5K5RA

Aspa-32mer dna,crystal form 2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
89
structure length
89
Chain Sequence
STDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of archaeal DNA segregation machinery reveal bacterial and eukaryotic linkages.
pubmed doi rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Transcription/dna
molecule keywords AspA
total genus 26
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5k5rA00
4XLPF 3JW4A 4HYEA 5E8IA 3SXYA 4L0YB 5HLIA 2X0LA 1O3QA 2F5EA 1Z05A 4HF1A 2QYOA 1STZA 4LFUA 3T1BA 2P4WA 4EGYA 4L9TA 3I53A 2DQRA 1YO5C 3K1PA 1R7JA 3P7NA 2W57A 2W24A 4XRFA 3LFKA 1FZPB 4CYDA 1K7AA 1IN7A 5ICEA 5J8CA 2ZCWA 3BOQA 3I59B 2E7WA 1I27A 2OZUA 4EJWA 1VTNC 2L01A 4KMUX 3B73A 1ON1A 4RAZA 3ISPA 1G6NA 3FXUA 2IT0A 1USSA 2R7DA 3GFMA 2IRFG 1XD7A 5IT9Z 3LAJA 5A2QK 1ZGJA 5DEQA 1JGSA 2LNBA 2OZ6A 5HLHA 2OAZA 1B1BA 4L9VA 4QLCU 3L09A 1ULYA 1O3RA 3ERED 2H94A 1R00A 3P9CA 5DCMA 5EEGA 1IN4A 1Y0UA 1YYVA 3M1EA 5KVRA 1I5ZA 3I59A 4EV0A 3F8BA 2V79A 2XGXA 2FSWA 2A07F 4M6YA 4N9HA 1G3TA 2LKPA 5AONA 3CUQA 1J59A 2JPBA 3DXJF 5DDGA 2QQBA 1TW3A 1Z7UA 3E6BA 1KU3A 1TNTA 3LWFA 1MJAA 3RIRA 1OMIA 5JR3A 1R5HA 1LJ9A 2VE8A 3VB2A 4UV9A 2PG4A 2DT5A 3IWZA 5ILUA 3J80Z 2RQPA 1XSDA 2W84A 5DCMB 3WTXC 4A5NA 2YR2A 4MEYF 1SD7A 3FXQA 5HDNA 4NB5A 2MBFA 3RPUA 4EM0B 3R4KA 2L54A 1L3LA 1KA8A 5DYMA 3L7WA 4KICA 5K1YA 1QO0D 3QAHA 4G6QA 1XCVA 1B6AA 5CVUA 2EFOA 5HS7A 3RYRA 3COAC 4HLXA 2BYVE 3BDDA 1PDNC 2XVCA 1H9GA 2DU9A 2CWEA 2DPUA 1CGPA 1SD5A 4A0YA 1T2KA 2CFXA 4D0PA 5DUKA 4HA8A 4I2OA 2RC4A 4L9JA 5FFXA 2EFQA 3M7GA 4A6EA 1EH8A 4Z2YA 2VXZA 3IKTA 1ZRDA 4A0ZA 5JHUA 2ISZA 4M6XA 4AD9A 1BIAA 4BHBA 1QBJA 4LB5A 2E1NA 2XV4S 3HOTA 2ESHA 2O8XA 3GXOA 2HTSA 4B8XA 4Y17A 3ZMZA 5JVTA 4LLNA 2FRHA 3P9IA 2MLGA 4L18B 3BJOA 1R1UA 5DD4A 2VC1A 5D4RA 1QZYA 4WX9A 5H6RA 4ZYGA 1ZLKA 3WTUC 5H20A 4JBAA 2M1BA 4ENMA 2A61A 2FBKA 4RGXA 1J5YA 3FHZA 4M73A 2RDPA 3I58A 2XAQA 2QBYB 5LGNA 5LGTA 1W7PB 1JHHA 3QP6A 5K5RA 2JSCA 3DPTA 2A68F 2MH9A 5BS6A 3L9FA 3HSFA 2L02A 3KEOA 5CVJA 1RUNA 2FNAA 1U5TB 3K2ZA 2UZKA 3PFIA 4EQQA 4AIKA 1GXPA 4GXOA 2DI3A 1K78A 4MTDA 2NNNA 1S8NA 3DF8A 1RNLA 2W85A 5KK1A 4KUMA 3W6JB 3CUQB 1FYMA 5HDGA 2Z33A 1G3WA 3ABUA 2CGPA 2P5KA 1F4KA 3V7SA 2AS5F 1P4WA 1USTA 2QENA 2O61A 2CO5A 5A2QZ 4G94A 2PMUA 1QPMA 2ISYA 1U5TA 4HAMA 3QU6A 2E7XA 3D0SA 2GIVA 1YQAA 1DPRA 2A3SA 4WWCA 4L9NA 4A12A 1ZRFA 4ZYEA 3F6VA 3R61A 2Y0MA 1YS7A 2QBYA 4BYYA 2UWMA 4EMSA 1I1GA 4WCGA 1KYZA 1HKTA 1SMTA 1OKRA 5LRSA 2Z99A 3DKWA 5D4SA 2FQ3A 3GFLA 3GFJA 1K79A 2P5VA 1TW2A 5HS8A 2FEZA 1FP2A 3R6SA 3VFZA 1FOKA 4O6JA 4EJUA 3P9KA 5FLXK 4GCVA 1T6SA 5HS9A 4ESBA 4KIBA 3R0JA 4G7ZF 2HZTA 3SQNA 1S6LA 3M8EA 1R36A 2CG4A 2RV8A 3M9AA 1Z6RA 1HKQA 3GEZA 3RKXA 2M87A 3WGGA 4ENKA 1S3JA 4TV7A 1BOAA 1KU9A 1SD4A 1ZYRF 1SD6A 2ZFWA 2AXLA 2EFNA 4M74A 3WTWC 4RS8A 2MLKA 4EJTA 2D45A 2HR3A 1IXCA 2RGVA 2ZJ2A 1MZBA 4Y13A 3REOA 3RYPA 1U78A 2XROA 2KIMA 4HQMA 4Q4ZF 2A69F 3CUOA 3DEUA 3ZMVA 4YIIA 1AOYA 2BBYA 4L5JA 2QZ8A 4E70A 2QQAA 3IKVA 3T8RA 3IRQA 2EFWA 2XRNA 4G7HF 5DCFA 2HWVA 1UHMA 4HOBA 3MZHA 3W6KB 4CDGA 1Z91A 1R22A 4YFXF 3SFZA 3O3KA 1G4DA 2F5CA 3WE3A 3TOAA 4HF2A 2R3SA 5ILSA 3F72A 3T0YA 1ZGAA 4G9YA 4KIFA 2C6YA 3KETA 3ML6A 1Q1HA 4LB6B 4EJOA 3GZ6A 3C3WA 2Q2EA 5J6XA 1YLFA 3TOBA 3CTAA 5D5UB 2V1DA 2PJPA 1XMKA 4ZH4F 4UUVA 1KYWA 3SZTA 1PP7U 3WE2A 3TO7A 4HZFA 2VC0A 2WWYA 1NHAA 4EM2A 4HDVA 4YFNF 4U7DA 4I98B 4HX7A 4HF0A 1RUOA 2PLYA 3JSPA 5HLGA 1W4MA 2F5FA 2CYYA 3E5XA 3HRUA 5ICCA 4WXCA 5ILVA 1T38A 2LF7A 2GWRA 5TJJA 4HQEA 3SZPA 1XGNA 1V4RA 5JFRA 5LBQA 3R0AA 4XSXF 1HKSA 1K6OA 2H27A 4FT8A 4PGHA 5HDKA 2FMYA 5LGUA 2XIGA 5LHIA 1SFXA 3E6DA 1MJ9A 2DFIA 2PQ8A 4FX0A 3BZ6A 1S7OA 3GZ5A 2HQNA 4A6DA 4M71A 4I01A 1ON2A 1GHCA 1XN7A 3C1DA 3F8MA 4I0BA 1TTYA 2F5DA 3R60A 4IPAA 2CQKA 2VBYA 2PFBA 3ULQB 2RNJA 4HLYA 2ZXJA 5EEHA 1JXSA 3HUGA 3S2WA 3V8JA 2BEOA 3WTZA 2O6GE 2G7HA 2QWWA 1TBXA 2HGCA 3I71A 4OIRF 4IRIA 2DQLA 4XLNF 3I54A 2VBWA 2QQ9A 1TQIA 3GLXA 1W5SA 4HX4A 1P4AA 2MD5A 3L2CA 3FZVA 4I7HA 1O7FA 4PZJA 1EV7A 1BBYA 3DQVC 2DTRA 5DV5A 1IZ1A 1JHFA 4OU0A 3RPQA 2D1VA 5ERIA 4HDUA 4H0EA 3BPXA 2YU3A 3EETA 1ZN2A 5CJ9A 2A6EF 1XDUA 4CHUA 4IVNA 3TGNA 3WU0A 1IAWA 2VT3A 2B0LA 1D3YA 3ZMTA 2HFHA 1ZARA 2J5OA 3V7RA 2X4HA 4HV6A 3QOPA 1IN5A 3ZPLA 4A0XA 3MAJA 3H92A 4L5IA 2WC2A 1Z6TA 2Z9OA 3F23A 1IUYA 3B02A 2XUBA 2ACJA 1MGTA 2UXXA 2MC3A 4Q47A 2FBHA 2EA2A 1W7PD 3KP2A 1W5TA 2IJLA 5IT3A 4BNCA 1OYYA 2VOOA 2OD5A 4CO8A 1FP1D 1BIBA 4CXFA 4U0YA 2A6HF 5ICFA 3JSOA 2K02A 5BOXA 2KIFA 2HTJA 1LEAA 2Y48A 1YW7A 3DPLC 4Y15A 4EVIA 2ZKZA 4ZYHA 1QQIA 1YFHA 1OYWA 3FM3A 5H6QA 4BHCA 1LEBA 3HRTA 2VOPA 1P4XA 2XAGA 1XGSA 3KP7A 2EV0A 3FMQA 4ZYDA 1R1VA 5D5VB 1ZG5A 2O0YA 1IN6A 1BI0A 1B9NA 4KYWA 5L3CA 5BQTA 2P6SA 1YTYA 1IN8A 2ZNZA 1QGPA 3EYIA 2FF4A 2IVMA 5BMZA 4IHSA 3J81K 3HSRA 1CF7B 4A5MA 3DFGA 3HOSA 2Z3YA 3AAFA 4EJVA 3KP3A 5FB2A 4S05A 4UVCA 2KRFA 3RKWA 1UCRA 2VE9A 2RN7A 4RB1A 1XCBA 5E18F 3WGHA 2P7CB 2LDUA 4OMYA 3IL2A 3BWGA 3VOEA 1MJBA 1FSHA 4U0VA 4OIQF 1RZ4A 2O3FA 2IPQX 4JK1X 3G3ZA 1E17A 2P7VB 3CUQC 2VT2A 1OR7A 3VEPA 1MKMA 1YG2A 1I1SA 5BPIA 3EYYA 5J8FA 5F6FA 3TDZC 2G9WA 4CZZA 4I02A 3KCCA 2KIUA 3IC7A 5E17F 1LVAA 2JPCA 4LJZF 4AIJA 3ROUA 5D8LB 1KQ0A 3K9TA 2GZWA 1XGMA 3H3ZA 4YIFA 2PEXA 2Y75A 2KJCA 3LQQA 3KP6A 2K27A 4KIGA 4RB3C 5DUIA 5K5OA 4S04A 3J7AO 2RKHA 1D8KA 2G7UA 2NAZA 1ZLJA 5ICGA 4HBLA 4AIHA 4M9SA 3HTUA 3WG9A 3BROA 1TQPA 1DPUA 3IHUA 3K69A 3ELKA 2ETHA 3PQKA 5D8KB 2GA2A 2J5PA 1R5GA 2JZYA 2XAFA 5D6FA 1J75A 3ZMUA 3QPHA 1F1ZA 5LEJA 1LDJA 3RKYA 2Z5UA 2VODA 4BAYA 3HRSA 2YX4A 4KFCA 1S7AA 3LA3A 4JQFA 3U2RA 4O3MA 2ZMEA 5E1XA 1FBQA 4KDPA 2NS0A 1S29A 2LF8A 4ENJA 1IRFA 3C7JA 1WKMA 2D1HA 4UVAA 2M30A 2P5LC 4HX8A 3MWMA 4BQAA 3MQ0A 1F5TA 1A04A 5HVQC 4LD5A 3N4MA 3NRVA 3TDUC 1TNSA 1UFMA 5LEKA 1YW9A 2VBXA 2R7FA 2VONA 4XBFA 5LLQA 3TO6A 4OIOF 1RIOH 1FT9A 5CVIA 2BE5F 3LA7A 3E3VA 1O3TA 3ZMDA 1I6XA 4MGRA 4MNUA 4G7OF 1FYKA 4ON0A 5LHGA 4GO1A 1LB2A 3DV8A 4WXDA 3E97A 4HV5A 1DDNA 4L0ZB 1UHWA 4BH9A 1WWXA 2E1CA 2K4BA 4P55A 3CDHA 1KQ9A 3E6CC 1BI3A 3JTHA 1G3SA 5E1ZB 3NEUA 1BJAA 3HSEA 1YIOA 5L3EA 1JE8A 3JAMZ 5FFZA 1J0RA 2QVOA 1LDKB 3E6MA 3FMRA 2K4JA 4KA4A 2HEOA 2V6CA 4KNYA 2V1UA 3F8NA 3V8KA 3EDPA 3D5LA 4LGWA 3HIFA 3GWZA 3KZYA 3I64A 4LK0F 4UVBA 2DK8A 2IW5A 3LA2A 4NHJA 1ZH5A 2BV6A 1R1TA 4Q5SF 4AWXB 2H6BA 4B09A 3ZQ7A 4ENNA 1HSJA 5FO5A 3RDIA 3HRMA 1ZRCA 4IHTA 4QWQA 3O6BB 4RB2C 1GXQA 1KU2A 1T0FA 1P2FA 1TQMA 1FSEA 3WODF 2M5WA 1J2XA 3T5XA 2COMA 4DNCA 3KEQA 4U0WA 1EH7A 1HW5A 3GW2A 4NQWA 1XMAA 3DP7A 2F2EA 2K7LA 3RI4A 1HSTA 2OA4A 3FWEA 3GF2A 5CVRA 1XB4A 3SHFA 5JI6A 4LG0B 4RGRA 2LSOA 5FGMA 4HW0A 4BXUA 2ZNYA 2XASA 2HKXA 4BHPA 3U1DA 3TO9A 3GX4X 3I5UA 3L00A 1ZG3A 2DPDA 4RB0A 1HW2A 3ABTA 2HS5A 3MFKA 1WRJA 2EA4A 5CVVA 1J7KA 5LHHA 3TQNA 1U3EM 3J80K 2ZMEB 2UXNA 4RAYA 3KE2A 2ADUA 5BPDA 2IA1A 3VODA 1FLIA 3J81Z 2PN6A 4M9ZA 4G6DA 4LMYA 1E2XA 5AIPA 1GVJA 3O2PE 2GQQA 3Q5FA 1R23A 2L4MA 3G73A 4OMZA 4KN4X 2VBZA 2TDXA 4N9IA 4GYGA 2JTVA 2STWA 2NYXA 3EUHA 2V9VA 3RTRA 1T39A 3CO7C 2OQGA 3BJ6A 1ONVA 2XAJA 3MZYA 1RI7A 2D2WA 1DP7P 2YSRA 4WXHA 1WSUA 4IF4A 1XSXA 1ZG1A 5L3BA 2XKOA 3KLOA 3Q9SA 3E5QA 4P9FA 3M8FA 6PAXA 2MH2A 3N97A 2CSOA 4MHGA 1T98A 4OIPF 1FY7A 4MQVA 5IT9K 4LG0A 1HQCA 3F8CA 3QRFF 2KJBA 3HHGA 2QLZA 3LAPA 5K5QA 3Q9VA 4ESJA 3V8LA 3KP5A 4R8HA 1IW7F 3U9GA 2Q8KA 3LSTA 5F1RA 1YS6A 1B9MA 2QUFA 3GVAA 4A2UA 2VN2A 3HYIA 2PMHA 2FNPA 2HDCA 3QPTA 4PCQA 1FBSA 2ZO4A 4YG2F 3T8TA 1PUEE 1UB9A 3BP8A 5E1WA 2A5YB 5L3DA 1MDMA 4MEXF 4U88A 4IXAA 1ZHFA 4XSZF 1B59A 2EV5A 4LK1F 4FHTA 4EGZA 4M72A 1K78B 2YX7A 1F9NA 1G3YA 3WTTC 1FWZA 3HTSB 4WF2A 1FYLA 2EWNA 2L3DA 1QNTA 1Z9CA 3ZN0A 1J9IA 4UXNA 2V1XA 3K1NA 2DO7A 4M9XA 3IRRA 2M45A 1O3SA 4G8XA 5FD5A 2FU4A 2JRTA 1BN5A 3KZZA 4RGSA 4UNOA 3WU1B 2QM3A 4DQ2A 3H3UA 5E20A 1U5TC 5L3FA 1D8JA 1IRGA 1KU7A 3TKYA 1SFEA 2HKOA 2NNYA 2RVCA 4WK8F 1BC7C 4IRGA 3EQLF 1U8RA 3QU3A 2EJRA 4I0AA 4LLGF 1LQ1A 4KMFA 3IWFA 2STTA 3NQOA 4IJAA 2WV0A 1V3FA 3GO5A 2O03A 3QP5A 2BGCA 2P8TA 1O7LA 1FPQA 3CJNA 1SMYF 3F3XA 3K0LA 2L4AA 2DBBA 3FF5A 1ODDA 2Q0OA 1TLHB 1U2WA 3V7CA 1U6GA 3KLNA 4OOIA 3F22A 3WTVC 3CO6C 1KQ8A 3JTGA 3MCZA 3OV8A 4EM1A 4CICA 4RGUA 4UHTA 5FD6A 3HHHA 3I4PA 2PBIA 1ZAOA 3JAMK 1ZREA 4GGGA 3F6OA 3BY6A 3KFWX 2H6CA 1IF1A 2ZBKA 3BJAA 2IA2A 3MEXA 3PQJA 1HBXG 2GA1A 2GAUA 5ED4A 5D5WB 2FXAA 4KN7X 2DK5A 2XKPA 3ECHA 2GXGA 3FM5A 3ZP5A 1Z1DA 1C0WA 1P92A 4Q48A 1OYIA 3GFIA 4K2EA 3K1MA 1SFUA 1R58A 2HYGD 5L3GA 4OINF 1DUXC 2GXBA 2K86A 3CLOA 1P6RA 4I09A 4F7ZA 3ZMSA 3C18A 1WI9A 1LDDA 4ESFA 4ZZDA 2CW0F 4P96A 2KKOA 1H0MA 5HOOA 4CGZA 1PP8F 2FA5A 2OBPA 4R1HA 2IP2A 1WQ2A 3FMSA 5DD8A 2DW4A 2FBIA 3GYHX 1BM9A 1D5VA 2DAOA 2EFPA 3RJPA 1CF7A 4MTEA 1QZZA 2P6TA 5TRDA 1SAXA 2XAHA 1EH6A 1IXSB 2W25A 2PI0A 1HXDA 1XGOA 2DLLA 5CYVA 4O5VA 1IXRC 3WTYC 4N0BA 4YFKF 2H09A 1MDMB 5F64A 4GYIA 1BI1A 5CLSA 2WTEA 2HYFA 2M8EA 3WGIA 1B4AA 3FX3A 4IRHA 3WTSC 4MQ9F 2FOKA 4AVPA 3FXRA 1BC8C 1KGSA 1O57A 3ZN1A 1HW1A 1LNWA 2HOEA 1AWCA 5D6EA 1FX7A 4LLLA 1L0OC 4P9UA 1XDSA 2ESNA 1FBUA 3V4GA 3GUDA 2OU2A 2XHKA 1YW8A 3BPVA 2EK5A 2JT1A 5E8GA 4U7BA 4R79A 2HQRA 1MD0A 3LQRA 1FNNA 4ZZLA 5FLXZ 1REPC 3ECOA 2OQRA 1BI2A 1FC3A 4PGGA 1X3UA 2IA0A 2EB7A 4KT5C 1XSVA 2NRAC 3OOPA 2FMLA 2EV6A 2FE3A 1W7PA 2MA3A 3I0TA 5AIQA 4UV8A 5LRRA 3E5UA 2YPRA 4ETSA 4P5OA 3F8FA 3KP4A 1H9TA 2ELHA 5D5XB 4ASNA 3F21A 4FX4A 1OPCA 4PDKA
chains in the Genus database with same CATH superfamily
4XLPF 3JW4A 2MC4A 4HYEA 2VQGA 9ANTA 5E8IA 2E1MC 2R7VA 1HDPA 3SXYA 1UAAA 2NXNB 4L0YB 3MKLA 3OR1C 5HLIA 1S72I 2X0LA 2PMZA 1O3QA 1SANA 1Z05A 2F5EA 2QGUA 4HF1A 3MVPA 3HPHA 2QYOA 4RDUA 2ZJQF 1STZA 4LFUA 3SDGA 3T1BA 2P4WA 4EGYA 5GAGJ 4L9TA 3I53A 2DQRA 3FK6A 1T95A 1YO5C 2XPUA 3K1PA 3QODA 3KYLA 1R7JA 2CQNA 2R7RA 3P7NA 5JLXA 2R92J 2W57A 2W24A 2EH3A 3LFKA 4XRFA 1W36D 3H9JA 1UJ8A 3V42A 1FZPB 4CYDA 3OR2C 2M9HA 2M34A 1POGA 1K7AA 3HOZJ 1IN7A 5ICEA 2ZCWA 3BOQA 5J8CA 3I59B 2E7WA 1U9NA 1FJLA 2HQAA 4IHXA 1X2MA 1I27A 2OZUA 4EJWA 2KIQA 1VTNC 2L01A 4KMUX 1TL8A 4ZTFA 4N4NB 3B73A 1ON1A 5HNFA 4BACA 4RAZA 4BE2A 3ISPA 5CPRB 3BZCA 4C3JJ 1G6NA 3FXUA 3A03A 2IS4A 1IV6A 2VUMJ 2WAEA 4DYQA 2IT0A 2CV0A 1USSA 2R7DA 1MBEA 3GFMA 2IRFG 1XD7A 5IT9Z 2LREA 3H35A 3LAJA 3OIQA 5A2QK 1ZGJA 4BY1J 3NWTA 5DEQA 3RZDJ 1JGSA 2LNBA 2OZ6A 5HLHA 2OAZA 3HKZN 3OS1A 1B1BA 2VASA 4E7ZA 4L9VA 3LSIA 3B6CA 3QYFA 4QLCU 3L09A 4CZCA 1ULYA 3BCAA 1JTXA 1O3RA 3SFIA 5FLMJ 1U8BA 3OYIA 1R4NB 2H94A 1R00A 3ERED 1JI8A 3P9CA 5DCMA 2M3AA 5EEGA 1IN4A 1Y0UA 1YYVA 3M1EA 2DMUA 5KVRA 1I5ZA 4XLFA 3I59A 4EV0A 3F8BA 3HXLA 2V79A 2XGXA 3OYMA 2FSWA 5FKMA 2A07F 4M6YA 1IGNA 1LE8B 2DDAA 4N9HA 4NC7A 1D0XA 1G3TA 3DKYA 3H1CA 2IS2A 3FXJA 1WZ2A 3FDYA 4DYCA 2LKPA 5AONA 3CUQA 1J59A 2JPBA 3DXJF 2HPMA 5DDGA 2JVHA 2QQBA 4GFBA 1TW3A 1Z7UA 3E6BA 4RLFA 3K4CA 1KU3A 1TNTA 1APLC 3BTIA 1MJAA 3LWFA 3RIRA 3ZQGA 3CC4I 4X6AJ 1OMIA 5JR3A 2V9KA 3AG2H 4QIWN 1R5HA 1LJ9A 4XKCA 2L7FP 3HZJA 2VE8A 2HZDA 3VB2A 5KNLA 4UV9A 2PG4A 2DT5A 2XF6A 5J1UA 1UZCA 2VQCA 3IWZA 1VQKI 5ILUA 1TC3C 2OTLI 3J80Z 2RQPA 1NG7A 1XSDA 2W84A 2KRHA 3OYCA 3PNYA 5DCMB 3WTXC 4A5NA 1TZLA 3A01A 2YR2A 1WJDA 4MEYF 1SD7A 4PUSA 2XSJC 1VFCA 2EINH 1ETYA 3FXQA 5HDNA 1HLVA 4NB5A 4HG2A 1Z0XA 2EZKA 4CCOA 2MBFA 3A4CA 5EJCA 2L5QA 2E36A 3IV5A 4E7LA 3RPUA 2R5ZA 1DP3A 4EM0B 3DTEA 2W7NA 3R4KA 4D5CA 4J19A 2L54A 1L3LA 1KA8A 5DYMA 1V5EA 3L7WA 4KICA 2R93J 5K1YA 2K5CA 1QO0D 4OWRB 3QAHA 2XDVA 1T08B 4G6QA 1ACIA 2X6WA 1WI3A 1XCVA 1B6AA 5CVUA 2EFOA 3J7ZI 5HS7A 3RYRA 3COAC 2XF5A 2BYVE 4HLXA 2DA2A 3HGYA 2M4KA 2Y9YA 2WY7Q 3OIPA 3BDDA 1PDNC 2XVCA 1H9GA 2DU9A 2CWEA 2DPUA 1CGPA 1SD5A 2O7OA 4A0YA 4JX5A 1T2KA 2KDZA 2CFXA 4D0PA 2OC6A 