ZA 5JI6A 2WV0A 1QBJA 1O7FA 2OA4A 4BHBA 3QP5A 5LGTA 2ADUA 3OOPA 3F8CA 2O3FA 1REPC 1W7PA 1KGSA 3P9KA 1IN7A 2M5WA 3V4GA 3D5LA 3NQOA 3J80K 4ZYEA 4I09A 2K4JA 4S04A 3EYIA 3GXOA 2J5OA 3HOSA 1USTA 4PCQA 4LK1F 2HTSA 3U2RA 3DKWA 5DD4A 5BQTA 3ROUA 1R1UA 4A0XA 3GYHX 4EV0A 1B9MA 2KRFA 2O0YA 1WRJA 1MKMA 4EJTA 4K2EA 1XSDA 3MEXA 2FU4A 2P7CB 4OINF 4IHSA 4G7HF 5F64A 1BBYA 1TNTA 2NAZA 3WODF 3HYIA 2XAFA 4KICA 4G94A 2VT3A 1SD4A 2CWEA 2E1CA 3E97A 2R3SA 1A04A 3KP5A 2QUFA 2IRFG 4LLGF 3HTUA 1S7AA 4HF1A 3KP3A 5H20A 4EGZA 3RTRA 3KEQA 1WKMA 1OMIA 4O3MA 2OZ6A 2W25A 5DCFA 5EEHA 5CVUA 2ISZA 1R5HA 3R6SA 4YFKF 3KFWX 4OOIA 1F1ZA 1BIBA 1MJBA 2EA4A 3C3WA 4XSZF 1T2KA 5TJJA 1VTNC 4CYDA 2FXAA 3KLOA 3IKVA 2HKOA 4A0YA 1ON1A 3KP7A 1MJ9A 3ZMZA 4A6EA 1FP2A 1RUNA 2WTEA 1P4XA 3GW2A 1TQMA 1U6GA 2CO5A 3LWFA 4KIGA 5CVIA 4P9FA 4BHCA 1B6AA 4HX7A 4B8XA 3P9CA 4WXHA 3M8EA 1YW7A 3WU0A 2UZKA 3ZMTA 3JW4A 3CO7C 3P9IA 2XRNA 1UB9A 4ZYDA 2DQRA 2YSRA 5FLXK 4KUMA 1O3RA 2XKOA 3FMRA 1ZGAA 3IWFA 5D6EA 3U1DA 4RAYA 3V8JA 4RGUA 3I54A 2J5PA 3ZMSA 1FLIA 4N9HA 3DPLC 3GFJA 1R36A 4BYYA 2BBYA 3DPTA 4NB5A 5DYMA 1R1TA 1G3TA 3V7SA 5BS6A 2XAGA 5K5RA 4OIRF 1TQIA 4L0YB 4XSXF 4MNUA 3MFKA 1XCVA 4HF0A 3VODA 2MLGA 2ZBKA 2YX7A 3BDDA 4HDVA 1V4RA 4S05A 2FMYA 2IP2A 2Y48A 2NYXA 2P6TA 5BPDA 5H6QA 4LD5A 1YG2A 2FRHA 1R7JA 1RNLA 1J5YA 3CUOA 3QOPA 2ESNA 5JR3A 2DPDA 2DK8A 4M74A 5CVRA 4IRGA 2GA1A 1O3QA 5JVTA 2VC0A 1Q1HA 5FO5A 5LHIA 4RB1A 2EFQA 3WTVC 4CHUA 3DV8A 3GZ6A 4IRIA 3SQNA 4U7BA 5AIPA 3BROA 5FLXZ 1S6LA 3ZP5A 1R5GA 4YIFA 3J81K 3BJAA 3I4PA 4CDGA 2RC4A 4YIIA 4G7ZF 2D1HA 1ONVA 4PGGA 1K7AA 4CGZA 4EVIA 2V1UA 2XIGA 4HV6A 4Q47A 3PQJA 4Y13A 1UHMA 2M45A 3WTUC 3FZVA 2GZWA 4M9XA 1YW8A 3W6JB 5A2QK 2L4AA 2EFWA 4CO8A 3KZYA 4ZYHA 3QU3A 5ILUA 2OAZA 2ETHA 2HDCA 4OMZA 1HKQA 3KETA 4YFNF 3I5UA 1D5VA 2LDUA 4CICA 3IL2A 4HDUA 2LF7A 2EFPA 3IHUA 1MD0A 1G4DA 2FNPA 2ZXJA 5D5WB 4M72A 1IXRC 4HAMA 2O03A 5CLSA 5L3BA 5E8IA 4KDPA 1IN5A 2MA3A 5E20A 4MHGA 3SHFA 3TGNA 3QPHA 4JQFA 3SXYA 1STZA 4L18B 1BN5A 1ZARA 3R60A 4ENJA 2Y0MA 1YQAA 4HX4A 1TLHB 3IRRA 4FHTA 1XGSA 2IPQX 4BAYA 4ON0A 2Z3YA 5KVRA 4UNOA 2DFIA 4R8HA 3DF8A 3R61A 1ULYA 3FXUA 3VB2A 2JTVA 3RKYA 1KYWA 2V9VA 1FBQA 1X3UA 4L5JA 3LQRA 3R0AA 4ENKA 4EJWA 2D1VA 4G9YA 2M1BA 3BPVA 1FWZA 2FE3A 3RI4A 3TQNA 2A3SA 4RB3C 4RGRA 3S2WA 1B4AA 4MQVA 1T98A 4M9SA 1W4MA 1K79A 5LBQA 1KU2A 1JGSA 2HOEA 4IPAA 2ELHA 3HOTA 3BOQA 1XMAA 4I0BA 5LGNA 1GHCA 2EA2A 2P8TA 3FM3A 3PQKA 5L3FA 2FNAA 4AWXB 5HVQC 1TBXA 4A2UA 1DUXC 4UV9A 4ZZDA 1FBUA 1XB4A 1SD6A 2JSCA 2NS0A 1WQ2A 3WGIA 1PP7U 2KIFA 2RDPA 1FT9A 1R1VA 3TDZC 2BV6A 2E7XA 2A6HF 4P5OA 2HFHA 3DXJF 3CLOA 3QU6A 2PMUA 4GXOA 1G3WA 3TKYA 2CG4A 1B1BA 1RIOH 4A5MA 3F8MA 1YS7A 5HDKA 3ULQB 1G3SA 4AIKA 3K0LA 3BP8A 2FBIA 3LA2A 2XVCA 3IC7A 2K02A 2VXZA 2HEOA 1H9GA 2VBZA 3BY6A 4BNCA 1BIAA 2JZYA 4HQEA 4UHTA 1SFXA 1ZLJA 3I58A 1W7PD 3ABTA 2HTJA 4HZFA 4E70A 1OYYA 3B73A 2G9WA 5HS7A 1E17A 5LRRA 2DPUA 5ICEA 2RVCA 3COAC 3EQLF 2W84A 5KK1A 3WE2A 5ED4A 3ELKA 1W7PB 2STWA 1WI9A 3R4KA 4O6JA 2DW4A 4BH9A 4RB2C 4G6QA 4IHTA 1ODDA 3HIFA 1V3FA 2PMHA 5EEGA 3HRUA 3FMQA 2C6YA 2XGXA 5AIQA 2Q0OA 3H92A 3M1EA 2EWNA 2BEOA 1TNSA 2XASA 3KCCA 1IN8A 2E1NA 1SFUA 4KFCA 5HLIA 4I98B 4UVCA 1ZAOA 4HLXA 1OYIA 4HW0A 2PFBA 3GFIA 3GUDA 1RZ4A 4Q5SF 4EMSA 3K1PA 1KQ9A 3HHHA 4ESJA 2ISYA 3F23A 2EFNA 2F5CA 4R79A 2KJBA 5DUIA 1O3SA 3O2PE 1DDNA 2BGCA 2GAUA 1ZG5A 5LGUA 3ABUA 2JPCA 3WGGA 1PDNC 2A68F 5ICCA 4WWCA 3FWEA 3KLNA 3LSTA 5FB2A 2ZJ2A 1U78A 1JHHA 1IXSB 2YU3A 2JRTA 3FXRA 4G7OF 2GQQA 1LJ9A 2PN6A 2H6BA 1XCBA 4BHPA 4HA8A 4U0YA 2G7HA 3C1DA 2G7UA 2FEZA 3MWMA 1FZPB 1MJAA 1L3LA 1KQ0A 4R1HA 2Z5UA 1ZGJA 1BI2A 4CZZA 4LLLA 1RI7A 3WTTC 1W5TA 3Q9VA 5ERIA 2R7FA 2MBFA 1XDUA 3ZPLA 1D8KA 1B59A 3KEOA 2M87A 2HQNA 1LDDA 2Y75A 1EH7A 4EQQA 3I59A 2GXBA 2GWRA 2A6EF 4HLYA 3WG9A 3CJNA 5CYVA 3C7JA 5DUKA 2MH2A 1YTYA 3RYPA 2K27A 3KP6A 2JPBA 3JTHA 2QVOA 3LAPA 4LGWA 3AAFA 1SFEA 3RKWA 4CXFA 1TTYA 2CW0F 4GO1A 4RGSA 5FGMA 3REOA 2LSOA 2ZNZA 3BWGA 4BQAA 1FSEA 4EGYA 4TV7A 4KYWA 3GLXA 3U9GA 5CVVA 1G6NA 2QYOA 3LQQA 3VFZA 2OQGA 4N9IA 2EFOA 4HYEA 4OIQF 1B9NA 1SAXA 1HW5A 3I0TA 1P92A 2XAJA 1U2WA 4EJOA 1KQ8A 4EM2A 3CO6C 3IRQA 4ENMA 2XAQA 3RJPA 3F3XA 1ZN2A 1P2FA 3GX4X 2D45A 3M9AA 3EYYA 3WTZA 3HRMA 3WTSC 4KN4X 4JK1X 3HSRA 2FQ3A 1DPRA 3K1NA 4RS8A 3P7NA 1I1SA 4U0VA 3F72A 3L7WA 3T0YA 4U88A 5CVJA 2GXGA 4Y17A 2XUBA 2P5LC 5DV5A 2KIMA 3WU1B 3TO6A 2ZNYA 1IF1A 1YLFA 2DO7A 3F8BA 3EDPA 1LDJA 1PUEE 2L01A 4GYIA 2HYGD 3FF5A 5HLGA 1IUYA 1LVAA 2UXNA 1FBSA 3T1BA 1HBXG 2HQRA 3F6VA 4ZYGA 5DEQA 1U5TC 4GYGA 2XV4S 2ESHA 5CJ9A 4MQ9F 4PZJA 1Z6RA 3NRVA 4XLPF 1IN4A 3F8FA 2DQLA 5BPIA 2QWWA 1FSHA 1K78A 2HGCA 1I27A 2VE9A 1FP1D 3WTYC 2HS5A 5FD5A 4L5IA 1P4WA 2FBHA 1H9TA 4OIPF 5J6XA 5DD8A 2A61A 4LFUA 4A6DA 4F7ZA 1YYVA 4UVBA 2RV8A 5F6FA 2XAHA 4WK8F 5H6RA 3HRSA 2YR2A 5D5UB 1KA8A 5HS9A 3CTAA 4Y15A 1ZG1A 5D4RA 4KA4A 2FBKA 4BXUA 1TQPA 2QM3A 4KIBA 1XSXA 1O7LA 2HKXA 3K1MA 1BC8C 1IRGA 2QLZA 2V6CA 5BMZA 3M7GA 1IZ1A 4EJUA 2LNBA 2HR3A 4U0WA 3M8FA 1XMKA 3JAMZ 4P96A 2RNJA 3RDIA 1T0FA 2F5EA 2K86A 4A5NA 3MQ0A 3K2ZA 1XSVA 3LA7A 3QPTA 2VT2A 2FF4A 4ASNA 4DNCA 3RPUA 2IT0A 1T6SA 3C18A 5LHGA 3HSEA 1JHFA 2DLLA 3WTXC 2VE8A 5E18F 2V79A 5FD6A 4IRHA 5L3CA 3MZHA 1OPCA 3BJ6A 1S7OA 4EM1A 3T8TA 1LEBA 5K5QA 4ESBA 3QAHA 2K7LA 3DEUA 4OU0A 5FFXA 2BE5F 3MZYA 1H0MA 2V1XA 1U8RA 5L3GA 4LK0F 4HF2A 5ILVA 2HZTA 5E1WA 5LHHA 1D8JA 4IXAA 3ZMUA 3ERED 1K6OA 2ZFWA 1RUOA 1QPMA 4LJZF 1HKTA 4DQ2A 2X0LA 5D5VB 4KMUX 2RN7A 3V7RA 1R58A 3ECHA 2VN2A 5J8FA 1Z1DA 2EV0A 5D6FA 2KJCA 5K5OA 1J9IA 1LEAA 3LA3A 4HV5A 1LQ1A 3G3ZA 4XBFA 2DK5A 2P5VA 1OR7A 1S8NA 5ICFA 4RB0A 2IA0A 2H27A 3KP2A 1XGOA 2OZUA 4KNYA 3DFGA 4FX4A 3JSOA 1SMYF 3GFLA 3E5XA 1Y0UA 2M8EA 4KT5C 4HBLA 3TOAA 4XLNF 4Z2YA 2L54A 2VODA 4WXCA 4LMYA 3RPQA 1BI0A 2Z99A 2Z33A 1QGPA 2AXLA 3ZMDA 4G8XA 5K1YA 1JXSA 3WGHA 3KP4A 4I01A 3QRFF 2CGPA 4UV8A 1U5TA 3E6BA 1R00A 3GFMA 4FT8A 2P5KA 1U5TB 1W5SA 3NEUA 2PI0A 2W85A 4ENNA 2EK5A 4KN7X 2GIVA 3L09A 3OV8A 2AS5F 4IJAA 4GGGA 1OYWA 5L3DA 3F22A 1HQCA 2OBPA 1BI3A 1NHAA 2KIUA 1GXQA 1ZG3A 3KZZA 2R7DA 3HRTA 5IT9K 1F9NA 3E6DA 4RAZA 5IT3A 1S3JA 3ISPA 2GA2A 4ZZLA 1Z91A 2IW5A 3ZMVA 1YW9A 2PEXA 2ACJA 2YX4A 4UVAA 3B02A 1MGTA 3DP7A 5E8GA 4UUVA 4B09A 2IVMA 2OQRA 1UHWA 1AWCA 4O5VA 1FX7A 1MZBA 4OMYA 4LLNA 1D3YA 2CFXA 2WWYA 1Z9CA 2PJPA 3I71A 4D0PA 1I6XA 2EV5A 2ZKZA 5HDGA 3RIRA 1O3TA 2FSWA 3G73A 4MTDA 4I0AA 3Q9SA 4L9VA 4WCGA 1IXCA 1IW7F 1PP8F 1LDKB 2VOPA 1CF7A 2P4WA 4UXNA 3L00A 3J80Z 2STTA 1F5TA 2OD5A 3Q5FA 1JE8A 2VBYA 4MGRA 1XD7A 4AIJA 1CF7B 1F4KA 3IKTA 2EB7A 4EJVA 4A12A 2PBIA 4LB6B 1QZYA 5D8KB 5IT9Z 2F5FA 1MDMA 4LG0A 2WC2A 3R0JA 3V7CA 1BI1A 5DCMA 1IN6A 3HTSB 1S29A 3VOEA 5D5XB 1MDMB 4LG0B 3T5XA 1FYKA 2W24A 5DCMB 3V8KA 1WSUA 2PG4A 5D8LB 4XRFA 3I59B 4P9UA 1ZRDA 2HYFA 1ZH5A 1FOKA 1YIOA 2Z9OA 1SD7A 4IF4A 2IA1A 1XGMA 3E6MA 2MH9A 1P4AA 2QQAA 1ZRCA 2XKPA 2QQ9A 3CUQA 3GF2A 2BYVE 1TW3A 2HWVA 2VBXA 3PFIA 2ZCWA 4YFXF 2NRAC 3CUQB 5J8CA 5LEJA 2RQPA 4MTEA 2Q2EA 1UFMA 2FA5A 4OIOF 4U7DA 4MEXF 1QO0D 3ZQ7A 2A5YB 3DQVC 2CQKA 3WE3A 3H3ZA 1QZZA 1G3YA 1I1GA 3GWZA 1LNWA 2DI3A 3QP6A 2NNYA 5F1RA 1IRFA 3E5QA 2DT5A 4M6XA 3K9TA 5E1XA 3F21A 3FMSA 4L9JA 4QLCU 1EV7A 1EH8A 3GO5A 4ESFA 3L2CA 2P6SA 4AD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R23 A;  2MD5 A;  5E1Z B;  3FM5 A;  1KU3 A;  2K4B A;  5DDG A;  1I5Z A;  5HLH A;  1FNN A;  4LB5 A;  3HSF A;  1WWX A;  2VC1 A;  4MEY F;  4M71 A;  4FX0 A;  2CYY A;  1QNT A;  1J7K A;  3TOB A;  5TRD A;  4WXD A;  1U3E M;  1FYM A;  4QWQ A;  3F8N A;  3EET A;  2MC3 A;  1Z7U A;  1QQI A;  2F5D A;  5ILS A;  1CGP A;  4GCV A;  3WTW C;  4WX9 A;  2ZME A;  2O8X A;  2E7W A;  3JAM K;  1Z6T A;  3L9F A;  1HKS A;  2DAO A;  3VEP A;  2ZME B;  1T39 A;  1HW2 A;  3J7A O;  3N97 A;  3ZN1 A;  1ZYR F;  3LFK A;  2JT1 A;  4M6Y A;  1BC7 C;  2PLY A;  3E3V A;  4JBA A;  4ZH4 