5K5YA

Crystal structure of truncated flgd (monoclinic form) from the human pathogen helicobacter pylori (strain 26695)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
146
structure length
146
Chain Sequence
b'NSVSMIGKIAETDVSGANFDGNNKLSFSLFFDEKIDASKGVPAIQILNENNELVKTIPLKDYNGQKGYINFEWDGTNEKGEKVPKGNYKIKAEYNLDSHSKQYLQTRIGRGEVESVIFDKGKPMLRMGEMVLPIDSAIEFYQPDQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Basal-body rod modification protein FlgD
molecule tags Motor protein
source organism Helicobacter pylori (strain atcc 700392 / 26695)
publication title Structure and Stability of FlgD from the Pathogenic 26695 Strain of Helicobacter pylori
doi rcsb
total genus 33
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5k5yA02
4ZZKA 4ZZFA 5K5YA 3C12A 3OSVA
chains in the Genus database with same CATH superfamily
3VFVB 5GSVA 4EI5A 5IKCB 1BD2E 4HD5A 1E7VA 4U3CA 4OZHF 5IVXB 3EJRA 3EH4B 4G8AC 1THAA 4KTGA 2H2SD 2ADJB 3DMMA 1S7UA 4PRAA 1IKOP 3P3SA 4FTDA 1VSCA 1RQ5A 1QFUH 4GY4A 3WJJC 2G2RA 3NFPA 1M1XB 3SGJC 4WFED 3AY4A 3EFFA 2NX5E 2BNUB 4M61A 1KIPB 3PV6A 4OGXL 4XI5C 4Y2DD 4A6YH 4NHUB 4TLKA 4BQ9A 2Y5TA 3IPBA 4YHPA 3SO3B 3ARFC 2QSCL 2JKSA 2Y9RT 5DD3L 1A02N 4MS8D 2QSQA 43CAA 4BYHA 2EDFA 3GMNB 2NOYA 3ZT7A 4L8CA 2YUVA 1TJGL 4NGHH 3DRQB 3N43B 1ML0A 3E6HB 3E7JA 4WWOA 5F89A 4JG1L 4K07A 5FLUA 1BQRA 1IBGL 5D70H 1XGZA 1H6EA 1OGPA 3MRJB 1N0XL 4LSPH 3KAAA 3RNQB 2X4SB 2FQDA 4AVJA 1JGEA 1OD7A 4YHIA 4XN7A 2YPVL 2AEQL 2J8UB 3KBEA 3IM1A 4WNSA 5DJ0B 1NCDL 6CGTA 1L5GA 1KJ2L 4F93B 3CN4A 1XGYL 3FFDA 2VH5L 5EN2B 3WYRA 1NCWL 4Q9RL 2C3HA 3NRFA 4O9HH 1M2VA 3OKKB 3CWGA 4U1SB 3UG5A 5ID1A 1F3DH 4NOBA 1TZGL 5JHLH 2BSBA 2DM3A 4OFDA 2JJTA 4NNPH 4F7MA 4NCC2 5C07B 3WU1A 1E3ZA 3CSPA 3KWWA 1DCLA 2CGYA 1PBYA 4OCSH 4QRUB 4DUVA 5BRZE 3TVMC 4W6YB 3U4BH 4G6KL 5E08L 3A4FA 4YBHA 1JIBA 2PWHA 5SWQB 1T89C 5D93C 5TJWK 3MLXL 4ODWB 2YK1L 2HZHA 1QHQA 5H37G 3T1FA 5IY5B 2N59A 1M4KA 5CZXD 5CNHA 1U41A 2V7NA 2OR7A 5FUOH 5AWNL 1AGEA 3MCLL 2YS4A 1A6VH 2DQFA 4UM9D 4GG6A 1ORSB 1MJUH 4PS3A 5DD6A 1JWMA 4JQVA 2VXVH 4IOSA 3FQ4A 3GZQA 4FFYH 3GGWB 4JFOB 2VAJA 4P05A 4PWEA 5ACZA 3HMXL 2NNXA 4HUKB 4EUPA 3BYTA 3QFDA 1L9PA 2XY1A 4YLQT 2EDNA 3GEWB 5SWZD 5D1QC 3VU2A 4D94A 4YSCA 2K7PA 4PW4A 3VG0H 3QQ4B 2DM4A 1TTUA 2WPGA 3C8DA 4QTIL 4EOWH 1AQ8A 5AAMC 5DZLA 2BVOA 4K0OA 2DLHA 4OR1A 4R3SB 1MFVA 4L5FH 4YHLH 3KXFD 5IM7B 2DWDB 4JGUA 5JHDB 4FMKA 4HK0A 5JHDE 1SEBB 2UXFA 3PHQB 2ZKHH 3RWJB 3QNYB 1RK0B 5HSFA 3K6NA 1OGTB 3DJTA 2NLJB 3Q3GA 4AYBA 1NAKH 1VFBB 2IDTA 2PYFB 1O7SA 2WZPA 3U48A 3CDZB 3OMAB 2A1WL 3QIUB 5HJBA 2F7OA 3TN0B 5I1LA 4MAUH 2JJWA 3OJDA 4NQXA 2X2JA 1F45A 4KDVA 3COOA 2EDLA 4JPIA 4DHLA 3PWJB 1T21A 3K1KC 3PU7A 2EDTA 3PV6B 2QR0A 5AENA 1OXYA 3UBXA 1S9KC 2Y5TB 1WAAE 5K93A 5GRJL 2ED7A 1N0LB 4PP1D 3GTTA 4HQQL 4NUGH 3V0VA 1HYSC 1OPOA 2A9CA 2G3MA 4MQ7A 4CMMB 1THCA 3NUKA 3I9GH 3WMQA 1JNNL 1H5BA 4P23B 3U1SH 3OB0K 2ESVB 3MRJA 4AYSA 4HLEA 2FR4A 3BJ91 1HEJC 3GBMH 5E99L 4JFEB 1ECYA 4H44C 2VR3A 1GGUA 2PXYA 2XXFA 5BS0B 3QG6B 1G0DA 3DX7A 4U4IA 4XPAL 5KWYC 3RU8H 4RMVA 3OKDB 3UTSE 3SKJL 5AVUB 1GZHC 1TPXB 3LRSA 2VITB 4L1DA 5FKPA 1C08A 4DZBB 1ES0A 2Z91B 4YWGH 5J1SC 3L4ZA 2Q6WB 5JNYB 3GBDA 3ABKB 3EJTA 1JPFA 3QR0A 2DBLL 3WNOA 1T4KA 3ARDD 1GJUA 1LWRA 5KVGL 1MG3C 2D7QA 4PJ7B 2R27A 2VO5A 1BDYA 4FLQA 3LKPA 2P49B 3SDDA 1HHGB 2TRHA 3IS1X 3FQYA 1NC2A 2PKDA 3MJWA 2BOBB 1UWXK 5LGKA 3PQYD 5IMLB 4AY0A 1DQQA 2L7JA 4JZJB 4O4YH 5CLZA 1I1YA 1QNZH 4J3WA 3KYAA 3RGHA 4M93B 2LV4A 1I85A 4GG6F 2IEPA 3CBJB 1P7BA 4GKSA 3KWTA 3S5ZA 1L9TA 3GJFH 3TNMB 3Q2WA 3TBYA 1S7TB 4BZ1L 4E5XB 1KNOB 4WQOA 3QIBC 4FZEL 5HPMB 3C9NA 3NPSC 2VLME 1PKOA 1P4IH 2AZAA 2OQJA 4POZD 4XZUA 3V0FA 1A9BB 5C0FA 5C0BA 3WL9B 3ARBA 3HZYB 4OCWH 1IFRA 4NZFA 3G5XA 1OVZA 2VDPL 1EJOH 3T77A 2NZ9C 2OMZA 1ID2A 5ECGA 5LN8A 1VFAB 2EZ0D 3V7AG 4G80B 4DESA 2AKRB 2OPCA 3G5VB 3RGVD 4XNXH 3VXTA 4F8LA 4PRPA 5EOQH 2AJUL 2GTZB 4UQDA 1IEAA 4F7EB 4OGAD 3WOVA 2BVOB 4R3SA 3JWNG 4Z77B 1R5WA 3X1EA 1KYUA 3CVIL 5EU7C 1IRAY 2FK9A 1HXMA 4GQQA 4PJBB 4BZ2A 1C5BL 4NXSA 2JVUA 2E7DA 1TF4A 2AQ2A 2COQA 1IGTA 4WW2A 3DKHA 1RUKH 2ZUXA 3CD4A 3OD3A 1UM4H 2C3WA 3T3ME 2UYLB 5IESH 2FB4L 2DQJL 2BNQD 2F5BH 3MRIA 3O6KH 4HUVB 4HP5A 3L5XH 5FYLE 4AW4A 5F1SA 5M95B 1KF9B 4JKMA 1SPDA 1UA6L 3QO1B 3PWNB 2BSTB 1YEIH 4O9HL 3K4ZA 1KCUL 1J0YA 4WUUA 2H6PA 2FL5A 4RIRA 1FHGA 2O6CA 5B38B 4R2GB 4H7VA 4UQIM 2UXVA 1NCBL 2AVGA 4CGTA 3JZYA 3GS4A 2JJVA 2NY2C 5G5DB 3IXAB 4X6CF 3UROR 2J4WH 4WEBH 2WLKA 2Y6SD 1LP9A 2MNJB 4FG0A 3U9PL 3L3IB 1N59B 4LDOB 2LR4A 5CJQH 2FJFA 4NAMA 3TCTA 2XQYG 1QEWA 2WOYA 2X5PA 3AADB 3SDAD 4HIPA 1QLFA 1OF2A 3MNVA 3CMOH 3CN3A 4B3EA 1T7VA 3EDEA 3UJTH 4IIZA 4KTYA 3ZUNC 4UOW1 2G60L 1RFDH 4PSRA 4A2GA 1FNEA 4XPTL 1ACXA 4LDEB 4TNWF 5BS0A 4D0BB 4PJBF 8CGTA 2DJSA 5DVOA 3N1MC 1Q38A 1VEPA 2R4RL 4PWFA 4OGYH 4JFXB 4KVPA 2EDHA 4J2QA 5C07E 5I28A 3EUDA 2Z0UA 3L1FA 4NNXB 4QRRD 3QDGE 2VLRD 1MCRA 1YQVL 2Q7NA 4JPKL 4ZD3L 5HYQB 1T5WB 4UV7H 1G7LA 3BPLB 1FDLL 4HV8B 4GRMB 1BAWA 2BS9A 4Q9RH 1NKRA 