5DUKA 2DN0A 4HA8A 4I2OA 2RC4A 4L9JA 5FFXA 4JYKA 3RKQA 2EFQA 3M7GA 4L5EA 3CCUI 4A6EA 1YIJI 5C4XJ 1EH8A 4Z2YA 3ZQIA 4D7MA 2VXDA 5EEAA 2VXZA 2R7ZJ 4C30A 3IKTA 1ZRDA 4A0ZA 1R6RA 3CCEI 3A02A 2L0KA 5JHUA 2JJ7A 2ISZA 4M6XA 4AD9A 1BIAA 4BHBA 1QBJA 1VQ6I 3S16J 3DLAA 4LB5A 1EA3A 5IOZA 2E1NA 2XV4S 1EKEA 1OISA 1WPKA 3NWSA 3HOTA 2ESHA 2O8XA 3GXOA 3GTOJ 2HTSA 4B8XA 4Y17A 3NAUA 3U1KA 3OIOA 3ZMZA 5JVTA 3BTLA 4LLNA 3BR5A 2FRHA 3G1LA 2MLGA 3P9IA 4L18B 4KT6A 2R7UA 3BJOA 1R1UA 5DD4A 2VC1A 3HOYJ 1S5LC 2CUEA 2PX9A 3I56I 4PK4A 5D4RA 1QZYA 4WX9A 3OL4A 5H6RA 3AG4H 4ZYGA 3OSGA 2ZSIB 2NVQJ 1ZLKA 4YELA 3WTUC 3OYGA 2R7OA 3FKIJ 5H20A 3VSKA 4JBAA 4UUSA 2M1BA 4ENMA 1Y39A 3TP3A 2LY9A 2A61A 2FBKA 3DBHB 4RGXA 2KDOA 2CQQA 1J5YA 3FHZA 2KHMA 2RDPA 3I58A 2XAQA 4M73A 2QBYB 3ZOBA 5LGNA 5LGTA 2PJRA 2X48A 1W7PB 1JHHA 3QP6A 5K5RA 1YX3A 2JSCA 3DPTA 2XB5A 2A68F 5IYDJ 2K9SA 3GZNB 2MH9A 3OYHA 3HL2A 5BS6A 4E7JA 3VSLA 4XORA 3CP2A 4BJTA 3M4OJ 4M3FA 3L9FA 2VQHA 3JRFA 3HSFA 2IEKA 2L02A 3KEOA 5CVJA 4D5FA 1RUNA 2FNAA 1U5TB 3K2ZA 3BZKA 2UZKA 1Z67A 3DBRB 5IP9J 3PFIA 4EQQA 4AIKA 3VYUB 4BL0B 3MKZA 3KZIC 4ITVA 1MBHA 3BG9A 1GXPA 2K3PA 1HA8A 3K7AJ 5M5XJ 4GXOA 2XC7A 4AYBA 1MMGA 1JUSA 2DI3A 2EIJH 2E5NA 1K78A 4W1UA 4MTDA 3G4SI 2OUMA 2NNNA 1Z7LA 1PYVA 1S8NA 3WG7H 1D0YA 3PSFA 2R7SA 1EF4A 3DF8A 1RNLA 2W85A 3QQAA 3OYLA 4IX7A 1RKTA 2ZXHA 1RKWA 5KK1A 4C2TA 4KUMA 3W6JB 1MH3A 2GOXB 3CUQB 1FYMA 5HDGA 1X2NA 2DOAA 2BY0A 2IAIA 3H3VK 2Z33A 2HOSA 1G3WA 3ABUA 1JKOC 2CGPA 2ZMEC 1H88C 2RNGA 4HSRA 2Y30A 4C2UA 3FXOA 2P5KA 3JCUC 1F4KA 1MW7A 2FQ4A 3V7SA 2AS5F 1P4WA 1T56A 1USTA 4XKWA 2QENA 2O61A 2CO5A 1KZHA 1BR2A 5A2QZ 3CJQB 3OYNA 5EG0A 4G94A 4A69C 2LD5A 2PMUA 2Q2EB 4MFDA 4YRVA 4ZC3A 1QPMA 2ISYA 1TT0A 1U5TA 3W2WA 1WJFA 3E0JB 3WHCA 2Y0SN 2MABA 4HAMA 3QU6A 2CUJA 2E7XA 3D0SA 2GIVA 1YQAA 1DPRA 4RAFA 2LP0A 3S2DJ 2A3SA 4WWCA 4L9NA 4A12A 3CJTB 5LD2C 3DWLE 1OCCH 1ZRFA 4ZYEA 4FE7A 4RA2A 3F6VA 2QEXI 1BL0A 1Y8QB 2VJ5A 3JRIA 3R61A 2ICWG 4UUSB 1IO2A 4AVZA 2Y0MA 4I6ZA 1YS7A 4AUXA 3BLYA 2QBYA 4BYYA 2UWMA 5M5WJ 2JWTA 4EMSA 3ZQHA 1I1GA 3GBGA 4WCGA 1KYZA 1HKTA 4YIRX 3QWLA 4J01A 3CC7I 1SMTA 2HOAA 1X1AA 5HODA 3HOXJ 1OKRA 5LRSA 3W2VA 2Z99A 3DKWA 3D5RC 4XL9A 1N78A 2BY1A 5D4SA 1VQ9I 3AG3H 2FQ3A 3GFLA 3GFJA 3PNTA 3QOEA 4FE4A 2W82A 1K79A 2P5VA 4X1EA 4HNTA 2M7AA 1VQ4I 1TW2A 5HS8A 2FEZA 2LTPA 1FTTA 2EILH 1FP2A 3R6SA 2QF7A 3K4KA 3VFZA 5KAFC 3H9QA 3ESWB 2V26A 4O6JA 4EJUA 1FOKA 3P9KA 3S3NA 5FLXK 3JRDA 1E0EA 2DOEA 3K4JA 4GRIA 1H89C 1BJZA 4GCVA 1T6SA 1SVOA 3G2BA 1T33A 5HS9A 1A5JA 3CP8A 4ESBA 3LSJA 5CQGA 5F1JA 2EZIA 4KIBA 3R0JA 3UNGC 2Z1DA 4A3EJ 2HQ5A 4G6TB 3A2KA 4G7ZF 2Z2SB 2HZTA 3SQNA 1S6LA 3M8EA 4FTHA 3ZQLA 3OL3A 1JJ6C 1R36A 2CG4A 1UG0A 2VKHA 1W5CC 3HG9A 3L2QA 2M7BA 1P7JA 2BHZA 2RV8A 3M9AA 1Z6RA 1YJNI 1HKQA 3GEZA 1MSFC 2L9VA 2K9LA 3RKXA 2M87A 3WGGA 4ENKA 3MMYB 1S3JA 3P5JA 3LSMA 3GTGJ 4TV7A 1BOAA 2LBFA 3JRHA 1HC8A 1KU9A 1SD4A 1ZYRF 1SD6A 2ZFWA 1ETXA 2AXLA 2EFNA 4M74A 3TW7A 3WTWC 4RS8A 2MLKA 4EJTA 2D45A 2HR3A 1IXCA 1D1AA 2RGVA 2ZJ2A 1MZBA 4Y3OA 3L2WA 4BUPA 4Y13A 3I4MJ 5C4JJ 4HPQA 3REOA 2VJIA 3RYPA 1U78A 2XROA 2BXZA 4CCNA 2KIMA 4HQMA 4Q4ZF 3I3LA 3ZQQA 2X1EA 1XS9A 2I5UA 4CCMA 3S15J 2OCCH 3QYEA 3PO2J 1VF9A 2A69F 3CUOA 3DEUA 3OYAA 3ZMVA 4XKBA 4YIIA 4PJ0C 1AOYA 2BBYA 3KYCB 4L5JA 1GV2A 3TP0A 3UKGA 4HEA2 4XQFA 4A3LJ 1ZKGA 2QZ8A 3C2BA 5E3NA 1VQPI 4E70A 2K9QA 2WAQN 2QQAA 3IKVA 3T8RA 3IRQA 1W0UA 5GPCA 2EFWA 2H8WA 2XRNA 4G7HF 5DCFA 2HWVA 1UHMA 4DOZA 2XAUA 1MBKA 3DEWA 2L9SA 2CH0A 4B48A 2CMPA 4HOBA 4KITB 2VJ4A 5IY5H 3HOWJ 4IZZA 3MZHA 3W6KB 4CDGA 1Z91A 3BG7A 3OY9A 1R5ID 2K3FA 1I6HJ 1R22A 2LYCA 4RM2A 4YFXF 3ZR8X 3SFZA 1JUPA 1XTAA 2BVLA 3O3KA 1G4DA 3BR6A 2F5CA 3WE3A 1O4XA 3K6GA 3TOAA 1OFCX 2H1KA 4HF2A 4XN3A 1ETKA 2QA4I 3VPRA 2R3SA 3K10A 1WJ5A 5M5YJ 5ILSA 3F72A 3UR3C 3T0YA 2DFFA 2YS9A 1ZGAA 4G9YA 4KIFA 4HNUA 3OS0A 2C6YA 3KETA 3D5SC 3ML6A 1Q1HA 1BR4A 4LB6B 4EJOA 2KL4A 3GZ6A 2FUG2 5F27A 3C3WA 3GTKJ 2Q2EA 5J6XA 1YLFA 2QSGX 3TOBA 3L2UA 3CTAA 5D5UB 2V1DA 2PJPA 5FLVA 2TRTA 1XMKA 2OV7A 2XB0X 1HOMA 1DQUA 4DBQA 2W48A 4IQJA 1BR1A 2IGKA 4ZH4F 1PUFB 4UUVA 1FOWA 1KYWA 3SZTA 3OWTA 3CD6I 1PP7U 3WE2A 3TO7A 2DDBA 2L7KA 4HZFA 3M3YJ 3QYBA 5B1AH 3BQZA 2VC0A 2WWYA 1NHAA 3PUBA 4EM2A 1I50J 1FOYA 2JRMA 2HXIA 4HDVA 4YFNF 4U7DA 2XPVA 4I98B 4HX7A 1YE9A 4HF0A 5K7FA 1RUOA 2PLYA 3JSPA 1SEUA 5HLGA 1W4MA 2F5FA 1AKHB 2CYYA 3E5XA 3HRUA 2DMTA 2F5VA 5ICCA 4WXCA 2B7EA 3L2RA 5ILVA 2F4OB 1FIPA 2BXYA 2LF7A 3C2HA 4N4OB 2NS7A 4ZJZA 1T38A 2GWRA 2WY8Q 4XM3A 3CCVI 1X1BA 2GLOA 3S14J 5TJJA 2NVTJ 2DMNA 5F0HA 4HQEA 2OJED 4RBOA 3SZPA 1XGNA 2W00A 1V4RA 3HBLA 5JFRA 3SZGA 5LBQA 3S2HJ 2ECBA 3R0AA 4XSXF 1HKSA 1K6OA 1S9HA 2H27A 3KEYA 4FT8A 2O8KA 4PGHA 5HDKA 2LK2A 2UUZA 2FMYA 3KIOA 3JRBA 5LGUA 2JQ7A 1Y6IA 2DODA 5JVGF 2XIGA 5KAIC 5LHIA 1SFXA 3E6DA 2M8GX 3AL0C 1MJ9A 3HM5A 2DFIA 2PQ8A 3MD2A 2V6EA 2DT7B 1VQNI 4FX0A 3ASNH 1FIAA 3BZ6A 1S7OA 3GZ5A 2HQNA 5E3MA 3H5NA 4A6DA 4M71A 4I01A 1EJ9A 1ON2A 1GHCA 1X4OA 1XN7A 4PFPA 5DM7F 3C1DA 2LBFB 2E2IJ 3F8MA 5FRNA 4I0BA 4IHYA 1Z3YA 3CF2A 1TTYA 4BXXJ 2F5DA 2KP6A 3R60A 4IPAA 2R7XA 2I10A 2CQKA 3GTPJ 2VBYA 2PFBA 1VQ8I 3S1RJ 1RC9A 2IGNA 3Q0UA 1MSEC 3ULQB 2RNJA 4HLYA 2CUZA 5J3LA 4XMYA 4FETA 2ZXJA 5EEHA 1JXSA 2AQEA 3HUGA 1P7IA 4CSWA 3S2WA 1FOXA 1TWFJ 3V8JA 2BEOA 3WTZA 1A6IA 2O6GE 2G7HA 3FIWA 2QWWA 1TBXA 3IH3A 3BT9A 3TBIA 3J7AY 4A3CJ 4RMNA 2DXIA 3B6AA 1YOVB 4PSXA 1JGGA 3W6VA 2HGCA 3Q0WA 5BNGA 3I71A 4BU2A 4OIRF 1OJLA 2GBYA 5J1YA 2D5VA 4IRIA 2DQLA 4XLNF 2OCEA 1B72A 2ZXIA 3I54A 2VBWA 2ME6A 4NBQA 2QQ9A 1TQIA 3GLXA 4IEJA 3W2AA 1W5SA 4HX4A 1P4AA 2ZB9A 4E7HA 2LH9A 2Z16A 5H2FC 4BXFA 5IP7J 2MD5A 3L2CA 1RPWA 3FZVA 2LC2A 3K4MA 4I7HA 2ZJRF 1O7FA 4PZJA 2EQRA 1EV7A 3K70C 2V4JC 1V55H 1BBYA 1BW5A 3IUOA 3DQVC 3E1SA 2K9NA 2DTRA 5DV5A 3ZQFA 1PUFA 3H9GA 1IZ1A 2M4GA 1JHFA 4OU0A 4A3IJ 2R0QC 3RPQA 2D1VA 1YX5A 5ERIA 1Y56A 2A6TA 1JTYA 5GAHJ 1G8XA 2NOJB 4HDUA 1N77A 2B63J 1HCRA 4BEHB 4H0EA 3BPXA 4NC8A 2YU3A 3O8GA 3EETA 1OR7C 1ZN2A 5CJ9A 1T8IA 1JKRC 3PO3J 1DGWY 2A6EF 1XDUA 4BE0A 5C3EJ 2ZJPF 4A3BJ 2K40A 4CHUA 4IVNA 3TGNA 3WU0A 3S1QJ 1IAWA 2VT3A 3I55I 5KCMA 2CW7A 2B0LA 1D3YA 3ZMTA 2VJJA 2O9LA 4B4CA 2HFHA 3DCFA 4JOMA 1K4SA 1TT5B 2M0CA 1ZARA 2J5OA 3V7RA 2E19A 2X4HA 3JREA 2BW3B 4HV6A 3QOPA 1YRNB 4A3DJ 1IN5A 2E2HJ 3ZPLA 1V54H 4CYCB 1VQ5I 4A0XA 2AXTC 3MAJA 3H92A 4L5IA 3FBIB 3CMAI 1TWHJ 3BCBA 2WC2A 1Z6TA 2Z9OA 3LSPA 3F23A 4PJMA 1IUYA 3O8HA 3B02A 2XUBA 2ACJA 2R5YB 1MGTA 2UXXA 1JT6A 4CUGA 2EIMH 2MC3A 2XGDA 3ABKH 4Q47A 5E3LA 3OS2A 5J4VA 3HGGA 1S7EA 4Y52J 2FBHA 1ZK8A 1UMQA 2EA2A 1WCMJ 1W7PD 2DFHA 3KP2A 3MKWB 4MLOA 2K85A 2CFOA 1W5TA 2IJLA 2X6OA 5IT3A 3F9KA 3FKJA 1OYYA 4BNCA 2VOOA 1OCZH 2OD5A 2COBA 3WHBA 4CO8A 1FP1D 3CF5F 1BIBA 4CXFA 4U0YA 4A93J 2A6HF 3GTMJ 5ICFA 4GDFA 5F08A 3JSOA 2K02A 5BOXA 1AKHA 3LSKA 2KIFA 2HTJA 2WAFA 1LEAA 2Y48A 1YW7A 3DPLC 4Y15A 1FTZA 4EVIA 5HLTA 5EGOB 2ZKZA 4ZYHA 1QQIA 1YFHA 1OYWA 3FM3A 2ZC2A 3BR3A 5H6QA 4BBRJ 4BHCA 1LEBA 3HRTA 1F43A 2XSDC 2EZHA 2DTZA 5K7HA 1WH7A 2VOPA 1P4XA 1XC5A 2XAGA 1XGSA 4PJNA 2VKEA 5J47A 4D9JA 4IOAF 5GPAA 3KP7A 2EV0A 3FMQA 1AHDP 1T0FC 3PL8A 4ZYDA 1R1VA 3M1CA 5D5VB 3OMYA 2O0YA 1IN6A 1BI0A 1ZG5A 1B9NA 2IS6A 4KYWA 1Y1WJ 1WJCA 1QZEA 2E1MB 5L3CA 4A3MJ 4E6KG 5BQTA 3CC2I 2P6SA 2YU9J 1YTYA 1IN8A 4EEFG 3EUAA 2ZNZA 2R4GA 4NDLA 4P1WA 1IRXA 4W97A 1QGPA 3EYIA 2RQQA 2FF4A 2IVMA 5BMZA 4IHSA 3KPHA 3J81K 3I4NJ 1WFXA 3HSRA 1CF7B 4A5MA 1ETWA 3DFGA 3HOSA 2Z3YA 3AAFA 4CCKA 4EJVA 3KP3A 5FB2A 4S05A 1WVRA 1BOBA 2O5RA 3MN2A 4UVCA 1MMSA 2KRFA 1ORKA 1SAUA 3Q3SA 5K7ZA 3RKWA 3LSRA 3CLQA 1PVEA 3IAS2 1UCRA 2VE9A 3TEDA 2RN7A 4RB1A 3HKZA 3FXLA 1XCBA 5E18F 3WGHA 1MBFA 2ECCA 3FBNB 5J40A 2DA7A 2P7CB 2LKSA 1SVLA 4C3IJ 2JA7J 2LDUA 2VPRA 4OMYA 3HPGA 4X0GA 3IL2A 3BWGA 3VOEA 1WHUA 1MJBA 5IYBJ 1FSHA 1OCTC 4BQQA 2CQXA 2P81A 4U0VA 4OIQF 1RZ4A 1IV8A 1N25A 2A05A 2O3FA 2IPQX 1NK3P 4JK1X 5FKOA 3G3ZA 2K9MA 4FISA 2LY1A 1QA6A 3RZOJ 5TGTA 1E17A 4QPOA 2P7VB 1RR7A 3CUQC 2VT2A 1OR7A 4C2MJ 2V7FA 3J7YJ 3VEPA 2NS8A 1MKMA 3L2VA 4PJLA 1YG2A 1ZELA 1I1SA 5B66C 5BPIA 2YUSA 5B1BH 3EYYA 5J8FA 1R49A 4DZJA 2DMQA 1BA5A 5F6FA 3TDZC 2G9WA 4CZZA 4I02A 2BY2A 3KCCA 5IPAA 2KIUA 1K83J 3IC7A 5E17F 2AO9A 3EUHC 4AM3A 1GLNA 1LVAA 4XONA 2JPCA 1ETQA 4LJZF 4AIJA 5F0FA 3ROUA 5D8LB 1KQ0A 5J1RA 3K9TA 3PNVA 2AHQA 2GZWA 1U0JA 4BDZA 1XGMA 2IGOA 1F36A 3H3ZA 3A1YA 4YIFA 3ERMA 2PEXA 1QVUA 2Y75A 2KZGA 2KJCA 3LQQA 3KP6A 2JN6A 3HDDA 4IQ4A 2K27A 4JP0A 2GXAA 1E3OC 1YHQI 4KIGA 3OYBA 4RB3C 5DUIA 5K5OA 4S04A 3J7AO 2RKHA 2DOFA 1Y8RB 1D8KA 2VPLA 2G7UA 2NAZA 1ZLJA 3DU5A 5ICGA 4HBLA 5E3OA 4AIHA 2DYRH 4M9SA 4DGWB 3HTUA 3WG9A 2E2JJ 3BROA 1TQPA 2ELKA 1A35A 1DPUA 3IHUA 3H0DA 3K70D 3K69A 3ELKA 2X1CA 1UHSA 2H1LA 3VDXA 2ETHA 2X1DA 3LOCA 5GAEJ 3PQKA 3OOUA 4LOCA 5D8KB 2GA2A 2X85A 2J5PA 3ABMH 3DLLF 1R5GA 3CMEI 2JZYA 1X3ZB 2XAFA 5D6FA 3ZQCA 2G0EA 2XGEA 3HUGB 5EF6A 1J75A 3ZMUA 2KFDA 2CJJA 1VQLI 1N75A 3QPHA 1F1ZA 3CCYA 5LEJA 1LDJA 2MYSA 3RKYA 2Z5UA 3HOUJ 2VODA 3A0BC 1ZR2A 4BAYA 3JRAA 3HRSA 3OYKA 2YX4A 4KFCA 1S7AA 3LA3A 4JQFA 4XNFA 1FEXA 4BS9A 3U2RA 1X58A 4XLAA 3FXMA 4C3HJ 4O3MA 4DYRA 2ZMEA 2MSYA 3N05A 5E1XA 1G2HA 1FBQA 1XX5A 4KDPA 1ENHA 1QHHD 2JA8J 4A3FJ 2NS0A 1S29A 2F6CA 2Y2ZA 2LF8A 4UB8C 4ENJA 1IRFA 3S1NJ 2L7ZA 3C7JA 3I9V2 2H8RA 4F3QA 1WKMA 2DFEA 2D1HA 4CH7A 2E71A 1XMXA 4UVAA 2M30A 2P5LC 4HX8A 3MWMA 5M3MJ 4BQAA 3MQ0A 1F5TA 2MFZA 5B5EC 4G12A 3M8JA 1A04A 5HVQC 4XIDA 1MH4A 4LD5A 3N4MA 4A3GJ 3NRVA 2F48A 3TDUC 1TNSA 3LSHA 1I3QJ 1UFMA 5LEKA 4E7SA 1YW9A 4Y7NJ 3G1OA 2R7TA 2VBXA 2R7FA 1XPXA 2JVGA 2VONA 2E1OA 1UELB 1MBGA 3BG6A 2JMWA 4XBFA 5C44J 5LLQA 3TO6A 2JA2A 4OIOF 2CUFA 1RIOH 3GTJJ 3BR2A 1FT9A 2KISA 5CVIA 2BE5F 2R5ZB 3LA7A 2LFBA 3E3VA 3SYTA 1O3TA 3ZMDA 3RSNA 4XOTA 1MMAA 3D1NI 4XRSG 1I6XA 4MGRA 1K6YA 4MNUA 3DTIA 5IP6A 1WJAA 1FYKA 4G7OF 3CJRB 1MNEA 4ON0A 5LHGA 2QKMB 3EUKL 4DBRA 1H8AC 4GO1A 1LB2A 3DV8A 4WXDA 3E97A 4HV5A 1DDNA 1XG1A 2NVYJ 2ZFUA 2JUCA 2L2OA 4JX6A 3CZ6A 4L0ZB 3CDLA 3X2QH 1UHWA 4AC0A 4BH9A 3ONQA 2QCOA 5JHFA 2KZVA 1PJRA 1WWXA 2E1CA 1NK2P 2K4BA 2VLAA 4P55A 3CDHA 1KQ9A 3RPUD 2BY3A 1BI3A 3E6CC 3JTHA 3CCSI 1G3SA 5E1ZB 3NEUA 1QPIA 3ABLH 4CCLA 2HI3A 3PIOF 1NG6A 3MKYB 5CQEA 1BJAA 2ME0A 4E7KA 3HSEA 2MW8A 1YIOA 5L3EA 3ZGKA 2BOLA 1JE8A 2IGMA 3JAMZ 5FFZA 3KX2A 4ZDLA 1J0RA 2QVOA 1LDKB 3E6MA 3FMRA 1RRJA 4UUTA 5DS9A 2K4JA 4KA4A 2HEOA 2V6CA 4XLEA 2P0WA 4KNYA 2V1UA 3F8NA 3FHNA 2WB1N 3V8KA 3EDPA 3D5LA 2GOMA 4AYBN 3IAM2 4C9YA 2HOTA 2I8DA 4LGWA 4ANJA 3HIFA 1AA7A 3GWZA 3I64A 3KZYA 4LK0F 5IYCJ 2LG4A 4B43A 4UVBA 4F52A 2HNHA 2DK8A 2IW5A 3LA2A 4NHJA 1ZH5A 2OTJI 1IUFA 1B8IA 2BV6A 1R1TA 2DJNA 4AWXB 4Q5SF 1W0TA 2BHYA 3CCRI 2H6BA 4B3XA 4B09A 3ZQ7A 4ENNA 1HSJA 5FO5A 3RQ4A 4E4HA 4A3KJ 2V9PA 3RDIA 3CQZJ 3HRMA 2XGCA 4OAZA 4HRIA 1ZRCA 1FMWA 2M2EA 1LUJB 5GP9A 1YJWI 4IHTA 4QWQA 3O6BB 5GADJ 1QVTA 1GXQA 4RB2C 1KU2A 1T0FA 1P2FA 3DKXA 1TQMA 1FSEA 2OPTA 2Q1ZB 2VB6A 3WODF 2M5WA 1J2XA 4XRMA 3T5XA 2COMA 2FJ1A 1IRZA 4DNCA 2ELJA 3ZRGA 3KEQA 1IG7A 3LSGA 4U0WA 1EH7A 2CQ7A 2CU7A 1HW5A 3GW2A 2Y0SA 2DMPA 3SEQA 1B72B 4NQWA 1XMAA 5LFAA 3DP7A 2F2EA 3ZXSA 2K7LA 3RI4A 4F92B 5EDNA 1HSTA 4A3JJ 2OA4A 3FWEA 1I3AA 2KQRA 1OCPA 2KPMA 2WAQA 4ZYAA 3GF2A 5CVRA 1XB4A 3SHFA 1RR8C 5JI6A 1LPQA 4LG0B 4RGRA 2LSOA 2VL8A 5FGMA 4HW0A 4BJ6C 4BXUA 5M3FJ 2ID6A 2ZNYA 3PFYA 3S1MJ 2WA0A 2DA1A 2XASA 4RAGA 1AU7A 4UB6C 2HKXA 4BHPA 2LRDA 3U1DA 1SVMA 3TO9A 2DA4A 3GX4X 5FRMA 3I5UA 3L00A 1ZG3A 2DPDA 4RB0A 1HW2A 3ABTA 4XN0A 2HS5A 2ZXWH 1TP4A 3MFKA 1ERDA 1WRJA 2VIXA 1TWGJ 2EA4A 3S3MA 1X1PA 5CVVA 1J7KA 5LHHA 2LMDA 3TQNA 1U3EM 5EZGA 4I99C 3J80K 4FCYA 1SFKA 2ZMEB 2UXNA 4M6VA 4RAYA 3KE2A 5F0CA 2ADUA 5BPDA 3BQYA 3H0GJ 4RLQA 2IA1A 