5K5RA

Aspa-32mer dna,crystal form 2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
89
structure length
89
Chain Sequence
STDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AspA
publication title Structures of archaeal DNA segregation machinery reveal bacterial and eukaryotic linkages.
pubmed doi rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Transcription/dna
total genus 26
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5k5rA00
2DO7A 3KE2A 3BZ6A 3ZMVA 3KP5A 5E1ZB 1J2XA 1I1GA 2J5PA 3VODA 2F2EA 4RB1A 3F3XA 1FPQA 2XROA 1JGSA 4M6YA 2RGVA 4L0ZB 3E5UA 4U88A 2XAFA 3E97A 1XGNA 2HFHA 3FXQA 2WV0A 4I02A 2L4AA 2L54A 2ISYA 1QO0D 1W7PA 4LGWA 5EEHA 1REPC 3ECHA 3F8NA 3LQQA 2NRAC 3GXOA 2M5WA 3RI4A 3R0AA 5FGMA 5E1WA 5ICFA 1WWXA 3ABUA 4MTDA 3PQJA 1B9NA 1FP2A 3SHFA 1HBXG 3OV8A 3IC7A 4XRFA 4ZH4F 2D45A 2GAUA 1BOAA 1IW7F 1F4KA 4O6JA 2K4JA 3F6VA 3HYIA 2ZCWA 2EFQA 1FOKA 3RYPA 1W4MA 2VC1A 3IKVA 2G7HA 3CUQB 2HR3A 3JW4A 3W6KB 1TW2A 2M30A 3JSPA 3I58A 1BC8C 2BBYA 3QPHA 4AIHA 2YPRA 1TW3A 2HEOA 3SXYA 2XAJA 3CUOA 1PP7U 2IJLA 4EVIA 4UXNA 5BOXA 3LA7A 3HRSA 4BYYA 5DD8A 4M73A 3KP4A 2VBYA 5HLGA 1T38A 3KEOA 3EUHA 1R58A 3H92A 1HW5A 3OOPA 2PLYA 3JSOA 3ELKA 2YU3A 1L3LA 3P9KA 4RB3C 2PG4A 1FX7A 1E17A 1D8KA 1IXCA 1BC7C 3I59B 1O3QA 3Q9SA 2STTA 2GIVA 4LD5A 5DYMA 4CDGA 3BY6A 3MAJA 1W7PB 5CYVA 4I7HA 4RGSA 2IT0A 1OR7A 2FBKA 1HKSA 2E7XA 3C1DA 2YX4A 4WK8F 1P4XA 1O3SA 1D8JA 2CFXA 1GHCA 4MQ9F 2VXZA 4PGGA 5ILSA 2AXLA 5HOOA 2HS5A 1TQMA 4IRIA 2FSWA 1A04A 2D2WA 1Z7UA 4L5IA 1PP8F 3E3VA 3J81K 2DPDA 2L4MA 2PQ8A 4OOIA 2JTVA 1P92A 2PI0A 3L7WA 1PUEE 4MEXF 3PQKA 3AAFA 2ZJ2A 5ICGA 4HA8A 1L0OC 2A68F 4UV9A 3WGHA 2Y48A 4LB6B 3J7AO 2FXAA 2OZ6A 5D5WB 2EB7A 4RAYA 3IRRA 5J6XA 4IVNA 5E20A 2VONA 5D8KB 1BN5A 4EJUA 5D8LB 3K2ZA 2H27A 2LDUA 1WQ2A 3Q5FA 1FC3A 3RPQA 5BQTA 1S7OA 2A69F 4WX9A 3B02A 4U7BA 3CO6C 3GVAA 1QBJA 1OYWA 2HGCA 3GFLA 3V8JA 3G3ZA 2PMUA 1SMYF 5LGNA 1WSUA 1G3TA 4G7ZF 2HWVA 1J9IA 3FXUA 3V4GA 1G3YA 1PDNC 4HDVA 3I54A 5E8IA 4HLYA 1RZ4A 4BHCA 2JPBA 2HYGD 3CUQC 1BM9A 3D5LA 4RB2C 2RDPA 3RJPA 1BIAA 4H0EA 3F8BA 1S29A 2V1DA 3R6SA 1O3RA 1BJAA 3I0TA 4HLXA 2JSCA 2ZNYA 2MC3A 1XD7A 3H3ZA 3LWFA 3QU3A 1YW8A 1J59A 4N9HA 2KJCA 2QM3A 2W84A 1C0WA 3IWZA 4BHBA 2L01A 2W85A 2Q2EA 3WTXC 1I5ZA 4ENJA 1B6AA 2W25A 4FHTA 1U78A 3GO5A 4GGGA 4MHGA 1FT9A 1F9NA 3ERED 2L02A 2ZMEB 4Y13A 5H6QA 4ZYHA 1FNNA 1HW2A 4EQQA 2KJBA 5HDGA 1U5TC 2DK8A 3DKWA 3F21A 2CSOA 3F6OA 3O6BB 3WTVC 1ZLJA 1Z1DA 5LEJA 4P9FA 5DCMB 1SD5A 2V1UA 2HOEA 3GW2A 3GFJA 3V7CA 1P4AA 3K9TA 4B09A 4E70A 1ZRFA 1KQ0A 3BP8A 4HQMA 1CGPA 2HTJA 1U2WA 2IP2A 2ESNA 2NNNA 4KFCA 1Z91A 3BPVA 2FEZA 3ROUA 3HRMA 2RN7A 3JAMK 2EA2A 5LHGA 4HX7A 1OYYA 3I5UA 1R1VA 4CGZA 5E17F 3GYHX 5CVVA 3KP6A 3CO7C 1KYWA 3FXRA 2Q0OA 5KK1A 4A0ZA 3HIFA 2FQ3A 3GWZA 1HXDA 1STZA 4KYWA 5D4SA 3RDIA 1ZREA 2MA3A 1IRGA 3ZN1A 1S6LA 1BI3A 1T39A 2FNPA 1JHHA 4KMUX 2HTSA 1CF7A 4LMYA 1MGTA 2XIGA 5K1YA 5D5UB 3MFKA 2Y0MA 4UNOA 2GA2A 2P4WA 3FMQA 1ZG5A 4KIGA 4KICA 5L3FA 1FP1D 4P96A 4OIOF 4WWCA 3TDZC 3QRFF 5FD6A 3DEUA 1KU9A 4R1HA 1FYLA 2EFNA 5EEGA 3VFZA 3SFZA 2Z99A 1BIBA 4HDUA 4KT5C 1SFEA 3Q9VA 1QZYA 5L3DA 2QENA 5BPIA 1SFXA 2OD5A 4A2UA 5FLXK 5LRRA 1UHWA 4BNCA 4XSZF 3WTUC 2GXBA 2OBPA 3DF8A 1LJ9A 1QNTA 3V8KA 4PZJA 2P7CB 2B0LA 3CUQA 2KIUA 3BOQA 4LLLA 4KIFA 5BMZA 1HQCA 1W7PD 5FFXA 5DDGA 3MWMA 2V79A 5HS7A 1IRFA 1R22A 2QYOA 2DFIA 1LEAA 5L3GA 4LLNA 1ONVA 4G6QA 3GUDA 1V3FA 3REOA 2M87A 4GYIA 4ZZLA 1BBYA 1CF7B 4IF4A 3GFMA 4Q48A 1S3JA 2XAQA 3E6DA 5JR3A 4HZFA 2O61A 3K0LA 2NYXA 5HS9A 4Y17A 3I59A 4FT8A 1U5TA 3P7NA 1U6GA 3RKYA 3N4MA 3KETA 3GF2A 4OMYA 5CVJA 3MZYA 4KNYA 2VT3A 5LLQA 4NB5A 5IT3A 5E1XA 5IT9K 4HF0A 4CXFA 1I1SA 3E5XA 3WODF 2IA1A 4AIKA 4AD9A 1SAXA 1YG2A 3T5XA 4HQEA 2EFOA 2F5CA 4A5MA 2UZKA 5A2QZ 4EV0A 2JRTA 1J75A 2P5VA 1I6XA 4EJWA 3MEXA 2DTRA 4KIBA 3FM3A 4ZYGA 2Y75A 4GCVA 4LJZF 4S05A 1ZGAA 3I71A 1ZRCA 3WTZA 3D0SA 3E6BA 3C7JA 1NHAA 2EV5A 4MGRA 2XV4S 4R79A 5CVRA 5H20A 1TQPA 3V7RA 4F7ZA 1RUOA 4EM2A 5TRDA 3CDHA 2H09A 2FA5A 4BXUA 2XASA 5L3BA 4JQFA 4P5OA 1MDMB 3KCCA 3L09A 2PN6A 3M1EA 1E2XA 4G9YA 2EJRA 4FX0A 2JPCA 2M8EA 4NHJA 2Z33A 2FRHA 4I0AA 1O7LA 2EFWA 2K27A 2QBYA 4CHUA 1MJAA 1U5TB 2UXXA 3LFKA 2Z5UA 2EV0A 2P6SA 3TKYA 5JVTA 4YFXF 2BV6A 1BI2A 3ISPA 4D0PA 2HQNA 4IXAA 1K6OA 2GWRA 1RIOH 5LGUA 3E5QA 4M74A 3QOPA 3VEPA 3J81Z 1F5TA 1XCVA 2Z3YA 4M9SA 2K7LA 1YW7A 2A3SA 3HUGA 1XN7A 3ABTA 2YSRA 2WTEA 5ILUA 2PEXA 3WGIA 3QP6A 3BJ6A 3DXJF 4HOBA 3EQLF 5LBQA 4M71A 1FYKA 2XHKA 4I2OA 1QQIA 3TO9A 2VOOA 3FZVA 4N0BA 3U1DA 1MKMA 4HAMA 4OMZA 2W57A 4L18B 5TJJA 4LK0F 5LEKA 4KMFA 5D5VB 4FX4A 1Q1HA 5F64A 1R1TA 2ZMEA 2DBBA 3FWEA 1FSHA 1XDUA 1ZG3A 1OKRA 3WU1B 4YIFA 1P4WA 1UHMA 1K78B 2VODA 3ZN0A 3KFWX 2FU4A 2IW5A 2Z9OA 1ZRDA 5DCMA 1G3WA 1B9MA 3HSFA 1TQIA 1TNTA 3WU0A 2QBYB 3NQOA 2VC0A 4BHPA 3F23A 3BJAA 4LK1F 3WE2A 5H6RA 3VB2A 1Z6RA 3R60A 4RS8A 5J8CA 4ON0A 1MJBA 3J80Z 4A0XA 4Z2YA 1SD4A 1UCRA 3L00A 1S7AA 1D5VA 4MTEA 4NQWA 5AONA 3SQNA 5AIQA 2QZ8A 2G9WA 3HOSA 2DU9A 2LKPA 2OU2A 3WG9A 2QQ9A 4U0VA 1LQ1A 4P55A 1H9GA 1DPRA 2CYYA 3M9AA 4RB0A 1KYZA 3K69A 2KIFA 3QAHA 5LHHA 4EJOA 2P7VB 1DP7P 3GFIA 1FLIA 3F8FA 4TV7A 3WTTC 2A6EF 1USTA 3ULQB 1TTYA 2K4BA 4ZYDA 3HHGA 4PGHA 1U8RA 5HVQC 2D1HA 2XGXA 4O5VA 3U9GA 3M7GA 2XAGA 2P5LC 5DUIA 2LNBA 2EA4A 4QWQA 2F5EA 2H94A 4EJTA 2R3SA 3DFGA 1OMIA 1KGSA 1RNLA 2CW0F 4KUMA 3TQNA 4ZYEA 3E6MA 1P6RA 3HSRA 5F6FA 3TOBA 1ZG1A 5HLIA 4G8XA 4OINF 1EH6A 5CLSA 3W6JB 2AS5F 3ZMZA 2A61A 1I27A 3HTUA 1J5YA 1ODDA 2P8TA 3RYRA 5ICEA 5DEQA 1ZN2A 2UWMA 4AWXB 5L3CA 2RQPA 1YQAA 4L5JA 1YW9A 2FMLA 5FO5A 1FY7A 4A6DA 4GO1A 2IA0A 1IN4A 2ZO4A 5DV5A 2OQRA 1IN7A 5CJ9A 1SFUA 2EFPA 1X3UA 1Z9CA 2CQKA 5ERIA 1YIOA 3K1PA 2COMA 2TDXA 5FD5A 2QLZA 2BE5F 2H6BA 3CTAA 4ESFA 4WXCA 3O2PE 3EYIA 2YX7A 1QGPA 3BROA 2PFBA 3MQ0A 2UXNA 1IN8A 1JE8A 1TNSA 1MJ9A 1GVJA 1J7KA 2K02A 4Q4ZF 3MZHA 2BGCA 1Y0UA 1DUXC 1YTYA 3GEZA 2W24A 2LSOA 1FYMA 3B73A 3SZTA 4EM0B 1UFMA 3R0JA 1YO5C 4RGXA 2F5FA 4G7OF 4GXOA 1J0RA 4I09A 1O3TA 1DPUA 3KP2A 5K5QA 5L3EA 3T0YA 4OIQF 1LDJA 3HOTA 5JHUA 4UVBA 3P9IA 1FBQA 5CVUA 3TDUC 1ZH5A 4KN4X 1IN6A 1ZAOA 1YFHA 4LLGF 3F72A 1LEBA 1Z05A 4A5NA 3F8MA 4EMSA 2R7DA 3I4PA 3LAJA 3RTRA 3P9CA 1KQ9A 3QU6A 1RUNA 1JHFA 2QWWA 4I0BA 1SD7A 5FB2A 3GX4X 3ZPLA 5BS6A 2E1NA 3BDDA 3GZ5A 1R36A 1MDMA 2O6GE 3FM5A 1XSXA 1SMTA 4CO8A 3EYYA 4XLNF 3ZMTA 5DD4A 1OPCA 4KDPA 2VE8A 2RKHA 2XKPA 4EGZA 4ESBA 2WC2A 2DI3A 5BPDA 2IA2A 3F8CA 4Q47A 3L2CA 2H6CA 2M45A 4HYEA 3TGNA 1FWZA 3WTWC 3KZZA 2XVCA 2F5DA 1R5HA 1R7JA 2DQRA 1JXSA 2CWEA 4EGYA 5DCFA 2MD5A 2YR2A 3ZMSA 1ZARA 1Z6TA 1UB9A 5LRSA 4Y15A 4HW0A 3T1BA 4I01A 4KN7X 4HF2A 5D6EA 4YFNF 3ZQ7A 3GZ6A 4BQAA 2CG4A 3FX3A 3ECOA 2A07F 4R8HA 4YIIA 3IKTA 4HV5A 1YYVA 2R7FA 3DV8A 1S8NA 2GXGA 4LG0A 1GXQA 1LVAA 2CGPA 3S2WA 1ZLKA 4G94A 1LDKB 5A2QK 1KQ8A 3ZP5A 3G73A 1K78A 1QZZA 1T98A 4O3MA 1F1ZA 4IRHA 1R00A 1U3EM 1XDSA 4HX8A 1KU7A 1IUYA 1AOYA 3COAC 1T2KA 1FBUA 4UVAA 3RKXA 3U2RA 2A6HF 2O0YA 5JI6A 5CVIA 2FF4A 3E6CC 1BI1A 3BWGA 2QUFA 1D3YA 1IXRC 4HX4A 4U7DA 3HRUA 4ENKA 2RC4A 2XKOA 5DUKA 2IRFG 5ILVA 2XAHA 4QLCU 4UV8A 5ICCA 4WXHA 1HKTA 3H3UA 2BYVE 1MD0A 3TOAA 3HSEA 1LDDA 2PBIA 3NEUA 1EH7A 2WWYA 2G7UA 1USSA 3TO7A 2HQRA 2ZBKA 4L9JA 3WE3A 4AVPA 3N97A 4MQVA 2VBZA 3IRQA 2FBIA 2D1VA 1T0FA 4L0YB 3FHZA 1WRJA 2ADUA 3K1MA 1IF1A 2NS0A 2V1XA 3DQVC 4LG0B 5LGTA 2J5OA 2FOKA 1IZ1A 2C6YA 3KP3A 4ETSA 2PJPA 2X4HA 4XSXF 3JTHA 2CO5A 3WTYC 3DP7A 1T6SA 3LA2A 1ON2A 4OIRF 4CYDA 3CJNA 2MH9A 3KLOA 1XSDA 4A0YA 4GYGA 2HDCA 4IPAA 4XBFA 2NNYA 4A12A 4ENMA 2MLKA 1DDNA 1KU3A 2XUBA 5LHIA 5HDNA 5HLHA 2V9VA 1LB2A 2DK5A 3V8LA 1G3SA 4KA4A 3F22A 4IJAA 4LB5A 1G4DA 1B4AA 2STWA 3O3KA 2MBFA 2GQQA 2O8XA 4AIJA 2RVCA 2OAZA 5KVRA 4IRGA 2ZFWA 1GXPA 5E8GA 3LAPA 1TLHB 1FSEA 2MLGA 1YLFA 2LF8A 2XRNA 4S04A 5J8FA 2QQBA 3T8RA 1HKQA 3RPUA 5HS8A 4YFKF 4L9NA 2DQLA 2VN2A 1MZBA 2ZXJA 2O3FA 4RGRA 3T8TA 3L9FA 4DQ2A 2PMHA 5AIPA 2P5KA 4BH9A 1BI0A 4UVCA 2HZTA 2K86A 3HHHA 2DPUA 4L9TA 3FMRA 4A6EA 1R1UA 4RGUA 1IN5A 2QQAA 3J80K 2IPQX 4PCQA 3V7SA 3KEQA 1HSTA 3IWFA 3MCZA 3ZMUA 3I64A 4HBLA 5F1RA 1ZHFA 2LF7A 4DNCA 5K5RA 1QPMA 2FBHA 1SD6A 1XGOA 4UUVA 2OZUA 2KIMA 3RKWA 1XMAA 2GZWA 2DT5A 3KP7A 2KKOA 1KU2A 2ZKZA 2OQGA 4UHTA 4RAZA 4MNUA 1ZGJA 1K79A 3C3WA 4ENNA 3TO6A 2P6TA 1XGSA 1RI7A 2M1BA 2E1CA 4N9IA 3DPLC 3HRTA 3CLOA 3JAMZ 3HTSB 1XSVA 1O57A 1EH8A 4IHTA 3QP5A 4YG2F 2MH2A 2ZNZA 4L9VA 3QPTA 3GLXA 2EV6A 3SZPA 5K5OA 4ZZDA 2FE3A 1HW1A 4IHSA 1EV7A 1P2FA 1LNWA 2E7WA 1R5GA 1WI9A 5E18F 1AWCA 1IXSB 3M8EA 4I98B 4ESJA 3KLNA 2DAOA 5JFRA 3LQRA 3BPXA 2JZYA 3BJOA 1R23A 4B8XA 2DW4A 2NAZA 1XB4A 4G7HF 3IHUA 4ASNA 2A5YB 1VTNC 2FMYA 2ESHA 4M9ZA 1W5TA 3RIRA 1H9TA 4EJVA 2O03A 2X0LA 1TBXA 3VOEA 4U0YA 1XMKA 2DLLA 2VT2A 3K1NA 5FFZA 2HYFA 4HF1A 1OYIA 2KRFA 3JTGA 3EDPA 4JBAA 3WGGA 4G6DA 3C18A 5FLXZ 3ML6A 1B1BA 3PFIA 4LFUA 1B59A 2HKXA 3WTSC 1ON1A 4JK1X 3KZYA 3M8FA 4M9XA 1IAWA 5D5XB 2VE9A 4Q5SF 5D4RA 2GA1A 2Q8KA 4BAYA 2JT1A 1KA8A 3I53A 2ELHA 2OA4A 4WXDA 4WF2A 4WCGA 1FZPB 2EK5A 2L3DA 1H0MA 4M6XA 4XLPF 3EETA 2ACJA 2IVMA 3IL2A 4OIPF 2V6CA 5ED4A 1XGMA 1ULYA 1O7FA 1XCBA 4CICA 2RNJA 3ZMDA 2RV8A 5HDKA 4P9UA 3DPTA 4EM1A 3FMSA 1FBSA 4HV6A 2BEOA 4OU0A 1W5SA 4CZZA 4MEYF 1YS7A 2ETHA 2ISZA 3LA3A 1ZYRF 3R61A 4M72A 1YS6A 1G6NA 2VBXA 2FNAA 5D6FA 4K2EA 6PAXA 2QVOA 2EWNA 3R4KA 2VOPA 2VBWA 5IT9Z 3NRVA 4U0WA 1WKMA 1HSJA 3FF5A 4PDKA 1K7AA 2HKOA 1V4RA 3LSTA
chains in the Genus database with same CATH superfamily
1RC9A 3VPRA 2WA0A 3SEQA 2DO7A 3KE2A 3BZ6A 4UUTA 3KP5A 5E1ZB 3ZMVA 1J2XA 1I1GA 1SVMA 2J5PA 3BQYA 3VODA 2F2EA 5JLXA 3A01B 1ETOA 4RB1A 3F3XA 1FPQA 2XROA 1JGSA 1OQYA 4M6YA 2H1LA 2RGVA 5IP9J 2HVQA 4L0ZB 3E5UA 3FK6A 1RRJA 3MZ8A 4U88A 2XAFA 3IH3A 3MMYB 3E97A 1XGNA 1SC7A 3M8JA 3HXLA 2HFHA 3FXQA 4RM2A 2XAUA 2E34A 2WV0A 4I02A 2L4AA 2HOAA 3LSMA 2L54A 2ISYA 1QO0D 4XLAA 1W7PA 2W1OA 4C30A 4I6ZA 1SFOJ 4LGWA 5E3LA 5EEHA 1F43A 1REPC 3DU5A 3ECHA 3K4KA 3F8NA 3LQQA 4XRSG 3QODA 3WHCA 2NRAC 3GXOA 2M5WA 3RI4A 3R0AA 1E0EA 2DT7B 4DYRA 4IZZA 5FGMA 3Q0WA 3I55I 5E1WA 5ICFA 2PJRB 1WWXA 2Y30A 3ABUA 4MTDA 4AYBA 2OTLI 1JUPA 2IXSA 2RREA 3MD2A 1IV6A 3PQJA 2IS2A 2NVYJ 1B9NA 1FP2A 3SHFA 1HBXG 3OV8A 2X51A 3D5RC 1I50J 1HCRA 4E7SA 3MKZA 3IC7A 3ZQIA 4F91B 3S8PA 4XRFA 4ZH4F 2D45A 3UNGC 2GAUA 1BOAA 1IW7F 1F4KA 3M4OJ 4O6JA 2K4JA 3F6VA 3HYIA 4A3IJ 3UR3C 2ZCWA 3CDLA 1RPWA 3IAS2 3KYLA 4F3QA 3TBIA 3JRGA 1QPIA 2EFQA 1FOKA 2AHQA 3RCOA 1W4MA 3RYPA 2CV1A 2VQLA 4PSWA 2VC1A 3I4NJ 1MMAA 1VZ0A 3IKVA 2IS6A 2G7HA 3CUQB 4P1WA 2TCTA 3J7YJ 4LIUA 2HR3A 2XPUA 3PO3J 3JW4A 5J4YA 3W6KB 1TW2A 2M30A 3JSPA 3I58A 5HNHA 1MBFA 1BC8C 2R7VA 2BBYA 4E7JA 3QPHA 2GIZA 4AIHA 1W36D 2E5NA 2YPRA 2ID6A 1TW3A 3JRFA 2DOAA 3SXYA 2HEOA 2VL8A 2XAJA 3CUOA 1PP7U 3CMEI 2IJLA 4EVIA 4UXNA 3G2BA 5BOXA 3LA7A 3OR1C 3HRSA 4BYYA 5DD8A 4M73A 4I76A 3OOUA 3KP4A 2VBYA 5HLGA 1NG7A 1T38A 2O9LA 3KEOA 3PNYA 1XS9A 3EUHA 1WFXA 1R58A 1XC5A 1MSFC 3N05A 2MFZA 1VQ4I 1A35A 3H92A 1HW5A 1U9OA 3OOPA 5K7ZA 2PLYA 1G59A 3JSOA 2Y0SN 2V26A 3ELKA 2YU3A 1L3LA 2KMUA 3P9KA 4RB3C 1WGXA 2PG4A 1FX7A 1QRYA 1DGWY 1E17A 1D8KA 1IXCA 4H4KC 1VQ7I 1BC7C 3I59B 4RLQA 1O3QA 3Q9SA 4FCYA 2STTA 5J47A 1LFPA 2GIVA 1QU3A 2LREA 2V6EA 4LD5A 3CP8A 5C44J 5DYMA 4CDGA 3H5RA 2EZKA 4XONA 2DFHA 2BY2A 5BNGA 2V9PA 1K4TA 4LG3A 4C2MJ 2M7AA 3BY6A 1ZR2A 3MAJA 1W7PB 2VKDA 4AC0A 2KZGA 5CYVA 4I7HA 4RGSA 4BY1J 2IT0A 1FJLA 1OR7A 4A3DJ 2FBKA 1HKSA 1OCCH 2E7XA 3P5JA 3C1DA 2YX4A 4WK8F 1P4XA 3E1SA 3B6AA 1A5JA 1O3SA 5FKOA 4B47A 3JRHA 1D8JA 2CFXA 4CA0A 5E3MA 4MLOA 1GHCA 5IYBJ 3ZGKA 3FXLA 2QSHX 2CMPA 4MQ9F 1P7JA 2VXZA 4PGGA 2BY0A 5ILSA 3WG7H 3DLLF 2AXLA 3BCBA 5HOOA 3QYEA 4KITB 2HS5A 1TQMA 1E3HA 4IRIA 5E79C 