5FM5M 1J8HE 1NEZG 1WWBX 4X2UA 5IG7B 4YHZH 1RZKL 5DUPH 3GIZH 2P5EE 4CBPA 1WGOA 3ILDA 2AJYL 4R26H 5E5MA 3VFSB 4MFHA 3MXVH 4ZUWB 1SUJA 3TEUA 4P04A 3IJ9A 3PLYA 3LIZA 4PG2A 5E9DA 1RP9A 1ROWA 2X4TB 4UT7L 4R83A 3C60D 3K91A 2Z64C 1LJMA 1BFTA 2KZ1B 3BAIA 2ZSVA 3A3YB 1UJ3A 1MCDA 2YK1H 3QS3A 4HAFA 5DRWB 2W0KA 5FO9A 4AE1A 4EVNB 4JS7A 3QUKB 2NW2A 3PHSA 4KTDL 4TTDC 4AENB 5LUMA 2GJZB 5KZCD 1OLLA 1TCRB 4G9FE 3VYOA 3BKJL 2QKIB 3IDNB 4H88L 3WN6A 1BFVH 1F6AB 3RDTC 4QRAA 2BSEA 5J11B 3MCKB 4NKOA 5AWNH 3I6KA 4FQLH 4FQCH 4ZAKA 2WTRA 5B22A 1JGLL 3DSFH 5T5FL 3PNWB 3LXUX 4AJ0A 4JHWL 2VZTA 2YPVA 3RY6C 4EKXA 4P4KA 4WI3A 5JW4M 1HCVA 2EXWD 4LRIC 4PJIF 2OMZB 1QW8A 2AQNA 4U1JB 4NN5B 3H42H 1HH6B 3VH8B 3FFOA 2A7BA 3L4UA 3T71A 4KAQH 4MVBC 3S37H 1X4YA 4Y9EA 5DJ6B 4Z7QB 5K39A 1TMCB 3RTQC 4NQCA 5H4ZA 4YXLL 4U1KB 3BT2L 4ODTH 1Z2KA 2IH1A 2DMGA 3L1OH 4X98B 4HCFA 1IGCL 4KVCL 5DEFB 1BF8A 1Z6JT 2WSPA 3BPOB 1RUML 4WGWB 1QHPA 3ULUH 4V1DD 2VMCA 3GQFA 1SDDB 2KC0A 1E65A 2XN0A 1ASOA 1IEBB 3QXDB 3NACL 3TZVC 1L0YA 2HN7A 4FEMA 2V7HB 3E3QC 4FQQA 1BECA 4JFHE 3ILPB 4WFGD 2PWGA 1Q9KA 2NPLX 2XTJC 2W1NA 3OAZH 2Q7YB 3SKMA 3U7WH 3IETB 2EIZA 3ZDYB 1LD9B 4CGUB 3DHJA 1FAKT 5DHXB 4ZOAA 3GZPA 2WXGA 4MXWH 2R0WL 5BQ7A 3DOSB 1UC6A 4YE4L 32C2B 3LZFH 3CAFA 1U8LB 1IGML 2FJFB 4F37K 3ECQA 1ZS8B 1WIPA 4GQRA 3T08A 3V2AR 4FOMA 1DJSA 4GQ9L 1BQLL 3IE4A 3CH1A 5DR5H 1OAKL 4I4WB 5J0BA 3WNPA 2ZXWB 1BWWA 4NQDE 1QKZL 1NDGA 5DLLA 2VDMB 2Z31C 1IGIH 1FUNA 5LLIC 3H9ZA 4DEPB 1N9PA 3UBHA 5J1AA 3IGLA 5IJVB 1B0RA 1P6FA 5BVPL 3SO5A 3SPIA 4PJEB 1M7UA 5TPWL 1TTFA 4QRQB 1VLXA 3GDBA 4KTEL 4UU9B 3C6LD 2EVGA 4DK5A 3UTZA 4HDIB 3F6LA 1I9EA 2XKNB 4TTGA 3GMOB 4U6HB 4PJ5A 4Y4FD 5EV7A 5BQDA 4Y4FB 5I18L 3Q8AA 4JR9H 5LHDA 12E8L 4WUUD 4KK9D 5D5ME 1SM3L 2YRZA 3NTCH 4WY7H 4QKTA 4O58H 4NQTA 4FFWD 2NSXA 2VDOH 4XMUA 2AQQA 2UUDK 4MLIA 1M71A 4PB9L 1FYHB 1J9RA 3N40F 1QBMH 3AFLA 4J3OF 1E3FA 2CPUA 1SRDA 1L9OA 4LSUL 4P06A 3IAQA 1H3PH 1MH5B 3EZ8A 4MA3B 5DHMC 3WN5B 3SQOL 4X6BA 2NZ9D 2PYEA 4WTXA 1R24A 4F20A 5ICZB 5DSCB 5I24A 1E9QA 3S37L 2Y2YA 3GLEA 3V8CA 4I2XE 3IDNA 4XB3A 2VCOA 3QEUA 5TE6L 2W81C 3CHRA 3KPLB 1IQWL 3HVDA 1G4RA 2FWOA 4G6KH 1ZT7A 2EXYC 4PR5A 4F91B 3MLVL 1G9HA 1NDMB 4YDKL 1QSVA 1FFPA 1VB9A 3LDBB 3FT9A 1PKQE 2OSLB 3T0EE 3HBZA 2NW3A 4MYWB 5E6YA 3L7FB 2DYPA 3A21A 4GT0A 3ARZA 5FYKH 4PGEA 2QJDA 3ZN6A 2DIEA 3WNJA 4DP2X 4GRLC 2VXSH 3L7EB 3PWPE 3KYNB 2BNRB 2OJEB 4PJEE 3E9UA 3GUTA 3LIZH 2VDLB 4N3TA 4NQCB 4PTTB 4XNZC 1RLWA 4AQ8A 1OAUH 2NXZB 2XWZA 3TT3L 3D85B 1CDBA 3Q6GL 5TF1H 3ULVC 2VZUA 5DYOA 1U8KA 3VWKC 5I75C 4GG8A 1H3XA 3B8SA 5L4MA 2KQMA 2D4DA 5CEZD 2QQNL 3UTSB 1U8JA 2ENYA 4BH7B 5DVLA 3TIEB 2FLBT 1ZV2A 4XNUH 1IBDA 2WUCH 5LBGA 4LSRL 4WV1C 3O3BB 1H3TA 1JL8A 5E4OA 1EVTC 1Y6KR 1GIGL 3DI3B 4MMYB 5HI3C 4HS8L 3RAJL 5KANI 3L9EA 2LU5A 1QFHA 4ENEC 4X4KA 4GAGH 1P53A 4MCZA 2WY3B 3FCBA 3QPKA 3B5HA 4KK6D 1LO2H 1MRCH 4WVRA 1JF6A 2HX7A 4HOZA 4U1LA 4HLZH 2WQSA 5TGBB 3TT1L 3WSQH 4MS6A 1GW6A 1S9VB 5J13B 2VJ8A 4GRWH 4QYOA 1MWAL 1AR2A 2NY6B 4HWZB 3ASNB 2PO6B 1HYSD 4I85A 3D4CA 3HNVH 3LHPL 4N24A 5I6PA 5BRZB 4FQ2H 4P9HH 1DBKL 3NPZB 4FNUA 4UYPA 3RPBA 5EF0A 1AD0B 4HJJL 3RWHB 1R0AH 5A2BA 4WI5A 1LEKB 2FE0A 5AL0A 4ZNEE 2ZNWA 4WV1B 5DZPA 1SXZA 3MLYL 5KS9F 1K85A 1W8OA 4GFTB 4HLZG 1F56A 4DP5X 2WV3A 3VD4A 5IQ7L 2J88L 4AWJC 3QULB 1QQDA 3QFGA 2WYIA 3BWAA 5K9JH 5E23A 5DZAA 4AJWA 3ILEA 3G6DL 2B4CL 3HRZB 5TK4A 5FYJH 2BXZA 1TEFA 3MJGX 4ERSL 3L2LA 2AXGA 3FOLB 1WCBA 2MQGA 2XNAA 5B7FA 3EHBD 1G1CA 1QD0A 4LHUD 3BAEH 3VFRB 1YSOA 5C0JA 3LKOA 3KPMB 4OFIA 3AQYA 4G6AC 1N70A 3U6XA 5HVHC 4UDUA 5FYKL 2VLLA 2X9WA 2PYEB 1JGDA 4AZUA 4A7QA 4HJ0D 3H3KA 1I7RA 1PY9A 2VXSL 5KOMC 5HBBA 2RJMA 3T9WA 1PZDA 4ILDA 2P4AB 3NIGB 3MJ9L 3RWFB 3GNML 5HI5C 1WF5A 4H1LA 2FDBP 1CLOH 4WWPA 1WBZB 4XTRC 2ODIA 2Y36L 4LKCA 1E4WH 1FGVH 4ZQKB 4YDVA 4CVXA 4ADGA 2XZQL 1ZLWH 5MERA 1KJ3H 4EF3A 4DGYH 2YEQA 2Y0SA 4I9WE 2R51A 4PW3A 2NNAB 4JRYA 4HIJB 1NBZA 3CXHK 1JZ5A 4P5SA 5EEVA 2MQ3A 5CGTA 3C75A 1PAZA 4FXKA 4UUJA 4YNYA 3IMUA 3PRZA 1BOGB 1PPIA 4AIZB 1YYMH 2AQ1A 4AM0B 2JJSC 4HEPA 2OBGA 5SV3A 3EHBB 3QPQC 4B9FA 3QQNA 1OAQL 2A99A 1KBGL 4NUQA 5FYKE 5IVZA 3UYPA 4FP8L 3VFTA 3V7AE 5AW5B 5HYJD 1BG9A 4HT1L 5DJCA 3VXME 3RTQB 4QLWA 1B0WA 4N0RA 5KBDA 2EACA 3N85H 3ZE2E 1AH1A 2H47C 4FG6D 4NIYE 2P8MB 1D5ZB 1D5BB 3HZKB 4L4JA 4X6EA 3VXOA 4XGZB 3VI4F 3UPRA 4K7FB 3L9BA 2GABA 2IMNA 5E8NB 5I0VA 2Z65C 3NIFF 3N40P 3ATEA 2HMID 5EEXA 1FVEA 2HVJB 4NLAA 3U2IA 4N0CC 1IAOB 1H3UA 3IN0A 3O3AB 2VERA 3VUAA 3HLAB 2FAUA 1DSFH 4UBDD 3NIFB 3WUWB 3QAZC 4H25A 1F3JA 1S9VA 3STZB 1U8PA 3HC0B 5B39A 1MI5E 3QS2A 1CMOA 2XWXA 3ZW3A 4K9EL 1J05B 2G9HB 4NKQB 5EWIL 2A6JA 3D51A 1KB5H 2VR7A 2OCFD 2B15A 3BDYH 5AAWA 1NPNA 3MBEC 1QO3A 2XBTA 4ZJ9A 2Q86A 4BSJA 1Z9SB 4O2CA 5C9JB 4L8BA 1FLTX 3LPGA 3K1DA 1EZSA 1T1ZA 1PX3A 4KK8C 3F7VA 1W0WB 4QCIB 4LZKA 3ZE0E 3LNHA 5HGAB 5INCB 3TP4A 3S5LA 4RRPG 4OSUL 5ILTL 2VDKH 3K80A 3NG5A 3WEXA 1CI3M 4OD1H 5HXMA 5F7NC 3ABLB 3NRPA 4XNQB 3BUTA 2X9ZA 2Q8BL 3N50A 5JLZB 1KB5A 3JV0A 2F58H 4XN8A 1KV3A 