3VODA 1FLIA 2ID3A 3J81Z 2PN6A 4FQGA 1K61A 2DA6A 4M9ZA 4G6DA 4LMYA 1P9QC 1E2XA 1E3HA 5AIPA 1ZGWA 1GVJA 3S8PA 1ETVA 1B8IB 3O2PE 2ZSHB 2GQQA 1V5GA 3Q5FA 2QKLB 1R23A 2L4MA 3G73A 2FX0A 4KN4X 4OMZA 1WGXA 2VBZA 2TDXA 2R5YA 4N9IA 4GYGA 2JTVA 2STWA 2NYXA 3IP4B 3SJMA 1FMVA 3EUHA 2V9VA 3RTRA 1T39A 1ZR4A 3VWBA 5B3SH 4BBSJ 3CO7C 2OQGA 3ZCOA 2NVUB 3BJ6A 1ONVA 2XAJA 2QQ8A 3MZYA 2F4MB 3DEEA 3VYRB 1RI7A 2D2WA 1DP7P 2YSRA 4HSTA 4XR6A 4WXHA 1GVDA 1WSUA 4IF4A 1XSXA 1ZG1A 1R71A 5L3BA 2XKOA 3KLOA 3Q9SA 3E5QA 4P9FA 2WB1A 4NUBA 2LR8A 3M8FA 1R9TJ 3H36A 1E3PA 1KONA 6PAXA 2MH2A 4NC6A 3CCQI 3N97A 1LFBA 2CSOA 4MHGA 5GTHC 3BG5A 4RM3A 2TCTA 2WBMA 1T98A 4B1RA 4OIPF 1FY7A 4MQVA 4D1QA 3SEZA 4B3AA 2E35A 3DU6A 3AG1H 5IT9K 4LG0A 1HQCA 1IDYA 2L9RA 1MBJA 3F8CA 3QRFF 2KJBA 4Y33A 3HHGA 2WADA 2QLZA 4Z6YA 3TMOA 3BR0A 2EPFA 3LAPA 4B47A 3OSFA 5EGOA 4D7NA 3GTQJ 4LG3A 1JKQC 5K5QA 3Q9VA 1YI2I 4BQOA 1Y1VJ 4ESJA 3V8LA 1VQOI 3KP5A 3CCMI 4R8HA 1IW7F 3U9GA 2Q8KA 2EBIA 3LSTA 5F1RA 3GTLJ 3LL7A 3JR9A 3BR1A 1YS6A 1B9MA 2QUFA 3GVAA 4M3EA 4M3GA 4PFOA 4A2UA 3QPLA 1GUUA 2VN2A 3HC7A 3HYIA 2PMHA 2FNPA 3VYSB 2HDCA 1JT0A 3AFHA 3QPTA 4PCQA 1FBSA 4XRSA 4Y4RA 2ZO4A 4YG2F 1UG2A 3T8TA 1PUEE 1UB9A 3BP8A 2JSPA 5CKTA 5E1WA 2A5YB 2HYJA 1DGRM 2HDWA 5L3DA 5EYRA 3OYEA 3RCOA 1MIJA 1MDMA 5DM6F 3K4NA 4MEXF 3OYFA 4U88A 4IXAA 1ZHFA 3F0CA 3PM1A 1QRYA 5HNHA 4XSZF 2F4IA 1DU0A 2VKDA 1B59A 2EV5A 4LK1F 4FHTA 3CMYA 4EGZA 4M72A 1YJ9I 1K78B 4CYCA 3LFUA 2DA3A 2IBDA 2BW3A 2YX7A 5DTDA 1F9NA 1JJ8C 3IH4A 1MNDA 1G3YA 2VKVA 3WTTC 2AQFA 1LFPA 2CW8A 5EZHA 1FWZA 3HTSB 1GDTA 1W36C 4WF2A 1FYLA 2LKXA 2EWNA 2IXSA 2BZTA 3FISA 2L3DA 1QNTA 1Z9CA 3M07A 3G6EI 3ZN0A 1J9IA 4BY7J 1X1CA 3QPSA 4YEJA 4UXNA 2V1XA 2HXOA 1W1WE 2DA5A 3K1NA 2L7MP 3VYTB 2DO7A 4M9XA 3IRRA 4ZDOA 1SFOJ 4B44A 2M45A 1MMNA 4M3DA 1O3SA 1IC8A 2QSFX 5E79C 2L9NA 4M3BA 4G8XA 3IH2A 1X4PA 2X6XA 5FD5A 2FU4A 2JRTA 3K4BA 3LMMA 1BN5A 2VI6A 3DPUA 3KZZA 4RGSA 2IS1A 1X3WB 4UNOA 3WU1B 1TWCJ 2QM3A 3CCLI 4DQ2A 3S17J 4V19K 3H3UA 4E7IA 4KJZA 5E20A 1U5TC 5FKNA 3TL4X 5L3FA 1D8JA 2LLKA 2DCEA 5KHDA 2CV1A 1KU7A 1IRGA 3TKYA 1SFEA 2HKOA 2NNYA 2XPWA 2RVCA 3K4LA 2JA5J 4WK8F 2XF7A 3ASOH 3C2GA 1JKPC 1BC7C 4IRGA 3E7LA 3EQLF 1U8RA 2CS3A 2W1OA 1D0ZA 3QU3A 4QTRA 2EJRA 4I0AA 4LLGF 2X6YA 1LQ1A 3IWFA 4KMFA 1VQ7I 2STTA 1A36A 3NQOA 3HB9A 4IJAA 1GV5A 4KISA 2WV0A 3EPZA 3BG3A 1V3FA 3GO5A 4IHWA 2RREA 2O03A 3QP5A 1K4TA 3A0HC 4V2GA 1VQMI 2BGCA 3H5RA 2P8TA 4BE1A 1O7LA 3JRGA 4IOCF 2OF7A 2HU9A 4DZPA 1FPQA 3OYDA 3CJNA 3F3XA 1SMYF 4PJJA 2N8GA 3BTJA 3K0LA 2L4AA 5FKKA 2BVMA 2JK3A 2DBBA 3FF5A 1ODDA 4MFEA 2Q0OA 1U2WA 1TLHB 1D1CA 1Z21A 3V7CA 4I76A 3WU2C 1U6GA 3Q0VA 3KLNA 4OOIA 3F22A 2JUGA 3K2AA 3WTVC 3DBLB 2KRCA 3DTKA 3CDIA 2EIKH 3CO6C 1M1EB 5IOYA 4QSHA 1KQ8A 3H5AA 3PSIA 1WH5A 3JTGA 1Y0NA 3MCZA 3OV8A 4EM1A 4CICA 4RGUA 4UHTA 4J00A 5FD6A 3HHHA 4OAYA 2Y69H 4DJAA 4CA0A 3I4PA 1IJWC 1Z77A 2DYSH 2PBIA 2R7QA 2CV2A 1QU3A 1G59A 1ZAOA 3JAMK 2V1NA 4GGGA 1ZREA 2LY2A 3F6OA 3HEFA 3BY6A 3SDBA 2R7WA 4MO7A 2KMUA 3KFWX 2H6CA 1RESA 1SC7A 4BEHA 1IF1A 2ZBKA 3BJAA 1D5YA 2IA2A 1I39A 3MEXA 3PQJA 1HBXG 1DU6A 2GA1A 2GAUA 5ED4A 1Q1VA 5D5WB 4QPQA 2X9DA 2FXAA 4KN7X 2DK5A 4II2A 1ETOA 5FJ8J 1VZ0A 2XKPA 3ECHA 2E5ZA 2GXGA 3FM5A 2B9SA 2EZLA 1U9OA 1Z1DA 3ZP5A 3HOVJ 1C0WA 1MMDA 1P92A 4Q48A 2LVSA 1OYIA 3GFIA 1Z3XA 5J4YA 1A31A 4K2EA 3NARA 3K1MA 4II3A 1SFUA 1R58A 2DJIA 2MGQA 2CRGA 2HYGD 5L3GA 4OINF 1DUXC 2GXBA 2K86A 3CLOA 1OCOH 1P6RA 3U21A 4I09A 4F7ZA 1WJEA 2FOWA 4BJ5C 1HF0A 1X1DA 3ZMSA 2PJRB 1D1BA 2NVXJ 4AIDA 3AL0B 4LIUA 3C18A 1WI9A 1LDDA 4S0HB 4ESFA 4ZZDA 2CW0F 4P96A 1QHGA 4H4KC 4BDYA 1NTCA 4LIVA 2XRLA 2KKOA 1H0MA 1OQYA 2Y31A 5HOOA 2X51A 4CGZA 1PP8F 2A5WA 2FA5A 2OBPA 1V5FA 5F04A 4AU7A 4UY8I 4R1HA 2IP2A 1WQ2A 4V2FA 1LE8A 2MG4A 3FMSA 1NH3A 5DD8A 2DW4A 2FBIA 3GYHX 3S3OA 3HJEA 1BM9A 3GCMA 1D5VA 2DAOA 4DIQA 2EFPA 4XICA 1MNMC 3RJPA 1CF7A 4PSWA 4MTEA 1VI0A 4FASD 2E34A 3A01B 1QZZA 1OCRH 2P6TA 3PIPF 5TRDA 2RAEA 3W3CA 1YITI 1SAXA 4ABZA 3PJRA 2XAHA 1RETA 1EH6A 1IXSB 3MZ8A 2W25A 3S93A 2PI0A 1HXDA 1XGOA 4F55A 2GM4A 2DLLA 5CYVA 4O5VA 1IXRC 3KYDB 3PUFA 3GMEA 2E60A 2HVQA 3WTYC 5EG0B 1LKXA 2WV1A 4N0BA 4YFKF 4F91B 2HVSA 2H09A 4JX4A 5F64A 4GYIA 1MDMB 3CCJI 1BI1A 2HDDA 5CLSA 2WTEA 2HYFA 4XK4A 2M8EA 3L1PA 3WGIA 4IO9F 1WJBA 1B4AA 3BC8A 4IKFA 3FX3A 4IRHA 4XLCA 4XOPA 3WTSC 4MQ9F 1ZTRA 1ZQ3P 2FOKA 2M0MA 4AVPA 4CCJA 1J09A 3FXRA 1BC8C 4NQWB 1KGSA 3S32A 3OYJA 2QSHX 1O57A 3ZN1A 2DT6A 4IL6C 4ZTJA 1HW1A 1LNWA 2HOEA 1AWCA 5FROA 5D6EA 3FXKA 1FX7A 1X19A 4LLLA 1L0OC 4P9UA 1XDSA 1FBUA 2ESNA 4ZDPA 1R4MB 2Y9ZA 3V4GA 3GUDA 1HDDC 2OU2A 2GIZA 1TWAJ 2VQLA 2XHKA 4BKXA 2LOOA 1YW8A 3AKZA 5JLWA 3BPVA 2EK5A 1ITYA 2JT1A 4XKVA 4XLHA 4BGDA 1CQTA 3G71I 5E8GA 1JUMA 4U7BA 2HVRA 1GT0C 3BTCA 4U87A 4R79A 2HQRA 4DW6A 2UV1A 1BW6A 1MD0A 4LITA 3LQRA 1A6QA 1FNNA 4ZZLA 2FD5A 5FLXZ 1REPC 2NOGA 3ECOA 3GLLA 2HPIA 5GTIC 2OQRA 3G1MA 2JA6J 1BI2A 2MD0A 2PMZN 1FC3A 4PGGA 3LNQA 1X3UA 2IA0A 2EB7A 4KT5C 1XSVA 2W4SA 2NRAC 1LVKA 1VNDA 3FK7A 3OOPA 2FMLA 2EV6A 4MIMA 1IDZA 5TISC 3TW6A 4NNJA 2FE3A 1OLTA 1YRNA 1W7PA 2MA3A 3I0TA 5AIQA 4UV8A 5LRRA 3CMMA 3E5UA 2KLOA 3RQIA 4EATA 2YPRA 4ETSA 4P5OA 3F8FA 4IHVA 3KP4A 4F93B 1H9TA 2ELHA 4BQNA 5D5XB 4ASNA 3F21A 3JRCA 5FKLA 2KT0A 3CESA 4FX4A 4HNVA 1LFUP 1OPCA 4PDKA
chains in the Genus database with same CATH topology
4XLPF 3JW4A 4HYEA 5E8IA 3SXYA 4L0YB 5HLIA 2X0LA 1O3QA 2F5EA 1Z05A 4HF1A 2QYOA 1STZA 4LFUA 3T1BA 2P4WA 4EGYA 4L9TA 3I53A 2DQRA 1YO5C 3K1PA 1R7JA 3P7NA 2W57A 2W24A 4XRFA 3LFKA 1FZPB 4CYDA 1K7AA 1IN7A 5ICEA 5J8CA 2ZCWA 3BOQA 3I59B 2E7WA 1I27A 2OZUA 4EJWA 1VTNC 2L01A 4KMUX 3B73A 1ON1A 4RAZA 3ISPA 1G6NA 3FXUA 2IT0A 1USSA 2R7DA 3GFMA 2IRFG 1XD7A 5IT9Z 3LAJA 5A2QK 1ZGJA 5DEQA 1JGSA 2LNBA 2OZ6A 5HLHA 2OAZA 1B1BA 4L9VA 4QLCU 3L09A 1ULYA 1O3RA 3ERED 2H94A 1R00A 3P9CA 5DCMA 5EEGA 1IN4A 1Y0UA 1YYVA 3M1EA 5KVRA 1I5ZA 3I59A 4EV0A 3F8BA 2V79A 2XGXA 2FSWA 2A07F 4M6YA 4N9HA 1G3TA 2LKPA 5AONA 3CUQA 1J59A 2JPBA 3DXJF 5DDGA 2QQBA 1TW3A 1Z7UA 3E6BA 1KU3A 1TNTA 3LWFA 1MJAA 3RIRA 1OMIA 5JR3A 1R5HA 1LJ9A 2VE8A 3VB2A 4UV9A 2PG4A 2DT5A 3IWZA 5ILUA 3J80Z 2RQPA 1XSDA 2W84A 5DCMB 3WTXC 4A5NA 2YR2A 4MEYF 1SD7A 3FXQA 5HDNA 4NB5A 2MBFA 3RPUA 4EM0B 3R4KA 2L54A 1L3LA 1KA8A 5DYMA 3L7WA 4KICA 5K1YA 1QO0D 3QAHA 4G6QA 1XCVA 1B6AA 5CVUA 2EFOA 5HS7A 3RYRA 3COAC 4HLXA 2BYVE 3BDDA 1PDNC 2XVCA 1H9GA 2DU9A 2CWEA 2DPUA 1CGPA 1SD5A 4A0YA 1T2KA 2CFXA 4D0PA 5DUKA 4HA8A 4I2OA 2RC4A 4L9JA 5FFXA 2EFQA 3M7GA 4A6EA 1EH8A 4Z2YA 2VXZA 3IKTA 1ZRDA 4A0ZA 5JHUA 2ISZA 4M6XA 4AD9A 1BIAA 4BHBA 1QBJA 4LB5A 2E1NA 2XV4S 3HOTA 2ESHA 2O8XA 3GXOA 2HTSA 4B8XA 4Y17A 3ZMZA 5JVTA 4LLNA 2FRHA 3P9IA 2MLGA 4L18B 3BJOA 1R1UA 5DD4A 2VC1A 5D4RA 1QZYA 4WX9A 5H6RA 4ZYGA 1ZLKA 3WTUC 5H20A 4JBAA 2M1BA 4ENMA 2A61A 2FBKA 4RGXA 1J5YA 3FHZA 4M73A 2RDPA 3I58A 2XAQA 2QBYB 5LGNA 5LGTA 1W7PB 1JHHA 3QP6A 5K5RA 2JSCA 3DPTA 2A68F 2MH9A 5BS6A 3L9FA 3HSFA 2L02A 3KEOA 5CVJA 1RUNA 2FNAA 1U5TB 3K2ZA 2UZKA 3PFIA 4EQQA 4AIKA 1GXPA 4GXOA 2DI3A 1K78A 4MTDA 2NNNA 1S8NA 3DF8A 1RNLA 2W85A 5KK1A 4KUMA 3W6JB 3CUQB 1FYMA 5HDGA 2Z33A 1G3WA 3ABUA 2CGPA 2P5KA 1F4KA 3V7SA 2AS5F 1P4WA 1USTA 2QENA 2O61A 2CO5A 5A2QZ 4G94A 2PMUA 1QPMA 2ISYA 1U5TA 4HAMA 3QU6A 2E7XA 3D0SA 2GIVA 1YQAA 1DPRA 2A3SA 4WWCA 4L9NA 4A12A 1ZRFA 4ZYEA 3F6VA 3R61A 2Y0MA 1YS7A 2QBYA 4BYYA 2UWMA 4EMSA 1I1GA 4WCGA 1KYZA 1HKTA 1SMTA 1OKRA 5LRSA 2Z99A 3DKWA 5D4SA 2FQ3A 3GFLA 3GFJA 1K79A 2P5VA 1TW2A 5HS8A 2FEZA 1FP2A 3R6SA 3VFZA 1FOKA 4O6JA 4EJUA 3P9KA 5FLXK 4GCVA 1T6SA 5HS9A 4ESBA 4KIBA 3R0JA 4G7ZF 2HZTA 3SQNA 1S6LA 3M8EA 1R36A 2CG4A 2RV8A 3M9AA 1Z6RA 1HKQA 3GEZA 3RKXA 2M87A 3WGGA 4ENKA 1S3JA 4TV7A 1BOAA 1KU9A 1SD4A 1ZYRF 1SD6A 2ZFWA 2AXLA 2EFNA 4M74A 3WTWC 4RS8A 2MLKA 4EJTA 2D45A 2HR3A 1IXCA 2RGVA 2ZJ2A 1MZBA 4Y13A 3REOA 3RYPA 1U78A 2XROA 2KIMA 4HQMA 4Q4ZF 2A69F 3CUOA 3DEUA 3ZMVA 4YIIA 1AOYA 2BBYA 4L5JA 2QZ8A 4E70A 2QQAA 3IKVA 3T8RA 3IRQA 2EFWA 2XRNA 4G7HF 5DCFA 2HWVA 1UHMA 4HOBA 3MZHA 3W6KB 4CDGA 1Z91A 1R22A 4YFXF 3SFZA 3O3KA 1G4DA 2F5CA 3WE3A 3TOAA 4HF2A 2R3SA 5ILSA 3F72A 3T0YA 1ZGAA 4G9YA 4KIFA 2C6YA 3KETA 3ML6A 1Q1HA 4LB6B 4EJOA 3GZ6A 3C3WA 2Q2EA 5J6XA 1YLFA 3TOBA 3CTAA 5D5UB 2V1DA 2PJPA 1XMKA 4ZH4F 4UUVA 1KYWA 3SZTA 1PP7U 3WE2A 3TO7A 4HZFA 2VC0A 2WWYA 1NHAA 4EM2A 4HDVA 4YFNF 4U7DA 4I98B 4HX7A 4HF0A 1RUOA 2PLYA 3JSPA 5HLGA 1W4MA 2F5FA 2CYYA 3E5XA 3HRUA 5ICCA 4WXCA 5ILVA 1T38A 2LF7A 2GWRA 5TJJA 4HQEA 3SZPA 1XGNA 1V4RA 5JFRA 5LBQA 3R0AA 4XSXF 1HKSA 1K6OA 2H27A 4FT8A 4PGHA 5HDKA 2FMYA 5LGUA 2XIGA 5LHIA 1SFXA 3E6DA 1MJ9A 2DFIA 2PQ8A 4FX0A 3BZ6A 1S7OA 3GZ5A 2HQNA 4A6DA 4M71A 4I01A 1ON2A 1GHCA 1XN7A 3C1DA 3F8MA 4I0BA 1TTYA 2F5DA 3R60A 4IPAA 2CQKA 2VBYA 2PFBA 3ULQB 2RNJA 4HLYA 2ZXJA 5EEHA 1JXSA 3HUGA 3S2WA 3V8JA 2BEOA 3WTZA 2O6GE 2G7HA 2QWWA 1TBXA 2HGCA 3I71A 4OIRF 4IRIA 2DQLA 4XLNF 3I54A 2VBWA 2QQ9A 1TQIA 3GLXA 1W5SA 4HX4A 1P4AA 2MD5A 3L2CA 3FZVA 4I7HA 1O7FA 4PZJA 1EV7A 1BBYA 3DQVC 2DTRA 5DV5A 1IZ1A 1JHFA 4OU0A 3RPQA 2D1VA 5ERIA 4HDUA 4H0EA 3BPXA 2YU3A 3EETA 1ZN2A 5CJ9A 2A6EF 1XDUA 4CHUA 4IVNA 3TGNA 3WU0A 1IAWA 2VT3A 2B0LA 1D3YA 3ZMTA 2HFHA 1ZARA 2J5OA 3V7RA 2X4HA 4HV6A 3QOPA 1IN5A 3ZPLA 4A0XA 3MAJA 3H92A 4L5IA 2WC2A 1Z6TA 2Z9OA 3F23A 1IUYA 3B02A 2XUBA 2ACJA 1MGTA 2UXXA 2MC3A 4Q47A 2FBHA 2EA2A 1W7PD 3KP2A 1W5TA 2IJLA 5IT3A 4BNCA 1OYYA 2VOOA 2OD5A 4CO8A 1FP1D 1BIBA 4CXFA 4U0YA 2A6HF 5ICFA 3JSOA 2K02A 5BOXA 2KIFA 2HTJA 1LEAA 2Y48A 1YW7A 3DPLC 4Y15A 4EVIA 2ZKZA 4ZYHA 1QQIA 1YFHA 1OYWA 3FM3A 5H6QA 4BHCA 1LEBA 3HRTA 2VOPA 1P4XA 2XAGA 1XGSA 3KP7A 2EV0A 3FMQA 4ZYDA 1R1VA 5D5VB 1ZG5A 2O0YA 1IN6A 1BI0A 1B9NA 4KYWA 5L3CA 5BQTA 2P6SA 1YTYA 1IN8A 2ZNZA 1QGPA 3EYIA 2FF4A 2IVMA 5BMZA 4IHSA 3J81K 3HSRA 1CF7B 4A5MA 3DFGA 3HOSA 2Z3YA 3AAFA 4EJVA 3KP3A 5FB2A 4S05A 4UVCA 2KRFA 3RKWA 1UCRA 2VE9A 2RN7A 4RB1A 1XCBA 5E18F 3WGHA 2P7CB 2LDUA 4OMYA 3IL2A 3BWGA 3VOEA 1MJBA 1FSHA 4U0VA 4OIQF 1RZ4A 2O3FA 2IPQX 4JK1X 3G3ZA 1E17A 2P7VB 3CUQC 2VT2A 1OR7A 3VEPA 1MKMA 1YG2A 1I1SA 5BPIA 3EYYA 5J8FA 5F6FA 3TDZC 2G9WA 4CZZA 4I02A 3KCCA 2KIUA 3IC7A 5E17F 1LVAA 2JPCA 4LJZF 4AIJA 3ROUA 5D8LB 1KQ0A 3K9TA 2GZWA 1XGMA 3H3ZA 4YIFA 2PEXA 2Y75A 2KJCA 3LQQA 3KP6A 2K27A 4KIGA 4RB3C 5DUIA 5K5OA 4S04A 3J7AO 2RKHA 1D8KA 2G7UA 2NAZA 1ZLJA 5ICGA 4HBLA 4AIHA 4M9SA 3HTUA 3WG9A 3BROA 1TQPA 1DPUA 3IHUA 3K69A 3ELKA 2ETHA 3PQKA 5D8KB 2GA2A 2J5PA 1R5GA 2JZYA 2XAFA 5D6FA 1J75A 3ZMUA 3QPHA 1F1ZA 5LEJA 1LDJA 3RKYA 2Z5UA 2VODA 4BAYA 3HRSA 2YX4A 4KFCA 1S7AA 3LA3A 4JQFA 3U2RA 4O3MA 2ZMEA 5E1XA 1FBQA 4KDPA 2NS0A 1S29A 2LF8A 4ENJA 1IRFA 3C7JA 1WKMA 2D1HA 4UVAA 2M30A 2P5LC 4HX8A 3MWMA 4BQAA 3MQ0A 1F5TA 1A04A 5HVQC 4LD5A 3N4MA 3NRVA 3TDUC 1TNSA 1UFMA 5LEKA 1YW9A 2VBXA 2R7FA 2VONA 4XBFA 5LLQA 3TO6A 4OIOF 1RIOH 1FT9A 5CVIA 2BE5F 3LA7A 3E3VA 1O3TA 3ZMDA 1I6XA 4MGRA 4MNUA 4G7OF 1FYKA 4ON0A 5LHGA 4GO1A 1LB2A 3DV8A 4WXDA 3E97A 4HV5A 1DDNA 4L0ZB 1UHWA 4BH9A 1WWXA 2E1CA 2K4BA 4P55A 3CDHA 1KQ9A 3E6CC 1BI3A 3JTHA 1G3SA 5E1ZB 3NEUA 1BJAA 3HSEA 1YIOA 5L3EA 1JE8A 3JAMZ 5FFZA 1J0RA 2QVOA 1LDKB 3E6MA 3FMRA 2K4JA 4KA4A 2HEOA 2V6CA 4KNYA 2V1UA 3F8NA 3V8KA 3EDPA 3D5LA 4LGWA 3HIFA 3GWZA 3KZYA 3I64A 4LK0F 4UVBA 2DK8A 2IW5A 3LA2A 4NHJA 1ZH5A 2BV6A 1R1TA 4Q5SF 4AWXB 2H6BA 4B09A 3ZQ7A 4ENNA 1HSJA 5FO5A 3RDIA 3HRMA 1ZRCA 4IHTA 4QWQA 3O6BB 4RB2C 1GXQA 1KU2A 1T0FA 1P2FA 1TQMA 1FSEA 3WODF 2M5WA 1J2XA 3T5XA 2COMA 4DNCA 3KEQA 4U0WA 1EH7A 1HW5A 3GW2A 4NQWA 1XMAA 3DP7A 2F2EA 2K7LA 3RI4A 1HSTA 2OA4A 3FWEA 3GF2A 5CVRA 1XB4A 3SHFA 5JI6A 4LG0B 4RGRA 2LSOA 5FGMA 4HW0A 4BXUA 2ZNYA 2XASA 2HKXA 4BHPA 3U1DA 3TO9A 3GX4X 3I5UA 3L00A 1ZG3A 2DPDA 4RB0A 1HW2A 3ABTA 2HS5A 3MFKA 1WRJA 2EA4A 5CVVA 