F;  2V1D A;  4I7H A;  3HHG A;  3SZP A;  2H94 A;  3N4M A;  3EUH A;  2FOK A;  2W57 A;  2COM A;  2RGV A;  1HW1 A;  1KU9 A;  4Q48 A;  4EM0 B;  2NNN A;  1EH6 A;  3O3K A;  3ZN0 A;  1GXP A;  2FML A;  1K78 B;  3BPX A;  4L9T A;  2YPR A;  2L4M A;  2MLK A;  2H6C A;  3F6O A;  3GVA A;  1FY7 A;  2KKO A;  6PAX A;  3E6C C;  2D2W A;  4PDK A;  2PQ8 A;  2VOO A;  2L3D A;  1BJA A;  4I02 A;  1SMT A;  4WF2 A;  5E17 F;  4P55 A;  1KU7 A;  2DTR A;  2QBY A;  5HDN A;  3W6K B;  5JHU A;  2XRO A;  3J81 Z;  1FYL A;  2O61 A;  2QBY B;  4Q4Z F;  2OU2 A;  1UCR A;  3HUG A;  3I64 A;  3LAJ A;  1BOA A;  2IJL A;  4L9N A;  1GVJ A;  2QQB A;  5LEK A;  2QZ8 A;  3MAJ A;  5AON A;  3KE2 A;  1C0W A;  5HS8 A;  2DBB A;  3ECO A;  5A2Q Z;  4HX8 A;  2EV6 A;  2DU9 A;  4RGX A;  1XN7 A;  2L02 A;  2VBW A;  3GZ5 A;  3TO7 A;  3BZ6 A;  3K69 A;  2RKH A;  4YG2 F;  1DP7 P;  2EJR A;  5FFZ A;  2ZO4 A;  3TO9 A;  1HXD A;  1XGN A;  3RYR A;  2A69 F;  1TW2 A;  1KYZ A;  2VON A;  4HQM A;  3JSP A;  2LKP A;  1P6R A;  3FXQ A;  4PGH A;  4ETS A;  3D0S A;  1FPQ A;  1J0R A;  1LB2 A;  4AIH A;  1AOY A;  3CDH A;  3JTG A;  1USS A;  2M30 A;  2QEN A;  4G6D A;  1FC3 A;  3FHZ A;  2B0L A;  1J2X A;  3ML6 A;  2XHK A;  1ZHF A;  1YS6 A;  3GEZ A;  1DPU A;  1Z05 A;  1L0O C;  1O57 A;  1ZLK A;  1YO5 C;  4I2O A;  1HST A;  1YFH A;  2P7V B;  1BM9 A;  2UXX A;  3SFZ A;  4L0Z B;  3TDU C;  4IVN A;  5ICG A;  1IAW A;  3BJO A;  1J75 A;  5D4S A;  1T38 A;  2Q8K A;  2CSO A;  4AVP A;  2IA2 A;  2X4H A;  1HSJ A;  1ZRF A;  3H3U A;  5LLQ A;  4KIF A;  4NHJ A;  4M73 A;  3V8L A;  5L3E A;  1XDS A;  3FX3 A;  3RKX A;  4KMF A;  4H0E A;  1ZRE A;  1R22 A;  1E2X A;  3CUQ C;  3MCZ A;  4N0B A;  5HOO A;  4M9Z A;  3IWZ A;  1ON2 A;  2H09 A;  2LF8 A;  3I53 A;  2F2E A;  5LRS A;  3T8R A;  1OKR A;  3O6B B;  3SZT A;  5JFR A;  5BOX A;  3E5U A;  2A07 F;  2O6G E;  1SD5 A;  2UWM A;  4NQW A;  4HOB A;  2TDX A;  1J59 A;  4A0Z A;  5JI6 A;  2WV0 A;  1QBJ A;  1O7F A;  2OA4 A;  4BHB A;  3QP5 A;  5LGT A;  2ADU A;  3OOP A;  3F8C A;  2O3F A;  1REP C;  1W7P A;  1KGS A;  3P9K A;  1IN7 A;  2M5W A;  3V4G A;  3D5L A;  3NQO A;  3J80 K;  4ZYE A;  4I09 A;  2K4J A;  4S04 A;  3EYI A;  3GXO A;  2J5O A;  3HOS A;  1UST A;  4PCQ A;  4LK1 F;  2HTS A;  3U2R A;  3DKW A;  5DD4 A;  5BQT A;  3ROU A;  1R1U A;  4A0X A;  3GYH X;  4EV0 A;  1B9M A;  2KRF A;  2O0Y A;  1WRJ A;  1MKM A;  4EJT A;  4K2E A;  1XSD A;  3MEX A;  2FU4 A;  2P7C B;  4OIN F;  4IHS A;  4G7H F;  5F64 A;  1BBY A;  1TNT A;  2NAZ A;  3WOD F;  3HYI A;  2XAF A;  4KIC A;  4G94 A;  2VT3 A;  1SD4 A;  2CWE A;  2E1C A;  3E97 A;  2R3S A;  1A04 A;  3KP5 A;  2QUF A;  2IRF G;  4LLG F;  3HTU A;  1S7A A;  4HF1 A;  3KP3 A;  5H20 A;  4EGZ A;  3RTR A;  3KEQ A;  1WKM A;  1OMI A;  4O3M A;  2OZ6 A;  2W25 A;  5DCF A;  5EEH A;  5CVU A;  2ISZ A;  1R5H A;  3R6S A;  4YFK F;  3KFW X;  4OOI A;  1F1Z A;  1BIB A;  1MJB A;  2EA4 A;  3C3W A;  4XSZ F;  1T2K A;  5TJJ A;  1VTN C;  4CYD A;  2FXA A;  3KLO A;  3IKV A;  2HKO A;  4A0Y A;  1ON1 A;  3KP7 A;  1MJ9 A;  3ZMZ A;  4A6E A;  1FP2 A;  1RUN A;  2WTE A;  1P4X A;  3GW2 A;  1TQM A;  1U6G A;  2CO5 A;  3LWF A;  4KIG A;  5CVI A;  4P9F A;  4BHC A;  1B6A A;  4HX7 A;  4B8X A;  3P9C A;  4WXH A;  3M8E A;  1YW7 A;  3WU0 A;  2UZK A;  3ZMT A;  3JW4 A;  3CO7 C;  3P9I A;  2XRN A;  1UB9 A;  4ZYD A;  2DQR A;  2YSR A;  5FLX K;  4KUM A;  1O3R A;  2XKO A;  3FMR A;  1ZGA A;  3IWF A;  5D6E A;  3U1D A;  4RAY A;  3V8J A;  4RGU A;  3I54 A;  2J5P A;  3ZMS A;  1FLI A;  4N9H A;  3DPL C;  3GFJ A;  1R36 A;  4BYY A;  2BBY A;  3DPT A;  4NB5 A;  5DYM A;  1R1T A;  1G3T A;  3V7S A;  5BS6 A;  2XAG A;  5K5R A;  4OIR F;  1TQI A;  4L0Y B;  4XSX F;  4MNU A;  3MFK A;  1XCV A;  4HF0 A;  3VOD A;  2MLG A;  2ZBK A;  2YX7 A;  3BDD A;  4HDV A;  1V4R A;  4S05 A;  2FMY A;  2IP2 A;  2Y48 A;  2NYX A;  2P6T A;  5BPD A;  5H6Q A;  4LD5 A;  1YG2 A;  2FRH A;  1R7J A;  1RNL A;  1J5Y A;  3CUO A;  3QOP A;  2ESN A;  5JR3 A;  2DPD A;  2DK8 A;  4M74 A;  5CVR A;  4IRG A;  2GA1 A;  1O3Q A;  5JVT A;  2VC0 A;  1Q1H A;  5FO5 A;  5LHI A;  4RB1 A;  2EFQ A;  3WTV C;  4CHU A;  3DV8 A;  3GZ6 A;  4IRI A;  3SQN A;  4U7B A;  5AIP A;  3BRO A;  5FLX Z;  1S6L A;  3ZP5 A;  1R5G A;  4YIF A;  3J81 K;  3BJA A;  3I4P A;  4CDG A;  2RC4 A;  4YII A;  4G7Z F;  2D1H A;  1ONV A;  4PGG A;  1K7A A;  4CGZ A;  4EVI A;  2V1U A;  2XIG A;  4HV6 A;  4Q47 A;  3PQJ A;  4Y13 A;  1UHM A;  2M45 A;  3WTU C;  3FZV A;  2GZW A;  4M9X A;  1YW8 A;  3W6J B;  5A2Q K;  2L4A A;  2EFW A;  4CO8 A;  3KZY A;  4ZYH A;  3QU3 A;  5ILU A;  2OAZ A;  2ETH A;  2HDC A;  4OMZ A;  1HKQ A;  3KET A;  4YFN F;  3I5U A;  1D5V A;  2LDU A;  4CIC A;  3IL2 A;  4HDU A;  2LF7 A;  2EFP A;  3IHU A;  1MD0 A;  1G4D A;  2FNP A;  2ZXJ A;  5D5W B;  4M72 A;  1IXR C;  4HAM A;  2O03 A;  5CLS A;  5L3B A;  5E8I A;  4KDP A;  1IN5 A;  2MA3 A;  5E20 A;  4MHG A;  3SHF A;  3TGN A;  3QPH A;  4JQF A;  3SXY A;  1STZ A;  4L18 B;  1BN5 A;  1ZAR A;  3R60 A;  4ENJ A;  2Y0M A;  1YQA A;  4HX4 A;  1TLH B;  3IRR A;  4FHT A;  1XGS A;  2IPQ X;  4BAY A;  4ON0 A;  2Z3Y A;  5KVR A;  4UNO A;  2DFI A;  4R8H A;  3DF8 A;  3R61 A;  1ULY A;  3FXU A;  3VB2 A;  2JTV A;  3RKY A;  1KYW A;  2V9V A;  1FBQ A;  1X3U A;  4L5J A;  3LQR A;  3R0A A;  4ENK A;  4EJW A;  2D1V A;  4G9Y A;  2M1B A;  3BPV A;  1FWZ A;  2FE3 A;  3RI4 A;  3TQN A;  2A3S A;  4RB3 C;  4RGR A;  3S2W A;  1B4A A;  4MQV A;  1T98 A;  4M9S A;  1W4M A;  1K79 A;  5LBQ A;  1KU2 A;  1JGS A;  2HOE A;  4IPA A;  2ELH A;  3HOT A;  3BOQ A;  1XMA A;  4I0B A;  5LGN A;  1GHC A;  2EA2 A;  2P8T A;  3FM3 A;  3PQK A;  5L3F A;  2FNA A;  4AWX B;  5HVQ C;  1TBX A;  4A2U A;  1DUX C;  4UV9 A;  4ZZD A;  1FBU A;  1XB4 A;  1SD6 A;  2JSC A;  2NS0 A;  1WQ2 A;  3WGI A;  1PP7 U;  2KIF A;  2RDP A;  1FT9 A;  1R1V A;  3TDZ C;  2BV6 A;  2E7X A;  2A6H F;  4P5O A;  2HFH A;  3DXJ F;  3CLO A;  3QU6 A;  2PMU A;  4GXO A;  1G3W A;  3TKY A;  2CG4 A;  1B1B A;  1RIO H;  4A5M A;  3F8M A;  1YS7 A;  5HDK A;  3ULQ B;  1G3S A;  4AIK A;  3K0L A;  3BP8 A;  2FBI A;  3LA2 A;  2XVC A;  3IC7 A;  2K02 A;  2VXZ A;  2HEO A;  1H9G A;  2VBZ A;  3BY6 A;  4BNC A;  1BIA A;  2JZY A;  4HQE A;  4UHT A;  1SFX A;  1ZLJ A;  3I58 A;  1W7P D;  3ABT A;  2HTJ A;  4HZF A;  4E70 A;  1OYY A;  3B73 A;  2G9W A;  5HS7 A;  1E17 A;  5LRR A;  2DPU A;  5ICE A;  2RVC A;  3COA C;  3EQL F;  2W84 A;  5KK1 A;  3WE2 A;  5ED4 A;  3ELK A;  1W7P B;  2STW A;  1WI9 A;  3R4K A;  4O6J A;  2DW4 A;  4BH9 A;  4RB2 C;  4G6Q A;  4IHT A;  1ODD A;  3HIF A;  1V3F A;  2PMH A;  5EEG A;  3HRU A;  3FMQ A;  2C6Y A;  2XGX A;  5AIQ A;  2Q0O A;  3H92 A;  3M1E A;  2EWN A;  2BEO A;  1TNS A;  2XAS A;  3KCC A;  1IN8 A;  2E1N A;  1SFU A;  4KFC A;  5HLI A;  4I98 B;  4UVC A;  1ZAO A;  4HLX A;  1OYI A;  4HW0 A;  2PFB A;  3GFI A;  3GUD A;  1RZ4 A;  4Q5S F;  4EMS A;  3K1P A;  1KQ9 A;  3HHH A;  4ESJ A;  2ISY A;  3F23 A;  2EFN A;  2F5C A;  4R79 A;  2KJB A;  5DUI A;  1O3S A;  3O2P E;  1DDN A;  2BGC A;  2GAU A;  1ZG5 A;  5LGU A;  3ABU A;  2JPC A;  3WGG A;  1PDN C;  2A68 F;  5ICC A;  4WWC A;  3FWE A;  3KLN A;  3LST A;  5FB2 A;  2ZJ2 A;  1U78 A;  1JHH A;  1IXS B;  2YU3 A;  2JRT A;  3FXR A;  4G7O F;  2GQQ A;  1LJ9 A;  2PN6 A;  2H6B A;  1XCB A;  4BHP A;  4HA8 A;  4U0Y A;  2G7H A;  3C1D A;  2G7U A;  2FEZ A;  3MWM A;  1FZP B;  1MJA A;  1L3L A;  1KQ0 A;  4R1H A;  2Z5U A;  1ZGJ A;  1BI2 A;  4CZZ A;  4LLL A;  1RI7 A;  3WTT C;  1W5T A;  3Q9V A;  5ERI A;  2R7F A;  2MBF A;  1XDU A;  3ZPL A;  1D8K A;  1B59 A;  3KEO A;  2M87 A;  2HQN A;  1LDD A;  2Y75 A;  1EH7 A;  4EQQ A;  3I59 A;  2GXB A;  2GWR A;  2A6E F;  4HLY A;  3WG9 A;  3CJN A;  5CYV A;  3C7J A;  5DUK A;  2MH2 A;  1YTY A;  3RYP A;  2K27 A;  3KP6 A;  2JPB A;  3JTH A;  2QVO A;  3LAP A;  4LGW A;  3AAF A;  1SFE A;  3RKW A;  4CXF A;  1TTY A;  2CW0 F;  4GO1 A;  