2VKEA 5B5EC 2KZVA 4QTRA 4B44A 2Y2ZA 3W3CA 3OY9A 2VLAA 2FSWA 1YRNB 4XN0A 2CV0A 1A04A 2D2WA 1Z7UA 4C9YA 4L5IA 1PP8F 3E3VA 3J81K 3LSPA 2DPDA 2L4MA 5CKTA 2PQ8A 4OOIA 2JTVA 1P92A 2L7FP 1NG6A 2PI0A 3L7WA 1PUEE 4MEXF 3PQKA 3AAFA 2ZJ2A 3CCLI 5ICGA 2O7OA 1ZGWA 4XLEA 4HA8A 3L2UA 1K6YA 1L0OC 2A68F 1JT0A 4UV9A 1Z3XA 3HOVJ 3WGHA 2L0KA 2CQXA 2VJIA 2Y48A 4LB6B 3J7AO 2FXAA 3S2DJ 2LYCA 3I9V2 2OZ6A 5D5WB 2EB7A 4XRSA 4RAYA 1PJRA 4B43A 3IRRA 5J6XA 3S3OA 3RPUD 4IVNA 3DKXA 5E20A 1R9TJ 2VONA 1YOVB 2ID3A 4OAYA 1X1AA 4BL0B 5D8KB 3K10A 1BN5A 1QHHD 4EJUA 5D8LB 3K2ZA 2EIJH 1IJWC 2H27A 4B1RA 5B3SH 4HG2A 2LDUA 3OL3A 1V5FA 2I5UA 1WQ2A 1APLC 4DGWB 3Q5FA 1SFKA 4D5CA 1FC3A 3RPQA 3IUOA 5BQTA 1S7OA 5FKNA 3BTJA 2W7NA 4YELA 2A69F 3S32A 2OUMA 4WX9A 1X4OA 2Q1ZB 2X1EA 3B02A 5IOZA 4U7BA 4NC6A 3CO6C 3GVAA 3PM1A 1QBJA 3D1NI 1OYWA 2HGCA 3GFLA 4XLFA 3V8JA 3G3ZA 2PMUA 1BL0A 1SMYF 4IO9F 5LGNA 4NUBA 1WSUA 1G3TA 4G7ZF 3OYBA 1W5CC 2HWVA 1J9IA 4XQFA 3FXUA 3V4GA 1G3YA 1YX5A 2EZIA 3OYMA 1PDNC 4HDVA 3GZNB 3I54A 3RZOJ 2F6CA 2BW3A 5E8IA 2I8DA 5JLWA 1RZ4A 1OJLA 3D5SC 3KIOA 4B4CA 2JPBA 4BHCA 4HLYA 3TL4X 3J7ZI 5EG0A 1Y1WJ 2HYGD 5CQEA 4ZTJA 3CUQC 1BM9A 3D5LA 4Y52J 5GAGJ 1JKOC 4RB2C 1ZQ3P 1AHDP 2A05A 3E7LA 2RDPA 3RJPA 2UV1A 3LL7A 1BIAA 2K9LA 4H0EA 1GT0C 3F8BA 2X85A 1S29A 2E1MC 1OCOH 2V1DA 3R6SA 1DU0A 1O3RA 1BJAA 3I0TA 4HLXA 2JSCA 5GPCA 2R7UA 2ZNYA 1TP4A 2L9SA 2E60A 3DTIA 2MC3A 3A4CA 3L2RA 1XD7A 2O5RA 2XF5A 3H3ZA 2DMPA 3LWFA 3QU3A 1YW8A 1J59A 3JRIA 4PFPA 2HZDA 4N9HA 2VI6A 4JOMA 2KJCA 2QM3A 2EINH 2W84A 1C0WA 3IWZA 2CUZA 4BHBA 2L01A 5TISC 2W85A 2Q2EA 3WTXC 2IGNA 1I5ZA 1FIPA 3AFHA 3OYLA 4ENJA 1B6AA 2VKVA 2W25A 4FHTA 1U78A 1T33A 3GO5A 3W6VA 4GGGA 4MHGA 4FASD 1FT9A 3G6EI 1F9NA 2L02A 2ZMEB 3ZRGA 3ERED 1X1DA 4Y13A 2E2HJ 5H6QA 4ZYHA 1FNNA 1HW2A 4EQQA 3VSLA 1R6RA 2KJBA 4BXFA 5J40A 5HDGA 3SEZA 3F0CA 1U5TC 2DK8A 2A6TA 1W1WE 3DKWA 1BW5A 3HOWJ 1MBKA 3ZQLA 3F21A 2CSOA 1Z67A 3F6OA 3O6BB 3QPSA 3WTVC 3DWLE 3BG3A 1ZLJA 1Z1DA 1V55H 4BQNA 3OMYA 5LEJA 2QA4I 1RR7A 4P9FA 5DCMB 3FXJA 4D7MA 4PJJA 1A31A 4E6KG 3S1MJ 4XM3A 1SD5A 2D5VA 3OYKA 4JX6A 2V1UA 2HOEA 3GW2A 3GFJA 3V7CA 1P4AA 3DBLB 3HPHA 1BR4A 3ASNH 1BR1A 4RDUA 3VDXA 2EIKH 3K9TA 1X1BA 3OYEA 4B09A 2ECBA 4E70A 2WAFA 5DM6F 1ZRFA 3BZCA 3MKLA 5DS9A 2VQHA 5J4VA 2HOTA 2EPFA 1KQ0A 3BP8A 4HQMA 1CGPA 3KZIC 1MMGA 2QSFX 1RESA 2HTJA 1U2WA 2IP2A 3K4LA 2ESNA 2NNNA 1W0TA 4KFCA 1Z91A 4V19K 1IO2A 5M3MJ 1EJ9A 2BW3B 5IY5H 3HB9A 3BPVA 3L1PA 4BKXA 5J1YA 1WJEA 5EG0B 2JA5J 2FEZA 4XMYA 5K7HA 3ROUA 2DA2A 1LFUP 2WV1A 3HRMA 2FUG2 2RN7A 4NQWB 2JA7J 1OCTC 4M3DA 3JAMK 4II3A 1ETWA 2EA2A 5GTHC 1P9QC 4HX7A 5LHGA 1OYYA 3FKIJ 1FOWA 2GBYA 3I5UA 3QOEA 2LP0A 1R1VA 2Y0SA 4CGZA 1H89C 5E17F 2R7OA 3GYHX 5CVVA 4EEFG 2E2JJ 3DKYA 3ABLH 1N75A 3KP6A 1QA6A 1XMXA 3CO7C 1KYWA 3IH4A 3FXRA 3H36A 2Q0OA 4MO7A 2XF7A 3MN2A 5K7FA 2CFOA 5KK1A 4A0ZA 3HIFA 2FQ3A 4XLCA 3H9GA 3S17J 3EUKL 3GWZA 1IC8A 1ZR4A 1HXDA 4QIWN 1STZA 2ECCA 4KYWA 5D4SA 3RDIA 5GTIC 1ZREA 3I3LA 4BJTA 2X9DA 2MA3A 2VPLA 4RAFA 1IRGA 3RQ4A 4S0HB 3ZN1A 1S6LA 1BI3A 2IGKA 3DTEA 1VQMI 1T39A 2FNPA 2JWTA 3VYSB 1JHHA 4KMUX 3CCQI 4IL6C 2HTSA 3JRAA 1CF7A 4HEA2 4LMYA 1MGTA 3A01A 2XIGA 5K1YA 5D5UB 3MFKA 2MC4A 2Y0MA 4UNOA 2GA2A 2P4WA 3FMQA 2XSJC 1ZG5A 1E3OC 4KIGA 4KICA 5L3FA 5F1JA 2XGEA 1FP1D 4P96A 4OIOF 4WWCA 3TDZC 2XSDC 3NARA 4DJAA 3QRFF 5FD6A 4XICA 3DEUA 3NWTA 2CU7A 5EDNA 1PVEA 3L2VA 1KU9A 4R1HA 1IDZA 1FYLA 2BXYA 4J01A 2EFNA 1R71A 5EEGA 3VFZA 2HXOA 3SFZA 3FBNB 3U21A 2Z99A 2NVTJ 1IG7A 1BIBA 4HDUA 4KT5C 3W2AA 1SFEA 3Q9VA 2M34A 1QZYA 3OS2A 2NVQJ 5L3DA 3ZXSA 4C3HJ 3LNQA 4NC8A 3A2KA 2WAQN 2PJRA 3H0GJ 5FRNA 1DU6A 3DEWA 2L7ZA 2QENA 4PJNA 1FIAA 4YEJA 5BPIA 1SFXA 2OD5A 4A2UA 2XDVA 5FLXK 5LRRA 2DYSH 2E71A 1UHWA 3ZOBA 3CC2I 4BNCA 4XSZF 4JP0A 1ERDA 5EYRA 5FJ8J 3WTUC 2BY3A 4J19A 2GXBA 2OBPA 1OCZH 2X1DA 1VQPI 3DF8A 1LJ9A 1QNTA 3PIPF 2BOLA 3GTPJ 4QPOA 3V8KA 4PZJA 2EBIA 3H3VK 2P7CB 2B0LA 2JK3A 4RBOA 3CUQA 2KIUA 3BOQA 4LLLA 2KQRA 2ZSHB 4KIFA 2CQQA 1WVRA 5BMZA 2ZMEC 2Y9YA 1HQCA 1IV8A 1W7PD 2XC7A 5FFXA 4AIDA 1MMNA 4W1UA 2P0WA 3MWMA 5DDGA 1H88C 2V79A 5HS7A 2F48A 1IRFA 1R22A 4RA2A 3GMEA 2QYOA 2DFIA 1LEAA 4UB8C 3QWLA 1YJ9I 5L3GA 4LLNA 2P81A 1Z77A 1ONVA 3LSIA 4G6QA 2DDAA 3GUDA 5JHFA 1V3FA 4RLFA 3REOA 4CYCA 9ANTA 2JMWA 2R5YB 2M87A 2HDWA 4GYIA 4ZZLA 1B8IB 1D0ZA 2BXZA 1BBYA 2IGOA 1CF7B 2OPTA 4IF4A 5C4JJ 3HC7A 3BC8A 3H5NA 3PFYA 2QKLB 3GFMA 4Q48A 1S3JA 2DYRH 4C2TA 2BVMA 2XAQA 4NBQA 3E6DA 3TW6A 2ELKA 2EILH 2CQ7A 1BW6A 5JR3A 4HZFA 4HNVA 3K0LA 2O61A 1VQKI 2NYXA 5HS9A 4Y17A 2K3PA 2QQ8A 3I59A 3SYTA 1KZHA 1IGNA 1ZKGA 4FT8A 3QPLA 1U5TA 2DMUA 3P7NA 1U6GA 3L2WA 3RKYA 3BG6A 3N4MA 3KETA 3GF2A 4BE1A 4OMYA 1P7IA 2K85A 5CVJA 3MZYA 4KNYA 1Z7LA 1TWHJ 2VT3A 5LLQA 3SFIA 2IEKA 4NB5A 3IP4B 3HPGA 2BHZA 3S93A 5IT3A 5B66C 5EGOA 4YRVA 2HPIA 5E1XA 5IT9K 3IV5A 4IHVA 5DM7F 4HF0A 4CXFA 4JX4A 2LC2A 2XB0X 1HOMA 1I1SA 3CJTB 1TWCJ 3E5XA 3WODF 2IA1A 3JR9A 4AIKA 2R93J 2HNHA 4NC7A 4AD9A 1SAXA 1YG2A 2EZHA 1E3PA 2EH3A 1FMVA 3T5XA 4HQEA 1T56A 2CRGA 2EFOA 2F5CA 4A5MA 2UZKA 5A2QZ 4EV0A 2NS8A 1GUUA 2JRTA 1J75A 2P5VA 1I6XA 3OYNA 4EJWA 3MEXA 2DTRA 2LRDA 1GV5A 4KIBA 2F5VA 3Q0UA 1YRNA 1ZELA 5DTDA 4E7LA 3FM3A 4ZYGA 2Y75A 4GCVA 4II2A 2N8GA 2XGCA 4LJZF 3LSGA 1YHQI 4BJ5C 4S05A 3ONQA 2GM4A 3S1NJ 1ZGAA 1HF0A 2V4JC 3I71A 1ZRCA 3WTZA 2XF6A 3D0SA 1JTXA 2ZXIA 3E6BA 4A3KJ 2E1MB 3C7JA 2NOJB 2KL4A 1R4NB 4AU7A 2LTPA 4HSRA 1NHAA 2EV5A 1FOXA 3K70D 4MGRA 2XV4S 1TWAJ 3DPUA 4BJ6C 4R79A 5CVRA 1WJDA 4M3FA 5H20A 4ZYAA 1TQPA 3V7RA 4F7ZA 1RUOA 4HPQA 1TT0A 4EM2A 5TRDA 3CDHA 2H09A 2FA5A 4CYCB 2V9KA 4BXUA 5IYCJ 3V42A 2LY2A 1A6QA 2XASA 4JQFA 4P5OA 3W2VA 4PFOA 5L3BA 1MDMB 3KCCA 3AG1H 3L09A 2PN6A 3M1EA 3H0DA 4V2FA 1E2XA 4G9YA 2EJRA 4FX0A 3OSFA 1UAAA 1U9NA 4C3JJ 2JPCA 1VFCA 2M8EA 2IGMA 4NHJA 2Z33A 2FRHA 1S9HA 2DA1A 4I0AA 1O7LA 2EFWA 3BG5A 2K27A 2QBYA 4CHUA 1MJAA 1U5TB 2UXXA 3S3NA 4AM3A 3LFKA 2Z5UA 3HGYA 1U8BA 1D0YA 2EV0A 1NK2P 2P6SA 2GLOA 3TKYA 5JVTA 3I4MJ 2LD5A 4PJ0C 4XK4A 4YFXF 2BV6A 2K5CA 4BS9A 1BI2A 3ISPA 4D0PA 5EGOB 2HQNA 1I3QJ 3A0HC 4IXAA 4BY7J 1JI8A 1K6OA 2KDZA 2GWRA 3O8GA 1RIOH 4DIQA 5LGUA 2BVLA 1JKQC 1K83J 1YITI 3E5QA 3G1MA 2LKXA 4M74A 3QOPA 3JRBA 1ZK8A 3G1OA 3VEPA 3J81Z 2E2IJ 1F5TA 1QZEA 4XRMA 4MFDA 3OYGA 4XL9A 3ZQQA 1XCVA 1JUSA 2Z3YA 3GTGJ 2HVSA 4M9SA 2K7LA 1YW7A 3C2HA 4LOCA 1S7EA 3H5AA 3RKQA 2A3SA 3HUGA 1XN7A 2K9MA 3ABTA 3OIOA 1HDPA 2WTEA 2YSRA 5ILUA 2PEXA 3WGIA 3HL2A 3QP6A 3PSFA 1MH4A 3BJ6A 3DXJF 3CCUI 4HOBA 3EQLF 1ITYA 5LBQA 4M71A 1FYKA 1X2MA 2XHKA 4I2OA 1QQIA 3TO9A 3BG9A 2VOOA 3FZVA 4N0BA 3U1DA 4DYQA 1MKMA 5GADJ 4HAMA 4MFEA 5F0CA 4OMZA 2W57A 2FX0A 4L18B 5TJJA 2RQQA 1Y56A 3OYJA 4XKWA 4LK0F 1UG2A 5LEKA 1T8IA 4KMFA 5D5VB 2LFBA 4FX4A 3S2HJ 2VJ5A 2LOOA 1Q1HA 2FD5A 3ZQFA 1JJ8C 1SANA 4RM3A 3OSGA 1TC3C 1WJ5A 1XG1A 1PUFB 5F64A 1R1TA 4ZTFA 2ZMEA 2HI3A 3TP0A 2DBBA 3K4CA 1MMSA 2CW7A 1WPKA 3FWEA 2WAQA 4DYCA 2L9RA 1FSHA 1XDUA 1ZG3A 1RR8C 1OKRA 3WU1B 4YIFA 1P4WA 4CCOA 4B48A 1UHMA 1K78B 3KYCB 2VODA 3ZN0A 3KFWX 2FU4A 2IW5A 4CZCA 3K4NA 2Z9OA 1ZRDA 3HOXJ 4XKVA 5DCMA 1G3WA 1B9MA 3HSFA 2UUZA 1TQIA 5LFAA 2H8WA 1TNTA 1MH3A 2KRCA 2BZTA 3WU0A 2EZLA 2DJNA 2ZSIB 2VJJA 2QBYB 2X48A 3ABKH 2EIMH 5IP6A 3FKJA 3NQOA 1HA8A 2VC0A 2B9SA 1AKHA 1X1PA 5HODA 3HKZA 3RQIA 2LH9A 3TP3A 3IH2A 4BHPA 3F23A 3BJAA 1MNEA 2ICWG 3BCAA 2Z1DA 4LK1F 4W97A 4D7NA 3WE2A 5M3FJ 5H6RA 1U0JA 3VB2A 5FLMJ 1SVLA 1Z6RA 3R60A 4RS8A 5J8CA 1RKTA 4ON0A 1MJBA 2X6WA 3J80Z 4A0XA 4Z2YA 3KPHA 1SD4A 1UCRA 3FK7A 3L00A 2WBMA 3FXMA 1S7AA 1VF9A 1WJBA 2ZJQF 1D5VA 4MTEA 3CJRB 4NQWA 1JTYA 1ZTRA 2HU9A 5CPRB 5AONA 3SQNA 4A3EJ 3RZDJ 3HUGB 5AIQA 2QZ8A 2G9WA 1XPXA 3HOSA 2DU9A 1Y6IA 2LKPA 2OU2A 3WG9A 2QQ9A 4U0VA 2M3AA 2V1NA 3QQAA 1LQ1A 4P55A 1H9GA 3BT9A 1DPRA 2CYYA 3M9AA 4RB0A 1KYZA 3K69A 3AG2H 2KRHA 3CZ6A 2R5ZA 3ABMH 2KIFA 2IBDA 3QAHA 5LHHA 1QVUA 1WI3A 2P7VB 4EJOA 3HZJA 1DP7P 4CUGA 3GFIA 1FLIA 4XLHA 2W48A 3F8FA 4TV7A 5CQGA 3WTTC 3MKWB 1D5YA 3Q3SA 2A6EF 1IRXA 1LUJB 1USTA 3ULQB 1TTYA 3CCRI 2K4BA 1WJCA 4ZYDA 3HHGA 4PGHA 4XKBA 3VWBA 1U8RA 5LD2C 1ETYA 5HVQC 5IOYA 2D1HA 4ABZA 2XGXA 3CCMI 4O5VA 2X1CA 3BQZA 1WH7A 3U9GA 3FXOA 3M7GA 2XAGA 4LIVA 1UHSA 1HC8A 2OC6A 2P5LC 1FTTA 5DUIA 2LNBA 3VYTB 2EA4A 2G0EA 4ZC3A 1Q1VA 1MNMC 4QWQA 3CMMA 2F5EA 2H94A 4EJTA 2R3SA 3DFGA 1OMIA 1UG0A 1ETVA 3GBGA 1KGSA 1RNLA 1FEXA 2FOWA 2CW0F 2W4SA 4KUMA 3PNTA 4NDLA 2YS9A 3TQNA 4ZYEA 1Z3YA 3E6MA 3L2QA 4BEHB 1AKHB 3NAUA 3OYAA 4ZDPA 1P6RA 3HSRA 5F6FA 4N4OB 3HM5A 3TOBA 4CCLA 1ZG1A 3BG7A 5M5WJ 5HLIA 3HJEA 2AO9A 4Y33A 4G8XA 4OINF 1EH6A 5CLSA 2GOXB 3BLYA 3W6JB 2AS5F 4F52A 1UMQA 3ZMZA 2A61A 1I27A 2CH0A 2R7QA 3GLLA 2WB1N 3HOZJ 3HTUA 1BOBA 3OYIA 3DTKA 1IRZA 2AXTC 1R4MB 4FQGA 1J5YA 1ODDA 1ETXA 2E19A 2DA6A 5F08A 5B1BH 2DODA 2P8TA 3CESA 3H9JA 3RYRA 5ICEA 5DEQA 4OWRB 1ZN2A 4BDZA 2UWMA 2KIQA 4AWXB 3LSKA 4F55A 2RQPA 5L3CA 1YQAA 2MABA 1T95A 4L5JA 1YW9A 2FMLA 5FO5A 2M2EA 1FY7A 4XN3A 4IX7A 1I3AA 2DTZA 4A6DA 2M7BA 3HDDA 4GO1A 2LK2A 2IA0A 1IN4A 3LFUA 1TZLA 2ZO4A 4XOPA 5DV5A 2QEXI 2CUJA 2JA8J 2OQRA 2V7FA 2QKMB 1IN7A 3K6GA 2ZC2A 5CJ9A 2R5ZB 1SFUA 3JRDA 4PUSA 2MGQA 1X3UA 2EFPA 1Z9CA 1VQ5I 2CQKA 5ERIA 3OIQA 1YIOA 1VNDA 3S1RJ 1N77A 3K1PA 2COMA 4JYKA 2TDXA 2VUMJ 4DOZA 5FD5A 4QPQA 2QLZA 2BE5F 3CTAA 2H6BA 3PSIA 3TEDA 4D1QA 4ESFA 3AL0B 3HOYJ 4WXCA 3VYRB 4L5EA 3O2PE 3EYIA 2YX7A 2R5YA 1QGPA 3BROA 5EZHA 4XIDA 4BUPA 2PFBA 1B8IA 3MQ0A 1X19A 2UXNA 1IN8A 3CP2A 1TNSA 1JE8A 1MJ9A 4IQJA 1H8AC 1YJNI 1VQ9I 1GVJA 1J7KA 2TRTA 1MNDA 4I99C 2K02A 4Q4ZF 4C3IJ 3OR2C 4J00A 4ITVA 4G6TB 3MZHA 1UZCA 2BGCA 1Y0UA 1DUXC 2IS1A 2XB5A 1YTYA 3GEZA 1K61A 4UUSB 2W24A 2LSOA 3CMAI 1FYMA 3B73A 3SZTA 4EM0B 2F4IA 1UFMA 4HNTA 3R0JA 1YO5C 1D1BA 2DMQA 4RGXA 1MW7A 5IPAA 2F5FA 1AA7A 4G7OF 2EQRA 4GXOA 1J0RA 4I09A 3G71I 1O3TA 4NNJA 1DPUA 2CUEA 3KP2A 5K5QA 2YU9J 5L3EA 3ZQCA 3SJMA 5H2FC 3T0YA 1W36C 2R7TA 1TWGJ 3PNVA 4OIQF 1LDJA 3HOTA 1V54H 5JHUA 2DN0A 4A3JJ 4UVBA 2KLOA 2KPMA 3P9IA 1FBQA 5CVUA 2ME6A 2X6YA 3TDUC 1ZH5A 2M0MA 2LR8A 1YX3A 3A02A 3I56I 4KN4X 4GRIA 3EUAA 4DBRA 2DA3A 3BTIA 4Y7NJ 3HG9A 4E4HA 4A3CJ 2JQ7A 1IN6A 3BZKA 5GAHJ 1ZAOA 1YFHA 4LLGF 1MSEC 3F72A 1LEBA 1Z05A 2HDDA 4A3GJ 2KISA 3BR3A 4A5NA 1T0FC 3PL8A 4DZJA 3F8MA 4EMSA 3HKZN 3JCUC 3SZGA 5JVGF 2R7DA 3I4PA 3LAJA 2W82A 1F36A 3RTRA 2K9QA 3P9CA 1KQ9A 3SDBA 3QU6A 3K2AA 1VQLI 2JRMA 5IP7J 5FKLA 4Y3OA 3PJRA 1RUNA 1JHFA 2QWWA 3KX2A 4I0BA 2JJ7A 2LMDA 4RMNA 1SD7A 3FISA 3BR5A 4D9JA 5FB2A 3GX4X 2HOSA 2ELJA 2HXIA 1W0UA 3ZPLA 1ACIA 5BS6A 2E1NA 1B72B 3BDDA 3TW7A 1LFBA 2DA4A 3GZ5A 3G1LA 5KCMA 3H35A 3AG3H 3QYBA 1R36A 1MDMA 2O6GE 4IHXA 3FM5A 1XSXA 4E7KA 1SMTA 4CO8A 3CCJI 3EYYA 4XLNF 3ZMTA 5DD4A 1OPCA 5M5YJ 3GTQJ 4KDPA 2R7RA 2VE8A 2RKHA 2XKPA 4EGZA 4ESBA 3PO2J 2WC2A 2DI3A 2K3FA 2IA2A 5BPDA 3F8CA 4Q47A 4C2UA 3L2CA 3CCSI 4A3MJ 2CV2A 2H6CA 2M45A 4HYEA 3TGNA 4CCKA 1FWZA 2DFFA 2OCCH 3A03A 3WTWC 3KZZA 2XVCA 2ZXWH 1D0XA 2F5DA 1R5HA 1M1EB 3O8HA 1AU7A 4QSHA 2OJED 1R7JA 2L7MP 3H9QA 3K4JA 1WJFA 2DQRA 4HNUA 1JXSA 5KAIC 3S15J 2CWEA 4A3BJ 1GV2A 3GCMA 5HLTA 1GDTA 4MIMA 2L7KA 1G8XA 4EGYA 5GP9A 5DCFA 1Y8RB 2MD5A 2ZXHA 5EJCA 2DDBA 2CJJA 4N4NB 2VXDA 2YR2A 4BBRJ 4DBQA 3ZMSA 1ZARA 4CSWA 1Z6TA 1UB9A 5LRSA 4RAGA 2LLKA 4PJMA 1T08B 4Y15A 4HW0A 3T1BA 1SAUA 4I01A 4KN7X 4HF2A 5GAEJ 5D6EA 4YFNF 2HQ5A 3ZQ7A 3GZ6A 4BQAA 2CG4A 3FX3A 1HLVA 2JUGA 3ECOA 3AL0C 4V2GA 4IOAF 2A07F 2LG4A 2M4KA 4R8HA 2JN6A 4YIIA 3IKTA 1X58A 4HV5A 1YYVA 3H1CA 1V5EA 4FE7A 5M5XJ 2R7FA 1TL8A 2FJ1A 1LE8B 3DV8A 1S8NA 3FHNA 2ZJPF 4X6AJ 4IHWA 2GXGA 4BE2A 1PUFA 4LG0A 2HVRA 1WCMJ 1GXQA 2WY7Q 1LVAA 5KNLA 2HPMA 4F93B 2CGPA 2QF7A 2VPRA 3S2WA 2E5ZA 1ZLKA 3OIPA 1X3ZB 1TWFJ 1NK3P 4G94A 2WB1A 2OCEA 1LDKB 3E0JB 5A2QK 4B3XA 1RETA 1KQ8A 