The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
146
|
structure length |
146
|
Chain Sequence |
NSVSMIGKIAETDVSGANFDGNNKLSFSLFFDEKIDASKGVPAIQILNENNELVKTIPLKDYNGQKGYINFEWDGTNEKGEKVPKGNYKIKAEYNLDSHSKQYLQTRIGRGEVESVIFDKGKPMLRMGEMVLPIDSAIEFYQPDQK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Basal-body rod modification protein FlgD
|
publication title |
Structure and Stability of FlgD from the Pathogenic 26695 Strain of Helicobacter pylori
doi rcsb |
source organism |
Helicobacter pylori (strain atcc 700392 / 26695)
|
molecule tags |
Motor protein
|
total genus |
33
|
structure length |
146
|
sequence length |
146
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2016-05-24 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF13860 | FlgD_ig | FlgD Ig-like domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like |