1J7KA 5LHHA 3TQNA 1U3EM 3J80K 2ZMEB 2UXNA 4RAYA 3KE2A 2ADUA 5BPDA 2IA1A 3VODA 1FLIA 3J81Z 2PN6A 4M9ZA 4G6DA 4LMYA 1E2XA 5AIPA 1GVJA 3O2PE 2GQQA 3Q5FA 1R23A 2L4MA 3G73A 4OMZA 4KN4X 2VBZA 2TDXA 4N9IA 4GYGA 2JTVA 2STWA 2NYXA 3EUHA 2V9VA 3RTRA 1T39A 3CO7C 2OQGA 3BJ6A 1ONVA 2XAJA 3MZYA 1RI7A 2D2WA 1DP7P 2YSRA 4WXHA 1WSUA 4IF4A 1XSXA 1ZG1A 5L3BA 2XKOA 3KLOA 3Q9SA 3E5QA 4P9FA 3M8FA 6PAXA 2MH2A 3N97A 2CSOA 4MHGA 1T98A 4OIPF 1FY7A 4MQVA 5IT9K 4LG0A 1HQCA 3F8CA 3QRFF 2KJBA 3HHGA 2QLZA 3LAPA 5K5QA 3Q9VA 4ESJA 3V8LA 3KP5A 4R8HA 1IW7F 3U9GA 2Q8KA 3LSTA 5F1RA 1YS6A 1B9MA 2QUFA 3GVAA 4A2UA 2VN2A 3HYIA 2PMHA 2FNPA 2HDCA 3QPTA 4PCQA 1FBSA 2ZO4A 4YG2F 3T8TA 1PUEE 1UB9A 3BP8A 5E1WA 2A5YB 5L3DA 1MDMA 4MEXF 4U88A 4IXAA 1ZHFA 4XSZF 1B59A 2EV5A 4LK1F 4FHTA 4EGZA 4M72A 1K78B 2YX7A 1F9NA 1G3YA 3WTTC 1FWZA 3HTSB 4WF2A 1FYLA 2EWNA 2L3DA 1QNTA 1Z9CA 3ZN0A 1J9IA 4UXNA 2V1XA 3K1NA 2DO7A 4M9XA 3IRRA 2M45A 1O3SA 4G8XA 5FD5A 2FU4A 2JRTA 1BN5A 3KZZA 4RGSA 4UNOA 3WU1B 2QM3A 4DQ2A 3H3UA 5E20A 1U5TC 5L3FA 1D8JA 1IRGA 1KU7A 3TKYA 1SFEA 2HKOA 2NNYA 2RVCA 4WK8F 1BC7C 4IRGA 3EQLF 1U8RA 3QU3A 2EJRA 4I0AA 4LLGF 1LQ1A 4KMFA 3IWFA 2STTA 3NQOA 4IJAA 2WV0A 1V3FA 3GO5A 2O03A 3QP5A 2BGCA 2P8TA 1O7LA 1FPQA 3CJNA 1SMYF 3F3XA 3K0LA 2L4AA 2DBBA 3FF5A 1ODDA 2Q0OA 1TLHB 1U2WA 3V7CA 1U6GA 3KLNA 4OOIA 3F22A 3WTVC 3CO6C 1KQ8A 3JTGA 3MCZA 3OV8A 4EM1A 4CICA 4RGUA 4UHTA 5FD6A 3HHHA 3I4PA 2PBIA 1ZAOA 3JAMK 1ZREA 4GGGA 3F6OA 3BY6A 3KFWX 2H6CA 1IF1A 2ZBKA 3BJAA 2IA2A 3MEXA 3PQJA 1HBXG 2GA1A 2GAUA 5ED4A 5D5WB 2FXAA 4KN7X 2DK5A 2XKPA 3ECHA 2GXGA 3FM5A 3ZP5A 1Z1DA 1C0WA 1P92A 4Q48A 1OYIA 3GFIA 4K2EA 3K1MA 1SFUA 1R58A 2HYGD 5L3GA 4OINF 1DUXC 2GXBA 2K86A 3CLOA 1P6RA 4I09A 4F7ZA 3ZMSA 3C18A 1WI9A 1LDDA 4ESFA 4ZZDA 2CW0F 4P96A 2KKOA 1H0MA 5HOOA 4CGZA 1PP8F 2FA5A 2OBPA 4R1HA 2IP2A 1WQ2A 3FMSA 5DD8A 2DW4A 2FBIA 3GYHX 1BM9A 1D5VA 2DAOA 2EFPA 3RJPA 1CF7A 4MTEA 1QZZA 2P6TA 5TRDA 1SAXA 2XAHA 1EH6A 1IXSB 2W25A 2PI0A 1HXDA 1XGOA 2DLLA 5CYVA 4O5VA 1IXRC 3WTYC 4N0BA 4YFKF 2H09A 1MDMB 5F64A 4GYIA 1BI1A 5CLSA 2WTEA 2HYFA 2M8EA 3WGIA 1B4AA 3FX3A 4IRHA 3WTSC 4MQ9F 2FOKA 4AVPA 3FXRA 1BC8C 1KGSA 1O57A 3ZN1A 1HW1A 1LNWA 2HOEA 1AWCA 5D6EA 1FX7A 4LLLA 1L0OC 4P9UA 1XDSA 2ESNA 1FBUA 3V4GA 3GUDA 2OU2A 2XHKA 1YW8A 3BPVA 2EK5A 2JT1A 5E8GA 4U7BA 4R79A 2HQRA 1MD0A 3LQRA 1FNNA 4ZZLA 5FLXZ 1REPC 3ECOA 2OQRA 1BI2A 1FC3A 4PGGA 1X3UA 2IA0A 2EB7A 4KT5C 1XSVA 2NRAC 3OOPA 2FMLA 2EV6A 2FE3A 1W7PA 2MA3A 3I0TA 5AIQA 4UV8A 5LRRA 3E5UA 2YPRA 4ETSA 4P5OA 3F8FA 3KP4A 1H9TA 2ELHA 5D5XB 4ASNA 3F21A 4FX4A 1OPCA 4PDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLP F;  3JW4 A;  4HYE A;  5E8I A;  3SXY A;  4L0Y B;  5HLI A;  2X0L A;  1O3Q A;  2F5E A;  1Z05 A;  4HF1 A;  2QYO A;  1STZ A;  4LFU A;  3T1B A;  2P4W A;  4EGY A;  4L9T A;  3I53 A;  2DQR A;  1YO5 C;  3K1P A;  1R7J A;  3P7N A;  2W57 A;  2W24 A;  4XRF A;  3LFK A;  1FZP B;  4CYD A;  1K7A A;  1IN7 A;  5ICE A;  5J8C A;  2ZCW A;  3BOQ A;  3I59 B;  2E7W A;  1I27 A;  2OZU A;  4EJW A;  1VTN C;  2L01 A;  4KMU X;  3B73 A;  1ON1 A;  4RAZ A;  3ISP A;  1G6N A;  3FXU A;  2IT0 A;  1USS A;  2R7D A;  3GFM A;  2IRF G;  1XD7 A;  5IT9 Z;  3LAJ A;  5A2Q K;  1ZGJ A;  5DEQ A;  1JGS A;  2LNB A;  2OZ6 A;  5HLH A;  2OAZ A;  1B1B A;  4L9V A;  4QLC U;  3L09 A;  1ULY A;  1O3R A;  3ERE D;  2H94 A;  1R00 A;  3P9C A;  5DCM A;  5EEG A;  1IN4 A;  1Y0U A;  1YYV A;  3M1E A;  5KVR A;  1I5Z A;  3I59 A;  4EV0 A;  3F8B A;  2V79 A;  2XGX A;  2FSW A;  2A07 F;  4M6Y A;  4N9H A;  1G3T A;  2LKP A;  5AON A;  3CUQ A;  1J59 A;  2JPB A;  3DXJ F;  5DDG A;  2QQB A;  1TW3 A;  1Z7U A;  3E6B A;  1KU3 A;  1TNT A;  3LWF A;  1MJA A;  3RIR A;  1OMI A;  5JR3 A;  1R5H A;  1LJ9 A;  2VE8 A;  3VB2 A;  4UV9 A;  2PG4 A;  2DT5 A;  3IWZ A;  5ILU A;  3J80 Z;  2RQP A;  1XSD A;  2W84 A;  5DCM B;  3WTX C;  4A5N A;  2YR2 A;  4MEY F;  1SD7 A;  3FXQ A;  5HDN A;  4NB5 A;  2MBF A;  3RPU A;  4EM0 B;  3R4K A;  2L54 A;  1L3L A;  1KA8 A;  5DYM A;  3L7W A;  4KIC A;  5K1Y A;  1QO0 D;  3QAH A;  4G6Q A;  1XCV A;  1B6A A;  5CVU A;  2EFO A;  5HS7 A;  3RYR A;  3COA C;  4HLX A;  2BYV E;  3BDD A;  1PDN C;  2XVC A;  1H9G A;  2DU9 A;  2CWE A;  2DPU A;  1CGP A;  1SD5 A;  4A0Y A;  1T2K A;  2CFX A;  4D0P A;  5DUK A;  4HA8 A;  4I2O A;  2RC4 A;  4L9J A;  5FFX A;  2EFQ A;  3M7G A;  4A6E A;  1EH8 A;  4Z2Y A;  2VXZ A;  3IKT A;  1ZRD A;  4A0Z A;  5JHU A;  2ISZ A;  4M6X A;  4AD9 A;  1BIA A;  4BHB A;  1QBJ A;  4LB5 A;  2E1N A;  2XV4 S;  3HOT A;  2ESH A;  2O8X A;  3GXO A;  2HTS A;  4B8X A;  4Y17 A;  3ZMZ A;  5JVT A;  4LLN A;  2FRH A;  3P9I A;  2MLG A;  4L18 B;  3BJO A;  1R1U A;  5DD4 A;  2VC1 A;  5D4R A;  1QZY A;  4WX9 A;  5H6R A;  4ZYG A;  1ZLK A;  3WTU C;  5H20 A;  4JBA A;  2M1B A;  4ENM A;  2A61 A;  2FBK A;  4RGX A;  1J5Y A;  3FHZ A;  4M73 A;  2RDP A;  3I58 A;  2XAQ A;  2QBY B;  5LGN A;  5LGT A;  1W7P B;  1JHH A;  3QP6 A;  5K5R A;  2JSC A;  3DPT A;  2A68 F;  2MH9 A;  5BS6 A;  3L9F A;  3HSF A;  2L02 A;  3KEO A;  5CVJ A;  1RUN A;  2FNA A;  1U5T B;  3K2Z A;  2UZK A;  3PFI A;  4EQQ A;  4AIK A;  1GXP A;  4GXO A;  2DI3 A;  1K78 A;  4MTD A;  2NNN A;  1S8N A;  3DF8 A;  1RNL A;  2W85 A;  5KK1 A;  4KUM A;  3W6J B;  3CUQ B;  1FYM A;  5HDG A;  2Z33 A;  1G3W A;  3ABU A;  2CGP A;  2P5K A;  1F4K A;  3V7S A;  2AS5 F;  1P4W A;  1UST A;  2QEN A;  2O61 A;  2CO5 A;  5A2Q Z;  4G94 A;  2PMU A;  1QPM A;  2ISY A;  1U5T A;  4HAM A;  3QU6 A;  2E7X A;  3D0S A;  2GIV A;  1YQA A;  1DPR A;  2A3S A;  4WWC A;  4L9N A;  4A12 A;  1ZRF A;  4ZYE A;  3F6V A;  3R61 A;  2Y0M A;  1YS7 A;  2QBY A;  4BYY A;  2UWM A;  4EMS A;  1I1G A;  4WCG A;  1KYZ A;  1HKT A;  1SMT A;  1OKR A;  5LRS A;  2Z99 A;  3DKW A;  5D4S A;  2FQ3 A;  3GFL A;  3GFJ A;  1K79 A;  2P5V A;  1TW2 A;  5HS8 A;  2FEZ A;  1FP2 A;  3R6S A;  3VFZ A;  1FOK A;  4O6J A;  4EJU A;  3P9K A;  5FLX K;  4GCV A;  1T6S A;  5HS9 A;  4ESB A;  4KIB A;  3R0J A;  4G7Z F;  2HZT A;  3SQN A;  1S6L A;  3M8E A;  1R36 A;  2CG4 A;  2RV8 A;  3M9A A;  1Z6R A;  1HKQ A;  3GEZ A;  3RKX A;  2M87 A;  3WGG A;  4ENK A;  1S3J A;  4TV7 A;  1BOA A;  1KU9 A;  1SD4 A;  1ZYR F;  1SD6 A;  2ZFW A;  2AXL A;  2EFN A;  4M74 A;  3WTW C;  4RS8 A;  2MLK A;  4EJT A;  2D45 A;  2HR3 A;  1IXC A;  2RGV A;  2ZJ2 A;  1MZB A;  4Y13 A;  3REO A;  3RYP A;  1U78 A;  2XRO A;  2KIM A;  4HQM A;  4Q4Z F;  2A69 F;  3CUO A;  3DEU A;  3ZMV A;  4YII A;  1AOY A;  2BBY A;  4L5J A;  2QZ8 A;  4E70 A;  2QQA A;  3IKV A;  3T8R A;  3IRQ A;  2EFW A;  2XRN A;  4G7H F;  5DCF A;  2HWV A;  1UHM A;  4HOB A;  3MZH A;  3W6K B;  4CDG A;  1Z91 A;  1R22 A;  4YFX F;  3SFZ A;  3O3K A;  1G4D A;  2F5C A;  3WE3 A;  3TOA A;  4HF2 A;  2R3S A;  5ILS A;  3F72 A;  3T0Y A;  1ZGA A;  4G9Y A;  4KIF A;  2C6Y A;  3KET A;  3ML6 A;  1Q1H A;  4LB6 B;  4EJO A;  3GZ6 A;  3C3W A;  2Q2E A;  5J6X A;  1YLF A;  3TOB A;  3CTA A;  5D5U B;  2V1D A;  2PJP A;  1XMK A;  4ZH4 F;  4UUV A;  1KYW A;  3SZT A;  1PP7 U;  3WE2 A;  3TO7 A;  4HZF A;  2VC0 A;  2WWY A;  1NHA A;  4EM2 A;  4HDV A;  4YFN F;  4U7D A;  4I98 B;  4HX7 A;  4HF0 A;  1RUO A;  2PLY A;  3JSP A;  5HLG A;  1W4M A;  2F5F A;  2CYY A;  3E5X A;  3HRU A;  5ICC A;  4WXC A;  5ILV A;  1T38 A;  2LF7 A;  2GWR A;  5TJJ A;  4HQE A;  3SZP A;  1XGN A;  1V4R A;  5JFR A;  5LBQ A;  3R0A A;  4XSX F;  1HKS A;  1K6O A;  2H27 A;  4FT8 A;  4PGH A;  5HDK A;  2FMY A;  5LGU A;  2XIG A;  5LHI A;  1SFX A;  3E6D A;  1MJ9 A;  2DFI A;  2PQ8 A;  4FX0 A;  3BZ6 A;  1S7O A;  3GZ5 A;  2HQN A;  4A6D A;  4M71 A;  4I01 A;  1ON2 A;  1GHC A;  1XN7 A;  3C1D A;  3F8M A;  4I0B A;  1TTY A;  2F5D A;  3R60 A;  4IPA A;  2CQK A;  2VBY A;  2PFB A;  3ULQ B;  2RNJ A;  4HLY A;  2ZXJ A;  5EEH A;  1JXS A;  3HUG A;  3S2W A;  3V8J A;  2BEO A;  3WTZ A;  2O6G E;  2G7H A;  2QWW A;  1TBX A;  2HGC A;  3I71 A;  4OIR F;  4IRI A;  2DQL A;  4XLN F;  3I54 A;  2VBW A;  2QQ9 A;  1TQI A;  3GLX A;  1W5S A;  4HX4 A;  1P4A A;  2MD5 A;  3L2C A;  3FZV A;  4I7H A;  1O7F A;  4PZJ A;  1EV7 A;  1BBY A;  3DQV C;  2DTR A;  5DV5 A;  1IZ1 A;  1JHF A;  4OU0 A;  3RPQ A;  2D1V A;  5ERI A;  4HDU A;  4H0E A;  3BPX A;  2YU3 A;  3EET A;  1ZN2 A;  5CJ9 A;  2A6E F;  1XDU A;  4CHU A;  4IVN A;  3TGN A;  3WU0 A;  1IAW A;  2VT3 A;  2B0L A;  1D3Y A;  3ZMT A;  2HFH A;  1ZAR A;  2J5O A;  3V7R A;  2X4H A;  4HV6 A;  3QOP A;  1IN5 A;  3ZPL A;  4A0X A;  3MAJ A;  3H92 A;  4L5I A;  2WC2 A;  1Z6T A;  2Z9O A;  3F23 A;  1IUY A;  3B02 A;  2XUB A;  2ACJ A;  1MGT A;  2UXX A;  2MC3 A;  4Q47 A;  2FBH A;  2EA2 A;  1W7P D;  3KP2 A;  1W5T A;  2IJL A;  5IT3 A;  4BNC A;  1OYY A;  2VOO A;  2OD5 A;  4CO8 A;  1FP1 D;  1BIB A;  4CXF A;  4U0Y A;  2A6H F;  5ICF A;  3JSO A;  2K02 A;  5BOX A;  2KIF A;  2HTJ A;  1LEA A;  2Y48 A;  1YW7 A;  3DPL C;  4Y15 A;  4EVI A;  2ZKZ A;  4ZYH A;  1QQI A;  1YFH A;  1OYW A;  3FM3 A;  5H6Q A;  4BHC A;  1LEB A;  3HRT A;  2VOP A;  1P4X A;  2XAG A;  1XGS A;  3KP7 A;  2EV0 A;  3FMQ A;  4ZYD A;  1R1V A;  5D5V B;  1ZG5 A;  2O0Y A;  1IN6 A;  1BI0 A;  1B9N A;  4KYW A;  5L3C A;  5BQT A;  2P6S A;  1YTY A;  1IN8 A;  2ZNZ A;  1QGP A;  3EYI A;  2FF4 A;  2IVM A;  5BMZ A;  4IHS A;  3J81 K;  3HSR A;  1CF7 B;  4A5M A;  3DFG A;  3HOS A;  2Z3Y A;  3AAF A;  4EJV A;  3KP3 A;  5FB2 A;  4S05 A;  4UVC A;  2KRF A;  3RKW A;  1UCR A;  2VE9 A;  2RN7 A;  4RB1 A;  1XCB A;  5E18 F;  3WGH A;  2P7C B;  2LDU A;  4OMY A;  3IL2 A;  3BWG A;  3VOE A;  1MJB A;  1FSH A;  4U0V A;  4OIQ F;  1RZ4 A;  2O3F A;  2IPQ X;  4JK1 X;  3G3Z A;  1E17 A;  2P7V B;  3CUQ C;  2VT2 A;  1OR7 A;  3VEP A;  1MKM A;  1YG2 A;  1I1S A;  5BPI A;  3EYY A;  5J8F A;  5F6F A;  3TDZ C;  2G9W A;  4CZZ A;  4I02 A;  3KCC A;  2KIU A;  3IC7 A;  5E17 F;  1LVA A;  2JPC A;  4LJZ F;  4AIJ A;  3ROU A;  5D8L B;  1KQ0 A;  3K9T A;  2GZW A;  1XGM A;  3H3Z A;  4YIF A;  2PEX A;  2Y75 A;  2KJC A;  3LQQ A;  3KP6 A;  2K27 A;  4KIG A;  4RB3 C;  5DUI A;  5K5O A;  4S04 A;  3J7A O;  2RKH A;  1D8K A;  2G7U A;  2NAZ A;  1ZLJ A;  5ICG A;  4HBL A;  4AIH A;  4M9S A;  3HTU A;  3WG9 A;  3BRO A;  1TQP A;  1DPU A;  3IHU A;  3K69 A;  3ELK A;  2ETH A;  3PQK A;  5D8K B;  2GA2 A;  2J5P A;  1R5G A;  2JZY A;  2XAF A;  5D6F A;  1J75 A;  3ZMU A;  3QPH A;  1F1Z A;  5LEJ A;  1LDJ A;  3RKY A;  2Z5U A;  2VOD A;  4BAY A;  3HRS A;  2YX4 A;  4KFC A;  1S7A A;  3LA3 A;  4JQF A;  3U2R A;  4O3M A;  2ZME A;  5E1X A;  1FBQ A;  4KDP A;  2NS0 A;  1S29 A;  2LF8 A;  4ENJ A;  1IRF A;  3C7J A;  1WKM A;  2D1H A;  4UVA A;  2M30 A;  2P5L C;  4HX8 A;  3MWM A;  4BQA A;  3MQ0 A;  1F5T A;  1A04 A;  5HVQ C;  4LD5 A;  3N4M A;  3NRV A;  3TDU C;  1TNS A;  1UFM A;  5LEK A;  1YW9 A;  2VBX A;  2R7F A;  2VON A;  4XBF A;  5LLQ A;  3TO6 A;  4OIO F;  1RIO H;  1FT9 A;  5CVI A;  2BE5 F;  3LA7 A;  3E3V A;  1O3T A;  3ZMD A;  1I6X A;  4MGR A;  4MNU A;  4G7O F;  1FYK A;  4ON0 A;  5LHG A;  4GO1 A;  1LB2 A;  3DV8 A;  4WXD A;  3E97 A;  4HV5 A;  1DDN A;  4L0Z B;  1UHW A;  4BH9 A;  1WWX A;  2E1C A;  2K4B A;  4P55 A;  3CDH A;  1KQ9 A;  3E6C C;  1BI3 A;  3JTH A;  1G3S A;  5E1Z B;  3NEU A;  1BJA A;  3HSE A;  1YIO A;  5L3E A;  1JE8 A;  3JAM Z;  5FFZ A;  1J0R A;  2QVO A;  1LDK B;  3E6M A;  3FMR A;  2K4J A;  4KA4 A;  2HEO A;  2V6C A;  4KNY A;  2V1U A;  3F8N A;  3V8K A;  3EDP A;  3D5L A;  4LGW A;  3HIF A;  3GWZ A;  3KZY A;  3I64 A;  4LK0 F;  4UVB A;  2DK8 A;  2IW5 A;  3LA2 A;  4NHJ A;  1ZH5 A;  2BV6 A;  1R1T A;  4Q5S F;  4AWX B;  2H6B A;  4B09 A;  3ZQ7 A;  4ENN A;  1HSJ A;  5FO5 A;  3RDI A;  3HRM A;  1ZRC A;  4IHT A;  4QWQ A;  3O6B B;  4RB2 C;  1GXQ A;  1KU2 A;  1T0F A;  1P2F A;  1TQM A;  1FSE A;  3WOD F;  2M5W A;  