3K4BA 1VQ6I 3FXKA 1D1AA 4HSTA 3IAM2 2PMZN 5C3EJ 4G12A 3ZP5A 3G73A 1K78A 1QZZA 1T98A 2ZB9A 1JKRC 3OYCA 5J1RA 3VYUB 4HRIA 4O3MA 1F1ZA 4IRHA 1R00A 2DFEA 2LY9A 1U3EM 1D1CA 1XDSA 2VQCA 2Y9ZA 2E36A 2E1OA 3BR0A 4HX8A 2KP6A 2R92J 1KU7A 3LSHA 3MVPA 1IUYA 1YJWI 3W2WA 1AOYA 4BGDA 3COAC 5F27A 1T2KA 1FBUA 4UVAA 3RKXA 3U2RA 4IEJA 3CQZJ 2A6HF 2AQEA 3GTOJ 2O0YA 5JI6A 5CVIA 2FF4A 4M3BA 1LPQA 3S14J 2GXAA 2DA5A 3E6CC 2YUSA 1GLNA 1BI1A 3BWGA 2QUFA 1D3YA 1Z21A 1IXRC 1N25A 4HX4A 4U7DA 3HRUA 1Y1VJ 2XRLA 2H1KA 4ENKA 2RC4A 2XKOA 5DUKA 2IRFG 1WJAA 4X0GA 3WHBA 3ZQHA 5ILVA 3CMYA 1R49A 2XAHA 2NXNB 3DEEA 3LMMA 4UV8A 4QLCU 5ICCA 2ZFUA 5C4XJ 4WXHA 2R7ZJ 1HKTA 3DLAA 3H3UA 3MKYB 2BYVE 1CQTA 1MD0A 3TOAA 2XPWA 1LDDA 3HSEA 2PBIA 3NEUA 2ME0A 4GFBA 1EH7A 5HNFA 3U1KA 4BQQA 2WWYA 2B63J 2G7UA 1USSA 3TO7A 2R0QC 4E7HA 2HQRA 2ZBKA 4L9JA 2VJ4A 3WE3A 4AVPA 3M3YJ 3CF2A 3N97A 4MQVA 2VBZA 3IRQA 2FBIA 2D1VA 1RKWA 1T0FA 5F0FA 3FHZA 1WRJA 5KHDA 4L0YB 1NH3A 2ADUA 3K1MA 1IF1A 1LVKA 2NS0A 2V1XA 4E7IA 4XKCA 3DQVC 4LG0B 4JX5A 5LGTA 3J7AY 2J5OA 4M6VA 2FOKA 2DOEA 1IZ1A 2VB6A 2C6YA 2L5QA 1VQOI 2DMTA 3KP3A 4ETSA 3BR2A 2DXIA 2X4HA 2PJPA 4XSXF 3RSNA 4BACA 1DP3A 3JTHA 1IDYA 2CO5A 3C2BA 3WTYC 3JRCA 3DP7A 4KJZA 1T6SA 3SDGA 1FMWA 3LA2A 1ON2A 3OYDA 1R5ID 2WY8Q 5F0HA 4OIRF 4CYDA 4KISA 2HYJA 3OL4A 3QYFA 3CJNA 4GDFA 3K4MA 2MH9A 3KLOA 1XSDA 4A0YA 2MD0A 3LOCA 1O4XA 2IAIA 4GYGA 3CCYA 2HDCA 3G4SI 4IPAA 1A36A 1X2NA 2HQAA 4XBFA 4A69C 5EEAA 1V5GA 3FIWA 2NNYA 4BEHA 2IS4A 4A12A 2VIXA 1X1CA 1WZ2A 4ENMA 2MLKA 2JA6J 2AQFA 1DDNA 1EKEA 1KU3A 4A93J 2XUBA 5LHIA 5HDNA 5HLHA 4CCJA 1OCRH 2W00A 2V9VA 1VQNI 1LB2A 3B6CA 1Y8QB 2DK5A 4IOCF 3LSRA 3V8LA 1G3SA 4KA4A 3F22A 4IJAA 3WU2C 4LB5A 1G4DA 1B4AA 2STWA 3O3KA 2VASA 2MBFA 1K4SA 1Y0NA 2GQQA 2O8XA 3TMOA 4AIJA 3S16J 2RVCA 4B3AA 1EF4A 3BTLA 4CH7A 4UY8I 2OAZA 5KVRA 4UB6C 4IRGA 2ZFWA 1GXPA 5E8GA 5E3OA 3LAPA 2OV7A 1TLHB 2A5WA 3GTJJ 4DW6A 1FSEA 2MLGA 3S3MA 1QHGA 1YLFA 2LF8A 2XRNA 4ZDOA 4S04A 2OF7A 4AVZA 5J8FA 2QQBA 4A3FJ 3JREA 3T8RA 1HKQA 1DGRM 3RPUA 4YFKF 5HS8A 4L9NA 2DQLA 2VN2A 1MZBA 2ZXJA 2O3FA 3OWTA 3BR1A 4RGRA 3T8TA 1JUMA 3L9FA 4DQ2A 2PMHA 5AIPA 4CCNA 2K9SA 2KT0A 2P5KA 3VSKA 1YI2I 3DBHB 4BH9A 3OS0A 2XGDA 2NOGA 2Z16A 1TT5B 1BI0A 4UVCA 2PX9A 2WAEA 2COBA 1BR2A 1FOYA 1QVTA 2HZTA 2K86A 3HHHA 2DCEA 1I6HJ 2DPUA 2F4MB 4L9TA 3FMRA 2LKSA 4A6EA 1R1UA 4RGUA 3GTMJ 1IN5A 2QQAA 1BA5A 3KEYA 3J80K 2IPQX 4F92B 3C2GA 4KT6A 4PCQA 3V7SA 3KEQA 2ZJRF 1HSTA 3IWFA 3MCZA 3ZMUA 1KONA 3I64A 3F9KA 4HBLA 5F1RA 1ZHFA 2LF7A 4DNCA 5K5RA 1QPMA 1YE9A 2FBHA 1SD6A 3ZCOA 1XGOA 4UUVA 2B7EA 2MG4A 4D5FA 1Z0XA 2OZUA 2KIMA 3LSJA 3RKWA 4AYBN 4OAZA 2QSGX 1X4PA 1XMAA 1MBEA 2NS7A 2GZWA 3AG4H 2DT5A 3OS1A 4YIRX 2CUFA 3KP7A 2KKOA 1KU2A 5FLVA 2RAEA 3CCEI 2KDOA 4XOTA 4UUSA 1S72I 1JKPC 2Y31A 2OQGA 2ZKZA 4UHTA 4RAZA 1HDDC 4M3GA 4MNUA 3GTKJ 4BBSJ 1ORKA 4BE0A 1ZGJA 2M4GA 1K79A 1X3WB 4IKFA 1MMDA 2JUCA 3C3WA 2DMNA 3BR6A 1Y39A 2KHMA 4ENNA 3TO6A 2MYSA 2P6TA 4AUXA 1XGSA 5TGTA 1RI7A 2M1BA 2E1CA 3S1QJ 2JA2A 3A0BC 4N9IA 3DPLC 4BQOA 3HRTA 3CLOA 3JAMZ 3HTSB 1XSVA 1WHUA 1O57A 1EH8A 4IHYA 2KFDA 4IHTA 3QP5A 1MIJA 4YG2F 2MH2A 2LY1A 1SEUA 2ZNZA 4EATA 4L9VA 3QPTA 3OYFA 4LITA 5F04A 3GLXA 2EV6A 3SZPA 2R7XA 5K5OA 2QCOA 4ZZDA 4XNFA 2NVXJ 1NTCA 1LKXA 3OYHA 3UKGA 2FE3A 4FETA 1HW1A 4IHSA 1EV7A 2R7WA 2DT6A 3HOUJ 1P2FA 1JGGA 2LVSA 2PMZA 1LNWA 2E7WA 2H8RA 1R5GA 2M8GX 1WI9A 5E18F 3ZQGA 1AWCA 2WADA 2L9NA 1IUFA 1IXSB 2X6XA 3M8EA 4I98B 5J1UA 4ESJA 2JSPA 3KLNA 2DAOA 4PSXA 2R4GA 4M3EA 3DCFA 5JFRA 1S5LC 3CF5F 3ZR8X 4DZPA 3LQRA 4FE4A 4U87A 3BPXA 2JZYA 3BJOA 1UJ8A 1R23A 5GPAA 1MBJA 5EF6A 4B8XA 2DW4A 1JT6A 2NAZA 1XB4A 3BTCA 1WH5A 5EZGA 5FKKA 4G7HF 3IHUA 2BHYA 4ASNA 2A5YB 1VTNC 1B72A 2FMYA 2L2OA 4XR6A 3CCVI 2ESHA 4M9ZA 1W5TA 2K9NA 3M1CA 3RIRA 2JVGA 2LBFA 4BU2A 3HEFA 3PUFA 1H9TA 5IYDJ 3EUHC 3CLQA 4EJVA 2O03A 2X0LA 2Q2EB 4FTHA 4X1EA 4BXXJ 1TBXA 3VOEA 2OTJI 1EA3A 1VQ8I 2R7SA 2K40A 4U0YA 3PIOF 1OFCX 2QGUA 2FQ4A 1XMKA 2DLLA 2VT2A 2X6OA 3K1NA 5FFZA 2HYFA 3GTLJ 4HF1A 1XTAA 1OYIA 3AKZA 2VQGA 2KRFA 1PYVA 3JTGA 3CJQB 2GOMA 3FDYA 3A1YA 3EDPA 4JBAA 3WGGA 4G6DA 5FKMA 1N78A 3CC7I 3C18A 5FLXZ 3PUBA 3ML6A 1B1BA 4PJLA 2CW8A 3PFIA 1ETQA 1B59A 4LFUA 2HKXA 4A3LJ 3NWSA 2M9HA 1UELB 3WTSC 3ESWB 1JJ6C 1ON1A 2I10A 1OR7C 3KZYA 4JK1X 3M8FA 1OLTA 2DOFA 4Z6YA 1MBHA 1J09A 4M9XA 5D5XB 3ASOH 2VE9A 3K70C 1IAWA 5FROA 2O8KA 1POGA 4Q5SF 5D4RA 3ERMA 2GA1A 2XPVA 2Z2SB 2Q8KA 4BAYA 1ENHA 2JT1A 1G2HA 1KA8A 5E3NA 1VI0A 2MW8A 2CS3A 3I53A 2ELHA 2OA4A 2M0CA 4WXDA 4WF2A 4WCGA 1FZPB 2EK5A 2L3DA 3X2QH 5J3LA 3M07A 1H0MA 3KYDB 4M6XA 4XLPF 1GVDA 4FISA 1A6IA 3EETA 2ACJA 2IVMA 3IL2A 4OIPF 2JVHA 2MSYA 2VKHA 2V6CA 5ED4A 5B1AH 2L9VA 1XGMA 1ULYA 3FBIB 1O7FA 1FTZA 1XCBA 4CICA 4PK4A 2RNJA 3CDIA 3DBRB 3ZMDA 2RV8A 5HDKA 4P9UA 2Y69H 3DPTA 3CD6I 4EM1A 4ANJA 3FMSA 1FBSA 4HV6A 2BEOA 1LE8A 1ETKA 4OU0A 2BY1A 2DJIA 1I39A 3HBLA 1MBGA 2NVUB 1W5SA 4XORA 4CZZA 4ZJZA 4E7ZA 3CC4I 4MEYF 3DU6A 4ZDLA 1YS7A 2ETHA 4Y4RA 2ISZA 2E35A 3Q0VA 3LA3A 1ZYRF 4CCMA 3R61A 2DA7A 1OCPA 4M72A 1YS6A 1G6NA 3EPZA 3HGGA 4BDYA 1YIJI 5FRMA 2VBXA 2LBFB 1XX5A 1SVOA 2FNAA 5D6FA 4K2EA 6PAXA 2QVOA 3K7AJ 5KAFC 2EWNA 3R4KA 2VOPA 2F4OB 2VBWA 4IQ4A 5IT9Z 3NRVA 2RNGA 1DQUA 2CQNA 1WKMA 1HSJA 1OISA 1BJZA 4U0WA 3FF5A 4PDKA 1K7AA 2HKOA 1V4RA 3LSTA
chains in the Genus database with same CATH topology
2DO7A 3KE2A 3BZ6A 3ZMVA 3KP5A 5E1ZB 1J2XA 1I1GA 2J5PA 3VODA 2F2EA 4RB1A 3F3XA 1FPQA 2XROA 1JGSA 4M6YA 2RGVA 4L0ZB 3E5UA 4U88A 2XAFA 3E97A 1XGNA 2HFHA 3FXQA 2WV0A 4I02A 2L4AA 2L54A 2ISYA 1QO0D 1W7PA 4LGWA 5EEHA 1REPC 3ECHA 3F8NA 3LQQA 2NRAC 3GXOA 2M5WA 3RI4A 3R0AA 5FGMA 5E1WA 5ICFA 1WWXA 3ABUA 4MTDA 3PQJA 1B9NA 1FP2A 3SHFA 1HBXG 3OV8A 3IC7A 4XRFA 4ZH4F 2D45A 2GAUA 1BOAA 1IW7F 1F4KA 4O6JA 2K4JA 3F6VA 3HYIA 2ZCWA 2EFQA 1FOKA 3RYPA 1W4MA 2VC1A 3IKVA 2G7HA 3CUQB 2HR3A 3JW4A 3W6KB 1TW2A 2M30A 3JSPA 3I58A 1BC8C 2BBYA 3QPHA 4AIHA 2YPRA 1TW3A 2HEOA 3SXYA 2XAJA 3CUOA 1PP7U 2IJLA 4EVIA 4UXNA 5BOXA 3LA7A 3HRSA 4BYYA 5DD8A 4M73A 3KP4A 2VBYA 5HLGA 1T38A 3KEOA 3EUHA 1R58A 3H92A 1HW5A 3OOPA 2PLYA 3JSOA 3ELKA 2YU3A 1L3LA 3P9KA 4RB3C 2PG4A 1FX7A 1E17A 1D8KA 1IXCA 1BC7C 3I59B 1O3QA 3Q9SA 2STTA 2GIVA 4LD5A 5DYMA 4CDGA 3BY6A 3MAJA 1W7PB 5CYVA 4I7HA 4RGSA 2IT0A 1OR7A 2FBKA 1HKSA 2E7XA 3C1DA 2YX4A 4WK8F 1P4XA 1O3SA 1D8JA 2CFXA 1GHCA 4MQ9F 2VXZA 4PGGA 5ILSA 2AXLA 5HOOA 2HS5A 1TQMA 4IRIA 2FSWA 1A04A 2D2WA 1Z7UA 4L5IA 1PP8F 3E3VA 3J81K 2DPDA 2L4MA 2PQ8A 4OOIA 2JTVA 1P92A 2PI0A 3L7WA 1PUEE 4MEXF 3PQKA 3AAFA 2ZJ2A 5ICGA 4HA8A 1L0OC 2A68F 4UV9A 3WGHA 2Y48A 4LB6B 3J7AO 2FXAA 2OZ6A 5D5WB 2EB7A 4RAYA 3IRRA 5J6XA 4IVNA 5E20A 2VONA 5D8KB 1BN5A 4EJUA 5D8LB 3K2ZA 2H27A 2LDUA 1WQ2A 3Q5FA 1FC3A 3RPQA 5BQTA 1S7OA 2A69F 4WX9A 3B02A 4U7BA 3CO6C 3GVAA 1QBJA 1OYWA 2HGCA 3GFLA 3V8JA 3G3ZA 2PMUA 1SMYF 5LGNA 1WSUA 1G3TA 4G7ZF 2HWVA 1J9IA 3FXUA 3V4GA 1G3YA 1PDNC 4HDVA 3I54A 5E8IA 4HLYA 1RZ4A 4BHCA 2JPBA 2HYGD 3CUQC 1BM9A 3D5LA 4RB2C 2RDPA 3RJPA 1BIAA 4H0EA 3F8BA 1S29A 2V1DA 3R6SA 1O3RA 1BJAA 3I0TA 4HLXA 2JSCA 2ZNYA 2MC3A 1XD7A 3H3ZA 3LWFA 3QU3A 1YW8A 1J59A 4N9HA 2KJCA 2QM3A 2W84A 1C0WA 3IWZA 4BHBA 2L01A 2W85A 2Q2EA 3WTXC 1I5ZA 4ENJA 1B6AA 2W25A 4FHTA 1U78A 3GO5A 4GGGA 4MHGA 1FT9A 1F9NA 3ERED 2L02A 2ZMEB 4Y13A 5H6QA 4ZYHA 1FNNA 1HW2A 4EQQA 2KJBA 5HDGA 1U5TC 2DK8A 3DKWA 3F21A 2CSOA 3F6OA 3O6BB 3WTVC 1ZLJA 1Z1DA 5LEJA 4P9FA 5DCMB 1SD5A 2V1UA 2HOEA 3GW2A 3GFJA 3V7CA 1P4AA 3K9TA 4B09A 4E70A 1ZRFA 1KQ0A 3BP8A 4HQMA 1CGPA 2HTJA 1U2WA 2IP2A 2ESNA 2NNNA 4KFCA 1Z91A 3BPVA 2FEZA 3ROUA 3HRMA 2RN7A 3JAMK 2EA2A 5LHGA 4HX7A 1OYYA 3I5UA 1R1VA 4CGZA 5E17F 3GYHX 5CVVA 3KP6A 3CO7C 1KYWA 3FXRA 2Q0OA 5KK1A 4A0ZA 3HIFA 2FQ3A 3GWZA 1HXDA 1STZA 4KYWA 5D4SA 3RDIA 1ZREA 2MA3A 1IRGA 3ZN1A 1S6LA 1BI3A 1T39A 2FNPA 1JHHA 4KMUX 2HTSA 1CF7A 4LMYA 1MGTA 2XIGA 5K1YA 5D5UB 3MFKA 2Y0MA 4UNOA 2GA2A 2P4WA 3FMQA 1ZG5A 4KIGA 4KICA 5L3FA 1FP1D 4P96A 4OIOF 4WWCA 3TDZC 3QRFF 5FD6A 3DEUA 1KU9A 4R1HA 1FYLA 2EFNA 5EEGA 3VFZA 3SFZA 2Z99A 1BIBA 4HDUA 4KT5C 1SFEA 3Q9VA 1QZYA 5L3DA 2QENA 5BPIA 1SFXA 2OD5A 4A2UA 5FLXK 5LRRA 1UHWA 4BNCA 4XSZF 3WTUC 2GXBA 2OBPA 3DF8A 1LJ9A 1QNTA 3V8KA 4PZJA 2P7CB 2B0LA 3CUQA 2KIUA 3BOQA 4LLLA 4KIFA 5BMZA 1HQCA 1W7PD 5FFXA 5DDGA 3MWMA 2V79A 5HS7A 1IRFA 1R22A 2QYOA 2DFIA 1LEAA 5L3GA 4LLNA 1ONVA 4G6QA 3GUDA 1V3FA 3REOA 2M87A 4GYIA 4ZZLA 1BBYA 1CF7B 4IF4A 3GFMA 4Q48A 1S3JA 2XAQA 3E6DA 5JR3A 4HZFA 2O61A 3K0LA 2NYXA 5HS9A 4Y17A 3I59A 4FT8A 1U5TA 3P7NA 1U6GA 3RKYA 3N4MA 3KETA 3GF2A 4OMYA 5CVJA 3MZYA 4KNYA 2VT3A 5LLQA 4NB5A 5IT3A 5E1XA 5IT9K 4HF0A 4CXFA 1I1SA 3E5XA 3WODF 2IA1A 4AIKA 4AD9A 1SAXA 1YG2A 3T5XA 4HQEA 2EFOA 2F5CA 4A5MA 2UZKA 5A2QZ 4EV0A 2JRTA 1J75A 2P5VA 1I6XA 4EJWA 3MEXA 2DTRA 4KIBA 3FM3A 4ZYGA 2Y75A 4GCVA 4LJZF 4S05A 1ZGAA 3I71A 1ZRCA 3WTZA 3D0SA 3E6BA 3C7JA 1NHAA 2EV5A 4MGRA 2XV4S 4R79A 5CVRA 5H20A 1TQPA 3V7RA 4F7ZA 1RUOA 4EM2A 5TRDA 3CDHA 2H09A 2FA5A 4BXUA 2XASA 5L3BA 4JQFA 4P5OA 1MDMB 3KCCA 3L09A 2PN6A 3M1EA 1E2XA 4G9YA 2EJRA 4FX0A 2JPCA 2M8EA 4NHJA 2Z33A 2FRHA 4I0AA 1O7LA 2EFWA 2K27A 2QBYA 4CHUA 1MJAA 1U5TB 2UXXA 3LFKA 2Z5UA 2EV0A 2P6SA 3TKYA 5JVTA 4YFXF 2BV6A 1BI2A 3ISPA 4D0PA 2HQNA 4IXAA 1K6OA 2GWRA 1RIOH 5LGUA 3E5QA 4M74A 3QOPA 3VEPA 3J81Z 1F5TA 1XCVA 2Z3YA 4M9SA 2K7LA 1YW7A 2A3SA 3HUGA 1XN7A 3ABTA 2YSRA 2WTEA 5ILUA 2PEXA 3WGIA 3QP6A 3BJ6A 3DXJF 4HOBA 3EQLF 5LBQA 4M71A 1FYKA 2XHKA 4I2OA 1QQIA 3TO9A 2VOOA 3FZVA 4N0BA 3U1DA 1MKMA 4HAMA 4OMZA 2W57A 4L18B 5TJJA 4LK0F 5LEKA 4KMFA 5D5VB 4FX4A 1Q1HA 5F64A 1R1TA 2ZMEA 2DBBA 3FWEA 1FSHA 1XDUA 1ZG3A 1OKRA 3WU1B 4YIFA 1P4WA 1UHMA 1K78B 2VODA 3ZN0A 3KFWX 2FU4A 2IW5A 2Z9OA 1ZRDA 5DCMA 1G3WA 1B9MA 3HSFA 1TQIA 1TNTA 3WU0A 2QBYB 3NQOA 2VC0A 4BHPA 3F23A 3BJAA 4LK1F 3WE2A 5H6RA 3VB2A 1Z6RA 3R60A 4RS8A 5J8CA 4ON0A 1MJBA 3J80Z 4A0XA 4Z2YA 1SD4A 1UCRA 3L00A 1S7AA 1D5VA 4MTEA 4NQWA 5AONA 3SQNA 5AIQA 2QZ8A 2G9WA 3HOSA 2DU9A 2LKPA 2OU2A 3WG9A 2QQ9A 4U0VA 1LQ1A 4P55A 1H9GA 1DPRA 2CYYA 3M9AA 4RB0A 1KYZA 3K69A 2KIFA 3QAHA 5LHHA 4EJOA 2P7VB 1DP7P 3GFIA 1FLIA 3F8FA 4TV7A 3WTTC 2A6EF 1USTA 3ULQB 1TTYA 2K4BA 4ZYDA 3HHGA 4PGHA 1U8RA 5HVQC 2D1HA 2XGXA 4O5VA 3U9GA 3M7GA 2XAGA 2P5LC 5DUIA 2LNBA 2EA4A 4QWQA 2F5EA 2H94A 4EJTA 2R3SA 3DFGA 1OMIA 1KGSA 1RNLA 2CW0F 4KUMA 3TQNA 4ZYEA 3E6MA 1P6RA 3HSRA 5F6FA 3TOBA 1ZG1A 5HLIA 4G8XA 4OINF 1EH6A 5CLSA 3W6JB 2AS5F 3ZMZA 2A61A 1I27A 3HTUA 1J5YA 1ODDA 2P8TA 3RYRA 5ICEA 5DEQA 1ZN2A 2UWMA 4AWXB 5L3CA 2RQPA 1YQAA 4L5JA 1YW9A 2FMLA 5FO5A 1FY7A 4A6DA 4GO1A 2IA0A 1IN4A 2ZO4A 5DV5A 2OQRA 1IN7A 5CJ9A 1SFUA 2EFPA 1X3UA 1Z9CA 2CQKA 5ERIA 1YIOA 3K1PA 2COMA 2TDXA 5FD5A 2QLZA 2BE5F 2H6BA 3CTAA 4ESFA 4WXCA 3O2PE 3EYIA 2YX7A 1QGPA 3BROA 2PFBA 3MQ0A 2UXNA 1IN8A 1JE8A 1TNSA 1MJ9A 1GVJA 1J7KA 2K02A 4Q4ZF 3MZHA 2BGCA 1Y0UA 1DUXC 1YTYA 3GEZA 2W24A 2LSOA 1FYMA 3B73A 3SZTA 4EM0B 1UFMA 3R0JA 1YO5C 4RGXA 2F5FA 4G7OF 4GXOA 1J0RA 4I09A 1O3TA 1DPUA 3KP2A 5K5QA 5L3EA 3T0YA 4OIQF 1LDJA 3HOTA 5JHUA 4UVBA 3P9IA 1FBQA 5CVUA 3TDUC 1ZH5A 4KN4X 1IN6A 1ZAOA 1YFHA 4LLGF 3F72A 1LEBA 1Z05A 4A5NA 3F8MA 4EMSA 2R7DA 3I4PA 3LAJA 3RTRA 3P9CA 1KQ9A 3QU6A 1RUNA 1JHFA 2QWWA 4I0BA 1SD7A 5FB2A 3GX4X 3ZPLA 5BS6A 2E1NA 3BDDA 3GZ5A 1R36A 1MDMA 2O6GE 3FM5A 1XSXA 1SMTA 4CO8A 3EYYA 4XLNF 3ZMTA 5DD4A 1OPCA 4KDPA 2VE8A 2RKHA 2XKPA 4EGZA 4ESBA 2WC2A 2DI3A 5BPDA 2IA2A 3F8CA 4Q47A 3L2CA 2H6CA 2M45A 4HYEA 3TGNA 1FWZA 3WTWC 3KZZA 2XVCA 2F5DA 1R5HA 1R7JA 2DQRA 1JXSA 2CWEA 4EGYA 5DCFA 2MD5A 2YR2A 3ZMSA 1ZARA 1Z6TA 1UB9A 5LRSA 4Y15A 4HW0A 3T1BA 4I01A 4KN7X 4HF2A 5D6EA 4YFNF 3ZQ7A 3GZ6A 4BQAA 2CG4A 3FX3A 3ECOA 2A07F 4R8HA 4YIIA 3IKTA 4HV5A 1YYVA 2R7FA 3DV8A 1S8NA 2GXGA 4LG0A 1GXQA 1LVAA 2CGPA 