3AWFA 3IPFA 3MLWL 5DZ9A 2KPWA 4NO0B 5JUEL 1ACCA 1U8OA 1MVUA 1J8HD 1XIWB 3IAGC 4PVBA 4CJ1A 5IFAL 2KT6A 1MFAL 2HFEA 3SDCA 3U4KA 3MBEB 3LIZL 4NCDA 3FCTB 4FTVD 4WU7A 1XCQB 1LO5A 4YDIL 4AL8L 1YMMD 5FOBA 1KXQA 2EABA 1IZKA 4LGRB 4N0UE 3BDBA 3IMTA 1FORL 43C9A 5IW6B 5KBKA 2B0SL 1A8JH 2PW2B 5TE4L 3D3VD 4OLVL 5AW4B 2EDMA 2YD4A 3G04B 4AVKA 2YD1A 4ZMOA 1RMFL 4URTB 4XNUL 5CGMA 1YUHA 5HDWA 4R8WL 4IBYA 1X7TA 1OP3K 4FP8H 4HK3J 4PJ8B 1X4XA 4JANB 3WFEH 2AC0A 2LVCA 4GPVA 3IDXL 3NJXA 4HH8A 3FT2B 4HS8H 4LSTH 4PRNB 4FXKC 1IVLA 4PGZA 4IK7A 4J3OH 3WTTA 3QXWA 1YNLH 4UM8A 1B0GB 1N6VA 4AEHL 3FL7A 3MR9A 1WJ3A 3L3KA 5JW5A 2NMSA 3UZEC 3RBGA 4KTDH 2EKSA 2CUMA 1JTTA 4X80H 4YSRA 4Z7WA 3B2MA 4PJHA 3B7SA 3GTNA 1EFXA 1IC4H 1ZSHA 4J6RH 4NQVB 4M7JL 1JPGB 2V6HA 4FNSA 3OZ9H 4IBUA 3FFCB 2DI8A 3QEHA 4Y2LA 4NZJA 4C4UA 3R4DA 4J3OG 2B59B 4MXVE 5ICUA 1RHFA 5MP6H 5HJDA 3HB3B 2YD6A 2XLLA 4P2RA 5KVGH 5SX4H 3AACA 1DDTA 2Z35B 4RFOL 2Q1EA 2OXGB 3RTQA 1IAKB 1OP4A 3MNZB 4JQIL 4W4OC 4CKVX 5I1EH 1P0SE 3FXIC 5K9KA 1Q9LB 1PQZB 1W80A 2R1XB 2CALA 3B1UA 4P5KA 3FRUA 2F5AH 2JKRM 2TSAA 4IU3A 4CW1A 1Q94A 1FCCA 2IO5A 5AZEL 1JYWA 4NSKB 5HDQH 5KOVC 4B7IA 3IFLL 3NCWA 2EDYA 2YSTA 4P4KC 5CWSB 1BIIA 2VISB 1WFUA 3QIWC 4D9QD 1K4CA 4AYMC 2FX9H 2JB5L 3G9AB 4RX4D 1NGYA 3ZHNA 2DDQL 1R4XA 2X4OA 5FXCH 2BY0A 5FUCC 5HYJB 3QI9C 1Y1DA 1KB9K 5I1JH 1A7PH 1GCFA 1TZHB 4WTZG 3X1GA 2J6EL 1PFOA 3VXSA 1DVZA 1F4WH 1J0JA 4IOIA 4Z5RA 3EO0A 4RGMB 3VM5A 5HHME 2PABA 3GRGA 4O02B 2XVLA 3F12B 1GGIL 4AQAB 1L7IL 1P5VB 1ORQA 3WIAA 5C9JA 5G4MA 3REWA 1IC5L 5GJSH 4AM0Q 3VXUE 2OS7A 2XICA 5FO7B 1MJUL 1RK7A 4KY1H 1P69B 5E24E 1E28A 4HPYL 4N87A 1IBZA 2JELH 4YK4B 2Q10A 1T1YB 4LLAA 4HFUL 4YSPA 4MNQE 2MHAA 4LMQE 4WDIB 2AITA 3HG3A 1AKPA 2PNDA 4X7DC 3UOAB 2B1HL 3BEVB 2KDGA 3DX6A 1JG9A 4UQAA 1VZGA 3ARBC 1OAKH 3ILQC 5ESVB 3UADA 3GLDA 3V4PB 1BXAA 1DZBA 1RCYA 4WI6A 3CXDL 3T4YB 2HFGL 3MRRB 1U8CB 3G08B 4NDMA 2NY7L 4QMEA 4HS3B 4WJ5B 3FUJA 1ZK5A 3WY3A 1AKJA 3P0VH 3B83A 3BKCH 1BGXH 1XCQA 2E59A 4M1CC 5IHUL 2A6KB 4M8UA 4KO7A 5ALCH 3FHQA 3FULA 1T1WA 2YMOA 2ZOLB 2E9JA 3K0YA 4PCYA 3TJEH 2VZ3A 1HESA 4BKLB 1USQA 1AS8A 2ODHA 5I17B 3KLAA 2NX5A 4XAWL 3ARGA 2Z8RA 5AOIA 3DVNA 4U6XB 3HG0A 4B9ZA 4JBSA 1YPZE 4NFDA 3O2VH 3OL2A 5E2WH 1X5JA 4Z78A 3ZGIA 2WBJA 3GSOB 4X0KA 2GSIA 3VGGA 1RURH 4MDJA 3OZKA 1S7SA 4WGVB 2X38A 4HIHA 1PVHA 3GI9L 2XTJE 3V0DA 3E2HC 2RQ8A 4HQQH 1JPTL 1QAWA 4ESKA 3MRMA 2GY7B 2WXNA 4Y2DB 2ZCZA 1MCLA 1KJVB 1UA3A 2ZKXA 4M48H 1GRWA 2NUTA 3FKUS 4RMUA 2Z4QA 3JTTB 3WHXB 1UA6H 4ZK8A 3UFIA 1OCOB 4Z0XA 1J9TA 4HKXA 2PPCA 4LSSL 1U58A 4X42A 1KTCA 2D3JA 5GS0D 4XP1H 2R1YB 1YEHL 5I74C 3H54A 5TQ2H 1QSFA 4XR8C 5E6ZA 3K8LA 3L2MA 2O30A 4NX0A 4H8UA 3FS9A 5KSAD 2Q0ZX 4QO1A 1B9KA 3HCVA 1IAII 4NNYB 5EDXA 1R9FA 4JJ5B 3D0LA 1O7DC 3WMPA 5EC1B 4YWGL 2QPDB 3VXRB 1IM9B 1O6VA 1Q0YL 3ARRA 3LN4B 4A7VA 3CIAA 2DBLH 3ZL1A 3LNGA 2GPZA 3APDA 1X5HA 1N67A 1S3KL 3NIGF 2XC8A 4ODVH 4ABWA 1CQKA 1GYWA 1IC0A 4IIQA 4U1HA 5T3XD 4L2YA 1AE6H 1MI5B 1M53A 1JK8A 2JCCA 3GRBA 3GXUB 3LPWA 9PCYA 5K9QI 1BMWA 4I5BA 1EZVX 2A6DB 4IKIA 5GRUH 2VAAA 3FSWA 1D5MB 4L0ZA 3AG1B 1JZJA 2ED9A 3CDGA 4ZAKD 5HVWA 5I15L 1A6ZB 5D7JA 5KSBB 4P57A 3FB5A 3NIDE 4X5PA 2YD7A 2M26A 5C0IA 4FXLA 4KO6A 4M02A 2D0FA 5GHWL 5CEYB 5DQ9B 4RZCB 4WK2B 4P2YA 5DT1H 2OYLA 4YBQC 1F0LA 2QADB 4FADA 3TU6A 3NZ8B 3ARXA 2FRGP 3FQ2A 3CZUB 1ROCA 2HKFH 2MIZA 1DUYB 5J57B 3DK0A 2G3NA 4DVBB 2XWJB 3SKNB 4V2BA 1T1YA 3WEBA 4LPTA 2DTML 1ODUA 1MCCA 3M1BA 1TLKA 1Q0EA 5LGHL 2QBWA 1U8MA 2A4CA 1A22B 4H88H 1KIUA 3QIBD 4FJZA 4KI5F 2O93L 3B3IB 3RUGB 5TK2A 3WKMH 3QW9A 4PGCA 4UWQB 1J8SA 2UVFA 4M9PA 4K7PL 2IOIA 3ES6B 4PIRF 3BSZL 2XV0A 2D2OA 4BCYA 3L16A 1Q90A 3VA2C 4PJ7F 4YPGB 3OGCB 4A55A 1PMYA 2R0KH 2GFBA 5EO1A 4OQ1A 3QQ3A 4NQSA 3GK8H 1H5BC 4GSXA 5GGSY 4PM1A 3RVTD 1MIMH 2EE2A 5DJYA 4I18B 3IF1A 1OSPH 2AK4D 4ZXBA 4FYQA 3GBNL 2EDDA 2JJTC 3REVA 4APXB 3NRQA 3Q7JA 5AOMA 1NPJA 4K4KA 3UXFA 2P8PA 3VJ6B 2IANB 3IMRA 4KRLB 3VXMA 3LEXB 1KDJA 1T5KA 5EPMA 4LCVA 3QYNA 2HMIC 4YHLL 4X6FB 1BZQK 3IJHA 3HN3A 5I1JL 3TV3H 3LXBA 3R1GL 1DHKA 4M8RA 3S34H 2J1YA 2KMWA 4E42B 4LIQE 1GW0A 3VQ1C 1VRSA 1FGVL 3E3QE 4BZYA 4ZTPH 1JZHA 3D30A 3QNZB 3BO8B 4P2QE 4G8GA 1I7ZA 5L2JB 5C3TA 3QISA 5GS0L 3RPIB 2W9DL 3VWJC 5K1VA 4NNYA 3D50A 2B3IA 3RLSA 2V2XB 2AAVA 5A3ID 3BAYA 2R39A 4UQ9A 4P5RA 1E3XA 2Q76B 3D39B 3QUHA 4NQED 3MRFB 3PJSA 4UIKL 1AHWB 5GJTL 4F92B 1UH3A 4FX5A 5CFAA 3MNWA 5H37A 3MRGB 5T3ZD 5J06A 1R3KA 4KH9A 4J3TA 4A68A 3CXFA 5MEND 1H3PL 1BAFH 3IFOB 5C70A 5LG6A 2ZICA 4HKJA 1MFBH 4HJ1A 1XBRA 3KD4A 1AS7A 2HLEB 3TURA 5KSAC 5EZLA 3RI5F 3M8OL 4GINA 1PAMA 1FJ1B 3RZCB 1JHLH 2ITFA 4C57C 2J8OA 4S1DC 3HG1B 4UQBA 1PY0A 4YJZL 1P7KB 2XVKA 1NMBH 2R8SL 2WCPA 1HI6B 3ECWA 3T65A 3NJFA 5JW3L 3E0GA 3WS6C 4XNBA 2AJVH 4JX0A 1F4WL 2X4QB 4NQQA 1MCOL 1HE8A 3KJ6H 4LF3B 4N8CH 4WCYH 1YEEH 4N0YL 5E8DL 1X9LA 2WO2B 4NWTL 5MEPA 3S4SA 2DMCA 3ARPA 5DRNA 1T1XA 1E8WA 3JTSA 4OZGB 5FB8A 1NCAL 2VRQA 3GMMA 5CINL 5JIDA 2QPSA 2P3YA 3TEXA 2D2CC 5GSRA 3ZE0B 3RVTC 1WP6A 4JG0H 1CQYA 2J21A 3V10A 3VRLF 