4RGS A;  5FGM A;  3REO A;  2LSO A;  2ZNZ A;  3BWG A;  4BQA A;  1FSE A;  4EGY A;  4TV7 A;  4KYW A;  3GLX A;  3U9G A;  5CVV A;  1G6N A;  2QYO A;  3LQQ A;  3VFZ A;  2OQG A;  4N9I A;  2EFO A;  4HYE A;  4OIQ F;  1B9N A;  1SAX A;  1HW5 A;  3I0T A;  1P92 A;  2XAJ A;  1U2W A;  4EJO A;  1KQ8 A;  4EM2 A;  3CO6 C;  3IRQ A;  4ENM A;  2XAQ A;  3RJP A;  3F3X A;  1ZN2 A;  1P2F A;  3GX4 X;  2D45 A;  3M9A A;  3EYY A;  3WTZ A;  3HRM A;  3WTS C;  4KN4 X;  4JK1 X;  3HSR A;  2FQ3 A;  1DPR A;  3K1N A;  4RS8 A;  3P7N A;  1I1S A;  4U0V A;  3F72 A;  3L7W A;  3T0Y A;  4U88 A;  5CVJ A;  2GXG A;  4Y17 A;  2XUB A;  2P5L C;  5DV5 A;  2KIM A;  3WU1 B;  3TO6 A;  2ZNY A;  1IF1 A;  1YLF A;  2DO7 A;  3F8B A;  3EDP A;  1LDJ A;  1PUE E;  2L01 A;  4GYI A;  2HYG D;  3FF5 A;  5HLG A;  1IUY A;  1LVA A;  2UXN A;  1FBS A;  3T1B A;  1HBX G;  2HQR A;  3F6V A;  4ZYG A;  5DEQ A;  1U5T C;  4GYG A;  2XV4 S;  2ESH A;  5CJ9 A;  4MQ9 F;  4PZJ A;  1Z6R A;  3NRV A;  4XLP F;  1IN4 A;  3F8F A;  2DQL A;  5BPI A;  2QWW A;  1FSH A;  1K78 A;  2HGC A;  1I27 A;  2VE9 A;  1FP1 D;  3WTY C;  2HS5 A;  5FD5 A;  4L5I A;  1P4W A;  2FBH A;  1H9T A;  4OIP F;  5J6X A;  5DD8 A;  2A61 A;  4LFU A;  4A6D A;  4F7Z A;  1YYV A;  4UVB A;  2RV8 A;  5F6F A;  2XAH A;  4WK8 F;  5H6R A;  3HRS A;  2YR2 A;  5D5U B;  1KA8 A;  5HS9 A;  3CTA A;  4Y15 A;  1ZG1 A;  5D4R A;  4KA4 A;  2FBK A;  4BXU A;  1TQP A;  2QM3 A;  4KIB A;  1XSX A;  1O7L A;  2HKX A;  3K1M A;  1BC8 C;  1IRG A;  2QLZ A;  2V6C A;  5BMZ A;  3M7G A;  1IZ1 A;  4EJU A;  2LNB A;  2HR3 A;  4U0W A;  3M8F A;  1XMK A;  3JAM Z;  4P96 A;  2RNJ A;  3RDI A;  1T0F A;  2F5E A;  2K86 A;  4A5N A;  3MQ0 A;  3K2Z A;  1XSV A;  3LA7 A;  3QPT A;  2VT2 A;  2FF4 A;  4ASN A;  4DNC A;  3RPU A;  2IT0 A;  1T6S A;  3C18 A;  5LHG A;  3HSE A;  1JHF A;  2DLL A;  3WTX C;  2VE8 A;  5E18 F;  2V79 A;  5FD6 A;  4IRH A;  5L3C A;  3MZH A;  1OPC A;  3BJ6 A;  1S7O A;  4EM1 A;  3T8T A;  1LEB A;  5K5Q A;  4ESB A;  3QAH A;  2K7L A;  3DEU A;  4OU0 A;  5FFX A;  2BE5 F;  3MZY A;  1H0M A;  2V1X A;  1U8R A;  5L3G A;  4LK0 F;  4HF2 A;  5ILV A;  2HZT A;  5E1W A;  5LHH A;  1D8J A;  4IXA A;  3ZMU A;  3ERE D;  1K6O A;  2ZFW A;  1RUO A;  1QPM A;  4LJZ F;  1HKT A;  4DQ2 A;  2X0L A;  5D5V B;  4KMU X;  2RN7 A;  3V7R A;  1R58 A;  3ECH A;  2VN2 A;  5J8F A;  1Z1D A;  2EV0 A;  5D6F A;  2KJC A;  5K5O A;  1J9I A;  1LEA A;  3LA3 A;  4HV5 A;  1LQ1 A;  3G3Z A;  4XBF A;  2DK5 A;  2P5V A;  1OR7 A;  1S8N A;  5ICF A;  4RB0 A;  2IA0 A;  2H27 A;  3KP2 A;  1XGO A;  2OZU A;  4KNY A;  3DFG A;  4FX4 A;  3JSO A;  1SMY F;  3GFL A;  3E5X A;  1Y0U A;  2M8E A;  4KT5 C;  4HBL A;  3TOA A;  4XLN F;  4Z2Y A;  2L54 A;  2VOD A;  4WXC A;  4LMY A;  3RPQ A;  1BI0 A;  2Z99 A;  2Z33 A;  1QGP A;  2AXL A;  3ZMD A;  4G8X A;  5K1Y A;  1JXS A;  3WGH A;  3KP4 A;  4I01 A;  3QRF F;  2CGP A;  4UV8 A;  1U5T A;  3E6B A;  1R00 A;  3GFM A;  4FT8 A;  2P5K A;  1U5T B;  1W5S A;  3NEU A;  2PI0 A;  2W85 A;  4ENN A;  2EK5 A;  4KN7 X;  2GIV A;  3L09 A;  3OV8 A;  2AS5 F;  4IJA A;  4GGG A;  1OYW A;  5L3D A;  3F22 A;  1HQC A;  2OBP A;  1BI3 A;  1NHA A;  2KIU A;  1GXQ A;  1ZG3 A;  3KZZ A;  2R7D A;  3HRT A;  5IT9 K;  1F9N A;  3E6D A;  4RAZ A;  5IT3 A;  1S3J A;  3ISP A;  2GA2 A;  4ZZL A;  1Z91 A;  2IW5 A;  3ZMV A;  1YW9 A;  2PEX A;  2ACJ A;  2YX4 A;  4UVA A;  3B02 A;  1MGT A;  3DP7 A;  5E8G A;  4UUV A;  4B09 A;  2IVM A;  2OQR A;  1UHW A;  1AWC A;  4O5V A;  1FX7 A;  1MZB A;  4OMY A;  4LLN A;  1D3Y A;  2CFX A;  2WWY A;  1Z9C A;  2PJP A;  3I71 A;  4D0P A;  1I6X A;  2EV5 A;  2ZKZ A;  5HDG A;  3RIR A;  1O3T A;  2FSW A;  3G73 A;  4MTD A;  4I0A A;  3Q9S A;  4L9V A;  4WCG A;  1IXC A;  1IW7 F;  1PP8 F;  1LDK B;  2VOP A;  1CF7 A;  2P4W A;  4UXN A;  3L00 A;  3J80 Z;  2STT A;  1F5T A;  2OD5 A;  3Q5F A;  1JE8 A;  2VBY A;  4MGR A;  1XD7 A;  4AIJ A;  1CF7 B;  1F4K A;  3IKT A;  2EB7 A;  4EJV A;  4A12 A;  2PBI A;  4LB6 B;  1QZY A;  5D8K B;  5IT9 Z;  2F5F A;  1MDM A;  4LG0 A;  2WC2 A;  3R0J A;  3V7C A;  1BI1 A;  5DCM A;  1IN6 A;  3HTS B;  1S29 A;  3VOE A;  5D5X B;  1MDM B;  4LG0 B;  3T5X A;  1FYK A;  2W24 A;  5DCM B;  3V8K A;  1WSU A;  2PG4 A;  5D8L B;  4XRF A;  3I59 B;  4P9U A;  1ZRD A;  2HYF A;  1ZH5 A;  1FOK A;  1YIO A;  2Z9O A;  1SD7 A;  4IF4 A;  2IA1 A;  1XGM A;  3E6M A;  2MH9 A;  1P4A A;  2QQA A;  1ZRC A;  2XKP A;  2QQ9 A;  3CUQ A;  3GF2 A;  2BYV E;  1TW3 A;  2HWV A;  2VBX A;  3PFI A;  2ZCW A;  4YFX F;  2NRA C;  3CUQ B;  5J8C A;  5LEJ A;  2RQP A;  4MTE A;  2Q2E A;  1UFM A;  2FA5 A;  4OIO F;  4U7D A;  4MEX F;  1QO0 D;  3ZQ7 A;  2A5Y B;  3DQV C;  2CQK A;  3WE3 A;  3H3Z A;  1QZZ A;  1G3Y A;  1I1G A;  3GWZ A;  1LNW A;  2DI3 A;  3QP6 A;  2NNY A;  5F1R A;  1IRF A;  3E5Q A;  2DT5 A;  4M6X A;  3K9T A;  5E1X A;  3F21 A;  3FMS A;  4L9J A;  4QLC U;  1EV7 A;  1EH8 A;  3GO5 A;  4ESF A;  3L2C A;  2P6S A;  4AD9 A; 
#chains in the Genus database with same CATH topology
 1R23 A;  2MD5 A;  5E1Z B;  3FM5 A;  1LFU P;  1KU3 A;  2K4B A;  5DDG A;  3PJR A;  3AKZ A;  4XOT A;  1I5Z A;  5HLH A;  1FNN A;  2ZXI A;  4A69 C;  4MFE A;  4LB5 A;  2E71 A;  1DGR M;  3HSF A;  1WWX A;  3GTQ J;  3JRF A;  3OR2 C;  2VC1 A;  2JA5 J;  1SAU A;  3OIO A;  1MBG A;  1W0U A;  4MEY F;  4M71 A;  4FX0 A;  2CYY A;  2M4G A;  1QNT A;  4CZC A;  4AC0 A;  1J7K A;  1LFP A;  3TOB A;  2P81 A;  5TRD A;  4WXD A;  2TRT A;  1U3E M;  2DMN A;  2FX0 A;  1FYM A;  5KHD A;  4QWQ A;  3F8N A;  4JX4 A;  3EET A;  3A1Y A;  2MC3 A;  1Z7U A;  1QQI A;  2F5D A;  5IP6 A;  3JRC A;  5ILS A;  1CGP A;  1BOB A;  4PJJ A;  4GCV A;  2IBD A;  3WTW C;  4DOZ A;  4WX9 A;  2ZME A;  2O8X A;  3I4M J;  1W36 C;  2E7W A;  3RCO A;  3JAM K;  1Z6T A;  2X48 A;  3L9F A;  4XNF A;  2X6X A;  1HKS A;  2DAO A;  3VEP A;  2ZME B;  3GME A;  1T39 A;  1HW2 A;  3J7A O;  3J7Y J;  3SEZ A;  1Y0N A;  3N97 A;  3ZN1 A;  1MBK A;  1ZYR F;  2R0Q C;  1TWG J;  2CV0 A;  2VXD A;  5IYC J;  3LFK A;  2JT1 A;  4ITV A;  4M6Y A;  2R7T A;  1BC7 C;  2PLY A;  3MKY B;  3E3V A;  4JBA A;  4ZH4 F;  1IUF A;  2V1D A;  1IGN A;  3H9G A;  4I7H A;  4BQO A;  1ACI A;  3HHG A;  3SZP A;  2L9N A;  2H94 A;  3N4M A;  3L2W A;  2VKD A;  3EUH A;  2FOK A;  2W57 A;  3S3N A;  4DYQ A;  2COM A;  2RGV A;  1HW1 A;  1KU9 A;  4E7L A;  4Q48 A;  4HRI A;  3CCL I;  4EM0 B;  4AUX A;  2BY2 A;  2NNN A;  4II2 A;  1EH6 A;  1OJL A;  3O3K A;  2YUS A;  3ZN0 A;  1GXP A;  3S2D J;  3V42 A;  2FML A;  3PO2 J;  1MNM C;  2GOM A;  1K78 B;  3BPX A;  4L9T A;  2YPR A;  2L4M A;  2MLK A;  1TWA J;  2EIM H;  2H6C A;  3F6O A;  3GVA A;  1FY7 A;  2A05 A;  1X19 A;  2KKO A;  6PAX A;  2MGQ A;  2D2W A;  3E6C C;  4PDK A;  2PQ8 A;  2VOO A;  2L3D A;  3HOW J;  4CUG A;  1YHQ I;  4XL9 A;  1U9O A;  2HOT A;  1ETQ A;  1MMD A;  4CCO A;  1BJA A;  3EUA A;  4I02 A;  1SMT A;  3W2W A;  4WF2 A;  2E36 A;  5E17 F;  4KT6 A;  4P55 A;  1KU7 A;  3H5R A;  2LMD A;  1N77 A;  4C9Y A;  2DTR A;  2QBY A;  3H9J A;  4H4K C;  3DKY A;  5HDN A;  4V2G A;  3W6K B;  5JHU A;  4S0H B;  2DT7 B;  1WJD A;  2XRO A;  3J81 Z;  1FYL A;  3HKZ A;  2O61 A;  3IAS 2;  3CF5 F;  4FE7 A;  1MMN A;  2QBY B;  4Q4Z F;  2OU2 A;  3I9V 2;  1UCR A;  3HUG A;  4I76 A;  3I64 A;  3LAJ A;  5JHF A;  1GT0 C;  1BOA A;  2R7V A;  2IJL A;  4BS9 A;  4L9N A;  1GVJ A;  2QQB A;  3LSJ A;  5LEK A;  2QZ8 A;  3CDI A;  3MAJ A;  5AON A;  3KE2 A;  3RPU D;  5KNL A;  1C0W A;  5HS8 A;  3X2Q H;  2X6Y A;  3CCJ I;  2DBB A;  3ECO A;  1G2H A;  5EGO A;  5A2Q Z;  4HX8 A;  2EV6 A;  1POG A;  4HNU A;  2DU9 A;  2E5Z A;  4RGX A;  1XG1 A;  1XN7 A;  1Y6I A;  2UUZ A;  2IS6 A;  2X6W A;  2L02 A;  2VBW A;  3WU2 C;  2OTJ I;  3GZ5 A;  1TT5 B;  3TO7 A;  3BZ6 A;  4AID A;  2EZK A;  3K69 A;  1ENH A;  4DBQ A;  2RKH A;  3DBH B;  5EGO B;  4YG2 F;  1DP7 P;  2EJR A;  1MNE A;  5BNG A;  5FFZ A;  4BJT A;  2ZO4 A;  3TO9 A;  1HXD A;  