3S2WA 1ZLKA 4G94A 1LDKB 5A2QK 1KQ8A 3ZP5A 3G73A 1K78A 1QZZA 1T98A 4O3MA 1F1ZA 4IRHA 1R00A 1U3EM 1XDSA 4HX8A 1KU7A 1IUYA 1AOYA 3COAC 1T2KA 1FBUA 4UVAA 3RKXA 3U2RA 2A6HF 2O0YA 5JI6A 5CVIA 2FF4A 3E6CC 1BI1A 3BWGA 2QUFA 1D3YA 1IXRC 4HX4A 4U7DA 3HRUA 4ENKA 2RC4A 2XKOA 5DUKA 2IRFG 5ILVA 2XAHA 4QLCU 4UV8A 5ICCA 4WXHA 1HKTA 3H3UA 2BYVE 1MD0A 3TOAA 3HSEA 1LDDA 2PBIA 3NEUA 1EH7A 2WWYA 2G7UA 1USSA 3TO7A 2HQRA 2ZBKA 4L9JA 3WE3A 4AVPA 3N97A 4MQVA 2VBZA 3IRQA 2FBIA 2D1VA 1T0FA 4L0YB 3FHZA 1WRJA 2ADUA 3K1MA 1IF1A 2NS0A 2V1XA 3DQVC 4LG0B 5LGTA 2J5OA 2FOKA 1IZ1A 2C6YA 3KP3A 4ETSA 2PJPA 2X4HA 4XSXF 3JTHA 2CO5A 3WTYC 3DP7A 1T6SA 3LA2A 1ON2A 4OIRF 4CYDA 3CJNA 2MH9A 3KLOA 1XSDA 4A0YA 4GYGA 2HDCA 4IPAA 4XBFA 2NNYA 4A12A 4ENMA 2MLKA 1DDNA 1KU3A 2XUBA 5LHIA 5HDNA 5HLHA 2V9VA 1LB2A 2DK5A 3V8LA 1G3SA 4KA4A 3F22A 4IJAA 4LB5A 1G4DA 1B4AA 2STWA 3O3KA 2MBFA 2GQQA 2O8XA 4AIJA 2RVCA 2OAZA 5KVRA 4IRGA 2ZFWA 1GXPA 5E8GA 3LAPA 1TLHB 1FSEA 2MLGA 1YLFA 2LF8A 2XRNA 4S04A 5J8FA 2QQBA 3T8RA 1HKQA 3RPUA 5HS8A 4YFKF 4L9NA 2DQLA 2VN2A 1MZBA 2ZXJA 2O3FA 4RGRA 3T8TA 3L9FA 4DQ2A 2PMHA 5AIPA 2P5KA 4BH9A 1BI0A 4UVCA 2HZTA 2K86A 3HHHA 2DPUA 4L9TA 3FMRA 4A6EA 1R1UA 4RGUA 1IN5A 2QQAA 3J80K 2IPQX 4PCQA 3V7SA 3KEQA 1HSTA 3IWFA 3MCZA 3ZMUA 3I64A 4HBLA 5F1RA 1ZHFA 2LF7A 4DNCA 5K5RA 1QPMA 2FBHA 1SD6A 1XGOA 4UUVA 2OZUA 2KIMA 3RKWA 1XMAA 2GZWA 2DT5A 3KP7A 2KKOA 1KU2A 2ZKZA 2OQGA 4UHTA 4RAZA 4MNUA 1ZGJA 1K79A 3C3WA 4ENNA 3TO6A 2P6TA 1XGSA 1RI7A 2M1BA 2E1CA 4N9IA 3DPLC 3HRTA 3CLOA 3JAMZ 3HTSB 1XSVA 1O57A 1EH8A 4IHTA 3QP5A 4YG2F 2MH2A 2ZNZA 4L9VA 3QPTA 3GLXA 2EV6A 3SZPA 5K5OA 4ZZDA 2FE3A 1HW1A 4IHSA 1EV7A 1P2FA 1LNWA 2E7WA 1R5GA 1WI9A 5E18F 1AWCA 1IXSB 3M8EA 4I98B 4ESJA 3KLNA 2DAOA 5JFRA 3LQRA 3BPXA 2JZYA 3BJOA 1R23A 4B8XA 2DW4A 2NAZA 1XB4A 4G7HF 3IHUA 4ASNA 2A5YB 1VTNC 2FMYA 2ESHA 4M9ZA 1W5TA 3RIRA 1H9TA 4EJVA 2O03A 2X0LA 1TBXA 3VOEA 4U0YA 1XMKA 2DLLA 2VT2A 3K1NA 5FFZA 2HYFA 4HF1A 1OYIA 2KRFA 3JTGA 3EDPA 4JBAA 3WGGA 4G6DA 3C18A 5FLXZ 3ML6A 1B1BA 3PFIA 4LFUA 1B59A 2HKXA 3WTSC 1ON1A 4JK1X 3KZYA 3M8FA 4M9XA 1IAWA 5D5XB 2VE9A 4Q5SF 5D4RA 2GA1A 2Q8KA 4BAYA 2JT1A 1KA8A 3I53A 2ELHA 2OA4A 4WXDA 4WF2A 4WCGA 1FZPB 2EK5A 2L3DA 1H0MA 4M6XA 4XLPF 3EETA 2ACJA 2IVMA 3IL2A 4OIPF 2V6CA 5ED4A 1XGMA 1ULYA 1O7FA 1XCBA 4CICA 2RNJA 3ZMDA 2RV8A 5HDKA 4P9UA 3DPTA 4EM1A 3FMSA 1FBSA 4HV6A 2BEOA 4OU0A 1W5SA 4CZZA 4MEYF 1YS7A 2ETHA 2ISZA 3LA3A 1ZYRF 3R61A 4M72A 1YS6A 1G6NA 2VBXA 2FNAA 5D6FA 4K2EA 6PAXA 2QVOA 2EWNA 3R4KA 2VOPA 2VBWA 5IT9Z 3NRVA 4U0WA 1WKMA 1HSJA 3FF5A 4PDKA 1K7AA 2HKOA 1V4RA 3LSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DO7 A;  3KE2 A;  3BZ6 A;  3ZMV A;  3KP5 A;  5E1Z B;  1J2X A;  1I1G A;  2J5P A;  3VOD A;  2F2E A;  4RB1 A;  3F3X A;  1FPQ A;  2XRO A;  1JGS A;  4M6Y A;  2RGV A;  4L0Z B;  3E5U A;  4U88 A;  2XAF A;  3E97 A;  1XGN A;  2HFH A;  3FXQ A;  2WV0 A;  4I02 A;  2L4A A;  2L54 A;  2ISY A;  1QO0 D;  1W7P A;  4LGW A;  5EEH A;  1REP C;  3ECH A;  3F8N A;  3LQQ A;  2NRA C;  3GXO A;  2M5W A;  3RI4 A;  3R0A A;  5FGM A;  5E1W A;  5ICF A;  1WWX A;  3ABU A;  4MTD A;  3PQJ A;  1B9N A;  1FP2 A;  3SHF A;  1HBX G;  3OV8 A;  3IC7 A;  4XRF A;  4ZH4 F;  2D45 A;  2GAU A;  1BOA A;  1IW7 F;  1F4K A;  4O6J A;  2K4J A;  3F6V A;  3HYI A;  2ZCW A;  2EFQ A;  1FOK A;  3RYP A;  1W4M A;  2VC1 A;  3IKV A;  2G7H A;  3CUQ B;  2HR3 A;  3JW4 A;  3W6K B;  1TW2 A;  2M30 A;  3JSP A;  3I58 A;  1BC8 C;  2BBY A;  3QPH A;  4AIH A;  2YPR A;  1TW3 A;  2HEO A;  3SXY A;  2XAJ A;  3CUO A;  1PP7 U;  2IJL A;  4EVI A;  4UXN A;  5BOX A;  3LA7 A;  3HRS A;  4BYY A;  5DD8 A;  4M73 A;  3KP4 A;  2VBY A;  5HLG A;  1T38 A;  3KEO A;  3EUH A;  1R58 A;  3H92 A;  1HW5 A;  3OOP A;  2PLY A;  3JSO A;  3ELK A;  2YU3 A;  1L3L A;  3P9K A;  4RB3 C;  2PG4 A;  1FX7 A;  1E17 A;  1D8K A;  1IXC A;  1BC7 C;  3I59 B;  1O3Q A;  3Q9S A;  2STT A;  2GIV A;  4LD5 A;  5DYM A;  4CDG A;  3BY6 A;  3MAJ A;  1W7P B;  5CYV A;  4I7H A;  4RGS A;  2IT0 A;  1OR7 A;  2FBK A;  1HKS A;  2E7X A;  3C1D A;  2YX4 A;  4WK8 F;  1P4X A;  1O3S A;  1D8J A;  2CFX A;  1GHC A;  4MQ9 F;  2VXZ A;  4PGG A;  5ILS A;  2AXL A;  5HOO A;  2HS5 A;  1TQM A;  4IRI A;  2FSW A;  1A04 A;  2D2W A;  1Z7U A;  4L5I A;  1PP8 F;  3E3V A;  3J81 K;  2DPD A;  2L4M A;  2PQ8 A;  4OOI A;  2JTV A;  1P92 A;  2PI0 A;  3L7W A;  1PUE E;  4MEX F;  3PQK A;  3AAF A;  2ZJ2 A;  5ICG A;  4HA8 A;  1L0O C;  2A68 F;  4UV9 A;  3WGH A;  2Y48 A;  4LB6 B;  3J7A O;  2FXA A;  2OZ6 A;  5D5W B;  2EB7 A;  4RAY A;  3IRR A;  5J6X A;  4IVN A;  5E20 A;  2VON A;  5D8K B;  1BN5 A;  4EJU A;  5D8L B;  3K2Z A;  2H27 A;  2LDU A;  1WQ2 A;  3Q5F A;  1FC3 A;  3RPQ A;  5BQT A;  1S7O A;  2A69 F;  4WX9 A;  3B02 A;  4U7B A;  3CO6 C;  3GVA A;  1QBJ A;  1OYW A;  2HGC A;  3GFL A;  3V8J A;  3G3Z A;  2PMU A;  1SMY F;  5LGN A;  1WSU A;  1G3T A;  4G7Z F;  2HWV A;  1J9I A;  3FXU A;  3V4G A;  1G3Y A;  1PDN C;  4HDV A;  3I54 A;  5E8I A;  4HLY A;  1RZ4 A;  4BHC A;  2JPB A;  2HYG D;  3CUQ C;  1BM9 A;  3D5L A;  4RB2 C;  2RDP A;  3RJP A;  1BIA A;  4H0E A;  3F8B A;  1S29 A;  2V1D A;  3R6S A;  1O3R A;  1BJA A;  3I0T A;  4HLX A;  2JSC A;  2ZNY A;  2MC3 A;  1XD7 A;  3H3Z A;  3LWF A;  3QU3 A;  1YW8 A;  1J59 A;  4N9H A;  2KJC A;  2QM3 A;  2W84 A;  1C0W A;  3IWZ A;  4BHB A;  2L01 A;  2W85 A;  2Q2E A;  3WTX C;  1I5Z A;  4ENJ A;  1B6A A;  2W25 A;  4FHT A;  1U78 A;  3GO5 A;  4GGG A;  4MHG A;  1FT9 A;  1F9N A;  3ERE D;  2L02 A;  2ZME B;  4Y13 A;  5H6Q A;  4ZYH A;  1FNN A;  1HW2 A;  4EQQ A;  2KJB A;  5HDG A;  1U5T C;  2DK8 A;  3DKW A;  3F21 A;  2CSO A;  3F6O A;  3O6B B;  3WTV C;  1ZLJ A;  1Z1D A;  5LEJ A;  4P9F A;  5DCM B;  1SD5 A;  2V1U A;  2HOE A;  3GW2 A;  3GFJ A;  3V7C A;  1P4A A;  3K9T A;  4B09 A;  4E70 A;  1ZRF A;  1KQ0 A;  3BP8 A;  4HQM A;  1CGP A;  2HTJ A;  1U2W A;  2IP2 A;  2ESN A;  2NNN A;  4KFC A;  1Z91 A;  3BPV A;  2FEZ A;  3ROU A;  3HRM A;  2RN7 A;  3JAM K;  2EA2 A;  5LHG A;  4HX7 A;  1OYY A;  3I5U A;  1R1V A;  4CGZ A;  5E17 F;  3GYH X;  5CVV A;  3KP6 A;  3CO7 C;  1KYW A;  3FXR A;  2Q0O A;  5KK1 A;  4A0Z A;  3HIF A;  2FQ3 A;  3GWZ A;  1HXD A;  1STZ A;  4KYW A;  5D4S A;  3RDI A;  1ZRE A;  2MA3 A;  1IRG A;  3ZN1 A;  1S6L A;  1BI3 A;  1T39 A;  2FNP A;  1JHH A;  4KMU X;  2HTS A;  1CF7 A;  4LMY A;  1MGT A;  2XIG A;  5K1Y A;  5D5U B;  3MFK A;  2Y0M A;  4UNO A;  2GA2 A;  2P4W A;  3FMQ A;  1ZG5 A;  4KIG A;  4KIC A;  5L3F A;  1FP1 D;  4P96 A;  4OIO F;  4WWC A;  3TDZ C;  3QRF F;  5FD6 A;  3DEU A;  1KU9 A;  4R1H A;  1FYL A;  2EFN A;  5EEG A;  3VFZ A;  3SFZ A;  2Z99 A;  1BIB A;  4HDU A;  4KT5 C;  1SFE A;  3Q9V A;  1QZY A;  5L3D A;  2QEN A;  5BPI A;  1SFX A;  2OD5 A;  4A2U A;  5FLX K;  5LRR A;  1UHW A;  4BNC A;  4XSZ F;  3WTU C;  2GXB A;  2OBP A;  3DF8 A;  1LJ9 A;  1QNT A;  3V8K A;  4PZJ A;  2P7C B;  2B0L A;  3CUQ A;  2KIU A;  3BOQ A;  4LLL A;  4KIF A;  5BMZ A;  1HQC A;  1W7P D;  5FFX A;  5DDG A;  3MWM A;  2V79 A;  5HS7 A;  1IRF A;  1R22 A;  2QYO A;  2DFI A;  1LEA A;  5L3G A;  4LLN A;  1ONV A;  4G6Q A;  3GUD A;  1V3F A;  3REO A;  2M87 A;  4GYI A;  4ZZL A;  1BBY A;  1CF7 B;  4IF4 A;  3GFM A;  4Q48 A;  1S3J A;  2XAQ A;  3E6D A;  5JR3 A;  4HZF A;  2O61 A;  3K0L A;  2NYX A;  5HS9 A;  4Y17 A;  3I59 A;  4FT8 A;  1U5T A;  3P7N A;  1U6G A;  3RKY A;  3N4M A;  3KET A;  3GF2 A;  4OMY A;  5CVJ A;  3MZY A;  4KNY A;  2VT3 A;  5LLQ A;  4NB5 A;  5IT3 A;  5E1X A;  5IT9 K;  4HF0 A;  4CXF A;  1I1S A;  3E5X A;  3WOD F;  2IA1 A;  4AIK A;  4AD9 A;  1SAX A;  1YG2 A;  3T5X A;  4HQE A;  2EFO A;  2F5C A;  4A5M A;  2UZK A;  5A2Q Z;  4EV0 A;  2JRT A;  1J75 A;  2P5V A;  1I6X A;  4EJW A;  3MEX A;  2DTR A;  4KIB A;  3FM3 A;  4ZYG A;  2Y75 A;  4GCV A;  4LJZ F;  4S05 A;  1ZGA A;  3I71 A;  1ZRC A;  3WTZ A;  3D0S A;  3E6B A;  3C7J A;  1NHA A;  2EV5 A;  4MGR A;  2XV4 S;  4R79 A;  5CVR A;  5H20 A;  1TQP A;  3V7R A;  4F7Z A;  1RUO A;  4EM2 A;  5TRD A;  3CDH A;  2H09 A;  2FA5 A;  4BXU A;  2XAS A;  5L3B A;  4JQF A;  4P5O A;  1MDM B;  3KCC A;  3L09 A;  2PN6 A;  3M1E A;  1E2X A;  4G9Y A;  2EJR A;  4FX0 A;  2JPC A;  2M8E A;  4NHJ A;  2Z33 A;  2FRH A;  4I0A A;  1O7L A;  2EFW A;  2K27 A;  2QBY A;  4CHU A;  1MJA A;  1U5T B;  2UXX A;  3LFK A;  2Z5U A;  2EV0 A;  2P6S A;  3TKY A;  5JVT A;  4YFX F;  2BV6 A;  1BI2 A;  3ISP A;  4D0P A;  2HQN A;  4IXA A;  1K6O A;  2GWR A;  1RIO H;  5LGU A;  3E5Q A;  4M74 A;  3QOP A;  3VEP A;  3J81 Z;  1F5T A;  1XCV A;  2Z3Y A;  4M9S A;  2K7L A;  1YW7 A;  2A3S A;  3HUG A;  1XN7 A;  3ABT A;  2YSR A;  2WTE A;  5ILU A;  2PEX A;  3WGI A;  3QP6 A;  3BJ6 A;  3DXJ F;  4HOB A;  3EQL F;  5LBQ A;  4M71 A;  1FYK A;  2XHK A;  4I2O A;  1QQI A;  3TO9 A;  2VOO A;  3FZV A;  4N0B A;  3U1D A;  1MKM A;  4HAM A;  4OMZ A;  2W57 A;  4L18 B;  5TJJ A;  4LK0 F;  5LEK A;  4KMF A;  5D5V B;  4FX4 A;  1Q1H A;  5F64 A;  1R1T A;  2ZME A;  2DBB A;  3FWE A;  1FSH A;  1XDU A;  1ZG3 A;  1OKR A;  3WU1 B;  4YIF A;  1P4W A;  1UHM A;  1K78 B;  2VOD A;  3ZN0 A;  3KFW X;  2FU4 A;  2IW5 A;  2Z9O A;  1ZRD A;  5DCM A;  1G3W A;  1B9M A;  3HSF A;  1TQI A;  1TNT A;  3WU0 A;  2QBY B;  3NQO A;  2VC0 A;  4BHP A;  3F23 A;  3BJA A;  4LK1 F;  3WE2 A;  5H6R A;  3VB2 A;  1Z6R A;  3R60 A;  4RS8 A;  5J8C A;  4ON0 A;  1MJB A;  3J80 Z;  4A0X A;  4Z2Y A;  1SD4 A;  1UCR A;  3L00 A;  1S7A A;  1D5V A;  4MTE A;  4NQW A;  5AON A;  3SQN A;  5AIQ A;  2QZ8 A;  2G9W A;  3HOS A;  2DU9 A;  2LKP A;  2OU2 A;  3WG9 A;  2QQ9 A;  4U0V A;  1LQ1 A;  4P55 A;  1H9G A;  1DPR A;  2CYY A;  3M9A A;  4RB0 A;  1KYZ A;  3K69 A;  2KIF A;  3QAH A;  5LHH A;  4EJO A;  2P7V B;  1DP7 P;  3GFI A;  1FLI A;  3F8F A;  4TV7 A;  3WTT C;  2A6E F;  1UST A;  3ULQ B;  1TTY A;  2K4B A;  4ZYD A;  3HHG A;  4PGH A;  1U8R A;  5HVQ C;  2D1H A;  2XGX A;  4O5V A;  3U9G A;  3M7G A;  2XAG A;  2P5L C;  5DUI A;  2LNB A;  2EA4 A;  4QWQ A;  2F5E A;  2H94 A;  4EJT A;  2R3S A;  3DFG A;  1OMI A;  1KGS A;  1RNL A;  2CW0 F;  4KUM A;  3TQN A;  4ZYE A;  3E6M A;  1P6R A;  3HSR A;  5F6F A;  3TOB A;  1ZG1 A;  5HLI A;  4G8X A;  4OIN F;  1EH6 A;  5CLS A;  3W6J B;  2AS5 F;  3ZMZ A;  2A61 A;  1I27 A;  3HTU A;  1J5Y A;  1ODD A;  2P8T A;  3RYR A;  5ICE A;  5DEQ A;  1ZN2 A;  2UWM A;  4AWX B;  5L3C A;  2RQP A;  1YQA A;  4L5J A;  1YW9 A;  2FML A;  5FO5 A;  1FY7 A;  4A6D A;  4GO1 A;  2IA0 A;  1IN4 A;  2ZO4 A;  5DV5 A;  2OQR A;  1IN7 A;  5CJ9 A;  1SFU A;  2EFP A;  1X3U A;  1Z9C A;  2CQK A;  5ERI A;  1YIO A;  3K1P A;  2COM A;  2TDX A;  5FD5 A;  2QLZ A;  2BE5 F;  2H6B A;  3CTA A;  4ESF A;  4WXC A;  3O2P E;  3EYI A;  2YX7 A;  1QGP A;  3BRO A;  2PFB A;  3MQ0 A;  2UXN A;  1IN8 A;  1JE8 A;  1TNS A;  1MJ9 A;  1GVJ A;  1J7K A;  2K02 A;  4Q4Z F;  3MZH A;  2BGC A;  1Y0U A;  1DUX C;  1YTY A;  3GEZ A;  2W24 A;  2LSO A;  1FYM A;  3B73 A;  3SZT A;  4EM0 B;  1UFM A;  3R0J A;  1YO5 C;  4RGX A;  2F5F A;  4G7O F;  4GXO A;  1J0R A;  4I09 A;  1O3T A;  1DPU A;  3KP2 A;  5K5Q A;  5L3E A;  3T0Y A;  4OIQ F;  1LDJ A;  3HOT A;  5JHU A;  4UVB A;  3P9I A;  1FBQ A;  5CVU A;  3TDU C;  1ZH5 A;  4KN4 X;  1IN6 A;  1ZAO A;  1YFH A;  4LLG F;  3F72 A;  1LEB A;  1Z05 A;  4A5N A;  3F8M A;  4EMS A;  2R7D A;  3I4P A;  3LAJ A;  3RTR A;  3P9C A;  1KQ9 A;  3QU6 A;  1RUN A;  1JHF A;  2QWW A;  4I0B A;  1SD7 A;  5FB2 A;  3GX4 X;  3ZPL A;  5BS6 A;  2E1N A;  3BDD A;  3GZ5 A;  1R36 A;  1MDM A;  2O6G E;  3FM5 A;  1XSX A;  1SMT A;  4CO8 A;  3EYY A;  4XLN F;  3ZMT A;  5DD4 A;  1OPC A;  4KDP A;  2VE8 A;  2RKH A;  2XKP A;  4EGZ A;  4ESB A;  2WC2 A;  2DI3 A;  5BPD A;  2IA2 A;  3F8C A;  4Q47 A;  3L2C A;  2H6C A;  2M45 A;  4HYE A;  3TGN