1J2X A;  3T5X A;  2COM A;  4DNC A;  3KEQ A;  4U0W A;  1EH7 A;  1HW5 A;  3GW2 A;  4NQW A;  1XMA A;  3DP7 A;  2F2E A;  2K7L A;  3RI4 A;  1HST A;  2OA4 A;  3FWE A;  3GF2 A;  5CVR A;  1XB4 A;  3SHF A;  5JI6 A;  4LG0 B;  4RGR A;  2LSO A;  5FGM A;  4HW0 A;  4BXU A;  2ZNY A;  2XAS A;  2HKX A;  4BHP A;  3U1D A;  3TO9 A;  3GX4 X;  3I5U A;  3L00 A;  1ZG3 A;  2DPD A;  4RB0 A;  1HW2 A;  3ABT A;  2HS5 A;  3MFK A;  1WRJ A;  2EA4 A;  5CVV A;  1J7K A;  5LHH A;  3TQN A;  1U3E M;  3J80 K;  2ZME B;  2UXN A;  4RAY A;  3KE2 A;  2ADU A;  5BPD A;  2IA1 A;  3VOD A;  1FLI A;  3J81 Z;  2PN6 A;  4M9Z A;  4G6D A;  4LMY A;  1E2X A;  5AIP A;  1GVJ A;  3O2P E;  2GQQ A;  3Q5F A;  1R23 A;  2L4M A;  3G73 A;  4OMZ A;  4KN4 X;  2VBZ A;  2TDX A;  4N9I A;  4GYG A;  2JTV A;  2STW A;  2NYX A;  3EUH A;  2V9V A;  3RTR A;  1T39 A;  3CO7 C;  2OQG A;  3BJ6 A;  1ONV A;  2XAJ A;  3MZY A;  1RI7 A;  2D2W A;  1DP7 P;  2YSR A;  4WXH A;  1WSU A;  4IF4 A;  1XSX A;  1ZG1 A;  5L3B A;  2XKO A;  3KLO A;  3Q9S A;  3E5Q A;  4P9F A;  3M8F A;  6PAX A;  2MH2 A;  3N97 A;  2CSO A;  4MHG A;  1T98 A;  4OIP F;  1FY7 A;  4MQV A;  5IT9 K;  4LG0 A;  1HQC A;  3F8C A;  3QRF F;  2KJB A;  3HHG A;  2QLZ A;  3LAP A;  5K5Q A;  3Q9V A;  4ESJ A;  3V8L A;  3KP5 A;  4R8H A;  1IW7 F;  3U9G A;  2Q8K A;  3LST A;  5F1R A;  1YS6 A;  1B9M A;  2QUF A;  3GVA A;  4A2U A;  2VN2 A;  3HYI A;  2PMH A;  2FNP A;  2HDC A;  3QPT A;  4PCQ A;  1FBS A;  2ZO4 A;  4YG2 F;  3T8T A;  1PUE E;  1UB9 A;  3BP8 A;  5E1W A;  2A5Y B;  5L3D A;  1MDM A;  4MEX F;  4U88 A;  4IXA A;  1ZHF A;  4XSZ F;  1B59 A;  2EV5 A;  4LK1 F;  4FHT A;  4EGZ A;  4M72 A;  1K78 B;  2YX7 A;  1F9N A;  1G3Y A;  3WTT C;  1FWZ A;  3HTS B;  4WF2 A;  1FYL A;  2EWN A;  2L3D A;  1QNT A;  1Z9C A;  3ZN0 A;  1J9I A;  4UXN A;  2V1X A;  3K1N A;  2DO7 A;  4M9X A;  3IRR A;  2M45 A;  1O3S A;  4G8X A;  5FD5 A;  2FU4 A;  2JRT A;  1BN5 A;  3KZZ A;  4RGS A;  4UNO A;  3WU1 B;  2QM3 A;  4DQ2 A;  3H3U A;  5E20 A;  1U5T C;  5L3F A;  1D8J A;  1IRG A;  1KU7 A;  3TKY A;  1SFE A;  2HKO A;  2NNY A;  2RVC A;  4WK8 F;  1BC7 C;  4IRG A;  3EQL F;  1U8R A;  3QU3 A;  2EJR A;  4I0A A;  4LLG F;  1LQ1 A;  4KMF A;  3IWF A;  2STT A;  3NQO A;  4IJA A;  2WV0 A;  1V3F A;  3GO5 A;  2O03 A;  3QP5 A;  2BGC A;  2P8T A;  1O7L A;  1FPQ A;  3CJN A;  1SMY F;  3F3X A;  3K0L A;  2L4A A;  2DBB A;  3FF5 A;  1ODD A;  2Q0O A;  1TLH B;  1U2W A;  3V7C A;  1U6G A;  3KLN A;  4OOI A;  3F22 A;  3WTV C;  3CO6 C;  1KQ8 A;  3JTG A;  3MCZ A;  3OV8 A;  4EM1 A;  4CIC A;  4RGU A;  4UHT A;  5FD6 A;  3HHH A;  3I4P A;  2PBI A;  1ZAO A;  3JAM K;  1ZRE A;  4GGG A;  3F6O A;  3BY6 A;  3KFW X;  2H6C A;  1IF1 A;  2ZBK A;  3BJA A;  2IA2 A;  3MEX A;  3PQJ A;  1HBX G;  2GA1 A;  2GAU A;  5ED4 A;  5D5W B;  2FXA A;  4KN7 X;  2DK5 A;  2XKP A;  3ECH A;  2GXG A;  3FM5 A;  3ZP5 A;  1Z1D A;  1C0W A;  1P92 A;  4Q48 A;  1OYI A;  3GFI A;  4K2E A;  3K1M A;  1SFU A;  1R58 A;  2HYG D;  5L3G A;  4OIN F;  1DUX C;  2GXB A;  2K86 A;  3CLO A;  1P6R A;  4I09 A;  4F7Z A;  3ZMS A;  3C18 A;  1WI9 A;  1LDD A;  4ESF A;  4ZZD A;  2CW0 F;  4P96 A;  2KKO A;  1H0M A;  5HOO A;  4CGZ A;  1PP8 F;  2FA5 A;  2OBP A;  4R1H A;  2IP2 A;  1WQ2 A;  3FMS A;  5DD8 A;  2DW4 A;  2FBI A;  3GYH X;  1BM9 A;  1D5V A;  2DAO A;  2EFP A;  3RJP A;  1CF7 A;  4MTE A;  1QZZ A;  2P6T A;  5TRD A;  1SAX A;  2XAH A;  1EH6 A;  1IXS B;  2W25 A;  2PI0 A;  1HXD A;  1XGO A;  2DLL A;  5CYV A;  4O5V A;  1IXR C;  3WTY C;  4N0B A;  4YFK F;  2H09 A;  1MDM B;  5F64 A;  4GYI A;  1BI1 A;  5CLS A;  2WTE A;  2HYF A;  2M8E A;  3WGI A;  1B4A A;  3FX3 A;  4IRH A;  3WTS C;  4MQ9 F;  2FOK A;  4AVP A;  3FXR A;  1BC8 C;  1KGS A;  1O57 A;  3ZN1 A;  1HW1 A;  1LNW A;  2HOE A;  1AWC A;  5D6E A;  1FX7 A;  4LLL A;  1L0O C;  4P9U A;  1XDS A;  2ESN A;  1FBU A;  3V4G A;  3GUD A;  2OU2 A;  2XHK A;  1YW8 A;  3BPV A;  2EK5 A;  2JT1 A;  5E8G A;  4U7B A;  4R79 A;  2HQR A;  1MD0 A;  3LQR A;  1FNN A;  4ZZL A;  5FLX Z;  1REP C;  3ECO A;  2OQR A;  1BI2 A;  1FC3 A;  4PGG A;  1X3U A;  2IA0 A;  2EB7 A;  4KT5 C;  1XSV A;  2NRA C;  3OOP A;  2FML A;  2EV6 A;  2FE3 A;  1W7P A;  2MA3 A;  3I0T A;  5AIQ A;  4UV8 A;  5LRR A;  3E5U A;  2YPR A;  4ETS A;  4P5O A;  3F8F A;  3KP4 A;  1H9T A;  2ELH A;  5D5X B;  4ASN A;  3F21 A;  4FX4 A;  1OPC A;  4PDK A; 
#chains in the Genus database with same CATH topology
 4XLP F;  3JW4 A;  2MC4 A;  4HYE A;  2VQG A;  9ANT A;  5E8I A;  2E1M C;  2R7V A;  1HDP A;  3SXY A;  1UAA A;  2NXN B;  4L0Y B;  3MKL A;  3OR1 C;  5HLI A;  1S72 I;  2X0L A;  2PMZ A;  1O3Q A;  1SAN A;  1Z05 A;  2F5E A;  2QGU A;  4HF1 A;  3MVP A;  3HPH A;  2QYO A;  4RDU A;  2ZJQ F;  1STZ A;  4LFU A;  3SDG A;  3T1B A;  2P4W A;  4EGY A;  5GAG J;  4L9T A;  3I53 A;  2DQR A;  3FK6 A;  1T95 A;  1YO5 C;  2XPU A;  3K1P A;  3QOD A;  3KYL A;  1R7J A;  2CQN A;  2R7R A;  3P7N A;  5JLX A;  2R92 J;  2W57 A;  2W24 A;  2EH3 A;  3LFK A;  4XRF A;  1W36 D;  3H9J A;  1UJ8 A;  3V42 A;  1FZP B;  4CYD A;  3OR2 C;  2M9H A;  2M34 A;  1POG A;  1K7A A;  3HOZ J;  1IN7 A;  5ICE A;  2ZCW A;  3BOQ A;  5J8C A;  3I59 B;  2E7W A;  1U9N A;  1FJL A;  2HQA A;  4IHX A;  1X2M A;  1I27 A;  2OZU A;  4EJW A;  2KIQ A;  1VTN C;  2L01 A;  4KMU X;  1TL8 A;  4ZTF A;  4N4N B;  3B73 A;  1ON1 A;  5HNF A;  4BAC A;  4RAZ A;  4BE2 A;  3ISP A;  5CPR B;  3BZC A;  4C3J J;  1G6N A;  3FXU A;  3A03 A;  2IS4 A;  1IV6 A;  2VUM J;  2WAE A;  4DYQ A;  2IT0 A;  2CV0 A;  1USS A;  2R7D A;  1MBE A;  3GFM A;  2IRF G;  1XD7 A;  5IT9 Z;  2LRE A;  3H35 A;  3LAJ A;  3OIQ A;  5A2Q K;  1ZGJ A;  4BY1 J;  3NWT A;  5DEQ A;  3RZD J;  1JGS A;  2LNB A;  2OZ6 A;  5HLH A;  2OAZ A;  3HKZ N;  3OS1 A;  1B1B A;  2VAS A;  4E7Z A;  4L9V A;  3LSI A;  3B6C A;  3QYF A;  4QLC U;  3L09 A;  4CZC A;  1ULY A;  3BCA A;  1JTX A;  1O3R A;  3SFI A;  5FLM J;  1U8B A;  3OYI A;  1R4N B;  2H94 A;  1R00 A;  3ERE D;  1JI8 A;  3P9C A;  5DCM A;  2M3A A;  5EEG A;  1IN4 A;  1Y0U A;  1YYV A;  3M1E A;  2DMU A;  5KVR A;  1I5Z A;  4XLF A;  3I59 A;  4EV0 A;  3F8B A;  3HXL A;  2V79 A;  2XGX A;  3OYM A;  2FSW A;  5FKM A;  2A07 F;  4M6Y A;  1IGN A;  1LE8 B;  2DDA A;  4N9H A;  4NC7 A;  1D0X A;  1G3T A;  3DKY A;  3H1C A;  2IS2 A;  3FXJ A;  1WZ2 A;  3FDY A;  4DYC A;  2LKP A;  5AON A;  3CUQ A;  1J59 A;  2JPB A;  3DXJ F;  2HPM A;  5DDG A;  2JVH A;  2QQB A;  4GFB A;  1TW3 A;  1Z7U A;  3E6B A;  4RLF A;  3K4C A;  1KU3 A;  1TNT A;  1APL C;  3BTI A;  1MJA A;  3LWF A;  3RIR A;  3ZQG A;  3CC4 I;  4X6A J;  1OMI A;  5JR3 A;  2V9K A;  3AG2 H;  4QIW N;  1R5H A;  1LJ9 A;  4XKC A;  2L7F P;  3HZJ A;  2VE8 A;  2HZD A;  3VB2 A;  5KNL A;  4UV9 A;  2PG4 A;  2DT5 A;  2XF6 A;  5J1U A;  1UZC A;  2VQC A;  3IWZ A;  1VQK I;  5ILU A;  1TC3 C;  2OTL I;  3J80 Z;  2RQP A;  1NG7 A;  1XSD A;  2W84 A;  2KRH A;  3OYC A;  3PNY A;  5DCM B;  3WTX C;  4A5N A;  1TZL A;  3A01 A;  2YR2 A;  1WJD A;  4MEY F;  1SD7 A;  4PUS A;  2XSJ C;  1VFC A;  2EIN H;  1ETY A;  3FXQ A;  5HDN A;  1HLV A;  4NB5 A;  4HG2 A;  1Z0X A;  2EZK A;  4CCO A;  2MBF A;  3A4C A;  5EJC A;  2L5Q A;  2E36 A;  3IV5 A;  4E7L A;  3RPU A;  2R5Z A;  1DP3 A;  4EM0 B;  3DTE A;  2W7N A;  3R4K A;  4D5C A;  4J19 A;  2L54 A;  1L3L A;  1KA8 A;  5DYM A;  1V5E A;  3L7W A;  4KIC A;  2R93 J;  5K1Y A;  2K5C A;  1QO0 D;  4OWR B;  3QAH A;  2XDV A;  1T08 B;  4G6Q A;  1ACI A;  2X6W A;  1WI3 A;  1XCV A;  1B6A A;  5CVU A;  2EFO A;  3J7Z I;  5HS7 A;  3RYR A;  3COA C;  2XF5 A;  2BYV E;  4HLX A;  2DA2 A;  3HGY A;  2M4K A;  2Y9Y A;  2WY7 Q;  3OIP A;  3BDD A;  1PDN C;  2XVC A;  1H9G A;  2DU9 A;  2CWE A;  2DPU A;  1CGP A;  1SD5 A;  2O7O A;  4A0Y A;  4JX5 A;  1T2K A;  2KDZ A;  2CFX A;  4D0P A;  2OC6 A;  5DUK A;  2DN0 A;  4HA8 A;  4I2O A;  2RC4 A;  4L9J A;  5FFX A;  4JYK A;  3RKQ A;  2EFQ A;  3M7G A;  4L5E A;  3CCU I;  4A6E A;  1YIJ I;  5C4X J;  1EH8 A;  4Z2Y A;  3ZQI A;  4D7M A;  2VXD A;  5EEA A;  2VXZ A;  2R7Z J;  4C30 A;  3IKT A;  1ZRD A;  4A0Z A;  1R6R A;  3CCE I;  3A02 A;  2L0K A;  5JHU A;  2JJ7 A;  2ISZ A;  4M6X A;  4AD9 A;  1BIA A;  4BHB A;  1QBJ A;  1VQ6 I;  3S16 J;  3DLA A;  4LB5 A;  1EA3 A;  5IOZ A;  2E1N A;  2XV4 S;  1EKE A;  1OIS A;  1WPK A;  3NWS A;  3HOT A;  2ESH A;  2O8X A;  3GXO A;  3GTO J;  2HTS A;  4B8X A;  4Y17 A;  3NAU A;  3U1K A;  3OIO A;  3ZMZ A;  5JVT A;  3BTL A;  4LLN A;  3BR5 A;  2FRH A;  3G1L A;  2MLG A;  3P9I A;  4L18 B;  4KT6 A;  2R7U A;  3BJO A;  1R1U A;  5DD4 A;  2VC1 A;  3HOY J;  1S5L C;  2CUE A;  2PX9 A;  3I56 I;  4PK4 A;  5D4R A;  1QZY A;  4WX9 A;  3OL4 A;  5H6R A;  3AG4 H;  4ZYG A;  3OSG A;  2ZSI B;  2NVQ J;  1ZLK A;  4YEL A;  3WTU C;  3OYG A;  2R7O A;  3FKI J;  5H20 A;  3VSK A;  4JBA A;  4UUS A;  2M1B A;  4ENM A;  1Y39 A;  3TP3 A;  2LY9 A;  2A61 A;  2FBK A;  3DBH B;  4RGX A;  2KDO A;  2CQQ A;  1J5Y A;  3FHZ A;  2KHM A;  2RDP A;  3I58 A;  2XAQ A;  4M73 A;  2QBY B;  3ZOB A;  5LGN A;  5LGT A;  2PJR A;  2X48 A;  1W7P B;  1JHH A;  3QP6 A;  5K5R A;  1YX3 A;  2JSC A;  3DPT A;  2XB5 A;  2A68 F;  5IYD J;  2K9S A;  3GZN B;  2MH9 A;  3OYH A;  3HL2 A;  5BS6 A;  4E7J A;  3VSL A;  4XOR A;  3CP2 A;  4BJT A;  3M4O J;  4M3F A;  3L9F A;  2VQH A;  3JRF A;  3HSF A;  2IEK A;  2L02 A;  3KEO A;  5CVJ A;  4D5F A;  1RUN A;  2FNA A;  1U5T B;  3K2Z A;  3BZK A;  2UZK A;  1Z67 A;  3DBR B;  5IP9 J;  3PFI A;  4EQQ A;  4AIK A;  3VYU B;  4BL0 B;  3MKZ A;  3KZI C;  4ITV A;  1MBH A;  3BG9 A;  1GXP A;  2K3P A;  1HA8 A;  3K7A J;  5M5X J;  4GXO A;  2XC7 A;  4AYB A;  1MMG A;  1JUS A;  2DI3 A;  2EIJ H;  2E5N A;  1K78 A;  4W1U A;  4MTD A;  3G4S I;  2OUM A;  2NNN A;  1Z7L A;  1PYV A;  1S8N A;  3WG7 H;  1D0Y A;  3PSF A;  2R7S A;  1EF4 A;  3DF8 A;  1RNL A;  2W85 A;  3QQA A;  3OYL A;  4IX7 A;  1RKT A;  2ZXH A;  1RKW A;  5KK1 A;  4C2T A;  4KUM A;  3W6J B;  1MH3 A;  2GOX B;  3CUQ B;  1FYM A;  5HDG A;  1X2N A;  2DOA A;  2BY0 A;  2IAI A;  3H3V K;  2Z33 A;  2HOS A;  1G3W A;  3ABU A;  1JKO C;  2CGP A;  2ZME C;  1H88 C;  2RNG A;  4HSR A;  2Y30 A;  4C2U A;  3FXO A;  2P5K A;  3JCU C;  1F4K A;  1MW7 A;  2FQ4 A;  3V7S A;  2AS5 F;  1P4W A;  1T56 A;  1UST A;  4XKW A;  2QEN A;  2O61 A;  2CO5 A;  1KZH A;  1BR2 A;  5A2Q Z;  3CJQ B;  3OYN A;  5EG0 A;  4G94 A;  4A69 C;  2LD5 A;  2PMU A;  2Q2E B;  4MFD A;  4YRV A;  4ZC3 A;  1QPM A;  2ISY A;  1TT0 A;  1U5T A;  3W2W A;  1WJF A;  3E0J B;  3WHC A;  2Y0S N;  2MAB A;  4HAM A;  3QU6 A;  2CUJ A;  2E7X A;  3D0S A;  2GIV A;  1YQA A;  1DPR A;  4RAF A;  2LP0 A;  3S2D J;  2A3S A;  4WWC A;  4L9N A;  4A12 A;  3CJT B;  5LD2 C;  3DWL E;  1OCC H;  1ZRF A;  4ZYE A;  4FE7 A;  4RA2 A;  3F6V A;  2QEX I;  1BL0 A;  1Y8Q B;  2VJ5 A;  3JRI A;  3R61 A;  2ICW G;  4UUS B;  1IO2 A;  4AVZ A;  2Y0M A;  4I6Z A;  1YS7 A;  4AUX A;  3BLY A;  2QBY A;  4BYY A;  2UWM A;  5M5W J;  2JWT A;  4EMS A;  3ZQH A;  1I1G A;  3GBG A;  4WCG A;  1KYZ A;  1HKT A;  4YIR X;  3QWL A;  4J01 A;  3CC7 I;  1SMT A;  2HOA A;  1X1A A;  5HOD A;  3HOX J;  1OKR A;  5LRS A;  3W2V A;  2Z99 A;  3DKW A;  3D5R C;  4XL9 A;  1N78 A;  2BY1 A;  5D4S A;  1VQ9 I;  3AG3 H;  2FQ3 A;  3GFL A;  3GFJ A;  3PNT A;  3QOE A;  4FE4 A;  2W82 A;  1K79 A;  2P5V A;  4X1E A;  4HNT A;  2M7A A;  1VQ4 I;  1TW2 A;  5HS8 A;  2FEZ A;  2LTP A;  1FTT A;  2EIL H;  1FP2 A;  3R6S A;  2QF7 A;  3K4K A;  3VFZ A;  5KAF C;  3H9Q A;  3ESW B;  2V26 A;  4O6J A;  4EJU A;  1FOK A;  3P9K A;  3S3N A;  5FLX K;  3JRD A;  1E0E A;  2DOE A;  3K4J A;  4GRI A;  1H89 C;  1BJZ A;  4GCV A;  1T6S A;  1SVO A;  3G2B A;  1T33 A;  5HS9 A;  1A5J A;  3CP8 A;  4ESB A;  3LSJ A;  5CQG A;  5F1J A;  2EZI A;  4KIB A;  3R0J A;  3UNG C;  2Z1D