2CMP A;  1HF0 A;  3LSR A;  1XGN A;  2ECC A;  3RYR A;  2A69 F;  3SJM A;  4IL6 C;  3PNV A;  1TW2 A;  1KYZ A;  3CES A;  3HB9 A;  4HQM A;  2VON A;  3JSP A;  2LKP A;  1P6R A;  1WGX A;  1AKH A;  3FXQ A;  4PGH A;  4ETS A;  3D0S A;  1FPQ A;  3DCF A;  1J0R A;  1LB2 A;  2Y0S A;  4AIH A;  1AOY A;  2DJI A;  3G71 I;  3CDH A;  3BQY A;  2K9L A;  4BUP A;  3JTG A;  4E7Z A;  2OPT A;  1USS A;  3C2B A;  1AKH B;  2H1K A;  3CC7 I;  2M30 A;  3CCQ I;  4HPQ A;  2QEN A;  4G6D A;  2JA2 A;  1FC3 A;  3FHZ A;  2B0L A;  1J2X A;  3ML6 A;  2R5Z A;  2E1O A;  4DGW B;  3ASN H;  2XHK A;  1ZHF A;  1YS6 A;  3GEZ A;  1DPU A;  1Z05 A;  2HDW A;  2DXI A;  1L0O C;  1O57 A;  4IHY A;  5IYB J;  1ZLK A;  2H1L A;  1VI0 A;  1YO5 C;  3GCM A;  3L2U A;  1HST A;  2EQR A;  2E35 A;  4I2O A;  1YFH A;  2P7V B;  1BM9 A;  2R5Z B;  1YE9 A;  2UXX A;  4AYB N;  4C3J J;  1VQ7 I;  3SFZ A;  4L0Z B;  3HOX J;  3TDU C;  5CQE A;  4IVN A;  5ICG A;  1IAW A;  3BJO A;  1J75 A;  3M8J A;  1ITY A;  4HEA 2;  5D4S A;  1VF9 A;  1T38 A;  2Q8K A;  2CSO A;  2F4O B;  3HPG A;  4AVP A;  2IA2 A;  2HXI A;  2X4H A;  5F08 A;  1HSJ A;  1ZRF A;  3H3U A;  1FOW A;  5LLQ A;  2B9S A;  1MND A;  4KIF A;  4NHJ A;  4M73 A;  3V8L A;  5L3E A;  4XLC A;  4QTR A;  2JA8 J;  1XDS A;  5B1A H;  4XON A;  2MW8 A;  3FX3 A;  3RKX A;  4KMF A;  4H0E A;  1ZRE A;  2WY8 Q;  1R22 A;  4Z6Y A;  2XDV A;  2G0E A;  1E2X A;  4BBS J;  3CLQ A;  3CUQ C;  1Z21 A;  3S8P A;  3MCZ A;  3IAM 2;  2GOX B;  4X0G A;  1YX3 A;  4N0B A;  5HOO A;  3FIW A;  4M9Z A;  5DTD A;  3IWZ A;  3WHC A;  5KCM A;  2MYS A;  3EUK L;  1ON2 A;  2H09 A;  3KEY A;  4DYR A;  2LF8 A;  4A3C J;  3I53 A;  3RSN A;  2F2E A;  5LRS A;  3T8R A;  1OKR A;  3O6B B;  2M2E A;  3B6C A;  3SZT A;  3OYN A;  2OCC H;  5JFR A;  3GLL A;  2HZD A;  4JX6 A;  1XMX A;  2CW8 A;  3E5U A;  5BOX A;  2A07 F;  2X1E A;  2O6G E;  3QPS A;  4A3G J;  1SD5 A;  2HVS A;  2KIQ A;  3OL3 A;  3OS0 A;  2UWM A;  2DA6 A;  3GTK J;  4NQW A;  3ZR8 X;  5IYD J;  1QU3 A;  3OYL A;  4HOB A;  2K85 A;  2TDX A;  4BL0 B;  1J59 A;  4A0Z A;  5JI6 A;  2WV0 A;  1GLN A;  4A3J J;  1QBJ A;  1O7F A;  4NQW B;  5FKK A;  4DZJ A;  2OA4 A;  4BHB A;  1OIS A;  4RDU A;  3LSG A;  4F3Q A;  1MSF C;  3QP5 A;  5LGT A;  2CW7 A;  2LKX A;  2ADU A;  3OOP A;  2O8K A;  3GTO J;  3F8C A;  2O3F A;  1REP C;  1W7P A;  2PJR A;  1KGS A;  3P9K A;  3F0C A;  1IN7 A;  2M5W A;  3V4G A;  3D5L A;  3NQO A;  4XKW A;  2EIL H;  3J80 K;  4ZYE A;  4I09 A;  2GBY A;  2K4J A;  4M3E A;  3GXO A;  4S04 A;  2J5O A;  3EYI A;  3ZXS A;  3HOS A;  1UST A;  1YIJ I;  4M3G A;  2ZSH B;  4PCQ A;  5GP9 A;  4LK1 F;  2PJR B;  2HTS A;  3U2R A;  3DKW A;  3BR1 A;  2WB1 A;  3AL0 C;  5DD4 A;  5BQT A;  4IX7 A;  3SFI A;  3ROU A;  3J7Z I;  3PIO F;  1R1U A;  4G6T B;  2XGC A;  5F27 A;  3OMY A;  4IKF A;  4A0X A;  3GYH X;  4EV0 A;  3S15 J;  1ZQ3 P;  1QVT A;  1B9M A;  4D5C A;  2KRF A;  2O0Y A;  1WRJ A;  5J4V A;  4EEF G;  1MKM A;  2KMU A;  4EJT A;  4OWR B;  4K2E A;  3H5A A;  1XSD A;  3MEX A;  2FU4 A;  2P7C B;  4BY7 J;  4OIN F;  4IHS A;  4G7H F;  4PK4 A;  5F64 A;  4CSW A;  1BBY A;  1TNT A;  3I3L A;  3DPU A;  1QRY A;  3UNG C;  2W82 A;  2NAZ A;  3WOD F;  3HYI A;  2DFF A;  1X4O A;  2XAF A;  1YOV B;  2XB0 X;  1X2N A;  4XRS A;  2E2J J;  4JYK A;  4KIC A;  4G94 A;  2VT3 A;  1SD4 A;  2CWE A;  2E1C A;  2GXA A;  3E97 A;  2R3S A;  1A04 A;  4AVZ A;  3GBG A;  3KP5 A;  1OQY A;  2IXS A;  1SVL A;  3OWT A;  1HOM A;  2QUF A;  2IRF G;  1NK2 P;  4LLG F;  3LSM A;  3HTU A;  1S7A A;  3HOY J;  4HF1 A;  3E7L A;  3S1Q J;  3KP3 A;  2HOA A;  3KX2 A;  5H20 A;  4EGZ A;  2B7E A;  2KIS A;  5F0F A;  2WA0 A;  3RTR A;  3ABM H;  3KEQ A;  4ZC3 A;  2R7U A;  3O8G A;  1WKM A;  1OMI A;  4O3M A;  4I99 C;  3WG7 H;  2OZ6 A;  3KYD B;  2W25 A;  4J19 A;  1Y1V J;  5DCF A;  1T33 A;  5EEH A;  5CVU A;  2V1N A;  3CF2 A;  1K4S A;  1U9N A;  5J1U A;  2DCE A;  1R5H A;  4RMN A;  2ISZ A;  2ZB9 A;  3LSI A;  3R6S A;  4MFD A;  2NVQ J;  4YFK F;  3KFW X;  4OOI A;  4BBR J;  3ZQL A;  1B8I B;  3VDX A;  1F1Z A;  2AXT C;  1RR7 A;  3SZG A;  2HOS A;  1NH3 A;  1JUP A;  3GTM J;  4B48 A;  4A3K J;  3LSP A;  1BIB A;  1MJB A;  2EA4 A;  3G1L A;  3C3W A;  4XSZ F;  1T2K A;  5LFA A;  5TJJ A;  1VTN C;  3A02 A;  2KP6 A;  2CH0 A;  3PNY A;  3BT9 A;  4CYD A;  3G2B A;  3OS2 A;  1ETV A;  2FXA A;  3KLO A;  2H8R A;  3IKV A;  2WAQ A;  1NK3 P;  1VQ4 I;  1T95 A;  2HKO A;  1WH5 A;  4A0Y A;  3MKZ A;  2E2I J;  1ON1 A;  1J09 A;  2W00 A;  3KP7 A;  1MJ9 A;  2L7M P;  3OYG A;  1MMS A;  3ZMZ A;  3MVP A;  4A6E A;  1FP2 A;  1RUN A;  3H9Q A;  3TL4 X;  2WTE A;  4JP0 A;  1P4X A;  5F1J A;  2R7R A;  1TWC J;  3BC8 A;  3CJR B;  3GW2 A;  1JT0 A;  1UJ8 A;  2XB5 A;  1TQM A;  1U6G A;  3ZQC A;  1D1A A;  2CO5 A;  3LWF A;  4KIG A;  1P7I A;  5CVI A;  1RET A;  4P9F A;  5J3L A;  3CJQ B;  4BHC A;  1A6Q A;  1VQO I;  1B6A A;  4HX7 A;  4B8X A;  1HA8 A;  3P9C A;  3JRI A;  4WXH A;  1Y56 A;  4LOC A;  1NG7 A;  2K9Q A;  2M9H A;  3JRD A;  2M0C A;  3M8E A;  1E0E A;  1IC8 A;  3BTJ A;  1YW7 A;  2NVY J;  3WU0 A;  1UG0 A;  5FKN A;  2UZK A;  3ZMT A;  5K7Z A;  3JW4 A;  3OS1 A;  3BG6 A;  3CO7 C;  3P9I A;  2XRN A;  9ANT A;  1UB9 A;  4PSW A;  4ZYD A;  4PFO A;  3PIP F;  2KZV A;  3A01 A;  3OYC A;  2DQR A;  1A6I A;  2YSR A;  3H5N A;  3K4M A;  4KUM A;  1O3R A;  5FLX K;  4CH7 A;  2XKO A;  1Z67 A;  3BZK A;  2EH3 A;  3CDL A;  3VYT B;  5GTH C;  3FMR A;  1ZGA A;  3EPZ A;  3IWF A;  5D6E A;  3U1D A;  4RAY A;  3CC2 I;  3V8J A;  3SDB A;  3A01 B;  3KZI C;  4RGU A;  4BDZ A;  3I54 A;  1DU0 A;  2J5P A;  3ZMS A;  1FLI A;  5JLW A;  3CCR I;  2Y0S N;  4N9H A;  5DS9 A;  3DPL C;  3GFJ A;  2EPF A;  1BR2 A;  1R36 A;  1RKT A;  2BBY A;  4BYY A;  5C4J J;  1LE8 A;  3DPT A;  4NB5 A;  5DYM A;  1R1T A;  3Q0V A;  3TMO A;  4D7N A;  1G3T A;  2K3F A;  2I10 A;  3V7S A;  2CU7 A;  1E3H A;  3B6A A;  5BS6 A;  1ETX A;  2XAG A;  5K5R A;  4OIR F;  1TQI A;  1LE8 B;  2Y2Z A;  4L0Y B;  4XSX F;  1JTY A;  2HQ5 A;  4MNU A;  3MFK A;  4N4N B;  1XCV A;  1EJ9 A;  2X6O A;  2Y9Y A;  1Z77 A;  4HF0 A;  3QYF A;  3VOD A;  2MLG A;  2ZBK A;  3FXM A;  1T8I A;  3S17 J;  2YX7 A;  3DBR B;  2ZXH A;  3W3C A;  1BR1 A;  1KON A;  5GPC A;  4PUS A;  4HST A;  3BDD A;  3LMM A;  4HDV A;  1V4R A;  4S05 A;  2N8G A;  2FMY A;  2IP2 A;  2Y48 A;  1I3A A;  2HNH A;  1XPX A;  2NYX A;  4E7S A;  2P6T A;  1H89 C;  2R92 J;  2W7N A;  5BPD A;  3VSK A;  3CZ6 A;  5B5E C;  3I55 I;  1R6R A;  5H6Q A;  3K70 C;  4LD5 A;  2DOD A;  1YG2 A;  2FRH A;  1UG2 A;  3TED A;  3DWL E;  1R7J A;  1JKP C;  5EG0 A;  1RNL A;  1J5Y A;  1D0Y A;  4OAZ A;  1X3Z B;  2MFZ A;  3CUO A;  1TL8 A;  2LD5 A;  3QOP A;  2ESN A;  3OSG A;  5JR3 A;  4A3E J;  2M4K A;  4XN0 A;  2ZJQ F;  2DK8 A;  3OYB A;  2DPD A;  5JLX A;  3W2A A;  4M74 A;  5CVR A;  2NVT J;  4IRG A;  1K4T A;  2GA1 A;  1O3Q A;  2BHZ A;  1WH7 A;  5JVT A;  2VC0 A;  1Q1H A;  5EG0 B;  2DDB A;  5FO5 A;  5LHI A;  5JVG F;  2R7W A;  4RB1 A;  1A31 A;  2EFQ A;  3WTV C;  1XS9 A;  2HPI A;  4CHU A;  3DV8 A;  2LRE A;  3GZ6 A;  4RBO A;  4IRI A;  2R5Y A;  3SQN A;  4U7B A;  5AIP A;  3VYR B;  1MH4 A;  3BRO A;  5FLX Z;  1W1W E;  3CMA I;  1VQ5 I;  3CJT B;  1S6L A;  3RZD J;  3ZP5 A;  1R5G A;  4YIF A;  2A5W A;  3J81 K;  3BJA A;  3I4P A;  5M5Y J;  2VIX A;  3OYI A;  4CDG A;  2RC4 A;  3QYE A;  4YII A;  4G7Z F;  2D1H A;  2R5Y B;  1ONV A;  3AL0 B;  4PGG A;  1K7A A;  5FLV A;  4CGZ A;  4IHX A;  4B1R A;  4BQN A;  3HDD A;  4EVI A;  5GAG J;  2V1U A;  3SDG A;  2XIG A;  4HV6 A;  4Q47 A;  1BL0 A;  4BEH A;  3PQJ A;  4Y13 A;  1WJ5 A;  2KLO A;  4NUB A;  1UHM A;  4RM2 A;  2IS1 A;  2M45 A;  3WTU C;  3HOZ J;  3FZV A;  3HG9 A;  2GZW A;  4BEH B;  4D5F A;  3PUB A;  3DU6 A;  4M9X A;  2IGK A;  1YW8 A;  4XKB A;  3W6J B;  5A2Q K;  4A3D J;  5EZG A;  2L4A A;  1ERD A;  3VYS B;  5H2F C;  2EFW A;  4CO8 A;  3KZY A;  1ZEL A;  4ZYH