A;  1FWZ A;  3WTW C;  3KZZ A;  2XVC A;  2F5D A;  1R5H A;  1R7J A;  2DQR A;  1JXS A;  2CWE A;  4EGY A;  5DCF A;  2MD5 A;  2YR2 A;  3ZMS A;  1ZAR A;  1Z6T A;  1UB9 A;  5LRS A;  4Y15 A;  4HW0 A;  3T1B A;  4I01 A;  4KN7 X;  4HF2 A;  5D6E A;  4YFN F;  3ZQ7 A;  3GZ6 A;  4BQA A;  2CG4 A;  3FX3 A;  3ECO A;  2A07 F;  4R8H A;  4YII A;  3IKT A;  4HV5 A;  1YYV A;  2R7F A;  3DV8 A;  1S8N A;  2GXG A;  4LG0 A;  1GXQ A;  1LVA A;  2CGP A;  3S2W A;  1ZLK A;  4G94 A;  1LDK B;  5A2Q K;  1KQ8 A;  3ZP5 A;  3G73 A;  1K78 A;  1QZZ A;  1T98 A;  4O3M A;  1F1Z A;  4IRH A;  1R00 A;  1U3E M;  1XDS A;  4HX8 A;  1KU7 A;  1IUY A;  1AOY A;  3COA C;  1T2K A;  1FBU A;  4UVA A;  3RKX A;  3U2R A;  2A6H F;  2O0Y A;  5JI6 A;  5CVI A;  2FF4 A;  3E6C C;  1BI1 A;  3BWG A;  2QUF A;  1D3Y A;  1IXR C;  4HX4 A;  4U7D A;  3HRU A;  4ENK A;  2RC4 A;  2XKO A;  5DUK A;  2IRF G;  5ILV A;  2XAH A;  4QLC U;  4UV8 A;  5ICC A;  4WXH A;  1HKT A;  3H3U A;  2BYV E;  1MD0 A;  3TOA A;  3HSE A;  1LDD A;  2PBI A;  3NEU A;  1EH7 A;  2WWY A;  2G7U A;  1USS A;  3TO7 A;  2HQR A;  2ZBK A;  4L9J A;  3WE3 A;  4AVP A;  3N97 A;  4MQV A;  2VBZ A;  3IRQ A;  2FBI A;  2D1V A;  1T0F A;  4L0Y B;  3FHZ A;  1WRJ A;  2ADU A;  3K1M A;  1IF1 A;  2NS0 A;  2V1X A;  3DQV C;  4LG0 B;  5LGT A;  2J5O A;  2FOK A;  1IZ1 A;  2C6Y A;  3KP3 A;  4ETS A;  2PJP A;  2X4H A;  4XSX F;  3JTH A;  2CO5 A;  3WTY C;  3DP7 A;  1T6S A;  3LA2 A;  1ON2 A;  4OIR F;  4CYD A;  3CJN A;  2MH9 A;  3KLO A;  1XSD A;  4A0Y A;  4GYG A;  2HDC A;  4IPA A;  4XBF A;  2NNY A;  4A12 A;  4ENM A;  2MLK A;  1DDN A;  1KU3 A;  2XUB A;  5LHI A;  5HDN A;  5HLH A;  2V9V A;  1LB2 A;  2DK5 A;  3V8L A;  1G3S A;  4KA4 A;  3F22 A;  4IJA A;  4LB5 A;  1G4D A;  1B4A A;  2STW A;  3O3K A;  2MBF A;  2GQQ A;  2O8X A;  4AIJ A;  2RVC A;  2OAZ A;  5KVR A;  4IRG A;  2ZFW A;  1GXP A;  5E8G A;  3LAP A;  1TLH B;  1FSE A;  2MLG A;  1YLF A;  2LF8 A;  2XRN A;  4S04 A;  5J8F A;  2QQB A;  3T8R A;  1HKQ A;  3RPU A;  5HS8 A;  4YFK F;  4L9N A;  2DQL A;  2VN2 A;  1MZB A;  2ZXJ A;  2O3F A;  4RGR A;  3T8T A;  3L9F A;  4DQ2 A;  2PMH A;  5AIP A;  2P5K A;  4BH9 A;  1BI0 A;  4UVC A;  2HZT A;  2K86 A;  3HHH A;  2DPU A;  4L9T A;  3FMR A;  4A6E A;  1R1U A;  4RGU A;  1IN5 A;  2QQA A;  3J80 K;  2IPQ X;  4PCQ A;  3V7S A;  3KEQ A;  1HST A;  3IWF A;  3MCZ A;  3ZMU A;  3I64 A;  4HBL A;  5F1R A;  1ZHF A;  2LF7 A;  4DNC A;  5K5R A;  1QPM A;  2FBH A;  1SD6 A;  1XGO A;  4UUV A;  2OZU A;  2KIM A;  3RKW A;  1XMA A;  2GZW A;  2DT5 A;  3KP7 A;  2KKO A;  1KU2 A;  2ZKZ A;  2OQG A;  4UHT A;  4RAZ A;  4MNU A;  1ZGJ A;  1K79 A;  3C3W A;  4ENN A;  3TO6 A;  2P6T A;  1XGS A;  1RI7 A;  2M1B A;  2E1C A;  4N9I A;  3DPL C;  3HRT A;  3CLO A;  3JAM Z;  3HTS B;  1XSV A;  1O57 A;  1EH8 A;  4IHT A;  3QP5 A;  4YG2 F;  2MH2 A;  2ZNZ A;  4L9V A;  3QPT A;  3GLX A;  2EV6 A;  3SZP A;  5K5O A;  4ZZD A;  2FE3 A;  1HW1 A;  4IHS A;  1EV7 A;  1P2F A;  1LNW A;  2E7W A;  1R5G A;  1WI9 A;  5E18 F;  1AWC A;  1IXS B;  3M8E A;  4I98 B;  4ESJ A;  3KLN A;  2DAO A;  5JFR A;  3LQR A;  3BPX A;  2JZY A;  3BJO A;  1R23 A;  4B8X A;  2DW4 A;  2NAZ A;  1XB4 A;  4G7H F;  3IHU A;  4ASN A;  2A5Y B;  1VTN C;  2FMY A;  2ESH A;  4M9Z A;  1W5T A;  3RIR A;  1H9T A;  4EJV A;  2O03 A;  2X0L A;  1TBX A;  3VOE A;  4U0Y A;  1XMK A;  2DLL A;  2VT2 A;  3K1N A;  5FFZ A;  2HYF A;  4HF1 A;  1OYI A;  2KRF A;  3JTG A;  3EDP A;  4JBA A;  3WGG A;  4G6D A;  3C18 A;  5FLX Z;  3ML6 A;  1B1B A;  3PFI A;  4LFU A;  1B59 A;  2HKX A;  3WTS C;  1ON1 A;  4JK1 X;  3KZY A;  3M8F A;  4M9X A;  1IAW A;  5D5X B;  2VE9 A;  4Q5S F;  5D4R A;  2GA1 A;  2Q8K A;  4BAY A;  2JT1 A;  1KA8 A;  3I53 A;  2ELH A;  2OA4 A;  4WXD A;  4WF2 A;  4WCG A;  1FZP B;  2EK5 A;  2L3D A;  1H0M A;  4M6X A;  4XLP F;  3EET A;  2ACJ A;  2IVM A;  3IL2 A;  4OIP F;  2V6C A;  5ED4 A;  1XGM A;  1ULY A;  1O7F A;  1XCB A;  4CIC A;  2RNJ A;  3ZMD A;  2RV8 A;  5HDK A;  4P9U A;  3DPT A;  4EM1 A;  3FMS A;  1FBS A;  4HV6 A;  2BEO A;  4OU0 A;  1W5S A;  4CZZ A;  4MEY F;  1YS7 A;  2ETH A;  2ISZ A;  3LA3 A;  1ZYR F;  3R61 A;  4M72 A;  1YS6 A;  1G6N A;  2VBX A;  2FNA A;  5D6F A;  4K2E A;  6PAX A;  2QVO A;  2EWN A;  3R4K A;  2VOP A;  2VBW A;  5IT9 Z;  3NRV A;  4U0W A;  1WKM A;  1HSJ A;  3FF5 A;  4PDK A;  1K7A A;  2HKO A;  1V4R A;  3LST A; 
#chains in the Genus database with same CATH topology
 1RC9 A;  3VPR A;  2WA0 A;  3SEQ A;  2DO7 A;  3KE2 A;  3BZ6 A;  4UUT A;  3KP5 A;  5E1Z B;  3ZMV A;  1J2X A;  1I1G A;  1SVM A;  2J5P A;  3BQY A;  3VOD A;  2F2E A;  5JLX A;  3A01 B;  1ETO A;  4RB1 A;  3F3X A;  1FPQ A;  2XRO A;  1JGS A;  1OQY A;  4M6Y A;  2H1L A;  2RGV A;  5IP9 J;  2HVQ A;  4L0Z B;  3E5U A;  3FK6 A;  1RRJ A;  3MZ8 A;  4U88 A;  2XAF A;  3IH3 A;  3MMY B;  3E97 A;  1XGN A;  1SC7 A;  3M8J A;  3HXL A;  2HFH A;  3FXQ A;  4RM2 A;  2XAU A;  2E34 A;  2WV0 A;  4I02 A;  2L4A A;  2HOA A;  3LSM A;  2L54 A;  2ISY A;  1QO0 D;  4XLA A;  1W7P A;  2W1O A;  4C30 A;  4I6Z A;  1SFO J;  4LGW A;  5E3L A;  5EEH A;  1F43 A;  1REP C;  3DU5 A;  3ECH A;  3K4K A;  3F8N A;  3LQQ A;  4XRS G;  3QOD A;  3WHC A;  2NRA C;  3GXO A;  2M5W A;  3RI4 A;  3R0A A;  1E0E A;  2DT7 B;  4DYR A;  4IZZ A;  5FGM A;  3Q0W A;  3I55 I;  5E1W A;  5ICF A;  2PJR B;  1WWX A;  2Y30 A;  3ABU A;  4MTD A;  4AYB A;  2OTL I;  1JUP A;  2IXS A;  2RRE A;  3MD2 A;  1IV6 A;  3PQJ A;  2IS2 A;  2NVY J;  1B9N A;  1FP2 A;  3SHF A;  1HBX G;  3OV8 A;  2X51 A;  3D5R C;  1I50 J;  1HCR A;  4E7S A;  3MKZ A;  3IC7 A;  3ZQI A;  4F91 B;  3S8P A;  4XRF A;  4ZH4 F;  2D45 A;  3UNG C;  2GAU A;  1BOA A;  1IW7 F;  1F4K A;  3M4O J;  4O6J A;  2K4J A;  3F6V A;  3HYI A;  4A3I J;  3UR3 C;  2ZCW A;  3CDL A;  1RPW A;  3IAS 2;  3KYL A;  4F3Q A;  3TBI A;  3JRG A;  1QPI A;  2EFQ A;  1FOK A;  2AHQ A;  3RCO A;  1W4M A;  3RYP A;  2CV1 A;  2VQL A;  4PSW A;  2VC1 A;  3I4N J;  1MMA A;  1VZ0 A;  3IKV A;  2IS6 A;  2G7H A;  3CUQ B;  4P1W A;  2TCT A;  3J7Y J;  4LIU A;  2HR3 A;  2XPU A;  3PO3 J;  3JW4 A;  5J4Y A;  3W6K B;  1TW2 A;  2M30 A;  3JSP A;  3I58 A;  5HNH A;  1MBF A;  1BC8 C;  2R7V A;  2BBY A;  4E7J A;  3QPH A;  2GIZ A;  4AIH A;  1W36 D;  2E5N A;  2YPR A;  2ID6 A;  1TW3 A;  3JRF A;  2DOA A;  3SXY A;  2HEO A;  2VL8 A;  2XAJ A;  3CUO A;  1PP7 U;  3CME I;  2IJL A;  4EVI A;  4UXN A;  3G2B A;  5BOX A;  3LA7 A;  3OR1 C;  3HRS A;  4BYY A;  5DD8 A;  4M73 A;  4I76 A;  3OOU A;  3KP4 A;  2VBY A;  5HLG A;  1NG7 A;  1T38 A;  2O9L A;  3KEO A;  3PNY A;  1XS9 A;  3EUH A;  1WFX A;  1R58 A;  1XC5 A;  1MSF C;  3N05 A;  2MFZ A;  1VQ4 I;  1A35 A;  3H92 A;  1HW5 A;  1U9O A;  3OOP A;  5K7Z A;  2PLY A;  1G59 A;  3JSO A;  2Y0S N;  2V26 A;  3ELK A;  2YU3 A;  1L3L A;  2KMU A;  3P9K A;  4RB3 C;  1WGX A;  2PG4 A;  1FX7 A;  1QRY A;  1DGW Y;  1E17 A;  1D8K A;  1IXC A;  4H4K C;  1VQ7 I;  1BC7 C;  3I59 B;  4RLQ A;  1O3Q A;  3Q9S A;  4FCY A;  2STT A;  5J47 A;  1LFP A;  2GIV A;  1QU3 A;  2LRE A;  2V6E A;  4LD5 A;  3CP8 A;  5C44 J;  5DYM A;  4CDG A;  3H5R A;  2EZK A;  4XON A;  2DFH A;  2BY2 A;  5BNG A;  2V9P A;  1K4T A;  4LG3 A;  4C2M J;  2M7A A;  3BY6 A;  1ZR2 A;  3MAJ A;  1W7P B;  2VKD A;  4AC0 A;  2KZG A;  5CYV A;  4I7H A;  4RGS A;  4BY1 J;  2IT0 A;  1FJL A;  1OR7 A;  4A3D J;  2FBK A;  1HKS A;  1OCC H;  2E7X A;  3P5J A;  3C1D A;  2YX4 A;  4WK8 F;  1P4X A;  3E1S A;  3B6A A;  1A5J A;  1O3S A;  5FKO A;  4B47 A;  3JRH A;  1D8J A;  2CFX A;  4CA0 A;  5E3M A;  4MLO A;  1GHC A;  5IYB J;  3ZGK A;  3FXL A;  2QSH X;  2CMP A;  4MQ9 F;  1P7J A;  2VXZ A;  4PGG A;  2BY0 A;  5ILS A;  3WG7 H;  3DLL F;  2AXL A;  3BCB A;  5HOO A;  3QYE A;  4KIT B;  2HS5 A;  1TQM A;  1E3H A;  4IRI A;  5E79 C;  2VKE A;  5B5E C;  2KZV A;  4QTR A;  4B44 A;  2Y2Z A;  3W3C A;  3OY9 A;  2VLA A;  2FSW A;  1YRN B;  4XN0 A;  2CV0 A;  1A04 A;  2D2W A;  1Z7U A;  4C9Y A;  4L5I A;  1PP8 F;  3E3V A;  3J81 K;  3LSP A;  2DPD A;  2L4M A;  5CKT A;  2PQ8 A;  4OOI A;  2JTV A;  1P92 A;  2L7F P;  1NG6 A;  2PI0 A;  3L7W A;  1PUE E;  4MEX F;  3PQK A;  3AAF A;  2ZJ2 A;  3CCL I;  5ICG A;  2O7O A;  1ZGW A;  4XLE A;  4HA8 A;  3L2U A;  1K6Y A;  1L0O C;  2A68 F;  1JT0 A;  4UV9 A;  1Z3X A;  3HOV J;  3WGH A;  2L0K A;  2CQX A;  2VJI A;  2Y48 A;  4LB6 B;  3J7A O;  2FXA A;  3S2D J;  2LYC A;  3I9V 2;  2OZ6 A;  5D5W B;  2EB7 A;  4XRS A;  4RAY A;  1PJR A;  4B43 A;  3IRR A;  5J6X A;  3S3O A;  3RPU D;  4IVN A;  3DKX A;  5E20 A;  1R9T J;  2VON A;  1YOV B;  2ID3 A;  4OAY A;  1X1A A;  4BL0 B;  5D8K B;  3K10 A;  1BN5 A;  1QHH D;  4EJU A;  5D8L B;  3K2Z A;  2EIJ H;  1IJW C;  2H27 A;  4B1R A;  5B3S H;  4HG2 A;  2LDU A;  3OL3 A;  1V5F A;  2I5U A;  1WQ2 A;  1APL C;  4DGW B;  3Q5F A;  1SFK A;  4D5C A;  1FC3 A;  3RPQ A;  3IUO A;  5BQT A;  1S7O A;  5FKN A;  3BTJ A;  2W7N A;  4YEL A;  2A69 F;  3S32 A;  2OUM A;  4WX9 A;  1X4O A;  2Q1Z B;  2X1E A;  3B02 A;  5IOZ A;  4U7B A;  4NC6 A;  3CO6 C;  3GVA A;  3PM1 A;  1QBJ A;  3D1N I;  1OYW A;  2HGC A;  3GFL A;  4XLF A;  3V8J A;  3G3Z A;  2PMU A;  1BL0 A;  1SMY F;  4IO9 F;  5LGN A;  4NUB A;  1WSU A;  1G3T A;  4G7Z F;  3OYB A;  1W5C C;  2HWV A;  1J9I A;  4XQF A;  3FXU A;  3V4G A;  1G3Y A;  1YX5 A;  2EZI A;  3OYM A;  1PDN C;  4HDV A;  3GZN B;  3I54 A;  3RZO J;  2F6C A;  2BW3 A;  5E8I A;  2I8D A;  5JLW A;  1RZ4 A;  1OJL A;  3D5S C;  3KIO A;  4B4C A;  2JPB A;  4BHC A;  4HLY A;  3TL4 X;  3J7Z I;  5EG0 A;  1Y1W J;  2HYG D;  5CQE A;  4ZTJ A;  3CUQ C;  1BM9 A;  3D5L A;  4Y52 J;  5GAG J;  1JKO C;  4RB2 C;  1ZQ3 P;  1AHD P;  2A05 A;  3E7L A;  2RDP A;  3RJP A;  2UV1 A;  3LL7 A;  1BIA A;  2K9L A;  4H0E A;  1GT0 C;  3F8B A;  2X85 A;  1S29 A;  2E1M C;  1OCO H;  2V1D A;  3R6S A;  1DU0 A;  1O3R A;  1BJA A;  3I0T A;  4HLX A;  2JSC A;  5GPC A;  2R7U A;  2ZNY A;  1TP4 A;  2L9S A;  2E60 A;  3DTI A;  2MC3 A;  3A4C A;  3L2R A;  1XD7 A;  2O5R A;  2XF5 A;  3H3Z A;  2DMP A;  3LWF A;  3QU3 A;  1YW8 A;  1J59 A;  3JRI A;  4PFP A;  2HZD A;  4N9H A;  2VI6 A;  4JOM A;  2KJC A;  2QM3 A;  2EIN H;  2W84 A;  1C0W A;  3IWZ A;  2CUZ A;  4BHB A;  2L01 A;  5TIS C;  2W85 A;  2Q2E A;  3WTX C;  2IGN A;  1I5Z A;  1FIP A;  3AFH A;  3OYL A;  4ENJ A;  1B6A A;  2VKV A;  2W25 A;  4FHT A;  1U78 A;  1T33 A;  3GO5 A;  3W6V A;  4GGG A;  4MHG A;  4FAS D;  1FT9 A;  3G6E I;  1F9N A;  2L02 A;  2ZME B;  3ZRG A;  3ERE D;  1X1D A;  4Y13 A;  2E2H J;  5H6Q A;  4ZYH A;  1FNN A;  1HW2 A;  4EQQ A;  3VSL A;  1R6R A;  2KJB A;  4BXF A;  5J40 A;  5HDG A;  3SEZ A;  3F0C A;  1U5T C;  2DK8 A;  2A6T A;  1W1W E;  3DKW A;  1BW5 A;  3HOW J;  1MBK A;  3ZQL A;  3F21 A;  2CSO A;  1Z67 A;  3F6O A;  3O6B B;  3QPS A;  3WTV C;  3DWL E;  3BG3 A;  1ZLJ A;  1Z1D A;  1V55 H;  4BQN A;  3OMY A;  5LEJ A;  2QA4 I;  1RR7 A;  4P9F A;  5DCM B;  3FXJ A;  4D7M A;  4PJJ A;  1A31 A;  4E6K G;  3S1M J;  4XM3 A;  1SD5 A;  2D5V A;  3OYK A;  4JX6 A;  2V1U A;  2HOE A;  3GW2 A;  3GFJ A;  3V7C A;  1P4A A;  3DBL B;  3HPH A;  1BR4 A;  3ASN H;  1BR1 A;  4RDU A;  3VDX A;  2EIK H;  3K9T A;  1X1B A;  3OYE A;  4B09 A;  2ECB A;  4E70 A;  2WAF A;  5DM6 F;  1ZRF A;  3BZC A;  3MKL A;  5DS9 A;  2VQH A;  5J4V A;  2HOT A;  2EPF A;  1KQ0 A;  3BP8 A;  4HQM A;  1CGP A;  3KZI C;  1MMG A;  2QSF X;  1RES A;  2HTJ A;  1U2W A;  2IP2 A;  3K4L A;  2ESN A;  2NNN A;  1W0T A;  4KFC A;  1Z91 A;  4V19 K;  1IO2 A;  5M3M J;  1EJ9 A;  2BW3 B;  5IY5 H;  3HB9 A;  3BPV A;  3L1P A;  4BKX A;  5J1Y A;  1WJE A;  5EG0 B;  2JA5 J;  2FEZ A;  4XMY A;  5K7H A;  3ROU A;  2DA2 A;  1LFU P;  2WV1 A;  3HRM A;  2FUG 2;  2RN7 A;  4NQW B;  2JA7 J;  1OCT C;  4M3D A;  3JAM K;  4II3 A;  1ETW A;  2EA2 A;  5GTH C;  