3ASOB 1H6UA 1I1AB 1CI5A 3BVDB 4TVPH 5HI4D 3MA9H 1S7UB 4X5LA 3CJJA 2GJ6A 3IEAA 2JTDA 2EVIA 4ZW7A 1AVAA 1SBSL 3QXTA 3IWVA 1K3IA 3DROB 3DV4A 4NENA 5I0ZA 1U3NA 4J1UA 4YDKH 1ZHLB 3LV3A 1QTSA 3X11A 4FQPA 5D96C 3ZKMC 3VFMA 4R4NC 1JFQL 2D03L 2X4NA 3QAQA 3RWIA 3D25A 3RX8A 1KJ2B 2X1XR 3B34A 4D0DB 4OD1L 2K4AA 1TJIH 3FCSA 3O9WA 1ZHBA 2YOCA 3ARVA 4KKPA 3QEQD 5GXBB 5KYXB 3QH3B 1HAUA 1XAUA 4QRTA 3TVMD 4GBXC 4BCXA 3BAJA 4X4ME 2WBJD 4AW7A 1FFOA 1EX0A 3OC8A 4NUPA 1TZOA 4R7VA 4KXDA 2Y6SC 2X6BA 2F19L 4NZ8A 4WTZA 2RTTA 1T7ZA 5D2NB 3I50H 1F02I 3ZE2B 1RURL 1CGWA 3QJHA 4EPSA 5KSVB 1MHPH 1RUQH 5SWSE 2WQAA 4G6FB 3HA0A 4BWWA 4U1MA 2DI9A 3MRDA 3MYZA 4LKXB 2EDWA 5MEOA 5DGRA 1U93A 4OLUH 4Z7QE 1BZOA 5E2VL 2BOCB 5FUZL 1S9XB 1Q4NX 4I13B 4KI5D 3ZTEA 1Q9OA 2HA1A 3QXVA 4QRSB 1RUKL 4EI5B 4MJ2A 1DSWA 4IRSC 3TYGL 1F13A 4LCWA 2Y22A 1NLDL 5C07A 4G8GB 5HHOD 5MHSE 3WTYA 4YL4A 4JKNA 3ARWA 2Y1AA 3UJIL 3JWDC 2R0LH 1TU2A 1Z66A 2R23A 3QIWD 3VRIB 2AJZB 1O6SB 2X0VA 1UACL 4OGAC 4XC1H 3EFFB 5B21A 4L5FE 5IK3A 3FONB 3K8MA 4Y5VA 4JREC 1S7RB 1MRFH 1UWYA 3C2SA 3QUYA 5J4MA 3RGVC 1T2JA 3D4YA 3QUGA 3L5JA 4BJLA 1OCWH 2YZ8A 1UZ8B 1HK6A 2FSEB 4F80A 1ZHNB 2C9XA 5I30L 4XOEA 5CJQL 1GGBL 4UQ3B 1S3KH 3KZ8A 2E27H 4N6RB 2ENQA 4N2CA 1YG9A 3MRBB 4MMZC 1I8KA 2Z3FA 4Y9FA 2V2WA 2D0HA 4LT7A 1CE6B 4XPGL 3RVWC 3WFDL 4JFDD 1VDGA 5DJ8B 3FUEA 1JGEB 3SBRA 3WO4B 2ZAIA 4TPRH 5F88B 4TNWK 5E1QA 3WELA 1M56B 4EZLA 4XMXA 3KWXA 5FYJE 2H1PL 4KQ0A 2VUOA 1IE5A 3OKYA 3TYFA 2J55A 2VDML 4HHWA 1P9MA 2Q3AA 5TH2B 1JUFA 1HSAB 1NSNL 3RGVB 4PN6A 2XYCA 3NSJA 5I0WA 5A2CA 5C0EA 1EFXD 4WHYH 2YLKA 2QSVA 4RFNC 3WNLA 1P84K 3OKEB 2VO8A 3C8HA 3PXJA 2GAZB 4XB7A 1ZLSH 5I1DB 2H1LM 2D31A 1T22A 2H32B 3BD3A 3QGVA 2FIRT 5DFVC 3VG0L 2R1WA 3L9RB 4IS6A 2R2CA 2HH0L 4JFQB 4OH2A 4K71B 1NFDE 1I1AA 3BGFB 2NY3B 4E9XA 2BVQB 4NN7B 1YJDH 4TNEA 1GOFA 4IGBA 3MRHA 3DXAA 2VDNB 3BVVA 2K8QA 2YARA 5BV7L 3T6QC 3UJTL 4YZFF 4JPQA 1GS7A 2APFA 4QHMA 4X5QA 1KIQA 2IBBA 2NT1A 2APSA 4HWNA 4LBEB 1XL4A 4R90H 3UBXB 4KZ0A 5KBNC 1LTXA 3SBPA 1AGEB 4FQXA 4PI2A 3P73A 3P30H 4J3UA 1EAPB 1UKQA 2BSCA 3W39A 1A2YA 1C8QA 4G9FB 2EIKB 3EXJA 4PGDB 4RISL 2LE9A 3UG3A 3DBXB 3MV7E 2NR6D 4J3OD 5GJTH 2IAMC 5AAMA 2CD0A 1AXIB 4KGJA 3L3OA 5CP7A 5I1AA 2BW4A 3PWUB 1I53A 3BGFC 3RJDA 4C56E 3D9AL 5D1ZC 4L05A 5HHNA 2NZ1A 2O5YH 5DJ2A 3X14B 5E4EB 4F9PA 2OCJA 1Z5LA 3FFCE 2IPTL 4JAMB 4TUJB 3DX1A 3QJHB 2EVFA 1NLBH 4FCHA 3RL1B 4PJIE 5ANMA 3RHWF 4LU5L 4F5CA 1GYCA 3VTAA 5MENA 2EQDA 1T0MB 3LY6A 4Z95H 4PS8A 1I75A 5AQ0A 3T0VA 3DUSB 2AJ3A 4IK6A 5KG9A 5BUAA 4KUZL 2Y7OA 4TUKH 3KNBB 4GRWB 3RB7A 3SBQA 3S96A 4XPAH 4Y88A 4PRHB 3V52L 3VFUA 1QLEL 5DUBA 3CK0L 1AQMA 1HQRA 1O5DT 2A9AA 3AB0B 5C6TH 3P2DA 3MMEB 4MASA 4X9GA 1JGUL 4DGWC 2WM0A 1S8DB 3VI3B 3SPHA 1RJZA 4XMLH 2BCKB 2KLSA 1NEZB 1A3ZA 3JWDH 2OX5A 1JRHL 1W16A 4ONHA 2QV4A 3JVGC 1HHGA 3KEDA 4N8CL 1G9NL 3LKNA 4RGNE 1CLZH 2IQAB 3P54A 1XGYH 4XCYB 2ALAA 3L5HA 1BM3H 1DJGA 1I7UB 3WFHA 3MV8D 4KRNA 1JPSH 1P5UC 3F6IA 3AREA 1Z0MA 4J2XA 2EH8H 5LWYL 1DLFH 3L81A 2VXVL 4FS0A 3TNMA 2CO6B 3TN0C 1D5RA 2SEBA 1QABA 3F85A 3SDAB 2GHWB 4Q0XL 3LS4L 3GSWA 1GY1A 1L4IA 4K94H 5I8KH 1IGCH 2OQJB 3K4DA 5CILH 1XB8A 2VKXA 4EDXA 5DU7A 1TSHA 1FZMA 2I7OA 3OPUA 1V27A 5AOLA 2BPBA 5IW1A 3EJZD 3EGDA 3MRKA 3PQYA 5T5FA 4R7XA 4LP4A 2NY2D 1B0IA 1R5IB 4FABH 2CAKA 5KSAB 4WEEA 2FWUA 5DQJA 1IIKA 4JFDA 1S7XB 4Y9BA 5I9QB 2G5RA 2AKRA 3UEZA 5EC2A 4UOQA 4R4ND 4BKSC 2LFGA 1OCRB 3C60C 3FQWB 1WZMA 3TLRA 3VI3F 2VDRB 4EIBA 4A2EA 4A2FA 2XXCB 1T03H 4XBPA 1AYOA 3JZ7A 4JFPA 2W91A 5LCVH 1JBJA 1KIRA 2NR6A 4Z7UE 4OI7A 5HHXL 3QHTC 3QZMA 4DN4H 2Y7LA 4N2MA 2BVYA 5K9QG 1UA7A 4FFYL 2WUBL 3STLB 4FI7A 4UTBA 4JDTH 2VERN 1I1RA 2TAAA 4GYBA 1KXTB 1ITBB 4ADIA 5SWSA 1CFQB 1DLHA 1WD8A 2WLMA 3Q1EA 3LZPA 5HGBA 1H3GA 5EB9A 1ETA1 3GHBL 2XXMB 3SGEH 3TBSA 2BSRB 3TWCL 3MV9A 5LJYH 3HRPA 1FYTD 3NJLA 4XPHH 1CG9B 3IFLH 5AW6B 3DIVA 3ZLQC 1ETJA 1CN4A 1O7VA 5DMIH 1RIVH 5LB1A 4HJEA 4NBYB 1Q9WB 2FIKB 3SE6A 1LP9B 3CHOA 5IROD 5D55A 4QRPB 2DDQH 4EBQL 3QDMA 3CK0H 1A9EA 5TF0A 2A1WH 4KKNA 4UIMB 3ARBD 2GTWA 3JWOC 5ESAA 2D7PA 3SKJH 4JDEA 5HD8C 1L0QA 2ZCHH 3O0RL 5HJ3A 2G75A 3PS6A 5HHNB 4P2QA 3TN0D 5FHAL 4YX2L 3ZHLA 1KENH 4XX1E 2HFFA 5JDSA 3KBHE 5C0CA 2A74A 4OQTL 5C0GB 4Z3GA 2C1PB 4FNRA 2NTSP 4XOCA 3GXMA 3FPYA 4B41A 5EOTB 4ALAH 3QCTH 4LQFL 4L23A 4DTGH 3KS0H 2BFVH 3C8KA 1KTDB 4OZHA 3FF8A 3BX7C 1C1EL 2WMPA 4UOZA 3RVUD 1EJ8A 4HFUH 1S5HA 4KKCC 3PE9A 1SOXA 1HCYA 1YC8A 4LGSB 2NY0D 1PD1A 1NGXA 4OM1H 4BK4A 3QI9D 1JHKL 5IOPA 1HVXA 2A0LD 1UJTA 2EYSA 4YHOH 1V7NH 3DETD 2VXQA 2V9TA 2WWMC 3HLKA 2IG2H 2GBUA 5KYYA 1X5GA 1NIDA 4NJAH 1FN4A 2FSDA 4Y2OB 4XN1A 3ATDA 3O6LL 1RSYA 2BNQA 4QPEA 1T6BX 2V4LA 4W93A 1LO4H 2UWEE 5E2JA 5BO1L 4YSSA 4HSAC 1YMHA 1RIUL 1JVKA 4FTVB 2AJYH 4R26L 3TJHC 5B8CB 2V0AA 4PQXA 2ZYHA 4S2SA 5FW6A 4A6YL 5LAXA 5T3ZE 3V9EA 1EUTA 1E5UI 1ZPUA 2DWYA 4J8QA 3S3CB 2ATPA 4Q6YA 2UWEB 3VFNA 3VDCA 4R7DA 3LSOB 1A14H 2A6IB 2BIHA 2LAGB 4LLVA 3W5NA 3BH4A 4OD2B 5F21B 3AU1A 3JV6B 1HXYB 2FO4B 2OMTA 3R0NA 3EYSL 4KKCD 2WTRB 1DYZA 