A;  4A3E J;  2HQ5 A;  4G6T B;  3A2K A;  4G7Z F;  2Z2S B;  2HZT A;  3SQN A;  1S6L A;  3M8E A;  4FTH A;  3ZQL A;  3OL3 A;  1JJ6 C;  1R36 A;  2CG4 A;  1UG0 A;  2VKH A;  1W5C C;  3HG9 A;  3L2Q A;  2M7B A;  1P7J A;  2BHZ A;  2RV8 A;  3M9A A;  1Z6R A;  1YJN I;  1HKQ A;  3GEZ A;  1MSF C;  2L9V A;  2K9L A;  3RKX A;  2M87 A;  3WGG A;  4ENK A;  3MMY B;  1S3J A;  3P5J A;  3LSM A;  3GTG J;  4TV7 A;  1BOA A;  2LBF A;  3JRH A;  1HC8 A;  1KU9 A;  1SD4 A;  1ZYR F;  1SD6 A;  2ZFW A;  1ETX A;  2AXL A;  2EFN A;  4M74 A;  3TW7 A;  3WTW C;  4RS8 A;  2MLK A;  4EJT A;  2D45 A;  2HR3 A;  1IXC A;  1D1A A;  2RGV A;  2ZJ2 A;  1MZB A;  4Y3O A;  3L2W A;  4BUP A;  4Y13 A;  3I4M J;  5C4J J;  4HPQ A;  3REO A;  2VJI A;  3RYP A;  1U78 A;  2XRO A;  2BXZ A;  4CCN A;  2KIM A;  4HQM A;  4Q4Z F;  3I3L A;  3ZQQ A;  2X1E A;  1XS9 A;  2I5U A;  4CCM A;  3S15 J;  2OCC H;  3QYE A;  3PO2 J;  1VF9 A;  2A69 F;  3CUO A;  3DEU A;  3OYA A;  3ZMV A;  4XKB A;  4YII A;  4PJ0 C;  1AOY A;  2BBY A;  3KYC B;  4L5J A;  1GV2 A;  3TP0 A;  3UKG A;  4HEA 2;  4XQF A;  4A3L J;  1ZKG A;  2QZ8 A;  3C2B A;  5E3N A;  1VQP I;  4E70 A;  2K9Q A;  2WAQ N;  2QQA A;  3IKV A;  3T8R A;  3IRQ A;  1W0U A;  5GPC A;  2EFW A;  2H8W A;  2XRN A;  4G7H F;  5DCF A;  2HWV A;  1UHM A;  4DOZ A;  2XAU A;  1MBK A;  3DEW A;  2L9S A;  2CH0 A;  4B48 A;  2CMP A;  4HOB A;  4KIT B;  2VJ4 A;  5IY5 H;  3HOW J;  4IZZ A;  3MZH A;  3W6K B;  4CDG A;  1Z91 A;  3BG7 A;  3OY9 A;  1R5I D;  2K3F A;  1I6H J;  1R22 A;  2LYC A;  4RM2 A;  4YFX F;  3ZR8 X;  3SFZ A;  1JUP A;  1XTA A;  2BVL A;  3O3K A;  1G4D A;  3BR6 A;  2F5C A;  3WE3 A;  1O4X A;  3K6G A;  3TOA A;  1OFC X;  2H1K A;  4HF2 A;  4XN3 A;  1ETK A;  2QA4 I;  3VPR A;  2R3S A;  3K10 A;  1WJ5 A;  5M5Y J;  5ILS A;  3F72 A;  3UR3 C;  3T0Y A;  2DFF A;  2YS9 A;  1ZGA A;  4G9Y A;  4KIF A;  4HNU A;  3OS0 A;  2C6Y A;  3KET A;  3D5S C;  3ML6 A;  1Q1H A;  1BR4 A;  4LB6 B;  4EJO A;  2KL4 A;  3GZ6 A;  2FUG 2;  5F27 A;  3C3W A;  3GTK J;  2Q2E A;  5J6X A;  1YLF A;  2QSG X;  3TOB A;  3L2U A;  3CTA A;  5D5U B;  2V1D A;  2PJP A;  5FLV A;  2TRT A;  1XMK A;  2OV7 A;  2XB0 X;  1HOM A;  1DQU A;  4DBQ A;  2W48 A;  4IQJ A;  1BR1 A;  2IGK A;  4ZH4 F;  1PUF B;  4UUV A;  1FOW A;  1KYW A;  3SZT A;  3OWT A;  3CD6 I;  1PP7 U;  3WE2 A;  3TO7 A;  2DDB A;  2L7K A;  4HZF A;  3M3Y J;  3QYB A;  5B1A H;  3BQZ A;  2VC0 A;  2WWY A;  1NHA A;  3PUB A;  4EM2 A;  1I50 J;  1FOY A;  2JRM A;  2HXI A;  4HDV A;  4YFN F;  4U7D A;  2XPV A;  4I98 B;  4HX7 A;  1YE9 A;  4HF0 A;  5K7F A;  1RUO A;  2PLY A;  3JSP A;  1SEU A;  5HLG A;  1W4M A;  2F5F A;  1AKH B;  2CYY A;  3E5X A;  3HRU A;  2DMT A;  2F5V A;  5ICC A;  4WXC A;  2B7E A;  3L2R A;  5ILV A;  2F4O B;  1FIP A;  2BXY A;  2LF7 A;  3C2H A;  4N4O B;  2NS7 A;  4ZJZ A;  1T38 A;  2GWR A;  2WY8 Q;  4XM3 A;  3CCV I;  1X1B A;  2GLO A;  3S14 J;  5TJJ A;  2NVT J;  2DMN A;  5F0H A;  4HQE A;  2OJE D;  4RBO A;  3SZP A;  1XGN A;  2W00 A;  1V4R A;  3HBL A;  5JFR A;  3SZG A;  5LBQ A;  3S2H J;  2ECB A;  3R0A A;  4XSX F;  1HKS A;  1K6O A;  1S9H A;  2H27 A;  3KEY A;  4FT8 A;  2O8K A;  4PGH A;  5HDK A;  2LK2 A;  2UUZ A;  2FMY A;  3KIO A;  3JRB A;  5LGU A;  2JQ7 A;  1Y6I A;  2DOD A;  5JVG F;  2XIG A;  5KAI C;  5LHI A;  1SFX A;  3E6D A;  2M8G X;  3AL0 C;  1MJ9 A;  3HM5 A;  2DFI A;  2PQ8 A;  3MD2 A;  2V6E A;  2DT7 B;  1VQN I;  4FX0 A;  3ASN H;  1FIA A;  3BZ6 A;  1S7O A;  3GZ5 A;  2HQN A;  5E3M A;  3H5N A;  4A6D A;  4M71 A;  4I01 A;  1EJ9 A;  1ON2 A;  1GHC A;  1X4O A;  1XN7 A;  4PFP A;  5DM7 F;  3C1D A;  2LBF B;  2E2I J;  3F8M A;  5FRN A;  4I0B A;  4IHY A;  1Z3Y A;  3CF2 A;  1TTY A;  4BXX J;  2F5D A;  2KP6 A;  3R60 A;  4IPA A;  2R7X A;  2I10 A;  2CQK A;  3GTP J;  2VBY A;  2PFB A;  1VQ8 I;  3S1R J;  1RC9 A;  2IGN A;  3Q0U A;  1MSE C;  3ULQ B;  2RNJ A;  4HLY A;  2CUZ A;  5J3L A;  4XMY A;  4FET A;  2ZXJ A;  5EEH A;  1JXS A;  2AQE A;  3HUG A;  1P7I A;  4CSW A;  3S2W A;  1FOX A;  1TWF J;  3V8J A;  2BEO A;  3WTZ A;  1A6I A;  2O6G E;  2G7H A;  3FIW A;  2QWW A;  1TBX A;  3IH3 A;  3BT9 A;  3TBI A;  3J7A Y;  4A3C J;  4RMN A;  2DXI A;  3B6A A;  1YOV B;  4PSX A;  1JGG A;  3W6V A;  2HGC A;  3Q0W A;  5BNG A;  3I71 A;  4BU2 A;  4OIR F;  1OJL A;  2GBY A;  5J1Y A;  2D5V A;  4IRI A;  2DQL A;  4XLN F;  2OCE A;  1B72 A;  2ZXI A;  3I54 A;  2VBW A;  2ME6 A;  4NBQ A;  2QQ9 A;  1TQI A;  3GLX A;  4IEJ A;  3W2A A;  1W5S A;  4HX4 A;  1P4A A;  2ZB9 A;  4E7H A;  2LH9 A;  2Z16 A;  5H2F C;  4BXF A;  5IP7 J;  2MD5 A;  3L2C A;  1RPW A;  3FZV A;  2LC2 A;  3K4M A;  4I7H A;  2ZJR F;  1O7F A;  4PZJ A;  2EQR A;  1EV7 A;  3K70 C;  2V4J C;  1V55 H;  1BBY A;  1BW5 A;  3IUO A;  3DQV C;  3E1S A;  2K9N A;  2DTR A;  5DV5 A;  3ZQF A;  1PUF A;  3H9G A;  1IZ1 A;  2M4G A;  1JHF A;  4OU0 A;  4A3I J;  2R0Q C;  3RPQ A;  2D1V A;  1YX5 A;  5ERI A;  1Y56 A;  2A6T A;  1JTY A;  5GAH J;  1G8X A;  2NOJ B;  4HDU A;  1N77 A;  2B63 J;  1HCR A;  4BEH B;  4H0E A;  3BPX A;  4NC8 A;  2YU3 A;  3O8G A;  3EET A;  1OR7 C;  1ZN2 A;  5CJ9 A;  1T8I A;  1JKR C;  3PO3 J;  1DGW Y;  2A6E F;  1XDU A;  4BE0 A;  5C3E J;  2ZJP F;  4A3B J;  2K40 A;  4CHU A;  4IVN A;  3TGN A;  3WU0 A;  3S1Q J;  1IAW A;  2VT3 A;  3I55 I;  5KCM A;  2CW7 A;  2B0L A;  1D3Y A;  3ZMT A;  2VJJ A;  2O9L A;  4B4C A;  2HFH A;  3DCF A;  4JOM A;  1K4S A;  1TT5 B;  2M0C A;  1ZAR A;  2J5O A;  3V7R A;  2E19 A;  2X4H A;  3JRE A;  2BW3 B;  4HV6 A;  3QOP A;  1YRN B;  4A3D J;  1IN5 A;  2E2H J;  3ZPL A;  1V54 H;  4CYC B;  1VQ5 I;  4A0X A;  2AXT C;  3MAJ A;  3H92 A;  4L5I A;  3FBI B;  3CMA I;  1TWH J;  3BCB A;  2WC2 A;  1Z6T A;  2Z9O A;  3LSP A;  3F23 A;  4PJM A;  1IUY A;  3O8H A;  3B02 A;  2XUB A;  2ACJ A;  2R5Y B;  1MGT A;  2UXX A;  1JT6 A;  4CUG A;  2EIM H;  2MC3 A;  2XGD A;  3ABK H;  4Q47 A;  5E3L A;  3OS2 A;  5J4V A;  3HGG A;  1S7E A;  4Y52 J;  2FBH A;  1ZK8 A;  1UMQ A;  2EA2 A;  1WCM J;  1W7P D;  2DFH A;  3KP2 A;  3MKW B;  4MLO A;  2K85 A;  2CFO A;  1W5T A;  2IJL A;  2X6O A;  5IT3 A;  3F9K A;  3FKJ A;  1OYY A;  4BNC A;  2VOO A;  1OCZ H;  2OD5 A;  2COB A;  3WHB A;  4CO8 A;  1FP1 D;  3CF5 F;  1BIB A;  4CXF A;  4U0Y A;  4A93 J;  2A6H F;  3GTM J;  5ICF A;  4GDF A;  5F08 A;  3JSO A;  2K02 A;  5BOX A;  1AKH A;  3LSK A;  2KIF A;  2HTJ A;  2WAF A;  1LEA A;  2Y48 A;  1YW7 A;  3DPL C;  4Y15 A;  1FTZ A;  4EVI A;  5HLT A;  5EGO B;  2ZKZ A;  4ZYH A;  1QQI A;  1YFH A;  1OYW A;  3FM3 A;  2ZC2 A;  3BR3 A;  5H6Q A;  4BBR J;  4BHC A;  1LEB A;  3HRT A;  1F43 A;  2XSD C;  2EZH A;  2DTZ A;  5K7H A;  1WH7 A;  2VOP A;  1P4X A;  1XC5 A;  2XAG A;  1XGS A;  4PJN A;  2VKE A;  5J47 A;  4D9J A;  4IOA F;  5GPA A;  3KP7 A;  2EV0 A;  3FMQ A;  1AHD P;  1T0F C;  3PL8 A;  4ZYD A;  1R1V A;  3M1C A;  5D5V B;  3OMY A;  2O0Y A;  1IN6 A;  1BI0 A;  1ZG5 A;  1B9N A;  2IS6 A;  4KYW A;  1Y1W J;  1WJC A;  1QZE A;  2E1M B;  5L3C A;  4A3M J;  4E6K G;  5BQT A;  3CC2 I;  2P6S A;  2YU9 J;  1YTY A;  1IN8 A;  4EEF G;  3EUA A;  2ZNZ A;  2R4G A;  4NDL A;  4P1W A;  1IRX A;  4W97 A;  1QGP A;  3EYI A;  2RQQ A;  2FF4 A;  2IVM A;  5BMZ A;  4IHS A;  3KPH A;  3J81 K;  3I4N J;  1WFX A;  3HSR A;  1CF7 B;  4A5M A;  1ETW A;  3DFG A;  3HOS A;  2Z3Y A;  3AAF A;  4CCK A;  4EJV A;  3KP3 A;  5FB2 A;  4S05 A;  1WVR A;  1BOB A;  2O5R A;  3MN2 A;  4UVC A;  1MMS A;  2KRF A;  1ORK A;  1SAU A;  3Q3S A;  5K7Z A;  3RKW A;  3LSR A;  3CLQ A;  1PVE A;  3IAS 2;  1UCR A;  2VE9 A;  3TED A;  2RN7 A;  4RB1 A;  3HKZ A;  3FXL A;  1XCB A;  5E18 F;  3WGH A;  1MBF A;  2ECC A;  3FBN B;  5J40 A;  2DA7 A;  2P7C B;  2LKS A;  1SVL A;  4C3I J;  2JA7 J;  2LDU A;  2VPR A;  4OMY A;  3HPG A;  4X0G A;  3IL2 A;  3BWG A;  3VOE A;  1WHU A;  1MJB A;  5IYB J;  1FSH A;  1OCT C;  4BQQ A;  2CQX A;  2P81 A;  4U0V A;  4OIQ F;  1RZ4 A;  1IV8 A;  1N25 A;  2A05 A;  2O3F A;  2IPQ X;  1NK3 P;  4JK1 X;  5FKO A;  3G3Z A;  2K9M A;  4FIS A;  2LY1 A;  1QA6 A;  3RZO J;  5TGT A;  1E17 A;  4QPO A;  2P7V B;  1RR7 A;  3CUQ C;  2VT2 A;  1OR7 A;  4C2M J;  2V7F A;  3J7Y J;  3VEP A;  2NS8 A;  1MKM A;  3L2V A;  4PJL A;  1YG2 A;  1ZEL A;  1I1S A;  5B66 C;  5BPI A;  2YUS A;  5B1B H;  3EYY A;  5J8F A;  1R49 A;  4DZJ A;  2DMQ A;  1BA5 A;  5F6F A;  3TDZ C;  2G9W A;  4CZZ A;  4I02 A;  2BY2 A;  3KCC A;  5IPA A;  2KIU A;  1K83 J;  3IC7 A;  5E17 F;  2AO9 A;  3EUH C;  4AM3 A;  1GLN A;  1LVA A;  4XON A;  2JPC A;  1ETQ A;  4LJZ F;  4AIJ A;  5F0F A;  3ROU A;  5D8L B;  1KQ0 A;  5J1R A;  3K9T A;  3PNV A;  2AHQ A;  2GZW A;  1U0J A;  4BDZ A;  1XGM A;  2IGO A;  1F36 A;  3H3Z A;  3A1Y A;  4YIF A;  3ERM A;  2PEX A;  1QVU A;  2Y75 A;  2KZG A;  2KJC A;  3LQQ A;  3KP6 A;  2JN6 A;  3HDD A;  4IQ4 A;  2K27 A;  4JP0 A;  2GXA A;  1E3O C;  1YHQ I;  4KIG A;  3OYB A;  4RB3 C;  5DUI A;  5K5O A;  4S04 A;  3J7A O;  2RKH A;  2DOF A;  1Y8R B;  1D8K A;  2VPL A;  2G7U A;  2NAZ A;  1ZLJ A;  3DU5 A;  5ICG A;  4HBL A;  5E3O A;  4AIH A;  2DYR H;  4M9S A;  4DGW B;  3HTU A;  3WG9 A;  2E2J J;  3BRO A;  1TQP A;  2ELK A;  1A35 A;  1DPU A;  3IHU A;  3H0D A;  3K70 D;  3K69 A;  3ELK A;  2X1C A;  1UHS A;  2H1L A;  3VDX A;  2ETH A;  2X1D A;  3LOC A;  5GAE J;  3PQK A;  3OOU A;  4LOC A;  5D8K B;  2GA2 A;  2X85 A;  2J5P A;  3ABM H;  3DLL F;  1R5G A;  3CME I;  2JZY A;  1X3Z B;  2XAF A;  5D6F A;  3ZQC A;  2G0E A;  2XGE A;  3HUG B;  5EF6 A;  1J75 A;  3ZMU A;  2KFD A;  2CJJ A;  1VQL I;  1N75 A;  3QPH A;  1F1Z A;  3CCY A;  5LEJ A;  1LDJ A;  2MYS A;  3RKY A;  2Z5U A;  3HOU J;  2VOD A;  3A0B C;  1ZR2 A;  4BAY A;  3JRA A;  3HRS A;  3OYK A;  2YX4 A;  4KFC A;  1S7A A;  3LA3 A;  4JQF A;  4XNF A;  1FEX A;  4BS9 A;  3U2R A;  1X58 A;  4XLA A;  3FXM A;  4C3H J;  4O3M A;  4DYR A;  2ZME A;  2MSY A;  3N05 A;  5E1X A;  1G2H A;  1FBQ A;  1XX5 A;  4KDP A;  1ENH A;  1QHH D;  2JA8 J;  4A3F J;  2NS0 A;  1S29 A;  2F6C A;  2Y2Z A;  2LF8 A;  4UB8 C;  4ENJ A;  1IRF A;  3S1N J;  2L7Z A;  3C7J A;  3I9V 2;  2H8R A;  4F3Q A;  1WKM A;  2DFE A;  2D1H A;  4CH7 A;  2E71 A;  1XMX A;  4UVA A;  2M30 A;  2P5L C;  4HX8 A;  3MWM A;  5M3M J;  4BQA A;  3MQ0 A;  1F5T A;  2MFZ A;  5B5E C;  4G12 A;  3M8J A;  1A04 A;  5HVQ C;  4XID A;  1MH4 A;  4LD5 A;  3N4M A;  4A3G J;  3NRV A;  2F48 A;  3TDU C;  1TNS A;  3LSH A;  1I3Q J;  1UFM A;  5LEK A;  4E7S A;  1YW9 A;  4Y7N J;  3G1O A;  2R7T A;  2VBX A;  2R7F A;  1XPX A;  2JVG A;  2VON A;  2E1O A;  1UEL B;  1MBG A;  3BG6 A;  2JMW A;  4XBF A;  5C44 J;  5LLQ A;  3TO6 A;  2JA2 A;  4OIO F;  2CUF A;  1RIO H;  3GTJ J;  3BR2 A;  1FT9 A;  2KIS A;  5CVI A;  2BE5 F;  2R5Z B;  3LA7 A;  2LFB A;  3E3V A;  3SYT A;  1O3T A;  3ZMD A;  3RSN A;  4XOT A;  1MMA A;  3D1N I;  4XRS G;  1I6X A;  4MGR A;  1K6Y A;  4MNU A;  3DTI A;  5IP6 A;  1WJA A;  1FYK A;  4G7O F;  3CJR B;  1MNE A;  4ON0 A;  5LHG A;  2QKM B;  3EUK L;  4DBR A;  1H8A C;  4GO1 A;  1LB2 A;  3DV8 A;  4WXD A;  3E97 A;  4HV5 A;  1DDN A;  1XG1 A;  2NVY J;  2ZFU A;  2JUC A;  2L2O A;  4JX6 A;  3CZ6 A;  4L0Z B;  3CDL A;  3X2Q H;  1UHW A;  4AC0 A;  4BH9 A;  3ONQ A;  2QCO A;  5JHF A;  2KZV A;  1PJR A;  1WWX A;  2E1C A;  1NK2 P;  2K4B A;  2VLA A;  4P55 A;  3CDH A;  1KQ9 A;  3RPU D;  2BY3 A;  1BI3 A;  3E6C C;  3JTH A;  3CCS I;  1G3S A;  5E1Z B;  3NEU A;  1QPI A;  3ABL H;  4CCL A;  2HI3 A;  3PIO F;  1NG6 A;  3MKY B;  5CQE A;  1BJA A;  2ME0 A;  4E7K A;  3HSE A;  2MW8 A;  1YIO A;  5L3E A;  3ZGK A;  2BOL A;  1JE8 A;  2IGM A;  3JAM Z;  5FFZ A;  3KX2 A;  4ZDL A;  1J0R A;  2QVO A;  1LDK B;  3E6M A;  3FMR A;  1RRJ A;  4UUT A;  5DS9 A;  2K4J A;  4KA4 A;  2HEO A;  2V6C A;  4XLE A;  2P0W A;  4KNY A;  2V1U A;  3F8N A;  3FHN A;  2WB1 N;  