1P9Q C;  4HX7 A;  5LHG A;  1OYY A;  3FKI J;  1FOW A;  2GBY A;  3I5U A;  3QOE A;  2LP0 A;  1R1V A;  2Y0S A;  4CGZ A;  1H89 C;  5E17 F;  2R7O A;  3GYH X;  5CVV A;  4EEF G;  2E2J J;  3DKY A;  3ABL H;  1N75 A;  3KP6 A;  1QA6 A;  1XMX A;  3CO7 C;  1KYW A;  3IH4 A;  3FXR A;  3H36 A;  2Q0O A;  4MO7 A;  2XF7 A;  3MN2 A;  5K7F A;  2CFO A;  5KK1 A;  4A0Z A;  3HIF A;  2FQ3 A;  4XLC A;  3H9G A;  3S17 J;  3EUK L;  3GWZ A;  1IC8 A;  1ZR4 A;  1HXD A;  4QIW N;  1STZ A;  2ECC A;  4KYW A;  5D4S A;  3RDI A;  5GTI C;  1ZRE A;  3I3L A;  4BJT A;  2X9D A;  2MA3 A;  2VPL A;  4RAF A;  1IRG A;  3RQ4 A;  4S0H B;  3ZN1 A;  1S6L A;  1BI3 A;  2IGK A;  3DTE A;  1VQM I;  1T39 A;  2FNP A;  2JWT A;  3VYS B;  1JHH A;  4KMU X;  3CCQ I;  4IL6 C;  2HTS A;  3JRA A;  1CF7 A;  4HEA 2;  4LMY A;  1MGT A;  3A01 A;  2XIG A;  5K1Y A;  5D5U B;  3MFK A;  2MC4 A;  2Y0M A;  4UNO A;  2GA2 A;  2P4W A;  3FMQ A;  2XSJ C;  1ZG5 A;  1E3O C;  4KIG A;  4KIC A;  5L3F A;  5F1J A;  2XGE A;  1FP1 D;  4P96 A;  4OIO F;  4WWC A;  3TDZ C;  2XSD C;  3NAR A;  4DJA A;  3QRF F;  5FD6 A;  4XIC A;  3DEU A;  3NWT A;  2CU7 A;  5EDN A;  1PVE A;  3L2V A;  1KU9 A;  4R1H A;  1IDZ A;  1FYL A;  2BXY A;  4J01 A;  2EFN A;  1R71 A;  5EEG A;  3VFZ A;  2HXO A;  3SFZ A;  3FBN B;  3U21 A;  2Z99 A;  2NVT J;  1IG7 A;  1BIB A;  4HDU A;  4KT5 C;  3W2A A;  1SFE A;  3Q9V A;  2M34 A;  1QZY A;  3OS2 A;  2NVQ J;  5L3D A;  3ZXS A;  4C3H J;  3LNQ A;  4NC8 A;  3A2K A;  2WAQ N;  2PJR A;  3H0G J;  5FRN A;  1DU6 A;  3DEW A;  2L7Z A;  2QEN A;  4PJN A;  1FIA A;  4YEJ A;  5BPI A;  1SFX A;  2OD5 A;  4A2U A;  2XDV A;  5FLX K;  5LRR A;  2DYS H;  2E71 A;  1UHW A;  3ZOB A;  3CC2 I;  4BNC A;  4XSZ F;  4JP0 A;  1ERD A;  5EYR A;  5FJ8 J;  3WTU C;  2BY3 A;  4J19 A;  2GXB A;  2OBP A;  1OCZ H;  2X1D A;  1VQP I;  3DF8 A;  1LJ9 A;  1QNT A;  3PIP F;  2BOL A;  3GTP J;  4QPO A;  3V8K A;  4PZJ A;  2EBI A;  3H3V K;  2P7C B;  2B0L A;  2JK3 A;  4RBO A;  3CUQ A;  2KIU A;  3BOQ A;  4LLL A;  2KQR A;  2ZSH B;  4KIF A;  2CQQ A;  1WVR A;  5BMZ A;  2ZME C;  2Y9Y A;  1HQC A;  1IV8 A;  1W7P D;  2XC7 A;  5FFX A;  4AID A;  1MMN A;  4W1U A;  2P0W A;  3MWM A;  5DDG A;  1H88 C;  2V79 A;  5HS7 A;  2F48 A;  1IRF A;  1R22 A;  4RA2 A;  3GME A;  2QYO A;  2DFI A;  1LEA A;  4UB8 C;  3QWL A;  1YJ9 I;  5L3G A;  4LLN A;  2P81 A;  1Z77 A;  1ONV A;  3LSI A;  4G6Q A;  2DDA A;  3GUD A;  5JHF A;  1V3F A;  4RLF A;  3REO A;  4CYC A;  9ANT A;  2JMW A;  2R5Y B;  2M87 A;  2HDW A;  4GYI A;  4ZZL A;  1B8I B;  1D0Z A;  2BXZ A;  1BBY A;  2IGO A;  1CF7 B;  2OPT A;  4IF4 A;  5C4J J;  3HC7 A;  3BC8 A;  3H5N A;  3PFY A;  2QKL B;  3GFM A;  4Q48 A;  1S3J A;  2DYR H;  4C2T A;  2BVM A;  2XAQ A;  4NBQ A;  3E6D A;  3TW6 A;  2ELK A;  2EIL H;  2CQ7 A;  1BW6 A;  5JR3 A;  4HZF A;  4HNV A;  3K0L A;  2O61 A;  1VQK I;  2NYX A;  5HS9 A;  4Y17 A;  2K3P A;  2QQ8 A;  3I59 A;  3SYT A;  1KZH A;  1IGN A;  1ZKG A;  4FT8 A;  3QPL A;  1U5T A;  2DMU A;  3P7N A;  1U6G A;  3L2W A;  3RKY A;  3BG6 A;  3N4M A;  3KET A;  3GF2 A;  4BE1 A;  4OMY A;  1P7I A;  2K85 A;  5CVJ A;  3MZY A;  4KNY A;  1Z7L A;  1TWH J;  2VT3 A;  5LLQ A;  3SFI A;  2IEK A;  4NB5 A;  3IP4 B;  3HPG A;  2BHZ A;  3S93 A;  5IT3 A;  5B66 C;  5EGO A;  4YRV A;  2HPI A;  5E1X A;  5IT9 K;  3IV5 A;  4IHV A;  5DM7 F;  4HF0 A;  4CXF A;  4JX4 A;  2LC2 A;  2XB0 X;  1HOM A;  1I1S A;  3CJT B;  1TWC J;  3E5X A;  3WOD F;  2IA1 A;  3JR9 A;  4AIK A;  2R93 J;  2HNH A;  4NC7 A;  4AD9 A;  1SAX A;  1YG2 A;  2EZH A;  1E3P A;  2EH3 A;  1FMV A;  3T5X A;  4HQE A;  1T56 A;  2CRG A;  2EFO A;  2F5C A;  4A5M A;  2UZK A;  5A2Q Z;  4EV0 A;  2NS8 A;  1GUU A;  2JRT A;  1J75 A;  2P5V A;  1I6X A;  3OYN A;  4EJW A;  3MEX A;  2DTR A;  2LRD A;  1GV5 A;  4KIB A;  2F5V A;  3Q0U A;  1YRN A;  1ZEL A;  5DTD A;  4E7L A;  3FM3 A;  4ZYG A;  2Y75 A;  4GCV A;  4II2 A;  2N8G A;  2XGC A;  4LJZ F;  3LSG A;  1YHQ I;  4BJ5 C;  4S05 A;  3ONQ A;  2GM4 A;  3S1N J;  1ZGA A;  1HF0 A;  2V4J C;  3I71 A;  1ZRC A;  3WTZ A;  2XF6 A;  3D0S A;  1JTX A;  2ZXI A;  3E6B A;  4A3K J;  2E1M B;  3C7J A;  2NOJ B;  2KL4 A;  1R4N B;  4AU7 A;  2LTP A;  4HSR A;  1NHA A;  2EV5 A;  1FOX A;  3K70 D;  4MGR A;  2XV4 S;  1TWA J;  3DPU A;  4BJ6 C;  4R79 A;  5CVR A;  1WJD A;  4M3F A;  5H20 A;  4ZYA A;  1TQP A;  3V7R A;  4F7Z A;  1RUO A;  4HPQ A;  1TT0 A;  4EM2 A;  5TRD A;  3CDH A;  2H09 A;  2FA5 A;  4CYC B;  2V9K A;  4BXU A;  5IYC J;  3V42 A;  2LY2 A;  1A6Q A;  2XAS A;  4JQF A;  4P5O A;  3W2V A;  4PFO A;  5L3B A;  1MDM B;  3KCC A;  3AG1 H;  3L09 A;  2PN6 A;  3M1E A;  3H0D A;  4V2F A;  1E2X A;  4G9Y A;  2EJR A;  4FX0 A;  3OSF A;  1UAA A;  1U9N A;  4C3J J;  2JPC A;  1VFC A;  2M8E A;  2IGM A;  4NHJ A;  2Z33 A;  2FRH A;  1S9H A;  2DA1 A;  4I0A A;  1O7L A;  2EFW A;  3BG5 A;  2K27 A;  2QBY A;  4CHU A;  1MJA A;  1U5T B;  2UXX A;  3S3N A;  4AM3 A;  3LFK A;  2Z5U A;  3HGY A;  1U8B A;  1D0Y A;  2EV0 A;  1NK2 P;  2P6S A;  2GLO A;  3TKY A;  5JVT A;  3I4M J;  2LD5 A;  4PJ0 C;  4XK4 A;  4YFX F;  2BV6 A;  2K5C A;  4BS9 A;  1BI2 A;  3ISP A;  4D0P A;  5EGO B;  2HQN A;  1I3Q J;  3A0H C;  4IXA A;  4BY7 J;  1JI8 A;  1K6O A;  2KDZ A;  2GWR A;  3O8G A;  1RIO H;  4DIQ A;  5LGU A;  2BVL A;  1JKQ C;  1K83 J;  1YIT I;  3E5Q A;  3G1M A;  2LKX A;  4M74 A;  3QOP A;  3JRB A;  1ZK8 A;  3G1O A;  3VEP A;  3J81 Z;  2E2I J;  1F5T A;  1QZE A;  4XRM A;  4MFD A;  3OYG A;  4XL9 A;  3ZQQ A;  1XCV A;  1JUS A;  2Z3Y A;  3GTG J;  2HVS A;  4M9S A;  2K7L A;  1YW7 A;  3C2H A;  4LOC A;  1S7E A;  3H5A A;  3RKQ A;  2A3S A;  3HUG A;  1XN7 A;  2K9M A;  3ABT A;  3OIO A;  1HDP A;  2WTE A;  2YSR A;  5ILU A;  2PEX A;  3WGI A;  3HL2 A;  3QP6 A;  3PSF A;  1MH4 A;  3BJ6 A;  3DXJ F;  3CCU I;  4HOB A;  3EQL F;  1ITY A;  5LBQ A;  4M71 A;  1FYK A;  1X2M A;  2XHK A;  4I2O A;  1QQI A;  3TO9 A;  3BG9 A;  2VOO A;  3FZV A;  4N0B A;  3U1D A;  4DYQ A;  1MKM A;  5GAD J;  4HAM A;  4MFE A;  5F0C A;  4OMZ A;  2W57 A;  2FX0 A;  4L18 B;  5TJJ A;  2RQQ A;  1Y56 A;  3OYJ A;  4XKW A;  4LK0 F;  1UG2 A;  5LEK A;  1T8I A;  4KMF A;  5D5V B;  2LFB A;  4FX4 A;  3S2H J;  2VJ5 A;  2LOO A;  1Q1H A;  2FD5 A;  3ZQF A;  1JJ8 C;  1SAN A;  4RM3 A;  3OSG A;  1TC3 C;  1WJ5 A;  1XG1 A;  1PUF B;  5F64 A;  1R1T A;  4ZTF A;  2ZME A;  2HI3 A;  3TP0 A;  2DBB A;  3K4C A;  1MMS A;  2CW7 A;  1WPK A;  3FWE A;  2WAQ A;  4DYC A;  2L9R A;  1FSH A;  1XDU A;  1ZG3 A;  1RR8 C;  1OKR A;  3WU1 B;  4YIF A;  1P4W A;  4CCO A;  4B48 A;  1UHM A;  1K78 B;  3KYC B;  2VOD A;  3ZN0 A;  3KFW X;  2FU4 A;  2IW5 A;  4CZC A;  3K4N A;  2Z9O A;  1ZRD A;  3HOX J;  4XKV A;  5DCM A;  1G3W A;  1B9M A;  3HSF A;  2UUZ A;  1TQI A;  5LFA A;  2H8W A;  1TNT A;  1MH3 A;  2KRC A;  2BZT A;  3WU0 A;  2EZL A;  2DJN A;  2ZSI B;  2VJJ A;  2QBY B;  2X48 A;  3ABK H;  2EIM H;  5IP6 A;  3FKJ A;  3NQO A;  1HA8 A;  2VC0 A;  2B9S A;  1AKH A;  1X1P A;  5HOD A;  3HKZ A;  3RQI A;  2LH9 A;  3TP3 A;  3IH2 A;  4BHP A;  3F23 A;  3BJA A;  1MNE A;  2ICW G;  3BCA A;  2Z1D A;  4LK1 F;  4W97 A;  4D7N A;  3WE2 A;  5M3F J;  5H6R A;  1U0J A;  3VB2 A;  5FLM J;  1SVL A;  1Z6R A;  3R60 A;  4RS8 A;  5J8C A;  1RKT A;  4ON0 A;  1MJB A;  2X6W A;  3J80 Z;  4A0X A;  4Z2Y A;  3KPH A;  1SD4 A;  1UCR A;  3FK7 A;  3L00 A;  2WBM A;  3FXM A;  1S7A A;  1VF9 A;  1WJB A;  2ZJQ F;  1D5V A;  4MTE A;  3CJR B;  4NQW A;  1JTY A;  1ZTR A;  2HU9 A;  5CPR B;  5AON A;  3SQN A;  4A3E J;  3RZD J;  3HUG B;  5AIQ A;  2QZ8 A;  2G9W A;  1XPX A;  3HOS A;  2DU9 A;  1Y6I A;  2LKP A;  2OU2 A;  3WG9 A;  2QQ9 A;  4U0V A;  2M3A A;  2V1N A;  3QQA A;  1LQ1 A;  4P55 A;  1H9G A;  3BT9 A;  1DPR A;  2CYY A;  3M9A A;  4RB0 A;  1KYZ A;  3K69 A;  3AG2 H;  2KRH A;  3CZ6 A;  2R5Z A;  3ABM H;  2KIF A;  2IBD A;  3QAH A;  5LHH A;  1QVU A;  1WI3 A;  2P7V B;  4EJO A;  3HZJ A;  1DP7 P;  4CUG A;  3GFI A;  1FLI A;  4XLH A;  2W48 A;  3F8F A;  4TV7 A;  5CQG A;  3WTT C;  3MKW B;  1D5Y A;  3Q3S A;  2A6E F;  1IRX A;  1LUJ B;  1UST A;  3ULQ B;  1TTY A;  3CCR I;  2K4B A;  1WJC A;  4ZYD A;  3HHG A;  4PGH A;  4XKB A;  3VWB A;  1U8R A;  5LD2 C;  1ETY A;  5HVQ C;  5IOY A;  2D1H A;  4ABZ A;  2XGX A;  3CCM I;  4O5V A;  2X1C A;  3BQZ A;  1WH7 A;  3U9G A;  3FXO A;  3M7G A;  2XAG A;  4LIV A;  1UHS A;  1HC8 A;  2OC6 A;  2P5L C;  1FTT A;  5DUI A;  2LNB A;  3VYT B;  2EA4 A;  2G0E A;  4ZC3 A;  1Q1V A;  1MNM C;  4QWQ A;  3CMM A;  2F5E A;  2H94 A;  4EJT A;  2R3S A;  3DFG A;  1OMI A;  1UG0 A;  1ETV A;  3GBG A;  1KGS A;  1RNL A;  1FEX A;  2FOW A;  2CW0 F;  2W4S A;  4KUM A;  3PNT A;  4NDL A;  2YS9 A;  3TQN A;  4ZYE A;  1Z3Y A;  3E6M A;  3L2Q A;  4BEH B;  1AKH B;  3NAU A;  3OYA A;  4ZDP A;  1P6R A;  3HSR A;  5F6F A;  4N4O B;  3HM5 A;  3TOB A;  4CCL A;  1ZG1 A;  3BG7 A;  5M5W J;  5HLI A;  3HJE A;  2AO9 A;  4Y33 A;  4G8X A;  4OIN F;  1EH6 A;  5CLS A;  2GOX B;  3BLY A;  3W6J B;  2AS5 F;  4F52 A;  1UMQ A;  3ZMZ A;  2A61 A;  1I27 A;  2CH0 A;  2R7Q A;  3GLL A;  2WB1 N;  3HOZ J;  3HTU A;  1BOB A;  3OYI A;  3DTK A;  1IRZ A;  2AXT C;  1R4M B;  4FQG A;  1J5Y A;  1ODD A;  1ETX A;  2E19 A;  2DA6 A;  5F08 A;  5B1B H;  2DOD A;  2P8T A;  3CES A;  3H9J A;  3RYR A;  5ICE A;  5DEQ A;  4OWR B;  1ZN2 A;  4BDZ A;  2UWM A;  2KIQ A;  4AWX B;  3LSK A;  4F55 A;  2RQP A;  5L3C A;  1YQA A;  2MAB A;  1T95 A;  4L5J A;  1YW9 A;  2FML A;  5FO5 A;  2M2E A;  1FY7 A;  4XN3 A;  4IX7 A;  1I3A A;  2DTZ A;  4A6D A;  2M7B A;  3HDD A;  4GO1 A;  2LK2 A;  2IA0 A;  1IN4 A;  3LFU A;  1TZL A;  2ZO4 A;  4XOP A;  5DV5 A;  2QEX I;  2CUJ A;  2JA8 J;  2OQR A;  2V7F A;  2QKM B;  1IN7 A;  3K6G A;  2ZC2 A;  5CJ9 A;  2R5Z B;  1SFU A;  3JRD A;  4PUS A;  2MGQ A;  1X3U A;  2EFP A;  1Z9C A;  1VQ5 I;  2CQK A;  5ERI A;  3OIQ A;  1YIO A;  1VND A;  3S1R J;  1N77 A;  3K1P A;  2COM A;  4JYK A;  2TDX A;  2VUM J;  4DOZ A;  5FD5 A;  4QPQ A;  2QLZ A;  2BE5 F;  3CTA A;  2H6B A;  3PSI A;  3TED A;  4D1Q A;  4ESF A;  3AL0 B;  3HOY J;  4WXC A;  3VYR B;  4L5E A;  3O2P E;  3EYI A;  2YX7 A;  2R5Y A;  1QGP A;  3BRO A;  5EZH A;  4XID A;  4BUP A;  2PFB A;  1B8I A;  3MQ0 A;  1X19 A;  2UXN A;  1IN8 A;  3CP2 A;  1TNS A;  1JE8 A;  1MJ9 A;  4IQJ A;  1H8A C;  1YJN I;  1VQ9 I;  1GVJ A;  1J7K A;  2TRT A;  1MND A;  4I99 C;  2K02 A;  4Q4Z F;  4C3I J;  3OR2 C;  4J00 A;  4ITV A;  4G6T B;  3MZH A;  1UZC A;  2BGC A;  1Y0U A;  1DUX C;  2IS1 A;  2XB5 A;  1YTY A;  3GEZ A;  1K61 A;  4UUS B;  2W24 A;  2LSO A;  3CMA I;  1FYM A;  3B73 A;  3SZT A;  4EM0 B;  2F4I A;  1UFM A;  4HNT A;  3R0J A;  1YO5 C;  1D1B A;  2DMQ A;  4RGX A;  1MW7 A;  5IPA A;  2F5F A;  1AA7 A;  4G7O F;  2EQR A;  4GXO A;  1J0R A;  4I09 A;  3G71 I;  1O3T A;  4NNJ A;  1DPU A;  2CUE A;  3KP2 A;  5K5Q A;  2YU9 J;  5L3E A;  3ZQC A;  3SJM A;  5H2F C;  3T0Y A;  1W36 C;  2R7T A;  1TWG J;  3PNV A;  4OIQ F;  1LDJ A;  3HOT A;  1V54 H;  5JHU A;  2DN0 A;  4A3J J;  4UVB A;  2KLO A;  2KPM A;  3P9I A;  1FBQ A;  5CVU A;  2ME6 A;  2X6Y A;  3TDU C;  1ZH5 A;  2M0M A;  2LR8 A;  1YX3 A;  3A02 A;  3I56 I;  4KN4 X;  4GRI A;  3EUA A;  4DBR A;  2DA3 A;  3BTI A;  4Y7N J;  3HG9 A;  4E4H A;  4A3C J;  2JQ7 A;  1IN6 A;  3BZK A;  5GAH J;  1ZAO A;  1YFH A;  4LLG F;  1MSE C;  3F72 A;  1LEB A;  1Z05 A;  2HDD A;  4A3G J;  2KIS A;  3BR3 A;  4A5N A;  1T0F C;  3PL8 A;  4DZJ A;  3F8M A;  4EMS A;  3HKZ N;  3JCU C;  3SZG A;  5JVG F;  2R7D A;  3I4P A;  3LAJ A;  2W82 A;  1F36 A;  3RTR A;  2K9Q A;  3P9C A;  1KQ9 A;  3SDB A;  3QU6 A;  3K2A A;  1VQL I;  2JRM A;  5IP7 J;  5FKL A;  4Y3O A;  3PJR A;  1RUN A;  1JHF A;  2QWW A;  3KX2 A;  4I0B A;  2JJ7 A;  2LMD A;  4RMN A;  1SD7 A;  3FIS A;  3BR5 A;  4D9J A;  5FB2 