4QYAA 1ULVA 1WFJA 3CUPB 3BKML 4OZGF 5AYUL 5JW4N 1M7IB 1DVTA 5T1DL 1KCRL 4G7VH 3FTGA 4E9TA 1LO3H 4EIZC 1G6RA 3MOBH 4GXVL 4YIQA 4NHCH 2FO1A 3MLTB 4JFXA 1OAJA 3IGAB 4FQIL 3O2WL 1P9MC 3RAJH 3LZLA 1R34A 4FHKA 2HT3C 3Q43A 4ZX4A 3CBKB 4IRZA 5DK0A 3QNXB 1ZAGA 4N5ED 4AYDC 3WENA 4JM4L 1KPRA 4XP1L 2Y25A 2EEFA 5IROC 4HOWA 1I3UA 1NCBH 2B7DT 4ZUWA 1J9CT 4N2GA 2ISDA 1A6TB 1V5JA 3QA3A 1SJEA 1XT5A 2J1WA 4KZEH 1SEQH 3LRMA 4BH8B 1NIBA 1J11A 2PR4H 4PG9B 3TX4A 1YPZB 4GW1A 2OI9B 2HX8A 5MEQA 1RJLA 1ZRUA 3U1QA 1J5IA 3NCXA 1V8HA 3GM0A 2EE6A 1JGUH 3F62A 4PY8J 2ZZUT 4CADA 4PRHD 3VSTA 4IU2A 1Q9WA 3ME0A 4ELME 1SOQA 2VLJD 5L7XH 1A3QA 1UVQB 2Y36H 2BWDA 2CRIA 2ITDB 4QRPA 1FZJB 2QPFA 3D2TA 3EGSA 1HQ4B 3MLZL 3T0ED 4PBWD 3L4TA 3S4SG 3AJ7A 4HGMA 1V10A 2CRZA 2Z92A 1VHPA 4NC1E 2CIKB 2EO9A 4J23A 4PREA 2VRAA 4AGNA 4AITA 2NT0A 1AZZC 1ECZA 1KPUB 2V5RA 3HBPA 2OTWA 4P0DA 1YMMA 1NAML 3EG9B 4JZJC 4W9GC 2D9QB 2EC9T 3ZT6A 4E9VA 1PW3A 1ZDQA 1C5CL 3U9PH 4V33A 4OT1L 3VXUB 4R97C 3AM8A 4A67A 3FZUD 5EBWB 1ZCRA 2F7QA 1NGXB 3V6OC 3B9KC 1SDDA 2I24N 3OQRA 3PP4L 3CFQA 2AQPA 3T2PA 4CUCA 3DX8B 5AALA 5BZXA 1PG7X 1T7YA 1XF4A 3FT1A 4N20A 4W9CC 4D9LH 5C2BH 4I88A 1CYWA 1TJHH 4X9FA 1A6AA 1XR9A 4BQBA 1Q9KB 5AW7B 1Z9PA 1HOEA 5CZKA 5KSUB 1OGAE 4JN2B 1CFTA 1X5YA 3FUIA 3SKOA 3FO1A 4X9IA 2VWEC 2W5PA 1QLRA 4ZYKB 5L8KB 2CJUL 5AD0A 4Z7VE 3SGDI 5LCVA 3S97C 4WLCA 4JRXE 1NCUA 3EYUH 5A7EA 3VDAA 1CU4H 3BZEA 1JXDA 1QSEE 2N3JA 4PV9B 2AI0H 3DVFA 4OZFA 3QPQD 4LL4A 4JCWA 4WUKL 1CT8A 1F58L 5FK9A 3RTQD 3T04D 1WFTA 4DT2A 1A1NB 5FWQA 2QQLH 2X6AA 4L1BA 4XP9L 4OUUB 4N8PA 1FRGL 1QBLL 2HJKB 2YWZA 1ZOXA 3THML 1R3HA 5EBLA 3OJMB 4WI0A 4Y4KC 4JE0A 1SXNA 3QC5X 1ZT1B 4F8QA 1W15A 3SE9L 4M1CD 2YXFA 5IGXL 1N10A 1G7PB 1MZZA 1UYWL 1ZVHA 4TVUA 1M05A 5AZ2L 5F7DB 4HZ1A 1QLEB 3GMPA 2P5PA 1FYTE 2B2XH 2Q8BH 1ID5I 4AQ1C 5HPMA 1MFDL 1H6TA 1PX4A 2NXZC 4LSQH 4P5TA 3SD5A 3ZDXB 2W0PA 2WHVA 1QACA 3CHXA 2MCG1 1D9KD 4OLYL 5C0AD 4BH7A 5HI5D 4DP1X 2ZF9A 4Q7DA 4P2OD 4A66A 3UCQA 4JFEE 4JNXA 1T0PB 3ZMEA 1E43A 5L88L 3CVHH 3CSYB 2NY1C 5F71A 2CE6A 2CKNA 1E9QB 1NAMH 3BQVA 5DC9B 2ZUTA 3H55A 3TTYA 4DKDC 4K5OA 1DJWA 2XA8H 4KHTL 5I1GL 5BV7C 4KQ3H 3MO1B 1QFWI 1TTBA 3F65A 4FQJL 3MROA 3C6LB 1GIGH 3OM3B 2WXFA 5T3XL 2VT0A 3FU7A 2FYYA 2O6DA 5E1AA 2X42A 4L9LC 3WD5H 1JYXA 2XETA 1EK3A 2QFPA 5ITBH 4NRXA 1CGTA 2NQDA 4PJ8C 3HE7A 4ZFFB 1JXGA 3BUYA 1XTMA 5GSVB 4DGUA 4F7CB 5IKCA 5ERWB 3WN5C 3KMDA 4PV8A 3AS1A 3ZSSA 3ZRFC 3TFKD 2G2NA 1NM9A 4JFFE 1IGJA 4J8RA 1SQ2N 3KPNB 1JWSB 3OVUB 1FC1A 3KYNA 3UL4A 5IP4A 2DWEB 2LTQC 2KDYA 2CO2A 2CDGA 5C08A 3ZE1B 3GSUA 4LHUG 3V6OA 1J7VR 1I9IL 2HTLC 3GM8A 2WK2A 4HALA 2C3VA 1D6EA 3FB8A 3KCWA 3DO3A 4X5XB 5HYIA 1IGYA 5DYOB 2DOCA 1BYOA 4LEEA 5CCKL 4KKLC 5AEAA 2VDOL 5I8CB 4GUCA 1SMAA 4DKAA 2NY0B 1C5DA 1MFBL 3ZXAC 1C1EH 3SJVE 1NICA 4MXVF 1QLFB 5ACMA 3RX9A 3G6DH 4BQ8A 1F58H 1XF4B 4PWIA 4PJXB 1EDHA 4UT6H 4BDVB 1DL7H 2FGZA 4I1NB 5DYFA 5I8EA 5GGSB 3WI9A 1RLBA 2NNCA 1LYQA 1ETZA 3ZZQA 1Y18B 1FSKB 3FH7A 1GY2A 4AXWA 2OI9C 5B1JA 1NGZB 5AB0A 4JN2A 1G9NC 4MAYB 2LLGA 3MRNA 3NYKA 5E8EB 1T7XA 1IBFA 4HH9B 3APMA 3W37A 3L3GA 5JIIA 5AD0B 1G7LB 4G5ZH 3DURA 1YY9C 1MLBA 3CFMA 2QVMA 4O51B 2I60H 4MMZA 4N0YH 4DERA 5IHWA 5KYWA 2A0LC 4XCNB 1U3HA 1A5FL 4TQ8A 4YDVB 5MP6L 1FIGH 4WFEE 3DUUB 2O61A 4WIQA 3EUUA 3G6JA 4NERA 3R7QA 4JM2D 4ZMWA 1DANT 5CKGA 1VFUA 2J25A 5D6CB 3SY6A 5I66B 3O2DL 4MNQB 3OQ3B 3AROA 3BT0A 1YC7A 4MMXA 2N7BA 3FN9A 1O7DE 3QUYC 3ZIMA 1KCVL 3C5SB 3WIFB 1NKOA 4JPVH 1JPST 1DVYA 2AXFA 1SMOA 2DH3A 4B9CA 3BI9X 4QHNB 5FA3B 2E9GA 5HD8D 3VWJB 1I7TA 4TNVK 4AM0A 4OKVB 2EECA 3G9VA 5DWUH 3V95A 2ERJB 3MV9E 3IDIB 4PJXF 2FX9L 5DVNA 4G6JL 1OB1A 3T0EA 4WFHE 1JVLA 5F3BA 4BWTA 3NOIA 3MCKA 4WSJA 5AOJA 3O3DB 3UX9B 3WIIH 4H8HA 4XX5A 3ZO0A 4D0CA 1G1KA 1VGKA 4LHUA 3D39D 4NQEB 2AEPL 5D7IB 2PTTB 3IMBA 1FH5L 1D5BA 4APQB 1A0QH 5CBEB 1MELA 2EYTB 3TH3T 4Y19B 3LNFA 1MWAH 3TBWB 3MBED 3SO3C 4H8QA 4XO4A 3N43F 1CL7H 3T3PE 3VCLA 3HJEA 3P4OA 2B1OA 1ACYL 4FKKA 1GKOA 1ET8A 3OV6A 4R7LA 4EI6A 4PJCE 1YUKB 5B39G 2CBMA 5JR1H 1Z7JA 2ERJC 4UOW0 1HL5A 3T8XA 1E6OH 3BRFA 1BFVL 2EP6A 2EEDA 3L48A 3QQ9D 4N1EA 4D9LL 5C2BL 2BZCA 2VIRA 1XH0A 3BWZA 3KXFE 2E9WA 2ZWKA 4HUWB 4TMPA 2OJ1A 1SBBA 3HG2A 2G9HA 3B6SA 2RFXB 3D87B 2ZT9C 2CKBB 1JNHB 1AG0A 1UZGA 4FC3E 2G5BB 4UT6L 5DEJA 3EF4A 5CZRA 3S6CA 2JXMA 4CU6A 5D7LA 2WXMA 4E36A 4XPHL 3QQXA 5F44A 4JPWL 1JWSA 3W11D 2BP8B 3LYRA 5AYQA 4UT6A 1KCSH 4HUXA 4NUMA 1F4YH 3C2AH 3BOVA 3QQDB 2BS71 4N8VA 4C4BA 2QR0B 2ICEA 4GIPD 1A4BA 5BUGA 4FG6C 4P3CL 2CA4A 2VDOB 3FSAA 4JKPH 3SBWA 4OCNC 5EU6A 4ZUVB 4UF7C 1QI4A 3A6BL 1ZDSA 2K6WA 5CO1A 4MLSA 1TTCA 2CBPA 2OA9A 1ZMYA 3U82B 5JYMA 4FLHA 2WBJC 4FQ1L 3O45B 2DMHA 4JRXD 3ZQ9A 4H0LC 3TEYA 2JCCF 5FV2A 3S8GB 1ZEAH 1RUPH 2Y2TA 2VXTL 1OAXL 5IB5A 4KDWA 2EIBA 2KKQA 4ANXA 4KJWD 3G5WA 1T5XB 4HWBA 3SGKC 3MLWH 2ZD0A 1INEL 1N12A 5GRVK 4PY8I 1JD9A 3BMWA 3CFKA 4WJG3 4ELKB 5JPNA 1TQSA 4N2EA 3PHAA 4NXKA 1W8EA 2VDMH 5E4AA 4MXWL 2XKNA 4ZUUB 4GNKB 4CU8A 1CS6A 2Y7NA 4PJCB 4G9DB 3Q9PA 4Y4FA 1LO0H 1A6UL 3NA9L 