A;  2H8W A;  3QU3 A;  5ILU A;  3TP0 A;  2JQ7 A;  5IOY A;  2OAZ A;  3BR2 A;  4IO9 F;  2ETH A;  2DA5 A;  1G59 A;  3BG5 A;  3U21 A;  4UY8 I;  4QPO A;  2HDC A;  4OMZ A;  2OF7 A;  4CCJ A;  2KT0 A;  1HKQ A;  2FUG 2;  3KET A;  4YFN F;  3I5U A;  5LD2 C;  1D5V A;  4ZDL A;  2LDU A;  2BXZ A;  1A5J A;  4ZYA A;  2CRG A;  4CIC A;  4PJ0 C;  3ZQI A;  3IL2 A;  2LF7 A;  4HDU A;  1X1B A;  2EFP A;  1MMG A;  2XSJ C;  3IHU A;  2WB1 N;  4UUT A;  4ANJ A;  1JKR C;  1MD0 A;  1G4D A;  3FKJ A;  2JVH A;  4AU7 A;  2FNP A;  4B4C A;  1KZH A;  2ZXJ A;  4NC8 A;  5D5W B;  4I6Z A;  3W6V A;  3D1N I;  5CKT A;  3H35 A;  4M72 A;  1IXR C;  2HVQ A;  4HAM A;  1S5L C;  2X1C A;  5IP7 J;  2O03 A;  2LRD A;  3DLA A;  5CLS A;  5E8I A;  3AG2 H;  5L3B A;  4KDP A;  1IN5 A;  3GTP J;  2MA3 A;  5E20 A;  4MHG A;  2O9L A;  3SHF A;  3ZGK A;  3KPH A;  2WV1 A;  3TGN A;  3QPH A;  2BHY A;  4JQF A;  4JX5 A;  3SXY A;  4HG2 A;  3LOC A;  3G4S I;  3S1R J;  1STZ A;  5J47 A;  4L18 B;  2RRE A;  1BN5 A;  1ETK A;  1ZAR A;  4ZTJ A;  4Y52 J;  3CCU I;  3R60 A;  1V5E A;  2LY2 A;  2Y0M A;  3ZQG A;  1YQA A;  4ENJ A;  4HX4 A;  1TLH B;  2R4G A;  5IOZ A;  3IRR A;  1VQK I;  4FHT A;  1YI2 I;  1XGS A;  2IPQ X;  1EF4 A;  2DA1 A;  4BAY A;  1IRZ A;  2QSF X;  4ON0 A;  2Z3Y A;  3NWS A;  3O8H A;  1Y8Q B;  5KVR A;  4UNO A;  3HUG B;  1VQ6 I;  1XX5 A;  2DMP A;  1IJW C;  2BZT A;  2DFI A;  3CMM A;  4XK4 A;  2QEX I;  3JRA A;  4R8H A;  3DF8 A;  3R61 A;  1ULY A;  3FXU A;  4C3I J;  3VB2 A;  2JTV A;  3RKY A;  1KYW A;  3AFH A;  2V9V A;  1FBQ A;  3DEW A;  2IS2 A;  1X3U A;  1RPW A;  1FMV A;  4C30 A;  1P9Q C;  4L5J A;  3LQR A;  3R0A A;  2JRM A;  2XPU A;  4ENK A;  4EJW A;  1GDT A;  2D1V A;  3BG9 A;  4G9Y A;  2M1B A;  3BPV A;  1SEU A;  2MSY A;  4BE1 A;  1FWZ A;  1YX5 A;  3FK7 A;  1ETW A;  3S1M J;  4C3H J;  2DYS H;  2FE3 A;  2K5C A;  3L2R A;  3TQN A;  3L1P A;  2A3S A;  3RI4 A;  4RB3 C;  3G6E I;  4RGR A;  3S2W A;  1FTT A;  1B4A A;  4MQV A;  1T98 A;  2FQ4 A;  4M9S A;  1W4M A;  1K79 A;  2DOA A;  2WAE A;  5LBQ A;  1ZK8 A;  1Y8R B;  2FJ1 A;  3M4O J;  1KU2 A;  2RNG A;  1JGS A;  1OLT A;  1IV8 A;  3JRB A;  1MBE A;  2HOE A;  3S1N J;  4DIQ A;  4IPA A;  2ELH A;  3OR1 C;  3HOT A;  1TT0 A;  2WAQ N;  3BOQ A;  3J7A Y;  4A3F J;  1OCT C;  4E7I A;  1JJ8 C;  1XMA A;  2I8D A;  1BW5 A;  4I0B A;  3MN2 A;  3QPL A;  2XC7 A;  1S9H A;  2ZC2 A;  4U87 A;  5LGN A;  1GHC A;  2VQC A;  2VJI A;  3K70 D;  2EA2 A;  2P8T A;  4QPQ A;  5E3N A;  1VZ0 A;  2EIK H;  3FM3 A;  4B47 A;  3PQK A;  5L3F A;  2FNA A;  4AWX B;  5HVQ C;  1TBX A;  5B3S H;  4A2U A;  1DUX C;  2GLO A;  4UV9 A;  4ZZD A;  1U8B A;  1FBU A;  1XB4 A;  1WHU A;  5HNF A;  1SD6 A;  2CV1 A;  2JSC A;  1YIT I;  2NS0 A;  1WQ2 A;  4XRS G;  5C3E J;  1OCC H;  3G1O A;  3OOU A;  2CQ7 A;  3WGI A;  4NBQ A;  2XF6 A;  1PP7 U;  4GFB A;  1JKQ C;  4L5E A;  2KIF A;  2RDP A;  2R7O A;  2LBF A;  1LFB A;  1FT9 A;  1R1V A;  3TDZ C;  2BV6 A;  4IEJ A;  2E7X A;  2A6H F;  3K4N A;  4E7K A;  4P5O A;  2HFH A;  5IY5 H;  3DXJ F;  3CLO A;  3OYK A;  3UR3 C;  3QU6 A;  2PMU A;  2WAD A;  2HI3 A;  4GXO A;  1G3W A;  4BJ5 C;  3H0G J;  3TKY A;  2LBF B;  2CG4 A;  1B1B A;  1RIO H;  1UEL B;  5M5W J;  4A5M A;  3F8M A;  1X1A A;  2K9N A;  1W36 D;  1YS7 A;  2F48 A;  2CQQ A;  2L9S A;  3BG7 A;  1ZR2 A;  4C2M J;  1M1E B;  3K10 A;  5HDK A;  3ULQ B;  1R49 A;  2Y69 H;  2QKM B;  2ELK A;  2LG4 A;  1WI3 A;  2OTL I;  1G3S A;  3DTE A;  3K4L A;  4AIK A;  3K0L A;  3BP8 A;  2FBI A;  3W2V A;  1SVO A;  3LA2 A;  4XOP A;  2XF5 A;  2XVC A;  3IC7 A;  2K02 A;  2VXZ A;  2LOO A;  2HEO A;  1H9G A;  2VBZ A;  3BY6 A;  4BNC A;  1BIA A;  2M8G X;  2QGU A;  1VQL I;  2BW3 A;  2JZY A;  4HQE A;  4UHT A;  1EKE A;  1SFX A;  1ZLJ A;  2CS3 A;  3I58 A;  3OYM A;  1W7P D;  3ABT A;  2QSH X;  3JRE A;  3S3M A;  2EZH A;  2HTJ A;  5EDN A;  2LK2 A;  1NTC A;  4XM3 A;  4ZDO A;  4HZF A;  4E70 A;  2BW3 B;  3FXL A;  1OYY A;  5FKM A;  3B73 A;  2G9W A;  5HS7 A;  1E17 A;  5LRR A;  3K4K A;  1DQU A;  2DPU A;  5ICE A;  3PSF A;  1JTX A;  2RVC A;  4EAT A;  3COA C;  3EQL F;  2W84 A;  5KK1 A;  3WE2 A;  4F92 B;  1DU6 A;  2JUG A;  5ED4 A;  2HYJ A;  4D1Q A;  4BY1 J;  3ELK A;  1QA6 A;  1IDY A;  1W7P B;  3KYC B;  2STW A;  1WI9 A;  4A3L J;  3R4K A;  4CCK A;  4BE2 A;  4NC6 A;  2DTZ A;  3FIS A;  2DW4 A;  4O6J A;  4BH9 A;  4XID A;  4RB2 C;  4G6Q A;  4YEJ A;  4IHT A;  1ODD A;  3HIF A;  1V3F A;  5TIS C;  2PMH A;  5EEG A;  2Z1D A;  3HRU A;  3FMQ A;  2CFO A;  2C6Y A;  2XGX A;  5AIQ A;  4B44 A;  3N05 A;  4M3B A;  2Q0O A;  3K7A J;  2W1O A;  2JVG A;  1Y1W J;  3H92 A;  3M1E A;  2DA7 A;  2EWN A;  2BEO A;  1TNS A;  3LSH A;  1ZTR A;  2XAS A;  3KCC A;  2VI6 A;  1IN8 A;  4DW6 A;  5E79 C;  4QIW N;  2E1N A;  1SFU A;  4KFC A;  5HLI A;  3RQ4 A;  4I98 B;  1ETY A;  4UVC A;  2HVR A;  1ZAO A;  1ZGW A;  4HLX A;  1OYI A;  4HW0 A;  2PFB A;  3SYT A;  3GFI A;  3GUD A;  2IGM A;  1YRN A;  1RZ4 A;  4Q5S F;  1K83 J;  2E34 A;  2IGO A;  1U0J A;  3NWT A;  4EMS A;  4AM3 A;  3K1P A;  2VQH A;  1EA3 A;  3M07 A;  1KQ9 A;  1OCR H;  3HHH A;  3IUO A;  5FJ8 J;  2OV7 A;  5KAI C;  5EF6 A;  4ESJ A;  2ISY A;  1YRN B;  4X6A J;  1JKO C;  1VFC A;  3F23 A;  3LL7 A;  2VL8 A;  2EFN A;  5FLM J;  2F5C A;  2JWT A;  3JRH A;  1BJZ A;  3Q0U A;  4R79 A;  2KJB A;  5DUI A;  1O3S A;  2L7K A;  2P0W A;  4BGD A;  3O2P E;  1DDN A;  2BGC A;  2VUM J;  2GAU A;  2X51 A;  3ASO H;  1ZG5 A;  5LGU A;  3ABU A;  4Y3O A;  1FJL A;  3CP2 A;  2JPC A;  3FKI J;  3WGG A;  1PDN C;  2A68 F;  2CV2 A;  5ICC A;  4WWC A;  3FWE A;  4YIR X;  3D5S C;  1WFX A;  2X9D A;  3KLN A;  2MC4 A;  3LST A;  2ZJ2 A;  3PFY A;  4LIT A;  5FB2 A;  1U78 A;  1JHH A;  1IXS B;  3BZC A;  4F93 B;  5K7F A;  2YU3 A;  2GIZ A;  2JRT A;  3QQA A;  3A0B C;  3FXR A;  4G7O F;  5FKO A;  2GQQ A;  2Y31 A;  1LJ9 A;  2W4S A;  1SFO J;  2VKH A;  2PN6 A;  1TZL A;  2M34 A;  1FOY A;  1X4P A;  3PNT A;  1HDD C;  2VPR A;  4A3B J;  2H6B A;  1RRJ A;  2AQF A;  1XCB A;  3H3V K;  4BHP A;  2DA2 A;  2R7Q A;  4HA8 A;  4N4O B;  1VQM I;  1B72 A;  2RQQ A;  4U0Y A;  2WBM A;  4M6V A;  2G7H A;  3C1D A;  2G7U A;  3CCY A;  1CQT A;  5E3L A;  2IEK A;  3CCM I;  1QZE A;  2FEZ A;  3HKZ N;  3MWM A;  1S72 I;  1FZP B;  1MJA A;  1L3L A;  1KQ0 A;  1SFK A;  4R1H A;  2Z5U A;  4BE0 A;  1B72 B;  4D9J A;  4GDF A;  1ZGJ A;  1OFC X;  1BI2 A;  4PSX A;  2DFH A;  4NNJ A;  3MZ8 A;  3OIQ A;  1K6Y A;  2JJ7 A;  4CZZ A;  4LLL A;  4DYC A;  4ZDP A;  1RI7 A;  3WTT C;  4CA0 A;  1W5T A;  4XMY A;  3Q9V A;  5ERI A;  2R7F A;  4CCM A;  5FRM A;  2MBF A;  4RA2 A;  2F4M B;  1XDU A;  2NXN B;  3ZPL A;  1D8K A;  4V19 K;  1IG7 A;  3HGY A;  1B59 A;  3ZQQ A;  3CC4 I;  1MBH A;  2HQA A;  2M3A A;  3KEO A;  2Z2S B;  2L5Q A;  3UKG A;  2M87 A;  2DMU A;  2HQN A;  1I50 J;  1LDD A;  2Y75 A;  1F43 A;  1W0T A;  4LIU A;  2YU9 J;  3JRG A;  3VSL A;  1EH7 A;  2M0M A;  4KIT B;  2BOL A;  2KQR A;  2O7O A;  3D5R C;  3I59 A;  4EQQ A;  2GXB A;  2GWR A;  2A6E F;  4HLY A;  3WG9 A;  4P1W A;  1V5F A;  3CJN A;  2QF7 A;  5CYV A;  3C7J A;  2LH9 A;  2NVX J;  3BLY A;  5DUK A;  2MH2 A;  1YTY A;  3RYP A;  1SVM A;  2K27 A;  3OYF A;  3JCU C;  3KP6 A;  2QQ8 A;  2JPB A;  2AQE A;  4PJL A;  5F04 A;  2XF7 A;  3LFU A;  3JTH A;  1VND A;  2QVO A;  1IDZ A;  4C2U A;  1WCM J;  4IQJ A;  3FBI B;  3LAP A;  4LGW A;  4ZTF A;  1ETO A;  2XRL A;  5J1R A;  3DTI A;  3AAF A;  2D5V A;  1SFE A;  3RKW A;  4CXF A;  3S14 J;  4GRI A;  1TTY A;  2CW0 F;  4GO1 A;  4MO7 A;  4RGS A;  5FGM A;  4XLE A;  3REO A;  3VPR A;  2LSO A;  4IHV A;  3I4N J;  2E2H J;  2M7A A;  3PL8 A;  2ZNZ A;  3BWG A;  4BQA A;  1FSE A;  2X85 A;  4EGY A;  4TV7 A;  4KYW A;  1PUF A;  3GLX A;  5EJC A;  2L9R A;  4B43 A;  3VWB A;  3U9G A;  3K2A A;  4E4H A;  2ID3 A;  3K4B A;  5CVV A;  4LIV A;  1G6N A;  3DKX A;  3GZN B;  2QYO A;  3AG3 H;  3LQQ A;  5GAD J;  4HNT A;  