A;  3GX4 X;  2HOS A;  2ELJ A;  2HXI A;  1W0U A;  3ZPL A;  1ACI A;  5BS6 A;  2E1N A;  1B72 B;  3BDD A;  3TW7 A;  1LFB A;  2DA4 A;  3GZ5 A;  3G1L A;  5KCM A;  3H35 A;  3AG3 H;  3QYB A;  1R36 A;  1MDM A;  2O6G E;  4IHX A;  3FM5 A;  1XSX A;  4E7K A;  1SMT A;  4CO8 A;  3CCJ I;  3EYY A;  4XLN F;  3ZMT A;  5DD4 A;  1OPC A;  5M5Y J;  3GTQ J;  4KDP A;  2R7R A;  2VE8 A;  2RKH A;  2XKP A;  4EGZ A;  4ESB A;  3PO2 J;  2WC2 A;  2DI3 A;  2K3F A;  2IA2 A;  5BPD A;  3F8C A;  4Q47 A;  4C2U A;  3L2C A;  3CCS I;  4A3M J;  2CV2 A;  2H6C A;  2M45 A;  4HYE A;  3TGN A;  4CCK A;  1FWZ A;  2DFF A;  2OCC H;  3A03 A;  3WTW C;  3KZZ A;  2XVC A;  2ZXW H;  1D0X A;  2F5D A;  1R5H A;  1M1E B;  3O8H A;  1AU7 A;  4QSH A;  2OJE D;  1R7J A;  2L7M P;  3H9Q A;  3K4J A;  1WJF A;  2DQR A;  4HNU A;  1JXS A;  5KAI C;  3S15 J;  2CWE A;  4A3B J;  1GV2 A;  3GCM A;  5HLT A;  1GDT A;  4MIM A;  2L7K A;  1G8X A;  4EGY A;  5GP9 A;  5DCF A;  1Y8R B;  2MD5 A;  2ZXH A;  5EJC A;  2DDB A;  2CJJ A;  4N4N B;  2VXD A;  2YR2 A;  4BBR J;  4DBQ A;  3ZMS A;  1ZAR A;  4CSW A;  1Z6T A;  1UB9 A;  5LRS A;  4RAG A;  2LLK A;  4PJM A;  1T08 B;  4Y15 A;  4HW0 A;  3T1B A;  1SAU A;  4I01 A;  4KN7 X;  4HF2 A;  5GAE J;  5D6E A;  4YFN F;  2HQ5 A;  3ZQ7 A;  3GZ6 A;  4BQA A;  2CG4 A;  3FX3 A;  1HLV A;  2JUG A;  3ECO A;  3AL0 C;  4V2G A;  4IOA F;  2A07 F;  2LG4 A;  2M4K A;  4R8H A;  2JN6 A;  4YII A;  3IKT A;  1X58 A;  4HV5 A;  1YYV A;  3H1C A;  1V5E A;  4FE7 A;  5M5X J;  2R7F A;  1TL8 A;  2FJ1 A;  1LE8 B;  3DV8 A;  1S8N A;  3FHN A;  2ZJP F;  4X6A J;  4IHW A;  2GXG A;  4BE2 A;  1PUF A;  4LG0 A;  2HVR A;  1WCM J;  1GXQ A;  2WY7 Q;  1LVA A;  5KNL A;  2HPM A;  4F93 B;  2CGP A;  2QF7 A;  2VPR A;  3S2W A;  2E5Z A;  1ZLK A;  3OIP A;  1X3Z B;  1TWF J;  1NK3 P;  4G94 A;  2WB1 A;  2OCE A;  1LDK B;  3E0J B;  5A2Q K;  4B3X A;  1RET A;  1KQ8 A;  3K4B A;  1VQ6 I;  3FXK A;  1D1A A;  4HST A;  3IAM 2;  2PMZ N;  5C3E J;  4G12 A;  3ZP5 A;  3G73 A;  1K78 A;  1QZZ A;  1T98 A;  2ZB9 A;  1JKR C;  3OYC A;  5J1R A;  3VYU B;  4HRI A;  4O3M A;  1F1Z A;  4IRH A;  1R00 A;  2DFE A;  2LY9 A;  1U3E M;  1D1C A;  1XDS A;  2VQC A;  2Y9Z A;  2E36 A;  2E1O A;  3BR0 A;  4HX8 A;  2KP6 A;  2R92 J;  1KU7 A;  3LSH A;  3MVP A;  1IUY A;  1YJW I;  3W2W A;  1AOY A;  4BGD A;  3COA C;  5F27 A;  1T2K A;  1FBU A;  4UVA A;  3RKX A;  3U2R A;  4IEJ A;  3CQZ J;  2A6H F;  2AQE A;  3GTO J;  2O0Y A;  5JI6 A;  5CVI A;  2FF4 A;  4M3B A;  1LPQ A;  3S14 J;  2GXA A;  2DA5 A;  3E6C C;  2YUS A;  1GLN A;  1BI1 A;  3BWG A;  2QUF A;  1D3Y A;  1Z21 A;  1IXR C;  1N25 A;  4HX4 A;  4U7D A;  3HRU A;  1Y1V J;  2XRL A;  2H1K A;  4ENK A;  2RC4 A;  2XKO A;  5DUK A;  2IRF G;  1WJA A;  4X0G A;  3WHB A;  3ZQH A;  5ILV A;  3CMY A;  1R49 A;  2XAH A;  2NXN B;  3DEE A;  3LMM A;  4UV8 A;  4QLC U;  5ICC A;  2ZFU A;  5C4X J;  4WXH A;  2R7Z J;  1HKT A;  3DLA A;  3H3U A;  3MKY B;  2BYV E;  1CQT A;  1MD0 A;  3TOA A;  2XPW A;  1LDD A;  3HSE A;  2PBI A;  3NEU A;  2ME0 A;  4GFB A;  1EH7 A;  5HNF A;  3U1K A;  4BQQ A;  2WWY A;  2B63 J;  2G7U A;  1USS A;  3TO7 A;  2R0Q C;  4E7H A;  2HQR A;  2ZBK A;  4L9J A;  2VJ4 A;  3WE3 A;  4AVP A;  3M3Y J;  3CF2 A;  3N97 A;  4MQV A;  2VBZ A;  3IRQ A;  2FBI A;  2D1V A;  1RKW A;  1T0F A;  5F0F A;  3FHZ A;  1WRJ A;  5KHD A;  4L0Y B;  1NH3 A;  2ADU A;  3K1M A;  1IF1 A;  1LVK A;  2NS0 A;  2V1X A;  4E7I A;  4XKC A;  3DQV C;  4LG0 B;  4JX5 A;  5LGT A;  3J7A Y;  2J5O A;  4M6V A;  2FOK A;  2DOE A;  1IZ1 A;  2VB6 A;  2C6Y A;  2L5Q A;  1VQO I;  2DMT A;  3KP3 A;  4ETS A;  3BR2 A;  2DXI A;  2X4H A;  2PJP A;  4XSX F;  3RSN A;  4BAC A;  1DP3 A;  3JTH A;  1IDY A;  2CO5 A;  3C2B A;  3WTY C;  3JRC A;  3DP7 A;  4KJZ A;  1T6S A;  3SDG A;  1FMW A;  3LA2 A;  1ON2 A;  3OYD A;  1R5I D;  2WY8 Q;  5F0H A;  4OIR F;  4CYD A;  4KIS A;  2HYJ A;  3OL4 A;  3QYF A;  3CJN A;  4GDF A;  3K4M A;  2MH9 A;  3KLO A;  1XSD A;  4A0Y A;  2MD0 A;  3LOC A;  1O4X A;  2IAI A;  4GYG A;  3CCY A;  2HDC A;  3G4S I;  4IPA A;  1A36 A;  1X2N A;  2HQA A;  4XBF A;  4A69 C;  5EEA A;  1V5G A;  3FIW A;  2NNY A;  4BEH A;  2IS4 A;  4A12 A;  2VIX A;  1X1C A;  1WZ2 A;  4ENM A;  2MLK A;  2JA6 J;  2AQF A;  1DDN A;  1EKE A;  1KU3 A;  4A93 J;  2XUB A;  5LHI A;  5HDN A;  5HLH A;  4CCJ A;  1OCR H;  2W00 A;  2V9V A;  1VQN I;  1LB2 A;  3B6C A;  1Y8Q B;  2DK5 A;  4IOC F;  3LSR A;  3V8L A;  1G3S A;  4KA4 A;  3F22 A;  4IJA A;  3WU2 C;  4LB5 A;  1G4D A;  1B4A A;  2STW A;  3O3K A;  2VAS A;  2MBF A;  1K4S A;  1Y0N A;  2GQQ A;  2O8X A;  3TMO A;  4AIJ A;  3S16 J;  2RVC A;  4B3A A;  1EF4 A;  3BTL A;  4CH7 A;  4UY8 I;  2OAZ A;  5KVR A;  4UB6 C;  4IRG A;  2ZFW A;  1GXP A;  5E8G A;  5E3O A;  3LAP A;  2OV7 A;  1TLH B;  2A5W A;  3GTJ J;  4DW6 A;  1FSE A;  2MLG A;  3S3M A;  1QHG A;  1YLF A;  2LF8 A;  2XRN A;  4ZDO A;  4S04 A;  2OF7 A;  4AVZ A;  5J8F A;  2QQB A;  4A3F J;  3JRE A;  3T8R A;  1HKQ A;  1DGR M;  3RPU A;  4YFK F;  5HS8 A;  4L9N A;  2DQL A;  2VN2 A;  1MZB A;  2ZXJ A;  2O3F A;  3OWT A;  3BR1 A;  4RGR A;  3T8T A;  1JUM A;  3L9F A;  4DQ2 A;  2PMH A;  5AIP A;  4CCN A;  2K9S A;  2KT0 A;  2P5K A;  3VSK A;  1YI2 I;  3DBH B;  4BH9 A;  3OS0 A;  2XGD A;  2NOG A;  2Z16 A;  1TT5 B;  1BI0 A;  4UVC A;  2PX9 A;  2WAE A;  2COB A;  1BR2 A;  1FOY A;  1QVT A;  2HZT A;  2K86 A;  3HHH A;  2DCE A;  1I6H J;  2DPU A;  2F4M B;  4L9T A;  3FMR A;  2LKS A;  4A6E A;  1R1U A;  4RGU A;  3GTM J;  1IN5 A;  2QQA A;  1BA5 A;  3KEY A;  3J80 K;  2IPQ X;  4F92 B;  3C2G A;  4KT6 A;  4PCQ A;  3V7S A;  3KEQ A;  2ZJR F;  1HST A;  3IWF A;  3MCZ A;  3ZMU A;  1KON A;  3I64 A;  3F9K A;  4HBL A;  5F1R A;  1ZHF A;  2LF7 A;  4DNC A;  5K5R A;  1QPM A;  1YE9 A;  2FBH A;  1SD6 A;  3ZCO A;  1XGO A;  4UUV A;  2B7E A;  2MG4 A;  4D5F A;  1Z0X A;  2OZU A;  2KIM A;  3LSJ A;  3RKW A;  4AYB N;  4OAZ A;  2QSG X;  1X4P A;  1XMA A;  1MBE A;  2NS7 A;  2GZW A;  3AG4 H;  2DT5 A;  3OS1 A;  4YIR X;  2CUF A;  3KP7 A;  2KKO A;  1KU2 A;  5FLV A;  2RAE A;  3CCE I;  2KDO A;  4XOT A;  4UUS A;  1S72 I;  1JKP C;  2Y31 A;  2OQG A;  2ZKZ A;  4UHT A;  4RAZ A;  1HDD C;  4M3G A;  4MNU A;  3GTK J;  4BBS J;  1ORK A;  4BE0 A;  1ZGJ A;  2M4G A;  1K79 A;  1X3W B;  4IKF A;  1MMD A;  2JUC A;  3C3W A;  2DMN A;  3BR6 A;  1Y39 A;  2KHM A;  4ENN A;  3TO6 A;  2MYS A;  2P6T A;  4AUX A;  1XGS A;  5TGT A;  1RI7 A;  2M1B A;  2E1C A;  3S1Q J;  2JA2 A;  3A0B C;  4N9I A;  3DPL C;  4BQO A;  3HRT A;  3CLO A;  3JAM Z;  3HTS B;  1XSV A;  1WHU A;  1O57 A;  1EH8 A;  4IHY A;  2KFD A;  4IHT A;  3QP5 A;  1MIJ A;  4YG2 F;  2MH2 A;  2LY1 A;  1SEU A;  2ZNZ A;  4EAT A;  4L9V A;  3QPT A;  3OYF A;  4LIT A;  5F04 A;  3GLX A;  2EV6 A;  3SZP A;  2R7X A;  5K5O A;  2QCO A;  4ZZD A;  4XNF A;  2NVX J;  1NTC A;  1LKX A;  3OYH A;  3UKG A;  2FE3 A;  4FET A;  1HW1 A;  4IHS A;  1EV7 A;  2R7W A;  2DT6 A;  3HOU J;  1P2F A;  1JGG A;  2LVS A;  2PMZ A;  1LNW A;  2E7W A;  2H8R A;  1R5G A;  2M8G X;  1WI9 A;  5E18 F;  3ZQG A;  1AWC A;  2WAD A;  2L9N A;  1IUF A;  1IXS B;  2X6X A;  3M8E A;  4I98 B;  5J1U A;  4ESJ A;  2JSP A;  3KLN A;  2DAO A;  4PSX A;  2R4G A;  4M3E A;  3DCF A;  5JFR A;  1S5L C;  3CF5 F;  3ZR8 X;  4DZP A;  3LQR A;  4FE4 A;  4U87 A;  3BPX A;  2JZY A;  3BJO A;  1UJ8 A;  1R23 A;  5GPA A;  1MBJ A;  5EF6 A;  4B8X A;  2DW4 A;  1JT6 A;  2NAZ A;  1XB4 A;  3BTC A;  1WH5 A;  5EZG A;  5FKK A;  4G7H F;  3IHU A;  2BHY A;  4ASN A;  2A5Y B;  1VTN C;  1B72 A;  2FMY A;  2L2O A;  4XR6 A;  3CCV I;  2ESH A;  4M9Z A;  1W5T A;  2K9N A;  3M1C A;  3RIR A;  2JVG A;  2LBF A;  4BU2 A;  3HEF A;  3PUF A;  1H9T A;  5IYD J;  3EUH C;  3CLQ A;  4EJV A;  2O03 A;  2X0L A;  2Q2E B;  4FTH A;  4X1E A;  4BXX J;  1TBX A;  3VOE A;  2OTJ I;  1EA3 A;  1VQ8 I;  2R7S A;  2K40 A;  4U0Y A;  3PIO F;  1OFC X;  2QGU A;  2FQ4 A;  1XMK A;  2DLL A;  2VT2 A;  2X6O A;  3K1N A;  5FFZ A;  2HYF A;  3GTL J;  4HF1 A;  1XTA A;  1OYI A;  3AKZ A;  2VQG A;  2KRF A;  1PYV A;  3JTG A;  3CJQ B;  2GOM A;  3FDY A;  3A1Y A;  3EDP A;  4JBA A;  3WGG A;  4G6D A;  5FKM A;  1N78 A;  3CC7 I;  3C18 A;  5FLX Z;  3PUB A;  3ML6 A;  1B1B A;  4PJL A;  2CW8 A;  3PFI A;  1ETQ A;  1B59 A;  4LFU A;  2HKX A;  4A3L J;  3NWS A;  2M9H A;  1UEL B;  3WTS C;  3ESW B;  1JJ6 C;  1ON1 A;  2I10 A;  1OR7 C;  3KZY A;  4JK1 X;  3M8F A;  1OLT A;  2DOF A;  4Z6Y A;  1MBH A;  1J09 A;  4M9X A;  5D5X B;  3ASO H;  2VE9 A;  3K70 C;  1IAW A;  5FRO A;  2O8K A;  1POG A;  4Q5S F;  5D4R A;  3ERM A;  2GA1 A;  2XPV A;  2Z2S B;  2Q8K A;  4BAY A;  1ENH A;  2JT1 A;  1G2H A;  1KA8 A;  5E3N A;  1VI0 A;  2MW8 A;  2CS3 A;  3I53 A;  2ELH A;  2OA4 A;  2M0C A;  4WXD A;  4WF2 A;  4WCG A;  1FZP B;  2EK5 A;  2L3D A;  3X2Q H;  5J3L A;  3M07 A;  1H0M A;  3KYD B;  4M6X A;  4XLP F;  1GVD A;  4FIS A;  1A6I A;  3EET A;  2ACJ A;  2IVM A;  3IL2 A;  4OIP F;  2JVH A;  2MSY A;  2VKH A;  2V6C A;  5ED4 A;  5B1A H;  2L9V A;  1XGM A;  1ULY A;  3FBI B;  1O7F A;  1FTZ A;  1XCB A;  4CIC A;  4PK4 A;  2RNJ A;  3CDI A;  3DBR B;  3ZMD A;  2RV8 A;  5HDK A;  4P9U A;  2Y69 H;  3DPT A;  3CD6 I;  4EM1 A;  4ANJ A;  3FMS A;  1FBS A;  4HV6 A;  2BEO A;  1LE8 A;  1ETK A;  4OU0 A;  2BY1 A;  2DJI A;  1I39 A;  3HBL A;  1MBG A;  2NVU B;  1W5S A;  4XOR A;  4CZZ A;  4ZJZ A;  4E7Z A;  3CC4 I;  4MEY F;  3DU6 A;  4ZDL A;  1YS7 A;  2ETH A;  4Y4R A;  2ISZ A;  2E35 A;  3Q0V A;  3LA3 A;  1ZYR F;  4CCM A;  3R61 A;  2DA7 A;  1OCP A;  4M72 A;  1YS6 A;  1G6N A;  3EPZ A;  3HGG A;  4BDY A;  1YIJ I;  5FRM A;  2VBX A;  2LBF B;  1XX5 A;  1SVO A;  2FNA A;  5D6F A;  4K2E A;  6PAX A;  2QVO A;  3K7A J;  5KAF C;  2EWN A;  3R4K A;  2VOP A;  2F4O B;  2VBW A;  4IQ4 A;  5IT9 Z;  3NRV A;  2RNG A;  1DQU A;  2CQN A;  1WKM A;  1HSJ A;  1OIS A;  1BJZ A;  4U0W A;  3FF5 A;  4PDK A;  1K7A A;  2HKO A;  1V4R A;  3LST A; 
#chains in the Genus database with same CATH homology
 2DO7 A;  3KE2 A;  3BZ6 A;  3ZMV A;  3KP5 A;  5E1Z B;  1J2X A;  1I1G A;  2J5P A;  3VOD A;  2F2E A;  4RB1 A;  3F3X A;  1FPQ A;  2XRO A;  1JGS A;  4M6Y A;  2RGV A;  4L0Z B;  3E5U A;  4U88 A;  2XAF A;  3E97 A;  1XGN A;  2HFH A;  3FXQ A;  2WV0 A;  4I02 A;  2L4A A;  2L54 A;  2ISY A;  1QO0 D;  1W7P A;  4LGW A;  5EEH A;  1REP C;  3ECH A;  3F8N A;  3LQQ A;  2NRA C;  3GXO A;  2M5W A;  3RI4 A;  3R0A A;  5FGM A;  5E1W A;  5ICF A;  1WWX A;  3ABU A;  4MTD A;  3PQJ A;  1B9N A;  1FP2 A;  3SHF A;  1HBX G;  3OV8 A;  3IC7 A;  4XRF A;  4ZH4 F;  2D45 A;  2GAU A;  1BOA A;  1IW7 F;  1F4K A;  4O6J A;  2K4J A;  3F6V A;  3HYI A;  2ZCW A;  2EFQ A;  1FOK A;  3RYP A;  1W4M A;  2VC1 A;  3IKV A;  2G7H A;  3CUQ B;  2HR3 A;  3JW4 A;  3W6K B;  1TW2 A;  2M30 A;  3JSP A;  3I58 A;  1BC8 C;  2BBY A;  3QPH A;  4AIH A;  2YPR A;  1TW3 A;  2HEO A;  3SXY A;  2XAJ A;  3CUO A;  1PP7 U;  2IJL A;  4EVI A;  4UXN A;  5BOX A;  3LA7 A;  3HRS A;  4BYY A;  5DD8 A;  4M73 A;  3KP4 A;  2VBY A;  5HLG A;  1T38 A;  3KEO A;  3EUH A;  1R58 A;  3H92 A;  1HW5 A;  3OOP A;  2PLY A;  3JSO A;  3ELK A;  2YU3 A;  1L3L A;  3P9K A;  4RB3 C;  2PG4 A;  1FX7 A;  1E17 A;  1D8K A;  1IXC A;  1BC7 C;  3I59 B;  1O3Q A;  3Q9S A;  2STT A;  2GIV A;  4LD5 A;  5DYM A;  4CDG A;  3BY6 A;  3MAJ A;  1W7P B;  5CYV A;  4I7H A;  4RGS A;  2IT0 A;  1OR7 A;  2FBK A;  1HKS A;  2E7X A;  3C1D A;  2YX4 A;  4WK8 F;  1P4X A;  1O3S A;  1D8J A;  2CFX A;  1GHC A;  4MQ9 F;  2VXZ A;  4PGG A;  5ILS A;  2AXL A;  5HOO A;  2HS5 A;  1TQM A;  4IRI A;  2FSW A;  1A04 A;  2D2W A;  1Z7U A;  4L5I A;  1PP8 F;  3E3V A;  3J81 K;  2DPD A;  2L4M A;  2PQ8 A;  4OOI A;  2JTV A;  1P92 A;  2PI0 A;  3L7W A;  1PUE E;  4MEX F;  3PQK A;  3AAF A;  2ZJ2 A;  