3V8K A;  3EDP A;  3D5L A;  2GOM A;  4AYB N;  3IAM 2;  4C9Y A;  2HOT A;  2I8D A;  4LGW A;  4ANJ A;  3HIF A;  1AA7 A;  3GWZ A;  3I64 A;  3KZY A;  4LK0 F;  5IYC J;  2LG4 A;  4B43 A;  4UVB A;  4F52 A;  2HNH A;  2DK8 A;  2IW5 A;  3LA2 A;  4NHJ A;  1ZH5 A;  2OTJ I;  1IUF A;  1B8I A;  2BV6 A;  1R1T A;  2DJN A;  4AWX B;  4Q5S F;  1W0T A;  2BHY A;  3CCR I;  2H6B A;  4B3X A;  4B09 A;  3ZQ7 A;  4ENN A;  1HSJ A;  5FO5 A;  3RQ4 A;  4E4H A;  4A3K J;  2V9P A;  3RDI A;  3CQZ J;  3HRM A;  2XGC A;  4OAZ A;  4HRI A;  1ZRC A;  1FMW A;  2M2E A;  1LUJ B;  5GP9 A;  1YJW I;  4IHT A;  4QWQ A;  3O6B B;  5GAD J;  1QVT A;  1GXQ A;  4RB2 C;  1KU2 A;  1T0F A;  1P2F A;  3DKX A;  1TQM A;  1FSE A;  2OPT A;  2Q1Z B;  2VB6 A;  3WOD F;  2M5W A;  1J2X A;  4XRM A;  3T5X A;  2COM A;  2FJ1 A;  1IRZ A;  4DNC A;  2ELJ A;  3ZRG A;  3KEQ A;  1IG7 A;  3LSG A;  4U0W A;  1EH7 A;  2CQ7 A;  2CU7 A;  1HW5 A;  3GW2 A;  2Y0S A;  2DMP A;  3SEQ A;  1B72 B;  4NQW A;  1XMA A;  5LFA A;  3DP7 A;  2F2E A;  3ZXS A;  2K7L A;  3RI4 A;  4F92 B;  5EDN A;  1HST A;  4A3J J;  2OA4 A;  3FWE A;  1I3A A;  2KQR A;  1OCP A;  2KPM A;  2WAQ A;  4ZYA A;  3GF2 A;  5CVR A;  1XB4 A;  3SHF A;  1RR8 C;  5JI6 A;  1LPQ A;  4LG0 B;  4RGR A;  2LSO A;  2VL8 A;  5FGM A;  4HW0 A;  4BJ6 C;  4BXU A;  5M3F J;  2ID6 A;  2ZNY A;  3PFY A;  3S1M J;  2WA0 A;  2DA1 A;  2XAS A;  4RAG A;  1AU7 A;  4UB6 C;  2HKX A;  4BHP A;  2LRD A;  3U1D A;  1SVM A;  3TO9 A;  2DA4 A;  3GX4 X;  5FRM A;  3I5U A;  3L00 A;  1ZG3 A;  2DPD A;  4RB0 A;  1HW2 A;  3ABT A;  4XN0 A;  2HS5 A;  2ZXW H;  1TP4 A;  3MFK A;  1ERD A;  1WRJ A;  2VIX A;  1TWG J;  2EA4 A;  3S3M A;  1X1P A;  5CVV A;  1J7K A;  5LHH A;  2LMD A;  3TQN A;  1U3E M;  5EZG A;  4I99 C;  3J80 K;  4FCY A;  1SFK A;  2ZME B;  2UXN A;  4M6V A;  4RAY A;  3KE2 A;  5F0C A;  2ADU A;  5BPD A;  3BQY A;  3H0G J;  4RLQ A;  2IA1 A;  3VOD A;  1FLI A;  2ID3 A;  3J81 Z;  2PN6 A;  4FQG A;  1K61 A;  2DA6 A;  4M9Z A;  4G6D A;  4LMY A;  1P9Q C;  1E2X A;  1E3H A;  5AIP A;  1ZGW A;  1GVJ A;  3S8P A;  1ETV A;  1B8I B;  3O2P E;  2ZSH B;  2GQQ A;  1V5G A;  3Q5F A;  2QKL B;  1R23 A;  2L4M A;  3G73 A;  2FX0 A;  4KN4 X;  4OMZ A;  1WGX A;  2VBZ A;  2TDX A;  2R5Y A;  4N9I A;  4GYG A;  2JTV A;  2STW A;  2NYX A;  3IP4 B;  3SJM A;  1FMV A;  3EUH A;  2V9V A;  3RTR A;  1T39 A;  1ZR4 A;  3VWB A;  5B3S H;  4BBS J;  3CO7 C;  2OQG A;  3ZCO A;  2NVU B;  3BJ6 A;  1ONV A;  2XAJ A;  2QQ8 A;  3MZY A;  2F4M B;  3DEE A;  3VYR B;  1RI7 A;  2D2W A;  1DP7 P;  2YSR A;  4HST A;  4XR6 A;  4WXH A;  1GVD A;  1WSU A;  4IF4 A;  1XSX A;  1ZG1 A;  1R71 A;  5L3B A;  2XKO A;  3KLO A;  3Q9S A;  3E5Q A;  4P9F A;  2WB1 A;  4NUB A;  2LR8 A;  3M8F A;  1R9T J;  3H36 A;  1E3P A;  1KON A;  6PAX A;  2MH2 A;  4NC6 A;  3CCQ I;  3N97 A;  1LFB A;  2CSO A;  4MHG A;  5GTH C;  3BG5 A;  4RM3 A;  2TCT A;  2WBM A;  1T98 A;  4B1R A;  4OIP F;  1FY7 A;  4MQV A;  4D1Q A;  3SEZ A;  4B3A A;  2E35 A;  3DU6 A;  3AG1 H;  5IT9 K;  4LG0 A;  1HQC A;  1IDY A;  2L9R A;  1MBJ A;  3F8C A;  3QRF F;  2KJB A;  4Y33 A;  3HHG A;  2WAD A;  2QLZ A;  4Z6Y A;  3TMO A;  3BR0 A;  2EPF A;  3LAP A;  4B47 A;  3OSF A;  5EGO A;  4D7N A;  3GTQ J;  4LG3 A;  1JKQ C;  5K5Q A;  3Q9V A;  1YI2 I;  4BQO A;  1Y1V J;  4ESJ A;  3V8L A;  1VQO I;  3KP5 A;  3CCM I;  4R8H A;  1IW7 F;  3U9G A;  2Q8K A;  2EBI A;  3LST A;  5F1R A;  3GTL J;  3LL7 A;  3JR9 A;  3BR1 A;  1YS6 A;  1B9M A;  2QUF A;  3GVA A;  4M3E A;  4M3G A;  4PFO A;  4A2U A;  3QPL A;  1GUU A;  2VN2 A;  3HC7 A;  3HYI A;  2PMH A;  2FNP A;  3VYS B;  2HDC A;  1JT0 A;  3AFH A;  3QPT A;  4PCQ A;  1FBS A;  4XRS A;  4Y4R A;  2ZO4 A;  4YG2 F;  1UG2 A;  3T8T A;  1PUE E;  1UB9 A;  3BP8 A;  2JSP A;  5CKT A;  5E1W A;  2A5Y B;  2HYJ A;  1DGR M;  2HDW A;  5L3D A;  5EYR A;  3OYE A;  3RCO A;  1MIJ A;  1MDM A;  5DM6 F;  3K4N A;  4MEX F;  3OYF A;  4U88 A;  4IXA A;  1ZHF A;  3F0C A;  3PM1 A;  1QRY A;  5HNH A;  4XSZ F;  2F4I A;  1DU0 A;  2VKD A;  1B59 A;  2EV5 A;  4LK1 F;  4FHT A;  3CMY A;  4EGZ A;  4M72 A;  1YJ9 I;  1K78 B;  4CYC A;  3LFU A;  2DA3 A;  2IBD A;  2BW3 A;  2YX7 A;  5DTD A;  1F9N A;  1JJ8 C;  3IH4 A;  1MND A;  1G3Y A;  2VKV A;  3WTT C;  2AQF A;  1LFP A;  2CW8 A;  5EZH A;  1FWZ A;  3HTS B;  1GDT A;  1W36 C;  4WF2 A;  1FYL A;  2LKX A;  2EWN A;  2IXS A;  2BZT A;  3FIS A;  2L3D A;  1QNT A;  1Z9C A;  3M07 A;  3G6E I;  3ZN0 A;  1J9I A;  4BY7 J;  1X1C A;  3QPS A;  4YEJ A;  4UXN A;  2V1X A;  2HXO A;  1W1W E;  2DA5 A;  3K1N A;  2L7M P;  3VYT B;  2DO7 A;  4M9X A;  3IRR A;  4ZDO A;  1SFO J;  4B44 A;  2M45 A;  1MMN A;  4M3D A;  1O3S A;  1IC8 A;  2QSF X;  5E79 C;  2L9N A;  4M3B A;  4G8X A;  3IH2 A;  1X4P A;  2X6X A;  5FD5 A;  2FU4 A;  2JRT A;  3K4B A;  3LMM A;  1BN5 A;  2VI6 A;  3DPU A;  3KZZ A;  4RGS A;  2IS1 A;  1X3W B;  4UNO A;  3WU1 B;  1TWC J;  2QM3 A;  3CCL I;  4DQ2 A;  3S17 J;  4V19 K;  3H3U A;  4E7I A;  4KJZ A;  5E20 A;  1U5T C;  5FKN A;  3TL4 X;  5L3F A;  1D8J A;  2LLK A;  2DCE A;  5KHD A;  2CV1 A;  1KU7 A;  1IRG A;  3TKY A;  1SFE A;  2HKO A;  2NNY A;  2XPW A;  2RVC A;  3K4L A;  2JA5 J;  4WK8 F;  2XF7 A;  3ASO H;  3C2G A;  1JKP C;  1BC7 C;  4IRG A;  3E7L A;  3EQL F;  1U8R A;  2CS3 A;  2W1O A;  1D0Z A;  3QU3 A;  4QTR A;  2EJR A;  4I0A A;  4LLG F;  2X6Y A;  1LQ1 A;  3IWF A;  4KMF A;  1VQ7 I;  2STT A;  1A36 A;  3NQO A;  3HB9 A;  4IJA A;  1GV5 A;  4KIS A;  2WV0 A;  3EPZ A;  3BG3 A;  1V3F A;  3GO5 A;  4IHW A;  2RRE A;  2O03 A;  3QP5 A;  1K4T A;  3A0H C;  4V2G A;  1VQM I;  2BGC A;  3H5R A;  2P8T A;  4BE1 A;  1O7L A;  3JRG A;  4IOC F;  2OF7 A;  2HU9 A;  4DZP A;  1FPQ A;  3OYD A;  3CJN A;  3F3X A;  1SMY F;  4PJJ A;  2N8G A;  3BTJ A;  3K0L A;  2L4A A;  5FKK A;  2BVM A;  2JK3 A;  2DBB A;  3FF5 A;  1ODD A;  4MFE A;  2Q0O A;  1U2W A;  1TLH B;  1D1C A;  1Z21 A;  3V7C A;  4I76 A;  3WU2 C;  1U6G A;  3Q0V A;  3KLN A;  4OOI A;  3F22 A;  2JUG A;  3K2A A;  3WTV C;  3DBL B;  2KRC A;  3DTK A;  3CDI A;  2EIK H;  3CO6 C;  1M1E B;  5IOY A;  4QSH A;  1KQ8 A;  3H5A A;  3PSI A;  1WH5 A;  3JTG A;  1Y0N A;  3MCZ A;  3OV8 A;  4EM1 A;  4CIC A;  4RGU A;  4UHT A;  4J00 A;  5FD6 A;  3HHH A;  4OAY A;  2Y69 H;  4DJA A;  4CA0 A;  3I4P A;  1IJW C;  1Z77 A;  2DYS H;  2PBI A;  2R7Q A;  2CV2 A;  1QU3 A;  1G59 A;  1ZAO A;  3JAM K;  2V1N A;  4GGG A;  1ZRE A;  2LY2 A;  3F6O A;  3HEF A;  3BY6 A;  3SDB A;  2R7W A;  4MO7 A;  2KMU A;  3KFW X;  2H6C A;  1RES A;  1SC7 A;  4BEH A;  1IF1 A;  2ZBK A;  3BJA A;  1D5Y A;  2IA2 A;  1I39 A;  3MEX A;  3PQJ A;  1HBX G;  1DU6 A;  2GA1 A;  2GAU A;  5ED4 A;  1Q1V A;  5D5W B;  4QPQ A;  2X9D A;  2FXA A;  4KN7 X;  2DK5 A;  4II2 A;  1ETO A;  5FJ8 J;  1VZ0 A;  2XKP A;  3ECH A;  2E5Z A;  2GXG A;  3FM5 A;  2B9S A;  2EZL A;  1U9O A;  1Z1D A;  3ZP5 A;  3HOV J;  1C0W A;  1MMD A;  1P92 A;  4Q48 A;  2LVS A;  1OYI A;  3GFI A;  1Z3X A;  5J4Y A;  1A31 A;  4K2E A;  3NAR A;  3K1M A;  4II3 A;  1SFU A;  1R58 A;  2DJI A;  2MGQ A;  2CRG A;  2HYG D;  5L3G A;  4OIN F;  1DUX C;  2GXB A;  2K86 A;  3CLO A;  1OCO H;  1P6R A;  3U21 A;  4I09 A;  4F7Z A;  1WJE A;  2FOW A;  4BJ5 C;  1HF0 A;  1X1D A;  3ZMS A;  2PJR B;  1D1B A;  2NVX J;  4AID A;  3AL0 B;  4LIU A;  3C18 A;  1WI9 A;  1LDD A;  4S0H B;  4ESF A;  4ZZD A;  2CW0 F;  4P96 A;  1QHG A;  4H4K C;  4BDY A;  1NTC A;  4LIV A;  2XRL A;  2KKO A;  1H0M A;  1OQY A;  2Y31 A;  5HOO A;  2X51 A;  4CGZ A;  1PP8 F;  2A5W A;  2FA5 A;  2OBP A;  1V5F A;  5F04 A;  4AU7 A;  4UY8 I;  4R1H A;  2IP2 A;  1WQ2 A;  4V2F A;  1LE8 A;  2MG4 A;  3FMS A;  1NH3 A;  5DD8 A;  2DW4 A;  2FBI A;  3GYH X;  3S3O A;  3HJE A;  1BM9 A;  3GCM A;  1D5V A;  2DAO A;  4DIQ A;  2EFP A;  4XIC A;  1MNM C;  3RJP A;  1CF7 A;  4PSW A;  4MTE A;  1VI0 A;  4FAS D;  2E34 A;  3A01 B;  1QZZ A;  1OCR H;  2P6T A;  3PIP F;  5TRD A;  2RAE A;  3W3C A;  1YIT I;  1SAX A;  4ABZ A;  3PJR A;  2XAH A;  1RET A;  1EH6 A;  1IXS B;  3MZ8 A;  2W25 A;  3S93 A;  2PI0 A;  1HXD A;  1XGO A;  4F55 A;  2GM4 A;  2DLL A;  5CYV A;  4O5V A;  1IXR C;  3KYD B;  3PUF A;  3GME A;  2E60 A;  2HVQ A;  3WTY C;  5EG0 B;  1LKX A;  2WV1 A;  4N0B A;  4YFK F;  4F91 B;  2HVS A;  2H09 A;  4JX4 A;  5F64 A;  4GYI A;  1MDM B;  3CCJ I;  1BI1 A;  2HDD A;  5CLS A;  2WTE A;  2HYF A;  4XK4 A;  2M8E A;  3L1P A;  3WGI A;  4IO9 F;  1WJB A;  1B4A A;  3BC8 A;  4IKF A;  3FX3 A;  4IRH A;  4XLC A;  4XOP A;  3WTS C;  4MQ9 F;  1ZTR A;  1ZQ3 P;  2FOK A;  2M0M A;  4AVP A;  4CCJ A;  1J09 A;  3FXR A;  1BC8 C;  4NQW B;  1KGS A;  3S32 A;  3OYJ A;  2QSH X;  1O57 A;  3ZN1 A;  2DT6 A;  4IL6 C;  4ZTJ A;  1HW1 A;  1LNW A;  2HOE A;  1AWC A;  5FRO A;  5D6E A;  3FXK A;  1FX7 A;  1X19 A;  4LLL A;  1L0O C;  4P9U A;  1XDS A;  1FBU A;  2ESN A;  4ZDP A;  1R4M B;  2Y9Z A;  3V4G A;  3GUD A;  1HDD C;  2OU2 A;  2GIZ A;  1TWA J;  2VQL A;  2XHK A;  4BKX A;  2LOO A;  1YW8 A;  3AKZ A;  5JLW A;  3BPV A;  2EK5 A;  1ITY A;  2JT1 A;  4XKV A;  4XLH A;  4BGD A;  1CQT A;  3G71 I;  5E8G A;  1JUM A;  4U7B A;  2HVR A;  1GT0 C;  3BTC A;  4U87 A;  4R79 A;  2HQR A;  4DW6 A;  2UV1 A;  1BW6 A;  1MD0 A;  4LIT A;  3LQR A;  1A6Q A;  1FNN A;  4ZZL A;  2FD5 A;  5FLX Z;  1REP C;  2NOG A;  3ECO A;  3GLL A;  2HPI A;  5GTI C;  2OQR A;  3G1M A;  2JA6 J;  1BI2 A;  2MD0 A;  2PMZ N;  1FC3 A;  4PGG A;  3LNQ A;  1X3U A;  2IA0 A;  2EB7 A;  4KT5 C;  1XSV A;  2W4S A;  2NRA C;  1LVK A;  1VND A;  3FK7 A;  3OOP A;  2FML A;  2EV6 A;  4MIM A;  1IDZ A;  5TIS C;  3TW6 A;  4NNJ A;  2FE3 A;  1OLT A;  1YRN A;  1W7P A;  2MA3 A;  3I0T A;  5AIQ A;  4UV8 A;  5LRR A;  3CMM A;  3E5U A;  2KLO A;  3RQI A;  4EAT A;  2YPR A;  4ETS A;  4P5O A;  3F8F A;  4IHV A;  3KP4 A;  4F93 B;  1H9T A;  2ELH A;  4BQN A;  5D5X B;  4ASN A;  3F21 A;  3JRC A;  5FKL A;  2KT0 A;  3CES A;  4FX4 A;  4HNV A;  1LFU P;  1OPC A;  4PDK A; 
#chains in the Genus database with same CATH homology
 4XLP F;  3JW4 A;  4HYE A;  5E8I A;  3SXY A;  4L0Y B;  5HLI A;  2X0L A;  1O3Q A;  2F5E A;  1Z05 A;  4HF1 A;  2QYO A;  1STZ A;  4LFU A;  3T1B A;  2P4W A;  4EGY A;  4L9T A;  3I53 A;  2DQR A;  1YO5 C;  3K1P A;  1R7J A;  3P7N A;  2W57 A;  2W24 A;  4XRF A;  3LFK A;  1FZP B;  4CYD A;  1K7A A;  1IN7 A;  5ICE A;  5J8C A;  2ZCW A;  3BOQ A;  3I59 B;  2E7W A;  1I27 A;  2OZU A;  4EJW A;  1VTN C;  2L01 A;  4KMU X;  3B73 A;  1ON1 A;  4RAZ A;  3ISP A;  1G6N A;  3FXU A;  2IT0 A;  1USS A;  2R7D A;  3GFM A;  2IRF G;  1XD7 A;  5IT9 Z;  3LAJ A;  5A2Q K;  1ZGJ A;  5DEQ A;  1JGS A;  2LNB A;  2OZ6 A;  5HLH A;  2OAZ A;  1B1B A;  4L9V A;  4QLC U;  3L09 A;  1ULY A;  1O3R A;  3ERE D;  2H94 A;  1R00 A;  3P9C A;  5DCM A;  5EEG A;  1IN4 A;  1Y0U A;  1YYV A;  3M1E A;  5KVR A;  1I5Z A;  3I59 A;  4EV0 A;  3F8B A;  2V79 A;  2XGX A;  2FSW A;  2A07 F;  4M6Y A;  4N9H A;  1G3T A;  2LKP A;  5AON A;  3CUQ A;  1J59 A;  2JPB A;  3DXJ F;  5DDG A;  2QQB A;  1TW3 A;  1Z7U A;  3E6B A;  1KU3 A;  1TNT A;  3LWF A;  1MJA A;  3RIR A;  1OMI A;  5JR3 A;  1R5H A;  1LJ9 A;  2VE8 A;  3VB2 A;  4UV9 A;  2PG4 A;  2DT5 A;  3IWZ A;  5ILU A;  3J80 Z;  2RQP A;  1XSD A;  2W84 A;  5DCM B;  3WTX C;  4A5N A;  2YR2 A;  4MEY F;  1SD7 A;  3FXQ A;  5HDN A;  4NB5 A;  2MBF A;  3RPU A;  4EM0 B;  3R4K A;  2L54 A;  1L3L A;  1KA8 A;  5DYM A;  3L7W A;  4KIC A;  5K1Y A;  1QO0 D;  3QAH A;  4G6Q A;  1XCV A;  1B6A A;  5CVU A;  2EFO A;  5HS7 A;  3RYR A;  3COA C;  4HLX A;  2BYV E;  3BDD A;  1PDN C;  2XVC A;  1H9G A;  2DU9 A;  2CWE A;  2DPU A;  1CGP A;  1SD5 A;  4A0Y A;  1T2K A;  2CFX A;  4D0P A;  5DUK A;  4HA8 A;  4I2O A;  2RC4 A;  4L9J A;  5FFX A;  2EFQ A;  3M7G A;  4A6E A;  1EH8 A;  4Z2Y A;  2VXZ A;  3IKT A;  