2NOG A;  5GAH J;  1PUF B;  4XKC A;  3VFZ A;  2OQG A;  4N9I A;  2EFO A;  2K9M A;  4G12 A;  4HYE A;  1BR4 A;  1MIJ A;  3S3O A;  2YS9 A;  3G1M A;  1JUS A;  1GUU A;  4OIQ F;  3S32 A;  1B9N A;  4F91 B;  1SAX A;  2I5U A;  1HW5 A;  3I0T A;  4XLF A;  1P92 A;  2XAJ A;  1U2W A;  4F52 A;  4EJO A;  1FEX A;  4YRV A;  3M1C A;  1KQ8 A;  1YJN I;  4CCN A;  2OJE D;  2CUE A;  2DDA A;  1X1C A;  3CP8 A;  4EM2 A;  3CO6 C;  3IRQ A;  4ENM A;  2XAQ A;  1VQN I;  2XAU A;  1MH3 A;  3RJP A;  3F3X A;  1ZN2 A;  1P2F A;  3GX4 X;  2V9K A;  4BXF A;  3HBL A;  3FK6 A;  2D45 A;  3M9A A;  1ZKG A;  3EYY A;  3WTZ A;  1Q1V A;  3TW7 A;  3AG1 H;  3HRM A;  3WTS C;  4KN4 X;  4XIC A;  3DU5 A;  4JK1 X;  3HSR A;  3OYJ A;  5FRN A;  2FQ3 A;  1DPR A;  1VQ8 I;  3K1N A;  4RS8 A;  2JMW A;  4PFP A;  2F5V A;  1HC8 A;  3P7N A;  4E6K G;  1OR7 C;  3IV5 A;  1MSE C;  2LP0 A;  1I1S A;  4U0V A;  3F72 A;  3L7W A;  4CYC A;  3T0Y A;  4U88 A;  5CVJ A;  5DM6 F;  2GXG A;  4Y17 A;  2R7S A;  2XUB A;  2P5L C;  5DV5 A;  3A0H C;  3CQZ J;  1GVD A;  2XPV A;  2KIM A;  4A3M J;  3DEE A;  3WU1 B;  1I39 A;  3TO6 A;  2ZNY A;  4CYC B;  1IF1 A;  4XR6 A;  2DT6 A;  4BJ6 C;  2JA6 J;  1YLF A;  2DO7 A;  3F8B A;  3TP3 A;  3EDP A;  1LDJ A;  3GTJ J;  1PUE E;  2BY3 A;  2L01 A;  4GYI A;  2VPL A;  2HYG D;  3K6G A;  3FF5 A;  1DP3 A;  5HLG A;  1IUY A;  1LVA A;  5B66 C;  2UXN A;  1E3P A;  1FBS A;  4J01 A;  1K61 A;  2DA4 A;  2LKS A;  3T1B A;  1FIA A;  1HBX G;  5J1Y A;  3H36 A;  4IZZ A;  2HQR A;  3F6V A;  4FQG A;  2PMZ A;  4DZP A;  4FET A;  1JGG A;  5HLT A;  2W48 A;  2KZG A;  4ZYG A;  5DEQ A;  2V4J C;  3S16 J;  5HOD A;  4A3I J;  1U5T C;  4GYG A;  1FOX A;  2WY7 Q;  2XV4 S;  2ESH A;  2Z16 A;  5CJ9 A;  4BXX J;  1V54 H;  2HU9 A;  4MQ9 F;  4PZJ A;  1VQ9 I;  1Z6R A;  3NRV A;  2OC6 A;  4XLP F;  1IN4 A;  3F8F A;  4XRM A;  1D0X A;  3C2G A;  2DQL A;  5BPI A;  2QWW A;  1FSH A;  2L9V A;  4F55 A;  1K78 A;  3BTL A;  2HGC A;  1I27 A;  2KRC A;  4BU2 A;  3HL2 A;  2VE9 A;  3PUF A;  1QPI A;  1IO2 A;  1FP1 D;  3WTY C;  2B63 J;  4IQ4 A;  2HS5 A;  1FIP A;  4DBR A;  5FD5 A;  4L5I A;  1P4W A;  4FE4 A;  2FBH A;  4PJN A;  1H9T A;  4ZJZ A;  2M7B A;  2L7F P;  4OIP F;  5J6X A;  1Z3X A;  1X1P A;  3CCE I;  1PJR A;  5DD8 A;  3ZOB A;  1APL C;  2A61 A;  5FKL A;  4LFU A;  5J40 A;  4A6D A;  2NS7 A;  4F7Z A;  1YYV A;  2VJ5 A;  4UVB A;  2RV8 A;  3P5J A;  5F6F A;  2XAH A;  2LR8 A;  3OYE A;  4WK8 F;  3K4C A;  1WJB A;  4NC7 A;  3HZJ A;  3E0J B;  5H6R A;  3HRS A;  4W1U A;  2YR2 A;  5D5U B;  1KA8 A;  1IV6 A;  5HS9 A;  3CTA A;  3E1S A;  4Y15 A;  2IS4 A;  1ZG1 A;  2R93 J;  5D4R A;  4KA4 A;  2FBK A;  4E7H A;  4BXU A;  3NAU A;  3I56 I;  1TQP A;  2ICW G;  5M5X J;  2QM3 A;  5IPA A;  4KIB A;  1XSX A;  2R7Z J;  1AA7 A;  4ABZ A;  1O7L A;  1V55 H;  2HKX A;  2JUC A;  1ZR4 A;  1X2M A;  1Z0X A;  3K1M A;  1BC8 C;  2TCT A;  1IRG A;  1R5I D;  2QLZ A;  2V6C A;  3IP4 B;  1HLV A;  5BMZ A;  3M7G A;  1IZ1 A;  4EJU A;  1MW7 A;  3LNQ A;  2LNB A;  3ABL H;  1TWH J;  2HR3 A;  3Q3S A;  2VB6 A;  4U0W A;  3M8F A;  1XMK A;  3JAM Z;  4P96 A;  2RNJ A;  3RDI A;  1T0F A;  3PM1 A;  3ZQF A;  2F5E A;  3CCS I;  2K86 A;  4A5N A;  3MQ0 A;  1HDP A;  3BR6 A;  2BXY A;  3K2Z A;  1XSV A;  3LA7 A;  3QPT A;  2VT2 A;  2VJJ A;  4XLH A;  2FF4 A;  4ASN A;  4DNC A;  3RPU A;  1W5C C;  2K40 A;  2IT0 A;  3MD2 A;  3A2K A;  2CQN A;  3RZO J;  5J4Y A;  2A6T A;  2ECB A;  1T6S A;  2GM4 A;  3C18 A;  1RKW A;  5LHG A;  4FAS D;  1UHS A;  3HSE A;  2VJ4 A;  2E1M C;  4XOR A;  1JHF A;  2DLL A;  2EZI A;  1R9T J;  3WTX C;  1TWF J;  4M3F A;  4QSH A;  4HNV A;  5M3M J;  3OYH A;  2VE8 A;  1TP4 A;  1WZ2 A;  5E18 F;  2V79 A;  3K4J A;  3MMY B;  5FD6 A;  3DLL F;  4IRH A;  1E3O C;  5L3C A;  3MZH A;  1OPC A;  3QOE A;  5F0C A;  3BJ6 A;  1S7O A;  4EM1 A;  3T8T A;  1LEB A;  1LUJ B;  5K5Q A;  4ESB A;  1XC5 A;  3QAH A;  3ONQ A;  2HXO A;  2K7L A;  1D1B A;  3DEU A;  4OU0 A;  4MIM A;  5FFX A;  3FHN A;  2LC2 A;  2DA3 A;  3DTK A;  2BE5 F;  4BQQ A;  2PX9 A;  3MZY A;  5E3O A;  1H0M A;  2OUM A;  2V1X A;  1U8R A;  5L3G A;  4LK0 F;  4HF2 A;  5ILV A;  2HZT A;  5E1W A;  5LHH A;  1D8J A;  4IXA A;  2HDD A;  3ZMU A;  3TW6 A;  3ERE D;  3BCB A;  2K9S A;  1GV5 A;  2XGD A;  1K6O A;  2ZFW A;  2ME0 A;  1RUO A;  2V7F A;  1D1C A;  1QPM A;  2BY0 A;  2UV1 A;  1UZC A;  4LJZ F;  1SAN A;  5EYR A;  1HKT A;  4DQ2 A;  2X0L A;  5D5V B;  3F9K A;  3FDY A;  3HGG A;  4KMU X;  2RN7 A;  2VKE A;  3V7R A;  1R58 A;  3ECH A;  4XLA A;  4C2T A;  2FD5 A;  4XKV A;  2DMQ A;  2VN2 A;  2KDZ A;  5J8F A;  2ZSI B;  1Z1D A;  2EV0 A;  5D6F A;  2R7X A;  2KJC A;  2Q1Z B;  3AG4 H;  3BG3 A;  4RLF A;  5K5O A;  1MMA A;  1J9I A;  1R4N B;  1LEA A;  3LA3 A;  5K7H A;  4HV5 A;  1LQ1 A;  1AHD P;  3G3Z A;  1TC3 C;  4Y4R A;  4YEL A;  3TBI A;  1Y39 A;  4XBF A;  2QCO A;  2DK5 A;  2P5V A;  1OR7 A;  1S8N A;  5ICF A;  3IH4 A;  4RB0 A;  3HM5 A;  4CCL A;  1R4M B;  2CUJ A;  2IA0 A;  3OYD A;  3VYU B;  2Y9Z A;  2H27 A;  3KP2 A;  3BCA A;  5GAE J;  3CCV I;  2L0K A;  1XGO A;  2OZU A;  4KNY A;  3DFG A;  3MKW B;  4IOA F;  2IGN A;  4FX4 A;  3FXK A;  2VQG A;  3JSO A;  1SMY F;  3GFL A;  3E5X A;  1Y0U A;  2M8E A;  5C4X J;  3BR5 A;  4KT5 C;  2EIN H;  4HBL A;  4BDY A;  2BVM A;  3HEF A;  4MLO A;  4OAY A;  3TOA A;  1P7J A;  4JOM A;  4W97 A;  4XLN F;  4Z2Y A;  2CJJ A;  2L54 A;  1N75 A;  2VOD A;  1VQP I;  5GTI C;  5M3F J;  4WXC A;  3QOD A;  4LMY A;  3RPQ A;  3ZCO A;  3Q0W A;  3BQZ A;  1BI0 A;  3HOV J;  2Z99 A;  2Z33 A;  1QGP A;  2AXL A;  2X1D A;  1RC9 A;  1N25 A;  2JSP A;  2CQX A;  4G8X A;  4PJM A;  3ZMD A;  5K1Y A;  1FTZ A;  2ME6 A;  4XQF A;  1JXS A;  3WGH A;  4IHW A;  2MG4 A;  3KP4 A;  4I01 A;  3QRF F;  2CGP A;  2ZFU A;  4UV8 A;  2LYC A;  1U5T A;  3ZQH A;  3OSF A;  3E6B A;  3RKQ A;  1R00 A;  3GFM A;  4FT8 A;  2VQL A;  1Z7L A;  3OY9 A;  2CUF A;  2EBI A;  1LKX A;  2P5K A;  1U5T B;  1W5S A;  3NEU A;  5CPR B;  2PI0 A;  2W85 A;  1UAA A;  5C44 J;  3U1K A;  4BAC A;  4ENN A;  3HOU J;  2EK5 A;  4KN7 X;  2GIV A;  1RR8 C;  3L09 A;  3OV8 A;  3QWL A;  2AS5 F;  4IJA A;  4GGG A;  3HC7 A;  3QYB A;  1OYW A;  1HCR A;  5L3D A;  2QSG X;  3F22 A;  3FXJ A;  5FRO A;  1HQC A;  1OCP A;  2OBP A;  4HSR A;  4UUS A;  4FIS A;  2ELJ A;  1BI3 A;  1X58 A;  1F36 A;  1S7E A;  1NHA A;  4FCY A;  1D0Z A;  4LG3 A;  2XPW A;  2KIU A;  1GXQ A;  4Y33 A;  4UUS B;  3S93 A;  1R71 A;  1ZG3 A;  1JI8 A;  2LFB A;  2NVU B;  3KZZ A;  5HNH A;  2R7D A;  3HRT A;  2XSD C;  2VLA A;  3HXL A;  1NG6 A;  2E19 A;  3CME I;  5IT9 K;  5CQG A;  1F9N A;  1BA5 A;  1XTA A;  3E6D A;  2ZXW H;  5DM7 F;  4RAZ A;  5KAF C;  5IT3 A;  2ZME C;  1S3J A;  2K3P A;  5F0H A;  3H1C A;  3ISP A;  2GA2 A;  1A35 A;  1N78 A;  1LPQ A;  4X1E A;  4ZZL A;  3IH3 A;  2LTP A;  1Z91 A;  3CMY A;  2IW5 A;  3ZMV A;  1YW9 A;  2PEX A;  4XN3 A;  2AHQ A;  2PMZ N;  2ACJ A;  2EIJ H;  1I3Q J;  2YX4 A;  3BR3 A;  4UVA A;  5EEA A;  3B02 A;  3CD6 I;  2ZJP F;  1MGT A;  3DP7 A;  3PSI A;  1PYV A;  5E8G A;  4UUV A;  4B09 A;  3LSK A;  2IVM A;  2V9P A;  1O4X A;  3BTC A;  2OQR A;  1UHW A;  1AWC A;  4O5V A;  1BW6 A;  1OCO H;  3WHB A;  1FX7 A;  1MZB A;  4RM3 A;  4E7J A;  2ZJR F;  2LY9 A;  4OMY A;  4LLN A;  1D3Y A;  2CFX A;  4B3A A;  4BKX A;  2WWY A;  1Z9C A;  2PJP A;  1AU7 A;  3EUH C;  3I71 A;  4D0P A;  2AO9 A;  3FXO A;  4RLQ A;  1WPK A;  2LY1 A;  4DJA A;  1I6X A;  3A03 A;  3DBL B;  2EV5 A;  3C2H A;  1Z3Y A;  2ZKZ A;  5HDG A;  3RIR A;  1O3T A;  1B8I A;  2FSW A;  3G73 A;  4MTD A;  4I0A A;  1JT6 A;  3Q9S A;  4L9V A;  1GV2 A;  3SEQ A;  4WCG A;  3L2Q A;  1QHG A;  1IXC A;  1IW7 F;  1PP8 F;  2LVS A;  4KIS A;  4A93 J;  1LDK B;  2VOP A;  1CF7 A;  5B1B H;  4UB6 C;  2OCE A;  2P4W A;  2FOW A;  2E5N A;  2Y30 A;  4UXN A;  3L00 A;  2O5R A;  3J80 Z;  3MKL A;  4NDL A;  1F5T A;  3FBN B;  2STT A;  3NAR A;  2QA4 I;  2OD5 