2XXGA 4XBGA 4OZIA 1IAIL 4TRPL 3T3PB 4F9LA 1LO2L 1MRCL 1B2WH 3IU3A 3U36A 3PABB 4HUUB 3IJSB 4N85A 4HJ0C 5JA9A 1BXUA 4QHLB 1AGFB 3QZPA 1BLNA 1K3ZA 1JWUB 3N55A 4G6AD 4HZLA 2DF3A 2YGVA 2V37A 4MMXB 2MKWA 3K4AA 2OW7A 1U8QB 4X6BB 3WAJA 1NCOA 2I27N 2VGLM 1HEZA 3SDXA 4GRLA 5TQ0L 1YO4A 5E6RB 4GB9A 4PGBB 2FTAA 3U0PB 1B6UA 2FHCA 2NR6C 3BISA 4J3OC 4XMPH 4ODUA 3SDYL 1RFDL 3G5YA 4TL5A 2XZQH 3FQNA 5IGXH 5JLZA 5JOPE 4JY4A 1WFNA 3MTRA 1TYRA 1URLA 2YAQA 4JCLA 4KKAC 3RKDC 5TFSH 1WDAA 5JXEA 4OCXH 4MX7B 5C0BB 3WL9A 4JW3A 1IM9D 5FUZH 4TTDD 4CNIB 1AGCA 4MD5B 3DVGA 3VXNA 2PTTA 3H9SE 4ZX5A 3TF4A 4RFNB 3HHRB 5DO8A 2H9GB 4R2GD 3UTTB 2MQCA 3V0GA 4HOXA 3SDCD 1QWHA 2LQRA 4JFFD 2W07B 4D3CL 2R4SH 4ZQTA 3C5ZB 5B7MA 2VDLL 4HW6A 1AY1L 4HSCX 2GKIA 2HWZL 2RR3A 2PPEA 4AKPA 3TH2T 3IDMB 4WO4B 2YA1A 5I1CL 2UY6B 1X6LA 3MXVL 5JW4Q 3UTTE 3Q5YA 4AGOA 5JYLA 1ZY9A 4AUYA 1BX2A 2ATKA 1I4FA 5I1KL 5CILL 2O72A 2MTAA 2Y6TE 3AREC 5F7LB 4ETYA 3V0JA 1KG0B 1YYLL 2D7OA 1E5AA 2E9IA 4HA1A 4P2AA 3I9IA 4RBPK 2VN4A 4RGOL 3QG7L 1Y7VA 4BGDA 3QO1A 2FX8H 4JZOA 4KK6C 4TSBL 4WI8A 3WLWC 5I5MA 4Z7WB 2H6PB 4RIRB 1CGXA 4Y5XC 1EUUA 3LRKA 5IBUG 4ONFL 1D7FA 5BMFH 1I9JL 2VLRB 2VLMD 2VZ1A 5FA4B 3CLEH 3MLZH 1IARB 1J8KA 4FJ6A 4AH2B 5A2LH 3BWUC 1U8NB 3CN1A 3FQUA 2Z31A 3KPSB 2Q20A 3PHQA 2WB7A 5ESVA 3LKSA 4NQDB 2HG5B 4YS4A 1FI8C 1YEGL 1UXSA 2IXQA 4MCMA 5ESQB 2QMJA 4UIKH 3M7FB 5EUOA 5AVTB 5F3HB 4JM2A 1EQWA 3HR5B 2CCLA 3F7PC 4W9HC 4GUQA 3ISWA 1HTYA 1OE2A 3MRPB 3WCYA 1QSEA 1OPGH 2P28B 4HS3A 4WJ5A 4RAUA 2CMRL 1M6OA 4XCFL 4YZWA 3V6FA 2HFGH 3C6EA 3GHBH 2JKLA 3US1A 5CIPH 1W9XA 5DCCA 4Q2ZB 2ZOLA 4Y16A 3V5KA 1FO0H 3B7YA 3G6AB 4FHBD 4UDTA 3FPXA 4OAWB 2A9MH 3KLAB 3MLSL 3VD5A 3QWRA 1P4IL 4OJCA 3V0VB 1B3IA 2XVGA 3D12B 4I89A 2B9BA 4CSSA 3LMJH 5HDBB 3IMWA 4QRRE 3RVXD 4JG1H 1EBPA 5GS0C 4X80L 3TBTA 1P1ZB 3CSBA 2GK0B 2EDQA 2EIMB 1DBJL 1F6LL 3BVTA 1A9VA 2XUWA 4WHTA 3Q1SL 1CGVA 2Y3NA 1KCBA 3QE5A 4HKBB 1VCBC 3U30C 4XNMA 4TNGA 5HHPA 5AG8A 1E27B 2F53E 4RFEA 1XIWC 1G4MA 2F53B 5GS1A 4NYLA 3IU4H 1NANH 3K0WA 1XR8B 3L13A 3CLFH 1LE5A 4IRZL 1P4LB 3PGCB 3BZFA 4NO0D 3M7OA 3OR7B 5IESL 2ESVD 1BVKA 2F1EA 2XZZA 1KCWA 2DQTL 5DZVA 4ACTA 3B9DA 2ZYSA 3NP3A 2NRDA 1TETL 4N2BA 1J12A 1P7QB 2CBQA 4ZAKC 4MCYB 1GKEA 1YEHH 4KUZH 1EPFA 5C0AE 3RDTA 3ULAB 3S48A 2O6PA 4IW4C 5E8PB 3P9LA 1YECH 4P5MA 4NZRL 2CA3A 5FDWB 3CZEA 1WFOA 4Y4KD 1RZ7H 2F74A 2VKWA 4FXKB 4YNYB 1XBDA 3KJ6L 3ZHDA 4Z7VF 3BP5B 3FUMA 3M17B 3MV7A 5IQ9A 3FCUB 4OIIH 1OAZH 3WHE1 4PWHA 3VI4E 4OLWL 3GLAA 4DCQB 3B2DC 3K2KA 4JFTA 2WNGA 2JLPA 3CHPA 1AANA 2P5ED 4HCRH 1USZA 3JWNC 3O11B 3HG1D 1FZKB 5CUSH 1C7SA 4OIAA 4PP2A 5IJKA 4QOKA 2L7QA 2XG4A 4H13C 4A37A 2K7QA 2Z4TA 3L4CA 4QDGA 3GSNL 4MAYC 2C4FT 5LO7A 4E0RB 5ID0A 7CGTA 1AO7A 1T3FA 1KCRH 1KXHA 3E1ZA 1NEUA 4HIEA 4CU7A 2Z7UA 5EZOL 1IT9L 1YQVH 4JPKH 3LN5A 4L8DA 3RWEB 1T0NB 1MF2L 1S7VB 2Q7YA 5KYUB 2YBGA 1Y0LA 2FH6A 3E8UH 2NY7H 1RPUA 5HGHB 4PJBA 2ARJB 3T09A 2P80D 3OLEA 4GBXB 4NKMB 4P49A 4BFGA 2B4CC 1OKEA 1N7MH 3ZTDC 3BYYA 1MNNA 1QSFD 3KCPA 4ZDHB 4ZFOL 4R96B 1I9RH 2DLEA 4J12A 3WGUB 2UZXB 3EFOA 4LAJH 5FO8B 1XZWA 1ZKAA 4K7PX 4E68A 1Z9SA 3T2LA 3PGDA 3C5XA 2W0FB 1LP9E 4IBTA 2LABA 1C12B 2AXJA 4MQXC 1CGYA 5FM8A 3SDYH 1PIGA 1RPQA 3IE9A 1TQBC 1GGCL 2DEXX 4HJGB 2VN5A 3V5KB 4F37F 4GUPA 2OYMA 4MTMA 4LSPL 1J87A 5D1ZB 3ZY7A 1BJ1J 4V1DE 3E9TA 4IMKC 4KKAD 3RKDD 4XMWA 3RI5K 3WUWG 3W2DL 1PG7L 3GXDA 1XXFC 1XTLA 4DZ8A 3JSSA 5J5EA 4FJYA 4A7TA 1SYVA 1PGRB 2H0JA 1LVEA 4L37A 2EADA 4K9EH 3A67L 1U8OB 1CXHA 3GK8L 1E8YA 3VSUA 3ZRCC 4D3CH 1UACH 1KN2H 3BAXA 1FDLH 2P8PB 3QRFM 4LLDB 4F2MA 1FHNA 2PCYA 4GS7B 5DGQA 1NBYA 2J3SA 3EYFB 1JV2B 3CU1A 4IBSA 4QT5B 1HHJB 5DURB 1DQKA 4DVBA 2VE6B 1MCNA 1DFXA 5ABAA 1NAMB 5K9OB 4KVCH 4N90E 4LPUA 1E4XH 4M4RA 3ZO9A 4N0UA 3CVHB 2HH0H 2VSMB 3ZDZF 4IRJD 4HU8A 5JORB 3RZWA 1MJ8H 4UI2A 4BQCA 1FNLA 5H35A 5CUSL 5I2IB 4G8EB 1TFHA 3FT4A 1DE4A 4PBXA 1A7NH 3CZFA 3RUGA 1K8IB 1BOYA 2N1KA 4I3SH 4O2FA 4XNYL 4HGWB 1PKQB 4PGCB 3F7KA 2LVEA 4YEEA 3L7FA 4FQCL 4LLWA 4YHPB 3L17A 3OKMA 4G1EA 1NMAL 5BOZG 3K6SB 2OR9L 3O81A 4LSDA 1IX2A 4LCCB 1I85C 4FI6A 4M1GL 5IF0B 4MWFA 4AT6B 4X9HA 3D69A 4D7PA 1KBKA 2IG2L 3IDJB 4XO5A 4NRYB 2GY5A 2MH4A 2VMJA 4G7YL 1R5VA 2WZPD 1BVNP 1TIUA 5AVYB 2YRPA 3A22A 1OF0A 2YRLA 4I8DA 2VDNH 3L6FA 4LEOA 4PJ5D 5EU4B 4U1GB 2IDFA 1NFAA 3LD8B 1XF3A 4KAQL 2WLHA 4GP5B 3VWKA 5I16A 4O5LH 4FXGC 4NBXB 4XAWH 3HE6A 3NCJH 3EOTL 1ND0B 3BT2H 4HYTB 6FABH 4DVRL 1LK2A 1WBXA 3H9SB 4N2AA 1WAPA 1T3FB 2FVNA 3OAWA 4BKTC 3UYOD 4ZZFA 3LZQA 3W9EA 3QNFA 1DCEA 2VJXA 3VRJA 4N2KA 4PS4H 3QJSB 3L8QA 4MD0B 1ETB1 3V4VA 3ULUE 4NI3A 4L8DB 3RWEA 3NCBB 4F1ZA 1CZ8H 4MD4B 4XVTH 1C5BH 1MRDL 1Q1PA 2C9VA 2WJ7A 2CH8A 1NIFA 4LQ1A 1YY9D 3KPSD 2WNKA 2WQRA 3RWCA 4Z7WF 3IRCA 1RL1A 3VB9A 3BZDA 3HAEB 1DDHA 5A2JH 5FGBC 3EYVB 1VKXA 3HZVA 3U7AA 1J8HA 3MRFA 4YFLI 4DQAA 1KWGA 2NNRA 1CLYL 2L8AA 5AUMB 1RU9L 3V8OA 2O5YL 3QZWB 3PWPD 4K23H 4RRPA 2EH8L 3ARYA 5LWYH 5FCUH 3LV3B 3CQFA 4AMKL 15C8H 3T3PF 1PSKH 3P9WB 4HEME 3WO3B 4X6DB 4MYPA 2L3BA 4AL8C 4X0NA 4BUHA 4G7QB 1MXDA 