1ZRD A;  4A0Z A;  5JHU A;  2ISZ A;  4M6X A;  4AD9 A;  1BIA A;  4BHB A;  1QBJ A;  4LB5 A;  2E1N A;  2XV4 S;  3HOT A;  2ESH A;  2O8X A;  3GXO A;  2HTS A;  4B8X A;  4Y17 A;  3ZMZ A;  5JVT A;  4LLN A;  2FRH A;  3P9I A;  2MLG A;  4L18 B;  3BJO A;  1R1U A;  5DD4 A;  2VC1 A;  5D4R A;  1QZY A;  4WX9 A;  5H6R A;  4ZYG A;  1ZLK A;  3WTU C;  5H20 A;  4JBA A;  2M1B A;  4ENM A;  2A61 A;  2FBK A;  4RGX A;  1J5Y A;  3FHZ A;  4M73 A;  2RDP A;  3I58 A;  2XAQ A;  2QBY B;  5LGN A;  5LGT A;  1W7P B;  1JHH A;  3QP6 A;  5K5R A;  2JSC A;  3DPT A;  2A68 F;  2MH9 A;  5BS6 A;  3L9F A;  3HSF A;  2L02 A;  3KEO A;  5CVJ A;  1RUN A;  2FNA A;  1U5T B;  3K2Z A;  2UZK A;  3PFI A;  4EQQ A;  4AIK A;  1GXP A;  4GXO A;  2DI3 A;  1K78 A;  4MTD A;  2NNN A;  1S8N A;  3DF8 A;  1RNL A;  2W85 A;  5KK1 A;  4KUM A;  3W6J B;  3CUQ B;  1FYM A;  5HDG A;  2Z33 A;  1G3W A;  3ABU A;  2CGP A;  2P5K A;  1F4K A;  3V7S A;  2AS5 F;  1P4W A;  1UST A;  2QEN A;  2O61 A;  2CO5 A;  5A2Q Z;  4G94 A;  2PMU A;  1QPM A;  2ISY A;  1U5T A;  4HAM A;  3QU6 A;  2E7X A;  3D0S A;  2GIV A;  1YQA A;  1DPR A;  2A3S A;  4WWC A;  4L9N A;  4A12 A;  1ZRF A;  4ZYE A;  3F6V A;  3R61 A;  2Y0M A;  1YS7 A;  2QBY A;  4BYY A;  2UWM A;  4EMS A;  1I1G A;  4WCG A;  1KYZ A;  1HKT A;  1SMT A;  1OKR A;  5LRS A;  2Z99 A;  3DKW A;  5D4S A;  2FQ3 A;  3GFL A;  3GFJ A;  1K79 A;  2P5V A;  1TW2 A;  5HS8 A;  2FEZ A;  1FP2 A;  3R6S A;  3VFZ A;  1FOK A;  4O6J A;  4EJU A;  3P9K A;  5FLX K;  4GCV A;  1T6S A;  5HS9 A;  4ESB A;  4KIB A;  3R0J A;  4G7Z F;  2HZT A;  3SQN A;  1S6L A;  3M8E A;  1R36 A;  2CG4 A;  2RV8 A;  3M9A A;  1Z6R A;  1HKQ A;  3GEZ A;  3RKX A;  2M87 A;  3WGG A;  4ENK A;  1S3J A;  4TV7 A;  1BOA A;  1KU9 A;  1SD4 A;  1ZYR F;  1SD6 A;  2ZFW A;  2AXL A;  2EFN A;  4M74 A;  3WTW C;  4RS8 A;  2MLK A;  4EJT A;  2D45 A;  2HR3 A;  1IXC A;  2RGV A;  2ZJ2 A;  1MZB A;  4Y13 A;  3REO A;  3RYP A;  1U78 A;  2XRO A;  2KIM A;  4HQM A;  4Q4Z F;  2A69 F;  3CUO A;  3DEU A;  3ZMV A;  4YII A;  1AOY A;  2BBY A;  4L5J A;  2QZ8 A;  4E70 A;  2QQA A;  3IKV A;  3T8R A;  3IRQ A;  2EFW A;  2XRN A;  4G7H F;  5DCF A;  2HWV A;  1UHM A;  4HOB A;  3MZH A;  3W6K B;  4CDG A;  1Z91 A;  1R22 A;  4YFX F;  3SFZ A;  3O3K A;  1G4D A;  2F5C A;  3WE3 A;  3TOA A;  4HF2 A;  2R3S A;  5ILS A;  3F72 A;  3T0Y A;  1ZGA A;  4G9Y A;  4KIF A;  2C6Y A;  3KET A;  3ML6 A;  1Q1H A;  4LB6 B;  4EJO A;  3GZ6 A;  3C3W A;  2Q2E A;  5J6X A;  1YLF A;  3TOB A;  3CTA A;  5D5U B;  2V1D A;  2PJP A;  1XMK A;  4ZH4 F;  4UUV A;  1KYW A;  3SZT A;  1PP7 U;  3WE2 A;  3TO7 A;  4HZF A;  2VC0 A;  2WWY A;  1NHA A;  4EM2 A;  4HDV A;  4YFN F;  4U7D A;  4I98 B;  4HX7 A;  4HF0 A;  1RUO A;  2PLY A;  3JSP A;  5HLG A;  1W4M A;  2F5F A;  2CYY A;  3E5X A;  3HRU A;  5ICC A;  4WXC A;  5ILV A;  1T38 A;  2LF7 A;  2GWR A;  5TJJ A;  4HQE A;  3SZP A;  1XGN A;  1V4R A;  5JFR A;  5LBQ A;  3R0A A;  4XSX F;  1HKS A;  1K6O A;  2H27 A;  4FT8 A;  4PGH A;  5HDK A;  2FMY A;  5LGU A;  2XIG A;  5LHI A;  1SFX A;  3E6D A;  1MJ9 A;  2DFI A;  2PQ8 A;  4FX0 A;  3BZ6 A;  1S7O A;  3GZ5 A;  2HQN A;  4A6D A;  4M71 A;  4I01 A;  1ON2 A;  1GHC A;  1XN7 A;  3C1D A;  3F8M A;  4I0B A;  1TTY A;  2F5D A;  3R60 A;  4IPA A;  2CQK A;  2VBY A;  2PFB A;  3ULQ B;  2RNJ A;  4HLY A;  2ZXJ A;  5EEH A;  1JXS A;  3HUG A;  3S2W A;  3V8J A;  2BEO A;  3WTZ A;  2O6G E;  2G7H A;  2QWW A;  1TBX A;  2HGC A;  3I71 A;  4OIR F;  4IRI A;  2DQL A;  4XLN F;  3I54 A;  2VBW A;  2QQ9 A;  1TQI A;  3GLX A;  1W5S A;  4HX4 A;  1P4A A;  2MD5 A;  3L2C A;  3FZV A;  4I7H A;  1O7F A;  4PZJ A;  1EV7 A;  1BBY A;  3DQV C;  2DTR A;  5DV5 A;  1IZ1 A;  1JHF A;  4OU0 A;  3RPQ A;  2D1V A;  5ERI A;  4HDU A;  4H0E A;  3BPX A;  2YU3 A;  3EET A;  1ZN2 A;  5CJ9 A;  2A6E F;  1XDU A;  4CHU A;  4IVN A;  3TGN A;  3WU0 A;  1IAW A;  2VT3 A;  2B0L A;  1D3Y A;  3ZMT A;  2HFH A;  1ZAR A;  2J5O A;  3V7R A;  2X4H A;  4HV6 A;  3QOP A;  1IN5 A;  3ZPL A;  4A0X A;  3MAJ A;  3H92 A;  4L5I A;  2WC2 A;  1Z6T A;  2Z9O A;  3F23 A;  1IUY A;  3B02 A;  2XUB A;  2ACJ A;  1MGT A;  2UXX A;  2MC3 A;  4Q47 A;  2FBH A;  2EA2 A;  1W7P D;  3KP2 A;  1W5T A;  2IJL A;  5IT3 A;  4BNC A;  1OYY A;  2VOO A;  2OD5 A;  4CO8 A;  1FP1 D;  1BIB A;  4CXF A;  4U0Y A;  2A6H F;  5ICF A;  3JSO A;  2K02 A;  5BOX A;  2KIF A;  2HTJ A;  1LEA A;  2Y48 A;  1YW7 A;  3DPL C;  4Y15 A;  4EVI A;  2ZKZ A;  4ZYH A;  1QQI A;  1YFH A;  1OYW A;  3FM3 A;  5H6Q A;  4BHC A;  1LEB A;  3HRT A;  2VOP A;  1P4X A;  2XAG A;  1XGS A;  3KP7 A;  2EV0 A;  3FMQ A;  4ZYD A;  1R1V A;  5D5V B;  1ZG5 A;  2O0Y A;  1IN6 A;  1BI0 A;  1B9N A;  4KYW A;  5L3C A;  5BQT A;  2P6S A;  1YTY A;  1IN8 A;  2ZNZ A;  1QGP A;  3EYI A;  2FF4 A;  2IVM A;  5BMZ A;  4IHS A;  3J81 K;  3HSR A;  1CF7 B;  4A5M A;  3DFG A;  3HOS A;  2Z3Y A;  3AAF A;  4EJV A;  3KP3 A;  5FB2 A;  4S05 A;  4UVC A;  2KRF A;  3RKW A;  1UCR A;  2VE9 A;  2RN7 A;  4RB1 A;  1XCB A;  5E18 F;  3WGH A;  2P7C B;  2LDU A;  4OMY A;  3IL2 A;  3BWG A;  3VOE A;  1MJB A;  1FSH A;  4U0V A;  4OIQ F;  1RZ4 A;  2O3F A;  2IPQ X;  4JK1 X;  3G3Z A;  1E17 A;  2P7V B;  3CUQ C;  2VT2 A;  1OR7 A;  3VEP A;  1MKM A;  1YG2 A;  1I1S A;  5BPI A;  3EYY A;  5J8F A;  5F6F A;  3TDZ C;  2G9W A;  4CZZ A;  4I02 A;  3KCC A;  2KIU A;  3IC7 A;  5E17 F;  1LVA A;  2JPC A;  4LJZ F;  4AIJ A;  3ROU A;  5D8L B;  1KQ0 A;  3K9T A;  2GZW A;  1XGM A;  3H3Z A;  4YIF A;  2PEX A;  2Y75 A;  2KJC A;  3LQQ A;  3KP6 A;  2K27 A;  4KIG A;  4RB3 C;  5DUI A;  5K5O A;  4S04 A;  3J7A O;  2RKH A;  1D8K A;  2G7U A;  2NAZ A;  1ZLJ A;  5ICG A;  4HBL A;  4AIH A;  4M9S A;  3HTU A;  3WG9 A;  3BRO A;  1TQP A;  1DPU A;  3IHU A;  3K69 A;  3ELK A;  2ETH A;  3PQK A;  5D8K B;  2GA2 A;  2J5P A;  1R5G A;  2JZY A;  2XAF A;  5D6F A;  1J75 A;  3ZMU A;  3QPH A;  1F1Z A;  5LEJ A;  1LDJ A;  3RKY A;  2Z5U A;  2VOD A;  4BAY A;  3HRS A;  2YX4 A;  4KFC A;  1S7A A;  3LA3 A;  4JQF A;  3U2R A;  4O3M A;  2ZME A;  5E1X A;  1FBQ A;  4KDP A;  2NS0 A;  1S29 A;  2LF8 A;  4ENJ A;  1IRF A;  3C7J A;  1WKM A;  2D1H A;  4UVA A;  2M30 A;  2P5L C;  4HX8 A;  3MWM A;  4BQA A;  3MQ0 A;  1F5T A;  1A04 A;  5HVQ C;  4LD5 A;  3N4M A;  3NRV A;  3TDU C;  1TNS A;  1UFM A;  5LEK A;  1YW9 A;  2VBX A;  2R7F A;  2VON A;  4XBF A;  5LLQ A;  3TO6 A;  4OIO F;  1RIO H;  1FT9 A;  5CVI A;  2BE5 F;  3LA7 A;  3E3V A;  1O3T A;  3ZMD A;  1I6X A;  4MGR A;  4MNU A;  4G7O F;  1FYK A;  4ON0 A;  5LHG A;  4GO1 A;  1LB2 A;  3DV8 A;  4WXD A;  3E97 A;  4HV5 A;  1DDN A;  4L0Z B;  1UHW A;  4BH9 A;  1WWX A;  2E1C A;  2K4B A;  4P55 A;  3CDH A;  1KQ9 A;  3E6C C;  1BI3 A;  3JTH A;  1G3S A;  5E1Z B;  3NEU A;  1BJA A;  3HSE A;  1YIO A;  5L3E A;  1JE8 A;  3JAM Z;  5FFZ A;  1J0R A;  2QVO A;  1LDK B;  3E6M A;  3FMR A;  2K4J A;  4KA4 A;  2HEO A;  2V6C A;  4KNY A;  2V1U A;  3F8N A;  3V8K A;  3EDP A;  3D5L A;  4LGW A;  3HIF A;  3GWZ A;  3KZY A;  3I64 A;  4LK0 F;  4UVB A;  2DK8 A;  2IW5 A;  3LA2 A;  4NHJ A;  1ZH5 A;  2BV6 A;  1R1T A;  4Q5S F;  4AWX B;  2H6B A;  4B09 A;  3ZQ7 A;  4ENN A;  1HSJ A;  5FO5 A;  3RDI A;  3HRM A;  1ZRC A;  4IHT A;  4QWQ A;  3O6B B;  4RB2 C;  1GXQ A;  1KU2 A;  1T0F A;  1P2F A;  1TQM A;  1FSE A;  3WOD F;  2M5W A;  1J2X A;  3T5X A;  2COM A;  4DNC A;  3KEQ A;  4U0W A;  1EH7 A;  1HW5 A;  3GW2 A;  4NQW A;  1XMA A;  3DP7 A;  2F2E A;  2K7L A;  3RI4 A;  1HST A;  2OA4 A;  3FWE A;  3GF2 A;  5CVR A;  1XB4 A;  3SHF A;  5JI6 A;  4LG0 B;  4RGR A;  2LSO A;  5FGM A;  4HW0 A;  4BXU A;  2ZNY A;  2XAS A;  2HKX A;  4BHP A;  3U1D A;  3TO9 A;  3GX4 X;  3I5U A;  3L00 A;  1ZG3 A;  2DPD A;  4RB0 A;  1HW2 A;  3ABT A;  2HS5 A;  3MFK A;  1WRJ A;  2EA4 A;  5CVV A;  1J7K A;  5LHH A;  3TQN A;  1U3E M;  3J80 K;  2ZME B;  2UXN A;  4RAY A;  3KE2 A;  2ADU A;  5BPD A;  2IA1 A;  3VOD A;  1FLI A;  3J81 Z;  2PN6 A;  4M9Z A;  4G6D A;  4LMY A;  1E2X A;  5AIP A;  1GVJ A;  3O2P E;  2GQQ A;  3Q5F A;  1R23 A;  2L4M A;  3G73 A;  4OMZ A;  4KN4 X;  2VBZ A;  2TDX A;  4N9I A;  4GYG A;  2JTV A;  2STW A;  2NYX A;  3EUH A;  2V9V A;  3RTR A;  1T39 A;  3CO7 C;  2OQG A;  3BJ6 A;  1ONV A;  2XAJ A;  3MZY A;  1RI7 A;  2D2W A;  1DP7 P;  2YSR A;  4WXH A;  1WSU A;  4IF4 A;  1XSX A;  1ZG1 A;  5L3B A;  2XKO A;  3KLO A;  3Q9S A;  3E5Q A;  4P9F A;  3M8F A;  6PAX A;  2MH2 A;  3N97 A;  2CSO A;  4MHG A;  1T98 A;  4OIP F;  1FY7 A;  4MQV A;  5IT9 K;  4LG0 A;  1HQC A;  3F8C A;  3QRF F;  2KJB A;  3HHG A;  2QLZ A;  3LAP A;  5K5Q A;  3Q9V A;  4ESJ A;  3V8L A;  3KP5 A;  4R8H A;  1IW7 F;  3U9G A;  2Q8K A;  3LST A;  5F1R A;  1YS6 A;  1B9M A;  2QUF A;  3GVA A;  4A2U A;  2VN2 A;  3HYI A;  2PMH A;  2FNP A;  2HDC A;  3QPT A;  4PCQ A;  1FBS A;  2ZO4 A;  4YG2 F;  3T8T A;  1PUE E;  1UB9 A;  3BP8 A;  5E1W A;  2A5Y B;  5L3D A;  1MDM A;  4MEX F;  4U88 A;  4IXA A;  1ZHF A;  4XSZ F;  1B59 A;  2EV5 A;  4LK1 F;  4FHT A;  4EGZ A;  4M72 A;  1K78 B;  2YX7 A;  1F9N A;  1G3Y A;  3WTT C;  1FWZ A;  3HTS B;  4WF2 A;  1FYL A;  2EWN A;  2L3D A;  1QNT A;  1Z9C A;  3ZN0 A;  1J9I A;  4UXN A;  2V1X A;  3K1N A;  2DO7 A;  4M9X A;  3IRR A;  2M45 A;  1O3S A;  4G8X A;  5FD5 A;  2FU4 A;  2JRT A;  1BN5 A;  3KZZ A;  4RGS A;  4UNO A;  3WU1 B;  2QM3 A;  4DQ2 A;  3H3U A;  5E20 A;  1U5T C;  5L3F A;  1D8J A;  1IRG A;  1KU7 A;  3TKY A;  1SFE A;  2HKO A;  2NNY A;  2RVC A;  4WK8 F;  1BC7 C;  4IRG A;  3EQL F;  1U8R A;  3QU3 A;  2EJR A;  4I0A A;  4LLG F;  1LQ1 A;  4KMF A;  3IWF A;  2STT A;  3NQO A;  4IJA A;  2WV0 A;  1V3F A;  3GO5 A;  2O03 A;  3QP5 A;  2BGC A;  2P8T A;  1O7L A;  1FPQ A;  3CJN A;  1SMY F;  3F3X A;  3K0L A;  2L4A A;  2DBB A;  3FF5 A;  1ODD A;  2Q0O A;  1TLH B;  1U2W A;  3V7C A;  1U6G A;  3KLN A;  4OOI A;  3F22 A;  3WTV C;  3CO6 C;  1KQ8 A;  3JTG A;  3MCZ A;  3OV8 A;  4EM1 A;  4CIC A;  4RGU A;  4UHT A;  5FD6 A;  3HHH A;  3I4P A;  2PBI A;  1ZAO A;  3JAM K;  1ZRE A;  4GGG A;  3F6O A;  3BY6 A;  3KFW X;  2H6C A;  1IF1 A;  2ZBK A;  3BJA A;  2IA2 A;  3MEX A;  3PQJ A;  1HBX G;  2GA1 A;  2GAU A;  5ED4 A;  5D5W B;  2FXA A;  4KN7 X;  2DK5 A;  2XKP A;  3ECH A;  2GXG A;  3FM5 A;  3ZP5 A;  1Z1D A;  1C0W A;  1P92 A;  4Q48 A;  1OYI A;  3GFI A;  4K2E A;  3K1M A;  1SFU A;  1R58 A;  2HYG D;  5L3G A;  4OIN F;  1DUX C;  2GXB A;  2K86 A;  3CLO A;  1P6R A;  4I09 A;  4F7Z A;  3ZMS A;  3C18 A;  1WI9 A;  1LDD A;  4ESF A;  4ZZD A;  2CW0 F;  4P96 A;  2KKO A;  1H0M A;  5HOO A;  4CGZ A;  1PP8 F;  2FA5 A;  2OBP A;  4R1H A;  2IP2 A;  1WQ2 A;  3FMS A;  5DD8 A;  2DW4 A;  2FBI A;  3GYH X;  1BM9 A;  1D5V A;  2DAO A;  2EFP A;  3RJP A;  1CF7 A;  4MTE A;  1QZZ A;  2P6T A;  5TRD A;  1SAX A;  2XAH A;  1EH6 A;  1IXS B;  2W25 A;  2PI0 A;  1HXD A;  1XGO A;  2DLL A;  5CYV A;  4O5V A;  1IXR C;  3WTY C;  4N0B A;  4YFK F;  2H09 A;  1MDM B;  5F64 A;  4GYI A;  1BI1 A;  5CLS A;  2WTE A;  2HYF A;  2M8E A;  3WGI A;  1B4A A;  3FX3 A;  4IRH A;  3WTS C;  4MQ9 F;  2FOK A;  4AVP A;  3FXR A;  1BC8 C;  1KGS A;  1O57 A;  3ZN1 A;  1HW1 A;  1LNW A;  2HOE A;  1AWC A;  5D6E A;  1FX7 A;  4LLL A;  1L0O C;  4P9U A;  1XDS A;  2ESN A;  1FBU A;  3V4G A;  3GUD A;  2OU2 A;  2XHK A;  1YW8 A;  3BPV A;  2EK5 A;  2JT1 A;  5E8G A;  4U7B A;  4R79 A;  2HQR A;  1MD0 A;  3LQR A;  1FNN A;  4ZZL A;  5FLX Z;  1REP C;  3ECO A;  2OQR A;  1BI2 A;  1FC3 A;  4PGG A;  1X3U A;  2IA0 A;  2EB7 A;  4KT5 C;  1XSV A;  2NRA C;  3OOP A;  2FML A;  2EV6 A;  2FE3 A;  1W7P A;  2MA3 A;  3I0T A;  5AIQ A;  4UV8 A;  5LRR A;  3E5U A;  2YPR A;  4ETS A;  4P5O A;  3F8F A;  3KP4 A;  1H9T A;  2ELH A;  5D5X B;  4ASN A;  3F21 A;  4FX4 A;  1OPC A;  4PDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...