A;  4RAF A;  3Q5F A;  2E1M B;  1YJ9 I;  1JE8 A;  2VBY A;  4IOC F;  2NS8 A;  2DOE A;  4MGR A;  1XD7 A;  4AIJ A;  1CF7 B;  1A36 A;  1F4K A;  1JJ6 C;  2VKV A;  3IKT A;  2EB7 A;  4EJV A;  2V6E A;  4A12 A;  2PBI A;  4LB6 B;  3KIO A;  1QZY A;  4UB8 C;  5D8K B;  1T08 B;  3HJE A;  5IT9 Z;  2DJN A;  2F5F A;  2RAE A;  1MDM A;  3ERM A;  4LG0 A;  1QHH D;  2WC2 A;  1WJF A;  2LLK A;  3R0J A;  3V7C A;  1BI1 A;  4AYB A;  3L2V A;  2KHM A;  4V2F A;  1MBF A;  1IN6 A;  5DCM A;  3HTS B;  3GTG J;  1OCZ H;  1S29 A;  4KJZ A;  1V5G A;  3VOE A;  1FMW A;  5D5X B;  1MDM B;  4LG0 B;  3T5X A;  1FYK A;  1RES A;  3OL4 A;  4B3X A;  3JR9 A;  1T0F C;  3BTI A;  2KL4 A;  2W24 A;  5DCM B;  3V8K A;  1WSU A;  1D5Y A;  1WVR A;  2PG4 A;  2E60 A;  1H88 C;  1X3W B;  5D8L B;  2JK3 A;  4XRF A;  2QKL B;  3I59 B;  4P9U A;  1ZRD A;  1WJC A;  2HYF A;  5TGT A;  3H0D A;  2KFD A;  2EZL A;  4J00 A;  1ZH5 A;  1FOK A;  1YIO A;  2Z9O A;  1SD7 A;  1G8X A;  2NOJ B;  2VAS A;  4Y7N J;  2XGE A;  4IF4 A;  2L2O A;  2IA1 A;  2JN6 A;  2HPM A;  1H8A C;  1XGM A;  3E6M A;  2MH9 A;  1P4A A;  2QQA A;  2DFE A;  1ZRC A;  2XKP A;  2QQ9 A;  3CUQ A;  2CUZ A;  3GF2 A;  2BYV E;  3OIP A;  1TW3 A;  3IH2 A;  2V26 A;  2HWV A;  2DOF A;  2DYR H;  5GPA A;  1PVE A;  2DMT A;  2VBX A;  3PFI A;  2ZCW A;  4YFX F;  2KDO A;  2KRH A;  2IAI A;  3CUQ B;  2NRA C;  5J8C A;  5LEJ A;  3ZRG A;  2RQP A;  4MTE A;  1WJA A;  2Q2E A;  1UFM A;  2FA5 A;  4OIO F;  1X1D A;  5E3M A;  1DGW Y;  4U7D A;  4MEX F;  1QO0 D;  2MAB A;  3ZQ7 A;  3A4C A;  3HPH A;  4M3D A;  2A5Y B;  2BVL A;  4D7M A;  3DQV C;  3KYL A;  1LVK A;  2Q2E B;  2BY1 A;  2KPM A;  4FTH A;  2CQK A;  3WE3 A;  3H3Z A;  1QZZ A;  1G3Y A;  1T56 A;  1I1G A;  1IRX A;  3GWZ A;  1LNW A;  2DI3 A;  3QP6 A;  2NNY A;  5EZH A;  1QVU A;  2F4I A;  2DN0 A;  1ORK A;  1WJE A;  1IRF A;  3E5Q A;  5F1R A;  3S2H J;  3OYA A;  2COB A;  1UMQ A;  2DT5 A;  4M6X A;  3K9T A;  3ESW B;  4II3 A;  5E1X A;  1MBJ A;  3F21 A;  1YJW I;  3FMS A;  4L9J A;  3GTL J;  2JA7 J;  5IP9 J;  4QLC U;  1JUM A;  2WAF A;  3M3Y J;  1I6H J;  1EV7 A;  3ABK H;  1EH8 A;  2F6C A;  3RQI A;  2L7Z A;  3GO5 A;  4ESF A;  4RAG A;  3L2C A;  2ID6 A;  3PO3 J;  3BR0 A;  1SC7 A;  2P6S A;  4AD9 A;  2MD0 A; 
#chains in the Genus database with same CATH homology
 1R23 A;  2MD5 A;  5E1Z B;  3FM5 A;  1KU3 A;  2K4B A;  5DDG A;  1I5Z A;  5HLH A;  1FNN A;  4LB5 A;  3HSF A;  1WWX A;  2VC1 A;  4MEY F;  4M71 A;  4FX0 A;  2CYY A;  1QNT A;  1J7K A;  3TOB A;  5TRD A;  4WXD A;  1U3E M;  1FYM A;  4QWQ A;  3F8N A;  3EET A;  2MC3 A;  1Z7U A;  1QQI A;  2F5D A;  5ILS A;  1CGP A;  4GCV A;  3WTW C;  4WX9 A;  2ZME A;  2O8X A;  2E7W A;  3JAM K;  1Z6T A;  3L9F A;  1HKS A;  2DAO A;  3VEP A;  2ZME B;  1T39 A;  1HW2 A;  3J7A O;  3N97 A;  3ZN1 A;  1ZYR F;  3LFK A;  2JT1 A;  4M6Y A;  1BC7 C;  2PLY A;  3E3V A;  4JBA A;  4ZH4 F;  2V1D A;  4I7H A;  3HHG A;  3SZP A;  2H94 A;  3N4M A;  3EUH A;  2FOK A;  2W57 A;  2COM A;  2RGV A;  1HW1 A;  1KU9 A;  4Q48 A;  4EM0 B;  2NNN A;  1EH6 A;  3O3K A;  3ZN0 A;  1GXP A;  2FML A;  1K78 B;  3BPX A;  4L9T A;  2YPR A;  2L4M A;  2MLK A;  2H6C A;  3F6O A;  3GVA A;  1FY7 A;  2KKO A;  6PAX A;  3E6C C;  2D2W A;  4PDK A;  2PQ8 A;  2VOO A;  2L3D A;  1BJA A;  4I02 A;  1SMT A;  4WF2 A;  5E17 F;  4P55 A;  1KU7 A;  2DTR A;  2QBY A;  5HDN A;  3W6K B;  5JHU A;  2XRO A;  3J81 Z;  1FYL A;  2O61 A;  2QBY B;  4Q4Z F;  2OU2 A;  1UCR A;  3HUG A;  3I64 A;  3LAJ A;  1BOA A;  2IJL A;  4L9N A;  1GVJ A;  2QQB A;  5LEK A;  2QZ8 A;  3MAJ A;  5AON A;  3KE2 A;  1C0W A;  5HS8 A;  2DBB A;  3ECO A;  5A2Q Z;  4HX8 A;  2EV6 A;  2DU9 A;  4RGX A;  1XN7 A;  2L02 A;  2VBW A;  3GZ5 A;  3TO7 A;  3BZ6 A;  3K69 A;  2RKH A;  4YG2 F;  1DP7 P;  2EJR A;  5FFZ A;  2ZO4 A;  3TO9 A;  1HXD A;  1XGN A;  3RYR A;  2A69 F;  1TW2 A;  1KYZ A;  2VON A;  4HQM A;  3JSP A;  2LKP A;  1P6R A;  3FXQ A;  4PGH A;  4ETS A;  3D0S A;  1FPQ A;  1J0R A;  1LB2 A;  4AIH A;  1AOY A;  3CDH A;  3JTG A;  1USS A;  2M30 A;  2QEN A;  4G6D A;  1FC3 A;  3FHZ A;  2B0L A;  1J2X A;  3ML6 A;  2XHK A;  1ZHF A;  1YS6 A;  3GEZ A;  1DPU A;  1Z05 A;  1L0O C;  1O57 A;  1ZLK A;  1YO5 C;  4I2O A;  1HST A;  1YFH A;  2P7V B;  1BM9 A;  2UXX A;  3SFZ A;  4L0Z B;  3TDU C;  4IVN A;  5ICG A;  1IAW A;  3BJO A;  1J75 A;  5D4S A;  1T38 A;  2Q8K A;  2CSO A;  4AVP A;  2IA2 A;  2X4H A;  1HSJ A;  1ZRF A;  3H3U A;  5LLQ A;  4KIF A;  4NHJ A;  4M73 A;  3V8L A;  5L3E A;  1XDS A;  3FX3 A;  3RKX A;  4KMF A;  4H0E A;  1ZRE A;  1R22 A;  1E2X A;  3CUQ C;  3MCZ A;  4N0B A;  5HOO A;  4M9Z A;  3IWZ A;  1ON2 A;  2H09 A;  2LF8 A;  3I53 A;  2F2E A;  5LRS A;  3T8R A;  1OKR A;  3O6B B;  3SZT A;  5JFR A;  5BOX A;  3E5U A;  2A07 F;  2O6G E;  1SD5 A;  2UWM A;  4NQW A;  4HOB A;  2TDX A;  1J59 A;  4A0Z A;  5JI6 A;  2WV0 A;  1QBJ A;  1O7F A;  2OA4 A;  4BHB A;  3QP5 A;  5LGT A;  2ADU A;  3OOP A;  3F8C A;  2O3F A;  1REP C;  1W7P A;  1KGS A;  3P9K A;  1IN7 A;  2M5W A;  3V4G A;  3D5L A;  3NQO A;  3J80 K;  4ZYE A;  4I09 A;  2K4J A;  4S04 A;  3EYI A;  3GXO A;  2J5O A;  3HOS A;  1UST A;  4PCQ A;  4LK1 F;  2HTS A;  3U2R A;  3DKW A;  5DD4 A;  5BQT A;  3ROU A;  1R1U A;  4A0X A;  3GYH X;  4EV0 A;  1B9M A;  2KRF A;  2O0Y A;  1WRJ A;  1MKM A;  4EJT A;  4K2E A;  1XSD A;  3MEX A;  2FU4 A;  2P7C B;  4OIN F;  4IHS A;  4G7H F;  5F64 A;  1BBY A;  1TNT A;  2NAZ A;  3WOD F;  3HYI A;  2XAF A;  4KIC A;  4G94 A;  2VT3 A;  1SD4 A;  2CWE A;  2E1C A;  3E97 A;  2R3S A;  1A04 A;  3KP5 A;  2QUF A;  2IRF G;  4LLG F;  3HTU A;  1S7A A;  4HF1 A;  3KP3 A;  5H20 A;  4EGZ A;  3RTR A;  3KEQ A;  1WKM A;  1OMI A;  4O3M A;  2OZ6 A;  2W25 A;  5DCF A;  5EEH A;  5CVU A;  2ISZ A;  1R5H A;  3R6S A;  4YFK F;  3KFW X;  4OOI A;  1F1Z A;  1BIB A;  1MJB A;  2EA4 A;  3C3W A;  4XSZ F;  1T2K A;  5TJJ A;  1VTN C;  4CYD A;  2FXA A;  3KLO A;  3IKV A;  2HKO A;  4A0Y A;  1ON1 A;  3KP7 A;  1MJ9 A;  3ZMZ A;  4A6E A;  1FP2 A;  1RUN A;  2WTE A;  1P4X A;  3GW2 A;  1TQM A;  1U6G A;  2CO5 A;  3LWF A;  4KIG A;  5CVI A;  4P9F A;  4BHC A;  1B6A A;  4HX7 A;  4B8X A;  3P9C A;  4WXH A;  3M8E A;  1YW7 A;  3WU0 A;  2UZK A;  3ZMT A;  3JW4 A;  3CO7 C;  3P9I A;  2XRN A;  1UB9 A;  4ZYD A;  2DQR A;  2YSR A;  5FLX K;  4KUM A;  1O3R A;  2XKO A;  3FMR A;  1ZGA A;  3IWF A;  5D6E A;  3U1D A;  4RAY A;  3V8J A;  4RGU A;  3I54 A;  2J5P A;  3ZMS A;  1FLI A;  4N9H A;  3DPL C;  3GFJ A;  1R36 A;  4BYY A;  2BBY A;  3DPT A;  4NB5 A;  5DYM A;  1R1T A;  1G3T A;  3V7S A;  5BS6 A;  2XAG A;  5K5R A;  4OIR F;  1TQI A;  4L0Y B;  4XSX F;  4MNU A;  3MFK A;  1XCV A;  4HF0 A;  3VOD A;  2MLG A;  2ZBK A;  2YX7 A;  3BDD A;  4HDV A;  1V4R A;  4S05 A;  2FMY A;  2IP2 A;  2Y48 A;  2NYX A;  2P6T A;  5BPD A;  5H6Q A;  4LD5 A;  1YG2 A;  2FRH A;  1R7J A;  1RNL A;  1J5Y A;  3CUO A;  3QOP A;  2ESN A;  5JR3 A;  2DPD A;  2DK8 A;  4M74 A;  5CVR A;  4IRG A;  2GA1 A;  1O3Q A;  5JVT A;  2VC0 A;  1Q1H A;  5FO5 A;  5LHI A;  4RB1 A;  2EFQ A;  3WTV C;  4CHU A;  3DV8 A;  3GZ6 A;  4IRI A;  3SQN A;  4U7B A;  5AIP A;  3BRO A;  5FLX Z;  1S6L A;  3ZP5 A;  1R5G A;  4YIF A;  3J81 K;  3BJA A;  3I4P A;  4CDG A;  2RC4 A;  4YII A;  4G7Z F;  2D1H A;  1ONV A;  4PGG A;  1K7A A;  4CGZ A;  4EVI A;  2V1U A;  2XIG A;  4HV6 A;  4Q47 A;  3PQJ A;  4Y13 A;  1UHM A;  2M45 A;  3WTU C;  3FZV A;  2GZW A;  4M9X A;  1YW8 A;  3W6J B;  5A2Q K;  2L4A A;  2EFW A;  4CO8 A;  3KZY A;  4ZYH A;  3QU3 A;  5ILU A;  2OAZ A;  2ETH A;  2HDC A;  4OMZ A;  1HKQ A;  3KET A;  4YFN F;  3I5U A;  1D5V A;  2LDU A;  4CIC A;  3IL2 A;  4HDU A;  2LF7 A;  2EFP A;  3IHU A;  1MD0 A;  1G4D A;  2FNP A;  2ZXJ A;  5D5W B;  4M72 A;  1IXR C;  4HAM A;  2O03 A;  5CLS A;  5L3B A;  5E8I A;  4KDP A;  1IN5 A;  2MA3 A;  5E20 A;  4MHG A;  3SHF A;  3TGN A;  3QPH A;  4JQF A;  3SXY A;  1STZ A;  4L18 B;  1BN5 A;  