5ICG A;  4HA8 A;  1L0O C;  2A68 F;  4UV9 A;  3WGH A;  2Y48 A;  4LB6 B;  3J7A O;  2FXA A;  2OZ6 A;  5D5W B;  2EB7 A;  4RAY A;  3IRR A;  5J6X A;  4IVN A;  5E20 A;  2VON A;  5D8K B;  1BN5 A;  4EJU A;  5D8L B;  3K2Z A;  2H27 A;  2LDU A;  1WQ2 A;  3Q5F A;  1FC3 A;  3RPQ A;  5BQT A;  1S7O A;  2A69 F;  4WX9 A;  3B02 A;  4U7B A;  3CO6 C;  3GVA A;  1QBJ A;  1OYW A;  2HGC A;  3GFL A;  3V8J A;  3G3Z A;  2PMU A;  1SMY F;  5LGN A;  1WSU A;  1G3T A;  4G7Z F;  2HWV A;  1J9I A;  3FXU A;  3V4G A;  1G3Y A;  1PDN C;  4HDV A;  3I54 A;  5E8I A;  4HLY A;  1RZ4 A;  4BHC A;  2JPB A;  2HYG D;  3CUQ C;  1BM9 A;  3D5L A;  4RB2 C;  2RDP A;  3RJP A;  1BIA A;  4H0E A;  3F8B A;  1S29 A;  2V1D A;  3R6S A;  1O3R A;  1BJA A;  3I0T A;  4HLX A;  2JSC A;  2ZNY A;  2MC3 A;  1XD7 A;  3H3Z A;  3LWF A;  3QU3 A;  1YW8 A;  1J59 A;  4N9H A;  2KJC A;  2QM3 A;  2W84 A;  1C0W A;  3IWZ A;  4BHB A;  2L01 A;  2W85 A;  2Q2E A;  3WTX C;  1I5Z A;  4ENJ A;  1B6A A;  2W25 A;  4FHT A;  1U78 A;  3GO5 A;  4GGG A;  4MHG A;  1FT9 A;  1F9N A;  3ERE D;  2L02 A;  2ZME B;  4Y13 A;  5H6Q A;  4ZYH A;  1FNN A;  1HW2 A;  4EQQ A;  2KJB A;  5HDG A;  1U5T C;  2DK8 A;  3DKW A;  3F21 A;  2CSO A;  3F6O A;  3O6B B;  3WTV C;  1ZLJ A;  1Z1D A;  5LEJ A;  4P9F A;  5DCM B;  1SD5 A;  2V1U A;  2HOE A;  3GW2 A;  3GFJ A;  3V7C A;  1P4A A;  3K9T A;  4B09 A;  4E70 A;  1ZRF A;  1KQ0 A;  3BP8 A;  4HQM A;  1CGP A;  2HTJ A;  1U2W A;  2IP2 A;  2ESN A;  2NNN A;  4KFC A;  1Z91 A;  3BPV A;  2FEZ A;  3ROU A;  3HRM A;  2RN7 A;  3JAM K;  2EA2 A;  5LHG A;  4HX7 A;  1OYY A;  3I5U A;  1R1V A;  4CGZ A;  5E17 F;  3GYH X;  5CVV A;  3KP6 A;  3CO7 C;  1KYW A;  3FXR A;  2Q0O A;  5KK1 A;  4A0Z A;  3HIF A;  2FQ3 A;  3GWZ A;  1HXD A;  1STZ A;  4KYW A;  5D4S A;  3RDI A;  1ZRE A;  2MA3 A;  1IRG A;  3ZN1 A;  1S6L A;  1BI3 A;  1T39 A;  2FNP A;  1JHH A;  4KMU X;  2HTS A;  1CF7 A;  4LMY A;  1MGT A;  2XIG A;  5K1Y A;  5D5U B;  3MFK A;  2Y0M A;  4UNO A;  2GA2 A;  2P4W A;  3FMQ A;  1ZG5 A;  4KIG A;  4KIC A;  5L3F A;  1FP1 D;  4P96 A;  4OIO F;  4WWC A;  3TDZ C;  3QRF F;  5FD6 A;  3DEU A;  1KU9 A;  4R1H A;  1FYL A;  2EFN A;  5EEG A;  3VFZ A;  3SFZ A;  2Z99 A;  1BIB A;  4HDU A;  4KT5 C;  1SFE A;  3Q9V A;  1QZY A;  5L3D A;  2QEN A;  5BPI A;  1SFX A;  2OD5 A;  4A2U A;  5FLX K;  5LRR A;  1UHW A;  4BNC A;  4XSZ F;  3WTU C;  2GXB A;  2OBP A;  3DF8 A;  1LJ9 A;  1QNT A;  3V8K A;  4PZJ A;  2P7C B;  2B0L A;  3CUQ A;  2KIU A;  3BOQ A;  4LLL A;  4KIF A;  5BMZ A;  1HQC A;  1W7P D;  5FFX A;  5DDG A;  3MWM A;  2V79 A;  5HS7 A;  1IRF A;  1R22 A;  2QYO A;  2DFI A;  1LEA A;  5L3G A;  4LLN A;  1ONV A;  4G6Q A;  3GUD A;  1V3F A;  3REO A;  2M87 A;  4GYI A;  4ZZL A;  1BBY A;  1CF7 B;  4IF4 A;  3GFM A;  4Q48 A;  1S3J A;  2XAQ A;  3E6D A;  5JR3 A;  4HZF A;  2O61 A;  3K0L A;  2NYX A;  5HS9 A;  4Y17 A;  3I59 A;  4FT8 A;  1U5T A;  3P7N A;  1U6G A;  3RKY A;  3N4M A;  3KET A;  3GF2 A;  4OMY A;  5CVJ A;  3MZY A;  4KNY A;  2VT3 A;  5LLQ A;  4NB5 A;  5IT3 A;  5E1X A;  5IT9 K;  4HF0 A;  4CXF A;  1I1S A;  3E5X A;  3WOD F;  2IA1 A;  4AIK A;  4AD9 A;  1SAX A;  1YG2 A;  3T5X A;  4HQE A;  2EFO A;  2F5C A;  4A5M A;  2UZK A;  5A2Q Z;  4EV0 A;  2JRT A;  1J75 A;  2P5V A;  1I6X A;  4EJW A;  3MEX A;  2DTR A;  4KIB A;  3FM3 A;  4ZYG A;  2Y75 A;  4GCV A;  4LJZ F;  4S05 A;  1ZGA A;  3I71 A;  1ZRC A;  3WTZ A;  3D0S A;  3E6B A;  3C7J A;  1NHA A;  2EV5 A;  4MGR A;  2XV4 S;  4R79 A;  5CVR A;  5H20 A;  1TQP A;  3V7R A;  4F7Z A;  1RUO A;  4EM2 A;  5TRD A;  3CDH A;  2H09 A;  2FA5 A;  4BXU A;  2XAS A;  5L3B A;  4JQF A;  4P5O A;  1MDM B;  3KCC A;  3L09 A;  2PN6 A;  3M1E A;  1E2X A;  4G9Y A;  2EJR A;  4FX0 A;  2JPC A;  2M8E A;  4NHJ A;  2Z33 A;  2FRH A;  4I0A A;  1O7L A;  2EFW A;  2K27 A;  2QBY A;  4CHU A;  1MJA A;  1U5T B;  2UXX A;  3LFK A;  2Z5U A;  2EV0 A;  2P6S A;  3TKY A;  5JVT A;  4YFX F;  2BV6 A;  1BI2 A;  3ISP A;  4D0P A;  2HQN A;  4IXA A;  1K6O A;  2GWR A;  1RIO H;  5LGU A;  3E5Q A;  4M74 A;  3QOP A;  3VEP A;  3J81 Z;  1F5T A;  1XCV A;  2Z3Y A;  4M9S A;  2K7L A;  1YW7 A;  2A3S A;  3HUG A;  1XN7 A;  3ABT A;  2YSR A;  2WTE A;  5ILU A;  2PEX A;  3WGI A;  3QP6 A;  3BJ6 A;  3DXJ F;  4HOB A;  3EQL F;  5LBQ A;  4M71 A;  1FYK A;  2XHK A;  4I2O A;  1QQI A;  3TO9 A;  2VOO A;  3FZV A;  4N0B A;  3U1D A;  1MKM A;  4HAM A;  4OMZ A;  2W57 A;  4L18 B;  5TJJ A;  4LK0 F;  5LEK A;  4KMF A;  5D5V B;  4FX4 A;  1Q1H A;  5F64 A;  1R1T A;  2ZME A;  2DBB A;  3FWE A;  1FSH A;  1XDU A;  1ZG3 A;  1OKR A;  3WU1 B;  4YIF A;  1P4W A;  1UHM A;  1K78 B;  2VOD A;  3ZN0 A;  3KFW X;  2FU4 A;  2IW5 A;  2Z9O A;  1ZRD A;  5DCM A;  1G3W A;  1B9M A;  3HSF A;  1TQI A;  1TNT A;  3WU0 A;  2QBY B;  3NQO A;  2VC0 A;  4BHP A;  3F23 A;  3BJA A;  4LK1 F;  3WE2 A;  5H6R A;  3VB2 A;  1Z6R A;  3R60 A;  4RS8 A;  5J8C A;  4ON0 A;  1MJB A;  3J80 Z;  4A0X A;  4Z2Y A;  1SD4 A;  1UCR A;  3L00 A;  1S7A A;  1D5V A;  4MTE A;  4NQW A;  5AON A;  3SQN A;  5AIQ A;  2QZ8 A;  2G9W A;  3HOS A;  2DU9 A;  2LKP A;  2OU2 A;  3WG9 A;  2QQ9 A;  4U0V A;  1LQ1 A;  4P55 A;  1H9G A;  1DPR A;  2CYY A;  3M9A A;  4RB0 A;  1KYZ A;  3K69 A;  2KIF A;  3QAH A;  5LHH A;  4EJO A;  2P7V B;  1DP7 P;  3GFI A;  1FLI A;  3F8F A;  4TV7 A;  3WTT C;  2A6E F;  1UST A;  3ULQ B;  1TTY A;  2K4B A;  4ZYD A;  3HHG A;  4PGH A;  1U8R A;  5HVQ C;  2D1H A;  2XGX A;  4O5V A;  3U9G A;  3M7G A;  2XAG A;  2P5L C;  5DUI A;  2LNB A;  2EA4 A;  4QWQ A;  2F5E A;  2H94 A;  4EJT A;  2R3S A;  3DFG A;  1OMI A;  1KGS A;  1RNL A;  2CW0 F;  4KUM A;  3TQN A;  4ZYE A;  3E6M A;  1P6R A;  3HSR A;  5F6F A;  3TOB A;  1ZG1 A;  5HLI A;  4G8X A;  4OIN F;  1EH6 A;  5CLS A;  3W6J B;  2AS5 F;  3ZMZ A;  2A61 A;  1I27 A;  3HTU A;  1J5Y A;  1ODD A;  2P8T A;  3RYR A;  5ICE A;  5DEQ A;  1ZN2 A;  2UWM A;  4AWX B;  5L3C A;  2RQP A;  1YQA A;  4L5J A;  1YW9 A;  2FML A;  5FO5 A;  1FY7 A;  4A6D A;  4GO1 A;  2IA0 A;  1IN4 A;  2ZO4 A;  5DV5 A;  2OQR A;  1IN7 A;  5CJ9 A;  1SFU A;  2EFP A;  1X3U A;  1Z9C A;  2CQK A;  5ERI A;  1YIO A;  3K1P A;  2COM A;  2TDX A;  5FD5 A;  2QLZ A;  2BE5 F;  2H6B A;  3CTA A;  4ESF A;  4WXC A;  3O2P E;  3EYI A;  2YX7 A;  1QGP A;  3BRO A;  2PFB A;  3MQ0 A;  2UXN A;  1IN8 A;  1JE8 A;  1TNS A;  1MJ9 A;  1GVJ A;  1J7K A;  2K02 A;  4Q4Z F;  3MZH A;  2BGC A;  1Y0U A;  1DUX C;  1YTY A;  3GEZ A;  2W24 A;  2LSO A;  1FYM A;  3B73 A;  3SZT A;  4EM0 B;  1UFM A;  3R0J A;  1YO5 C;  4RGX A;  2F5F A;  4G7O F;  4GXO A;  1J0R A;  4I09 A;  1O3T A;  1DPU A;  3KP2 A;  5K5Q A;  5L3E A;  3T0Y A;  4OIQ F;  1LDJ A;  3HOT A;  5JHU A;  4UVB A;  3P9I A;  1FBQ A;  5CVU A;  3TDU C;  1ZH5 A;  4KN4 X;  1IN6 A;  1ZAO A;  1YFH A;  4LLG F;  3F72 A;  1LEB A;  1Z05 A;  4A5N A;  3F8M A;  4EMS A;  2R7D A;  3I4P A;  3LAJ A;  3RTR A;  3P9C A;  1KQ9 A;  3QU6 A;  1RUN A;  1JHF A;  2QWW A;  4I0B A;  1SD7 A;  5FB2 A;  3GX4 X;  3ZPL A;  5BS6 A;  2E1N A;  3BDD A;  3GZ5 A;  1R36 A;  1MDM A;  2O6G E;  3FM5 A;  1XSX A;  1SMT A;  4CO8 A;  3EYY A;  4XLN F;  3ZMT A;  5DD4 A;  1OPC A;  4KDP A;  2VE8 A;  2RKH A;  2XKP A;  4EGZ A;  4ESB A;  2WC2 A;  2DI3 A;  5BPD A;  2IA2 A;  3F8C A;  4Q47 A;  3L2C A;  2H6C A;  2M45 A;  4HYE A;  3TGN A;  1FWZ A;  3WTW C;  3KZZ A;  2XVC A;  2F5D A;  1R5H A;  1R7J A;  2DQR A;  1JXS A;  2CWE A;  4EGY A;  5DCF A;  2MD5 A;  2YR2 A;  3ZMS A;  1ZAR A;  1Z6T A;  1UB9 A;  5LRS A;  4Y15 A;  4HW0 A;  3T1B A;  4I01 A;  4KN7 X;  4HF2 A;  5D6E A;  4YFN F;  3ZQ7 A;  3GZ6 A;  4BQA A;  2CG4 A;  3FX3 A;  3ECO A;  2A07 F;  4R8H A;  4YII A;  3IKT A;  4HV5 A;  1YYV A;  2R7F A;  3DV8 A;  1S8N A;  2GXG A;  4LG0 A;  1GXQ A;  1LVA A;  2CGP A;  3S2W A;  1ZLK A;  4G94 A;  1LDK B;  5A2Q K;  1KQ8 A;  3ZP5 A;  3G73 A;  1K78 A;  1QZZ A;  1T98 A;  4O3M A;  1F1Z A;  4IRH A;  1R00 A;  1U3E M;  1XDS A;  4HX8 A;  1KU7 A;  1IUY A;  1AOY A;  3COA C;  1T2K A;  1FBU A;  4UVA A;  3RKX A;  3U2R A;  2A6H F;  2O0Y A;  5JI6 A;  5CVI A;  2FF4 A;  3E6C C;  1BI1 A;  3BWG A;  2QUF A;  1D3Y A;  1IXR C;  4HX4 A;  4U7D A;  3HRU A;  4ENK A;  2RC4 A;  2XKO A;  5DUK A;  2IRF G;  5ILV A;  2XAH A;  4QLC U;  4UV8 A;  5ICC A;  4WXH A;  1HKT A;  3H3U A;  2BYV E;  1MD0 A;  3TOA A;  3HSE A;  1LDD A;  2PBI A;  3NEU A;  1EH7 A;  2WWY A;  2G7U A;  1USS A;  3TO7 A;  2HQR A;  2ZBK A;  4L9J A;  3WE3 A;  4AVP A;  3N97 A;  4MQV A;  2VBZ A;  3IRQ A;  2FBI A;  2D1V A;  1T0F A;  4L0Y B;  3FHZ A;  1WRJ A;  2ADU A;  3K1M A;  1IF1 A;  2NS0 A;  2V1X A;  3DQV C;  4LG0 B;  5LGT A;  2J5O A;  2FOK A;  1IZ1 A;  2C6Y A;  3KP3 A;  4ETS A;  2PJP A;  2X4H A;  4XSX F;  3JTH A;  2CO5 A;  3WTY C;  3DP7 A;  1T6S A;  3LA2 A;  1ON2 A;  4OIR F;  4CYD A;  3CJN A;  2MH9 A;  3KLO A;  1XSD A;  4A0Y A;  4GYG A;  2HDC A;  4IPA A;  4XBF A;  2NNY A;  4A12 A;  4ENM A;  2MLK A;  1DDN A;  1KU3 A;  2XUB A;  5LHI A;  5HDN A;  5HLH A;  2V9V A;  1LB2 A;  2DK5 A;  3V8L A;  1G3S A;  4KA4 A;  3F22 A;  4IJA A;  4LB5 A;  1G4D A;  1B4A A;  2STW A;  3O3K A;  2MBF A;  2GQQ A;  2O8X A;  4AIJ A;  2RVC A;  2OAZ A;  5KVR A;  4IRG A;  2ZFW A;  1GXP A;  5E8G A;  3LAP A;  1TLH B;  1FSE A;  2MLG A;  1YLF A;  2LF8 A;  2XRN A;  4S04 A;  5J8F A;  2QQB A;  3T8R A;  1HKQ A;  3RPU A;  5HS8 A;  4YFK F;  4L9N A;  2DQL A;  2VN2 A;  1MZB A;  2ZXJ A;  2O3F A;  4RGR A;  3T8T A;  3L9F A;  4DQ2 A;  2PMH A;  5AIP A;  2P5K A;  4BH9 A;  1BI0 A;  4UVC A;  2HZT A;  2K86 A;  3HHH A;  2DPU A;  4L9T A;  3FMR A;  4A6E A;  1R1U A;  4RGU A;  1IN5 A;  2QQA A;  3J80 K;  2IPQ X;  4PCQ A;  3V7S A;  3KEQ A;  1HST A;  3IWF A;  3MCZ A;  3ZMU A;  3I64 A;  4HBL A;  5F1R A;  1ZHF A;  2LF7 A;  4DNC A;  5K5R A;  1QPM A;  2FBH A;  1SD6 A;  1XGO A;  4UUV A;  2OZU A;  2KIM A;  3RKW A;  1XMA A;  2GZW A;  2DT5 A;  3KP7 A;  2KKO A;  1KU2 A;  2ZKZ A;  2OQG A;  4UHT A;  4RAZ A;  4MNU A;  1ZGJ A;  1K79 A;  3C3W A;  4ENN A;  3TO6 A;  2P6T A;  1XGS A;  1RI7 A;  2M1B A;  2E1C A;  4N9I A;  3DPL C;  3HRT A;  3CLO A;  3JAM Z;  3HTS B;  1XSV A;  1O57 A;  1EH8 A;  4IHT A;  3QP5 A;  4YG2 F;  2MH2 A;  2ZNZ A;  4L9V A;  3QPT A;  3GLX A;  2EV6 A;  3SZP A;  5K5O A;  4ZZD A;  2FE3 A;  1HW1 A;  4IHS A;  1EV7 A;  1P2F A;  1LNW A;  2E7W A;  1R5G A;  1WI9 A;  5E18 F;  1AWC A;  1IXS B;  3M8E A;  4I98 B;  4ESJ A;  3KLN A;  2DAO A;  5JFR A;  3LQR A;  3BPX A;  2JZY A;  3BJO A;  1R23 A;  4B8X A;  2DW4 A;  2NAZ A;  1XB4 A;  4G7H F;  3IHU A;  4ASN A;  2A5Y B;  1VTN C;  2FMY A;  2ESH A;  4M9Z A;  1W5T A;  3RIR A;  1H9T A;  4EJV A;  2O03 A;  2X0L A;  1TBX A;  3VOE A;  4U0Y A;  1XMK A;  2DLL A;  2VT2 A;  3K1N A;  5FFZ A;  2HYF A;  4HF1 A;  1OYI A;  2KRF A;  3JTG A;  3EDP A;  4JBA A;  3WGG A;  4G6D A;  3C18 A;  5FLX Z;  3ML6 A;  1B1B A;  3PFI A;  4LFU A;  1B59 A;  2HKX A;  3WTS C;  1ON1 A;  4JK1 X;  3KZY A;  3M8F A;  4M9X A;  1IAW A;  5D5X B;  2VE9 A;  4Q5S F;  5D4R A;  2GA1 A;  2Q8K A;  4BAY A;  2JT1 A;  1KA8 A;  3I53 A;  2ELH A;  2OA4 A;  4WXD A;  4WF2 A;  4WCG A;  1FZP B;  2EK5 A;  2L3D A;  1H0M A;  4M6X A;  4XLP F;  3EET A;  2ACJ A;  2IVM A;  3IL2 A;  4OIP F;  2V6C A;  5ED4 A;  1XGM A;  1ULY A;  1O7F A;  1XCB A;  4CIC A;  2RNJ A;  3ZMD A;  2RV8 A;  5HDK A;  4P9U A;  3DPT A;  4EM1 A;  3FMS A;  1FBS A;  4HV6 A;  2BEO A;  4OU0 A;  1W5S A;  4CZZ A;  4MEY F;  1YS7 A;  2ETH A;  2ISZ A;  3LA3 A;  1ZYR F;  3R61 A;  4M72 A;  1YS6 A;  1G6N A;  2VBX A;  2FNA A;  5D6F A;  4K2E A;  6PAX A;  2QVO A;  2EWN A;  3R4K A;  2VOP A;  2VBW A;  5IT9 Z;  3NRV A;  4U0W A;  1WKM A;  1HSJ A;  3FF5 A;  4PDK A;  1K7A A;  2HKO A;  1V4R A;  3LST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...