4PLNC 3R06A 4FYTA 3RFZC 1VERA 4WRLA 4JO1H 5DK2A 3THMH 3IVKB 5CEZE 3KGTA 3MODL 3FO2A 1QYGH 2VQ1A 4KXBA 3BWAB 2HXAA 3EH5B 4QTHB 2HT4D 3P3TA 1U8LA 5FGBA 5I74B 3JQOB 3UAAA 1P4UA 1TJIL 4QNPE 5EIIA 2YGPA 1ZGLA 4M6MH 5E2TL 1QPXA 3WY4A 4HEPG 3GMLB 2ZWZA 4OFKA 3KHOA 1OOWA 3I9PA 3LQAH 4UTAL 4WW1B 4ZTPL 2A6KA 5J8OA 1LILA 4WWKB 4Y4HC 3LNDA 2VYRE 5C6PB 4HXAL 4XCCH 3NFNB 3VI3E 2FEEI 1PLGL 1Q9OB 4HS6B 3RRQA 1Y07A 1E90A 1NC4B 4WI2A 3D4ZA 5KS9B 5M7QA 4EN3B 3VMOA 4NAJA 1SDAB 3I75B 4OIBA 2UZYB 5DRZA 2CR6A 3T3MF 3KL5A 4PJAA 2B1HH 4XVJH 1D5IL 2ROYA 3GSOA 4K94L 4Z7UF 4BFNA 4F7TB 3IJEA 1I3RB 4QTIH 4EOWL 1HSBB 4KY2A 2ZSWA 1TDQA 1IT9H 1OSZA 2F15A 1JGIA 2OSYA 2WW8A 3BSHA 3PWJA 2YPLB 4NJ9L 1NCIA 2E7BA 1GSMA 4OGQC 3UPCA 5E99H 1DUZB 1WIUA 2HKAA 3BVNB 1TZIA 4WSKA 2OL3A 3H85A 4EJ1C 1KGYE 2PCXA 1UCTA 4NGHL 2Z31D 4JHZA 1MRFL 4XP6L 5IMKB 2WZ0A 1XSOA 2P9RA 3ENEA 1D9KC 1BOGA 2AABH 4OJFL 2YKLL 1JD7A 3AMLA 4NC2B 2X4UA 2FWOB 4BFOA 4YMPA 3QUML 5IQMA 1K5NB 4I0PD 3VFTB 3W57A 1AZCA 2AK1L 4U3SB 5DK3A 1YEEL 3RFZA 2PPDA 3VFGH 2BHZA 1OD9A 2Z93B 3P1VA 1GZQA 3S8FB 5D7IE 1NCAH 2H3XC 3NIDF 4XODA 3GZOA 1IGFL 3VXMD 3ML8A 3UDWC 1KCLA 2XWBA 3BGMB 5TH2A 2W59A 2OMBA 3OR6B 2ZUQB 5JQ6H 3PREA 4W9EC 4XHQA 3INUL 1CICB 1VZHA 3VWJD 4LSSH 1GAFH 3L5IA 3QI9B 3C5JB 3O6FB 2HJFB 4KK5D 4P46C 3M88A 1MF2H 4BFJA 1TU2B 1B4TA 1UXWB 4NJAL 2BVQA 1DJZA 4S1SH 3MRCB 4P4KD 3T2QA 5BO1H 5CEYA 1L0XA 1OT2A 4KI5C 4HPOL 5D1QD 2N7AA 3PCYA 4LIQL 3PXHA 1H15B 4G7RB 4K2UH 4PJDF 4WEUD 2IV9A 5T3ZL 5FUOL 2H8PA 4NC0B 4YBLC 2GSMB 2YIHA 3TH4T 3DDGA 4YGVB 1PDKA 1ZHNA 5KVGE 2I07B 2TSBA 1LE9B 1F11A 3ZE2F 3CC1A 1U8IA 1J88A 3HS9A 1CXEA 3IRZA 1PZ3A 2PW1A 2FATL 4XNAA 3U2SB 2QQKL 3VGHA 3FO2B 4LLMA 1EDYA 1A2YB 3MYJB 1NUDA 3VG9C 3NIFE 4MAYD 3WJJA 3ARBB 2ZOWA 3MA9L 3KH4A 5L88H 3BKMH 5AYUH 5J9PB 2X6VA 3QXAB 3MQIA 2NXZD 1H9DA 4PJ7E 4RAVB 3VQMA 5CCJA 2EILB 3IDYB 4TS6A 2BP3A 1N64L 2VNCA 2JMRA 5I1GH 4NP4H 1OOAA 5CZXC 3R4RA 4K5LA 4KPHH 4X83A 4ZPVA 2NY5C 3ROOA 2V17H 4R0LB 4WHCA 3SYAA 4XP4H 3TZVB 1DQVA 4UQ2A 1I3GH 1RZGB 1ZA3B 3ZKMD 3BESR 4X4ZA 4E41E 3K8KA 1DP0A 2PLTA 1Q0XL 5JXAH 4ZSOB 4I3RL 4HIXL 5C7ZA 4X4MA 1FH5H 4JM0A 3BW9A 3MSPA 1YN6B 1AJ7L 2XOTA 1YMME 2VOTA 5DVMA 1HKLL 4U2ZA 1JTPA 3WJLC 4EI0A 2DQEH 2AABL 4OJFH 4BFFA 1ZWIB 4ABUA 5I82A 3A6BH 1BVLA 4HUVA 2NXYC 3QJFB 4XXCC 5I8OH 2BOLA 1CK0H 1JK9A 1XIWD 3RTLA 4FCAA 4HIQA 1O9WA 3SBWC 4YFDB 5LGJB 5HYSG 4Z7VB 5L2KA 1B90A 4PJ9B 2B1AH 2XPGA 4IDJL 3DYMA 1L5GB 5HYSB 3FSZA 2GBTA 3C87A 2CDFA 4HETA 4ABVA 2VDRH 3HNTL 4M43L 3II1A 1ZVNA 4B5ZA 3FRPG 4P46A 3INUH 5I9QC 4C59B 4ZFGL 2ZUUA 1M57B 4DP7X 1MCWW 3ML9A 2X4UB 1KB5L 5LXGH 1QRND 4XX1G 3T0BA 5JQIB 2AMGA 3WHE0 4P2OB 1G6RL 3P0GB 4ZX6A 3VXRD 1EAOA 1AHWA 1E9OB 4JRFA 2Y1VA 1UZ6E 3EKCA 2FUQA 3MRGA 1UURA 1FVCA 4MDIB 3QJZA 5IHLB 5F6IC 3GJFA 3VD2A 4Z9KB 4U6YA 2YSSA 5B4MC 2ENPA 3GJEB 5BZDB 3KPOA 5JO5B 4M62H 5KBPA 3DTXA 2ZPKL 2PCPA 4ICWA 5IFJA 1OTSC 1BIIB 2VISA 2WSDA 2JLLA 2X12A 1DN0B 3OXRB 4HPYH 5FM5O 3QP3A 1OK8A 5F89B 1MHHA 2HP4A 3DSNB 3M1CA 3H53A 1PD6A 4TYUA 2EEBA 4PJGE 1CDJA 2RH0A 4YQXH 1HI6A 2IADA 2FT6A 2BZ7A 2VLKB 5KJRH 5TDNA 2GITB 3DX3A 4DN4L 1CXIA 5F1OB 3MKGA 1CIUA 5LDSA 4M6OH 1N3NB 4FNTA 4K8RL 4XT1C 4DOHB 4DKFL 4O02A 3K7UA 4LCYA 3WKQA 4OV5A 1IU1A 1YNTA 1FO0B 3ETSA 5HHMD 1TT6A 2WVTA 1FA4A 1RZPA 5FO9B 4N22A 3HFFA 3WG7B 3WLWD 3CFJB 4D9RD 5AW9B 3VGEA 3D05A 1NL0L 4EUPH 3MRLB 2DRUA 4M00A 1JF1B 4L3ED 1R3LB 3VGBA 1T83C 4HD9A 4OM0H 4YAQB 5DD3H 2W60A 3C6SB 3C08L 3DX4A 2I9TB 1X4ZA 1IUZA 1A3RL 1OGTA 2NXYD 3BEVA 3QXAA 4NI6A 4QXUL 3RVUC 3DC0A 3S36X 1N26A 1U3HC 2BIPA 3EJCA 3MBWA 1DBKH 4MJ6B 2MSPA 3E1F1 4K3EL 1LNUB 1A25A 3P4NA 2FD6H 2VTFA 4UMSA 5HGDB 3U4AA 3C6LC 5ILTH 3SDCC 4MVBD 2N4IA 2ZG2A 4EUPG 3IDGA 1HCFX 4R2GC 3NJHA 4PVMA 1T21B 4OFPA 4M6ML 2E75C 4LSVH 5H94A 3X11B 3PHOB 1G7JA 5AZ2H 2F58L 2FX7H 3P30L 3D2UA 1NCDH 1GGTA 2NY5L 2IH1B 3BW9B 3ECUA 3A0OA 4PEEA 4YFEA 2EH7H 3BLPX 1RHHB 1ZHBB 4FULA 2XIIA 2BVPA 2JKIS 1LK3L 1GYAA 3STLA 1GMIA 4BCZA 5JOEA 2ZP8A 5A6IA 1TZAA 1AHKA 4Y4HB 4PJFF 3WFBL 4LCUA 5KEZA 3C2AL 5KYYB 3HS8A 1HZKA 5D72H 1XIWA 4L3CA 5ACZB 2HN7B 2GYSA 4PMFA 4Z76A 5HDQL 3MBEA 4L29A 5DHEA 1HILA 2WZ5A 2XA8L 2J71A 4XMVA 3WFEL 2YEZB 1J5DA 3QQ4A 5ALBL 1HFUA 3K6IA 1BREA 1H3VA 1KT2A 2QKSA 3V4UL 2R0ZL 3MA7B 4ZUTA 2E8YA 3VXQB 3WD5L 1F1DA 3KXFA 3QORB 1KGIA 4ZT1A 2GEEA 1BV8A 4FABL 1J1XL 2HVKA 4BFKA 2ZKHL 1T04B 1U58B 2YA0A 1IM3B 3N04A 5TDPB 1INDL 4RWYH 1T0OA 5D6DA 1KEMH 5FDYA 4IMLA 3HZMA 4WKZA 2C3XA 4YUEL 3ARUA 3TGXA 2BWQA 1TKWB 2ZCKL 3TBBA 1WA1X 3TPKA 4PD4K 2C1PA 3QUZB 1WITA 3QDJE 1IGMH 1WTLA 4DKFH 5JW5B 4ANWA 1FVCB 4MQXD 2JELL 1QR1A 4XPFL 4S0HA 4NT6B 3O4LB 5TE7L 3CLWA 4U6YB 4XE5B 4ATTA 4TF4A 5BZDA 5GS2H 2AV7A 4FXGA 2FT8A 2OMUA 5DZOA 4GOSA 3EJZC 4I7ZC 5EU3A 1X5LA 3GBNH 4FNPA 4FYRA 4LMQI 2EXWC 5IB4B 1DN0A 3OXRA 1CGUA 1AZRA 5GRWA 3LS5L 3B8YA 3MV11 3X1NA 4FGMA 5DD1L 2CCVA 5I1IH 1G7QA 5FKAB 4X6CA 3B2PA 1CE6A 1HXKA 3B2VH 2VWEE 5D4JA 3AY2A 1MWAB 3LZOA 4KTEH 4OV6F 1BQHG 4N28A 4AX3A 1FNFA 5IHUH 4AQ1A 1K72A 3QG6A 5JPNC 1N3NA 