1ZAR A;  3R60 A;  4ENJ A;  2Y0M A;  1YQA A;  4HX4 A;  1TLH B;  3IRR A;  4FHT A;  1XGS A;  2IPQ X;  4BAY A;  4ON0 A;  2Z3Y A;  5KVR A;  4UNO A;  2DFI A;  4R8H A;  3DF8 A;  3R61 A;  1ULY A;  3FXU A;  3VB2 A;  2JTV A;  3RKY A;  1KYW A;  2V9V A;  1FBQ A;  1X3U A;  4L5J A;  3LQR A;  3R0A A;  4ENK A;  4EJW A;  2D1V A;  4G9Y A;  2M1B A;  3BPV A;  1FWZ A;  2FE3 A;  3RI4 A;  3TQN A;  2A3S A;  4RB3 C;  4RGR A;  3S2W A;  1B4A A;  4MQV A;  1T98 A;  4M9S A;  1W4M A;  1K79 A;  5LBQ A;  1KU2 A;  1JGS A;  2HOE A;  4IPA A;  2ELH A;  3HOT A;  3BOQ A;  1XMA A;  4I0B A;  5LGN A;  1GHC A;  2EA2 A;  2P8T A;  3FM3 A;  3PQK A;  5L3F A;  2FNA A;  4AWX B;  5HVQ C;  1TBX A;  4A2U A;  1DUX C;  4UV9 A;  4ZZD A;  1FBU A;  1XB4 A;  1SD6 A;  2JSC A;  2NS0 A;  1WQ2 A;  3WGI A;  1PP7 U;  2KIF A;  2RDP A;  1FT9 A;  1R1V A;  3TDZ C;  2BV6 A;  2E7X A;  2A6H F;  4P5O A;  2HFH A;  3DXJ F;  3CLO A;  3QU6 A;  2PMU A;  4GXO A;  1G3W A;  3TKY A;  2CG4 A;  1B1B A;  1RIO H;  4A5M A;  3F8M A;  1YS7 A;  5HDK A;  3ULQ B;  1G3S A;  4AIK A;  3K0L A;  3BP8 A;  2FBI A;  3LA2 A;  2XVC A;  3IC7 A;  2K02 A;  2VXZ A;  2HEO A;  1H9G A;  2VBZ A;  3BY6 A;  4BNC A;  1BIA A;  2JZY A;  4HQE A;  4UHT A;  1SFX A;  1ZLJ A;  3I58 A;  1W7P D;  3ABT A;  2HTJ A;  4HZF A;  4E70 A;  1OYY A;  3B73 A;  2G9W A;  5HS7 A;  1E17 A;  5LRR A;  2DPU A;  5ICE A;  2RVC A;  3COA C;  3EQL F;  2W84 A;  5KK1 A;  3WE2 A;  5ED4 A;  3ELK A;  1W7P B;  2STW A;  1WI9 A;  3R4K A;  4O6J A;  2DW4 A;  4BH9 A;  4RB2 C;  4G6Q A;  4IHT A;  1ODD A;  3HIF A;  1V3F A;  2PMH A;  5EEG A;  3HRU A;  3FMQ A;  2C6Y A;  2XGX A;  5AIQ A;  2Q0O A;  3H92 A;  3M1E A;  2EWN A;  2BEO A;  1TNS A;  2XAS A;  3KCC A;  1IN8 A;  2E1N A;  1SFU A;  4KFC A;  5HLI A;  4I98 B;  4UVC A;  1ZAO A;  4HLX A;  1OYI A;  4HW0 A;  2PFB A;  3GFI A;  3GUD A;  1RZ4 A;  4Q5S F;  4EMS A;  3K1P A;  1KQ9 A;  3HHH A;  4ESJ A;  2ISY A;  3F23 A;  2EFN A;  2F5C A;  4R79 A;  2KJB A;  5DUI A;  1O3S A;  3O2P E;  1DDN A;  2BGC A;  2GAU A;  1ZG5 A;  5LGU A;  3ABU A;  2JPC A;  3WGG A;  1PDN C;  2A68 F;  5ICC A;  4WWC A;  3FWE A;  3KLN A;  3LST A;  5FB2 A;  2ZJ2 A;  1U78 A;  1JHH A;  1IXS B;  2YU3 A;  2JRT A;  3FXR A;  4G7O F;  2GQQ A;  1LJ9 A;  2PN6 A;  2H6B A;  1XCB A;  4BHP A;  4HA8 A;  4U0Y A;  2G7H A;  3C1D A;  2G7U A;  2FEZ A;  3MWM A;  1FZP B;  1MJA A;  1L3L A;  1KQ0 A;  4R1H A;  2Z5U A;  1ZGJ A;  1BI2 A;  4CZZ A;  4LLL A;  1RI7 A;  3WTT C;  1W5T A;  3Q9V A;  5ERI A;  2R7F A;  2MBF A;  1XDU A;  3ZPL A;  1D8K A;  1B59 A;  3KEO A;  2M87 A;  2HQN A;  1LDD A;  2Y75 A;  1EH7 A;  4EQQ A;  3I59 A;  2GXB A;  2GWR A;  2A6E F;  4HLY A;  3WG9 A;  3CJN A;  5CYV A;  3C7J A;  5DUK A;  2MH2 A;  1YTY A;  3RYP A;  2K27 A;  3KP6 A;  2JPB A;  3JTH A;  2QVO A;  3LAP A;  4LGW A;  3AAF A;  1SFE A;  3RKW A;  4CXF A;  1TTY A;  2CW0 F;  4GO1 A;  4RGS A;  5FGM A;  3REO A;  2LSO A;  2ZNZ A;  3BWG A;  4BQA A;  1FSE A;  4EGY A;  4TV7 A;  4KYW A;  3GLX A;  3U9G A;  5CVV A;  1G6N A;  2QYO A;  3LQQ A;  3VFZ A;  2OQG A;  4N9I A;  2EFO A;  4HYE A;  4OIQ F;  1B9N A;  1SAX A;  1HW5 A;  3I0T A;  1P92 A;  2XAJ A;  1U2W A;  4EJO A;  1KQ8 A;  4EM2 A;  3CO6 C;  3IRQ A;  4ENM A;  2XAQ A;  3RJP A;  3F3X A;  1ZN2 A;  1P2F A;  3GX4 X;  2D45 A;  3M9A A;  3EYY A;  3WTZ A;  3HRM A;  3WTS C;  4KN4 X;  4JK1 X;  3HSR A;  2FQ3 A;  1DPR A;  3K1N A;  4RS8 A;  3P7N A;  1I1S A;  4U0V A;  3F72 A;  3L7W A;  3T0Y A;  4U88 A;  5CVJ A;  2GXG A;  4Y17 A;  2XUB A;  2P5L C;  5DV5 A;  2KIM A;  3WU1 B;  3TO6 A;  2ZNY A;  1IF1 A;  1YLF A;  2DO7 A;  3F8B A;  3EDP A;  1LDJ A;  1PUE E;  2L01 A;  4GYI A;  2HYG D;  3FF5 A;  5HLG A;  1IUY A;  1LVA A;  2UXN A;  1FBS A;  3T1B A;  1HBX G;  2HQR A;  3F6V A;  4ZYG A;  5DEQ A;  1U5T C;  4GYG A;  2XV4 S;  2ESH A;  5CJ9 A;  4MQ9 F;  4PZJ A;  1Z6R A;  3NRV A;  4XLP F;  1IN4 A;  3F8F A;  2DQL A;  5BPI A;  2QWW A;  1FSH A;  1K78 A;  2HGC A;  1I27 A;  2VE9 A;  1FP1 D;  3WTY C;  2HS5 A;  5FD5 A;  4L5I A;  1P4W A;  2FBH A;  1H9T A;  4OIP F;  5J6X A;  5DD8 A;  2A61 A;  4LFU A;  4A6D A;  4F7Z A;  1YYV A;  4UVB A;  2RV8 A;  5F6F A;  2XAH A;  4WK8 F;  5H6R A;  3HRS A;  2YR2 A;  5D5U B;  1KA8 A;  5HS9 A;  3CTA A;  4Y15 A;  1ZG1 A;  5D4R A;  4KA4 A;  2FBK A;  4BXU A;  1TQP A;  2QM3 A;  4KIB A;  1XSX A;  1O7L A;  2HKX A;  3K1M A;  1BC8 C;  1IRG A;  2QLZ A;  2V6C A;  5BMZ A;  3M7G A;  1IZ1 A;  4EJU A;  2LNB A;  2HR3 A;  4U0W A;  3M8F A;  1XMK A;  3JAM Z;  4P96 A;  2RNJ A;  3RDI A;  1T0F A;  2F5E A;  2K86 A;  4A5N A;  3MQ0 A;  3K2Z A;  1XSV A;  3LA7 A;  3QPT A;  2VT2 A;  2FF4 A;  4ASN A;  4DNC A;  3RPU A;  2IT0 A;  1T6S A;  3C18 A;  5LHG A;  3HSE A;  1JHF A;  2DLL A;  3WTX C;  2VE8 A;  5E18 F;  2V79 A;  5FD6 A;  4IRH A;  5L3C A;  3MZH A;  1OPC A;  3BJ6 A;  1S7O A;  4EM1 A;  3T8T A;  1LEB A;  5K5Q A;  4ESB A;  3QAH A;  2K7L A;  3DEU A;  4OU0 A;  5FFX A;  2BE5 F;  3MZY A;  1H0M A;  2V1X A;  1U8R A;  5L3G A;  4LK0 F;  4HF2 A;  5ILV A;  2HZT A;  5E1W A;  5LHH A;  1D8J A;  4IXA A;  3ZMU A;  3ERE D;  1K6O A;  2ZFW A;  1RUO A;  1QPM A;  4LJZ F;  1HKT A;  4DQ2 A;  2X0L A;  5D5V B;  4KMU X;  2RN7 A;  3V7R A;  1R58 A;  3ECH A;  2VN2 A;  5J8F A;  1Z1D A;  2EV0 A;  5D6F A;  2KJC A;  5K5O A;  1J9I A;  1LEA A;  3LA3 A;  4HV5 A;  1LQ1 A;  3G3Z A;  4XBF A;  2DK5 A;  2P5V A;  1OR7 A;  1S8N A;  5ICF A;  4RB0 A;  2IA0 A;  2H27 A;  3KP2 A;  1XGO A;  2OZU A;  4KNY A;  3DFG A;  4FX4 A;  3JSO A;  1SMY F;  3GFL A;  3E5X A;  1Y0U A;  2M8E A;  4KT5 C;  4HBL A;  3TOA A;  4XLN F;  4Z2Y A;  2L54 A;  2VOD A;  4WXC A;  4LMY A;  3RPQ A;  1BI0 A;  2Z99 A;  2Z33 A;  1QGP A;  2AXL A;  3ZMD A;  4G8X A;  5K1Y A;  1JXS A;  3WGH A;  3KP4 A;  4I01 A;  3QRF F;  2CGP A;  4UV8 A;  1U5T A;  3E6B A;  1R00 A;  3GFM A;  4FT8 A;  2P5K A;  1U5T B;  1W5S A;  3NEU A;  2PI0 A;  2W85 A;  4ENN A;  2EK5 A;  4KN7 X;  2GIV A;  3L09 A;  3OV8 A;  2AS5 F;  4IJA A;  4GGG A;  1OYW A;  5L3D A;  3F22 A;  1HQC A;  2OBP A;  1BI3 A;  1NHA A;  2KIU A;  1GXQ A;  1ZG3 A;  3KZZ A;  2R7D A;  3HRT A;  5IT9 K;  1F9N A;  3E6D A;  4RAZ A;  5IT3 A;  1S3J A;  3ISP A;  2GA2 A;  4ZZL A;  1Z91 A;  2IW5 A;  3ZMV A;  1YW9 A;  2PEX A;  2ACJ A;  2YX4 A;  4UVA A;  3B02 A;  1MGT A;  3DP7 A;  5E8G A;  4UUV A;  4B09 A;  2IVM A;  2OQR A;  1UHW A;  1AWC A;  4O5V A;  1FX7 A;  1MZB A;  4OMY A;  4LLN A;  1D3Y A;  2CFX A;  2WWY A;  1Z9C A;  2PJP A;  3I71 A;  4D0P A;  1I6X A;  2EV5 A;  2ZKZ A;  5HDG A;  3RIR A;  1O3T A;  2FSW A;  3G73 A;  4MTD A;  4I0A A;  3Q9S A;  4L9V A;  4WCG A;  1IXC A;  1IW7 F;  1PP8 F;  1LDK B;  2VOP A;  1CF7 A;  2P4W A;  4UXN A;  3L00 A;  3J80 Z;  2STT A;  1F5T A;  2OD5 A;  3Q5F A;  1JE8 A;  2VBY A;  4MGR A;  1XD7 A;  4AIJ A;  1CF7 B;  1F4K A;  3IKT A;  2EB7 A;  4EJV A;  4A12 A;  2PBI A;  4LB6 B;  1QZY A;  5D8K B;  5IT9 Z;  2F5F A;  1MDM A;  4LG0 A;  2WC2 A;  3R0J A;  3V7C A;  1BI1 A;  5DCM A;  1IN6 A;  3HTS B;  1S29 A;  3VOE A;  5D5X B;  1MDM B;  4LG0 B;  3T5X A;  1FYK A;  2W24 A;  5DCM B;  3V8K A;  1WSU A;  2PG4 A;  5D8L B;  4XRF A;  3I59 B;  4P9U A;  1ZRD A;  2HYF A;  1ZH5 A;  1FOK A;  1YIO A;  2Z9O A;  1SD7 A;  4IF4 A;  2IA1 A;  1XGM A;  3E6M A;  2MH9 A;  1P4A A;  2QQA A;  1ZRC A;  2XKP A;  2QQ9 A;  3CUQ A;  3GF2 A;  2BYV E;  1TW3 A;  2HWV A;  2VBX A;  3PFI A;  2ZCW A;  4YFX F;  2NRA C;  3CUQ B;  5J8C A;  5LEJ A;  2RQP A;  4MTE A;  2Q2E A;  1UFM A;  2FA5 A;  4OIO F;  4U7D A;  4MEX F;  1QO0 D;  3ZQ7 A;  2A5Y B;  3DQV C;  2CQK A;  3WE3 A;  3H3Z A;  1QZZ A;  1G3Y A;  1I1G A;  3GWZ A;  1LNW A;  2DI3 A;  3QP6 A;  2NNY A;  5F1R A;  1IRF A;  3E5Q A;  2DT5 A;  4M6X A;  3K9T A;  5E1X A;  3F21 A;  3FMS A;  4L9J A;  4QLC U;  1EV7 A;  1EH8 A;  3GO5 A;  4ESF A;  3L2C A;  2P6S A;  4AD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...