3LVTA 3SOBH 2XX0A 4PIBA 5AW2B 3ULVH 3OKDA 4LOUC 4PLKD 4EMZA 4EBQH 2FJGB 4IU3B 3HKFA 5HY9A 3SY0B 5CN2A 4LO9A 2Z91A 2VL5B 2WYZA 3NA4A 3QFJB 4G43A 1M6UA 5BPPA 5ISZA 4AVIA 5E2WL 4CADB 2OXHA 4AEIL 5HP5A 4YEFA 4HJJH 2C8NA 3ZU8A 4ZMPA 5KVFE 2P7TB 2D31B 4OD2A 1KLGA 3B9KD 2IPUG 4Y1TA 3EDFA 1RZKC 4AC4A 2Y69B 3PJNA 3KGSA 3SPVB 3BXNA 3UG4A 2V5TA 3DJSA 3PIQA 2F54D 4C4KO 2DYPB 1SXBA 4Y2DC 2A38A 5K9JL 1P5VA 1NGWB 4YDJB 2DB8A 4FI8A 4P3DA 1KIQB 3M45A 3UMNA 2GIYA 1RIVL 1N4XL 3MOQA 2LFEA 4G42B 2G0LA 5F9JB 3VDBA 5TTRA 4NO5A 1KIPA 1NMBL 2QZQA 1LEGA 3ZE1E 2R8SH 1OTTD 2EDOA 2YMXL 3AXHA 4E41A 1CR9H 4LCIH 1XZ0A 2HRPH 3DV6A 2HT2D 3PL6B 4Z3JA 3CV5A 5ELIA 2JQMA 5CEXB 2BVPB 3KE0A 1WTGT 3HI1B 4LPYA 4F27A 2C7UB 1I8MB 3MGAA 5C0CE 3NACH 2FO8A 2OSXA 3TIEA 1INDH 1E2ZA 4G7SB 1PZ5B 2VC2H 2X2YA 2ZXCA 4FD0A 4NKIH 5CJ5A 4GAFB 4NM8H 2QSCH 5I26A 1VFOA 3BP6B 5FFOA 3ZMNA 5DD0H 3ZZ1A 3TT3H 1A0QL 4NPJA 1XDTT 3KLSA 4DUWA 3ARFA 4UNIA 3F5WA 5HHXH 1FNAA 1JJUA 2P5WE 4Q56A 1HH9B 2GJRA 5GZNA 2KQNA 5EOQL 1HOCA 4PW9A 2P52A 1JZEA 1TJHL 1ZSDB 3EH2A 2TRYA 3KXFB 4TL4A 2A83A 2D7TL 4N2DA 3B9AA 4S0TD 4W9FC 2AMUA 4Y4FC 3AQDA 1YLBB 3BUPA 2XKUA 4HWUA 2QLVB 1OAYL 5CLYA 3LZRA 1KDIA 5I6OA 5LN4A 2XQYA 4CVUA 4YDNA 5BO0D 1NCTA 3QEQA 3RWHA 4XNZB 4ZFGH 3VACA 4BFRA 4WTQA 2MNUA 2WBKA 1PYWA 2C9UA 4WV1A 1DJXA 2AQTA 4XC3L 3U6XS 2XG5A 1JMZA 5JHBA 3MUHL 4XP6H 3QVAA 1TYJA 3PV7A 2EYRB 2XY2A 3FOMB 2RIKA 1XCTB 1BQHB 2W9EL 1L6XA 4KKRA 3VXUA 5D71H 5L2KD 1W72L 4NPYB 3SDDC 5I18H 1KYDA 3QSKB 5E1IA 3P69A 1MFNA 3FO0L 1NGQH 1OCCB 4HKJB 5EA0L 5C2UB 5C8JA 3M07A 5DS8A 4ZMNA 1ZA6B 3LH2L 1SY6H 3MLYH 4LPCA 2WLLB 3Q6FB 3SDXE 4QIRA 1KLFA 2BIQA 2ICWA 5EF1A 4BFEA 2KS0A 1CDIA 3VFGL 4LOFA 4F7PA 1ET7A 5BUPA 1MWAA 2HTLD 2YO3A 4MGXA 4JG0L 1U36A 1E4WL 3WNMA 5ECJE 5DFTA 5INDA 3NESA 5DQJB 2CHWA 4V1DB 1QPPA 2VLLB 3BVWA 2R2BA 2K70A 1MIEL 2RD0A 3QJQB 4I77L 3VQLA 2FJGA 3VX1A 3KYKL 4XRCA 3TA3B 3EJYC 1GJWA 4OD3H 5CLWA 1IQWH 5GGRA 1OWWA 2EC8A 4KGLA 1VGEH 1J9SA 2BIIA 1SY6A 4U0RC 5KBLA 1GC1H 2DQCL 3P3UA 3UTPD 4MJ5B 3V55A 3BSGA 1PLAA 5DJZA 4NO2B 3KPRE 2DJ4A 3HS0A 1U95B 2LT9A 4Y2NA 5ERWA 3DPBB 5ABZA 3OJVC 2P44B 3K72A 3ETTA 5A7BA 5ALBH 3SQRA 5T3ZH 3O8XA 1U8HA 3ETBF 1MG2C 5DRXB 2DEYX 4YBLB 4J6IA 5EZJA 3MV8B 3WDJA 2V3FA 2NY1D 3GSXA 4AIZA 4BXVA 3MV9D 1M05B 5C08B 3MOAL 1AS6A 1XGPA 1KJ3L 4I3SL 3GMPB 1S9YA 3AS0A 3KL3A 1M1SA 4E41D 4OCYH 2X2HA 2ZP9A 2DQUH 4FQIH 1MCIA 4MQ7B 5KVEE 4NKOB 2C7UA 5C7XH 1I8MA 3RIKA 4N2LA 3OKOB 3DSFL 5T5FH 3U1PA 4E2OA 1PNDA 3DMMB 2FJHA 1SOKA 1IQDB 1SXAA 4JKWA 5I8EB 2F7RA 3NJVA 4PP1C 3VD7A 4X8CA 4AZ8B 3PF2A 1NCCL 3T5WA 1OZUA 1F6FB 2JKTM 3NGBB 3PGFH 3CX5K 3OF6D 1WHPA 4HT1H 4DIXA 5E6IC 3BSZA 3F7LA 2HLAB 3P02A 3CCHA 3U79A 3OAUL 4UT7H 43CAB 4UU9A 5DD5L 4RAHA 4JUTA 2PETA 5KAQF 5D8JH 3NEEA 1BQ5A 3A23A 3DVIA 3GMOA 3SZ6A 4QRSA 5LNDA 2FQFA 1YEKL 2HRGA 3BAKA 3GB7A 3P9MB 1D2PA 2R0ZH 1TTGA 2Z8SA 1N0XH 4UAOC 4BUQA 4ZUSA 4URKA 2ZE0A 5CS7A 4HUMB 3WMSA 1MUJB 5BV7B 2CUIA 5JTWA 2R59A 5J6SA 4UOJA 3ZE1F 3UIZA 5I66A 3IGKA 1WC7B 3VJ6A 4K3GA 1DQTA 1FIGL 5H2BA 1NBVH 1QFOA 5L0QC 5FC9A 2X4PA 3O2DA 4NN5C 1P5UB 3DX9A 4N2NA 3NP4A 4Y8DC 1IJNA 4OFVA 1FNGB 5E6UB 2IC2A 2AV1B 3EDDA 3B3BA 3DOSA 2BFVL 3D85D 1BBDH 1VPOL 3K2IA 3L5WB 4Q4IA 3SB3A 4DPRA 3ABGA 1TJMA 2XZCH 1SNRA 2AJXL 1E6JL 2Y7QB 3BP4A 4Z7QF 4OCSL 1EJFA 5E5RB 3MRBA 4MKTA 2WIMA 1IBBA 3F04A 3P40A 2V2WB 1FV1A 3DJRA 4KMTL 1IILE 2CNZA 1QKZH 3P0YH 4N4YB 4V2CB 3ZRSA 2NDGA 5EHFA 1ETZB 3LQMA 2FUTA 1NINA 1U6AL 4L0YA 4Y89A 3V0AC 4N0FA 4XXWC 3TBVB 5SWZA 3T1FB 4FKEA 2PW2A 2ZOTA 4G80A 3V4VH 1S7QB 3SYPA 1SFHA 5GZOC 1C08B 1MFCL 4WI9A 4KJPD 3WKYA 2K6ZA 5HHOE 3FB6B 5MHSD 3N42F 3Q8BA 5F6HI 4ODXA 4NB7A 5EEYA 3JWNH 4JANA 3WS3A 1KXVC 1BMZA 1ORSA 2DQ6A 2PO6C 3DK2A 4M7JH 1J10A 1JZFA 3B9KA 5FYKU 5I1DA 5CGYD 1JPSL 3TBCA 3EJSA 4UM9A 3KJ4C 5D5MA 1QI5A 2OR9H 3I74A 1K6QL 2AGJH 3VFOA 3QA3B 1HS6A 4ONGL 3OX8A 3S0PA 1KPVA 4IGBB 4I48A 4P2RD 4ZMYA 4GKLA 3HRZC 4W81A 2EC9U 3DXAB 4YO0B 4YXKL 2OMXB 3QFDB 1MCHA 3OMIB 5CR1A 2Z9TA 4JZJA 3D18A 1I1YB 3S36H 1IGIL 1A6PA 2K4WA 2BX5A 3L45A 1ZK9A 1A65A 2W65B 1EEYA 3UIYA 4I3GA 4OFQA 3C08H 1F86A 4Q89A 1QVOB 1W72B 5PCYA 5DD5H 3D48R 1R75A 4MJ4A 5I0YA 1MW3A 4C54A 4BM7A 4K3EH 4ELMA 4S1DD 4XBEH 2RALA 5LQBH 2V2TB 3AXLA 1XEUA 4G8GD 2HTKD 5IMMA 4X50A 3AU0A 2YKLH 25C8H 5IV2A 1DJYA 2E47A 3F58L 2DMBA 5ETUA 3LX9A 4KUCD 1AD9B 4M3JA 3VD9A 1LWJA 3QUMH 1RULH 3BQUA 3N42B 4PY7B 1K4DA 2HT3D 4DP8X 1AP2A 1FCGA 1ZTXH 3EIFA 4ZO8A 5DHYA 3VXPB 3HEIB 1AZNA 3KGUA 2C9SA 4NZUH 3HG4A 4TLTA 1NGYB 4F7EA 3GSVB 1J86A 3IFPB 4OF0A 4NNXA 3NJJA 5HYJA 4RSVA 2YZ1A 4Q6IA 5D2LF 4XO3A 2WBXA 2ESVA 4DQOH 3X12A 7TAAA 4Z5RB 4NO3B 3MMEA 2MOVA 2OYKA 4X9YA 4WWKC 4LLQB 1WSST 1A7OL 3QFJE 4EDWH 3DA0A 2BCKA 3IJSA 1QNZL 4B7LA 2IH3A 4LSRH 1EO8L 1OAYH 1G7HB 4QRBA 3OG4B 4Z0BH 4PU2A 1E28B 4RGND 5DJ0A 5HI3D 1NBCA 3VFWA 2HUEA 4MAZA 3OMNB 4PRIB 3TZVD 3CFTA 2ZF8A 4M8VA 1BD2D 4BFIB 3GSQA 1KYOK 4UT9A 3AT0A 3IXAA 4FQXD 2B5IC 2HYMA 4JHBA 1NIAA 1HKLH 2JKJA 2GTQA 3Q3GB 2PYFA 5ISZE 2Y7QA 3BP4B 4JDZB 5LCVL 3VTMA 4CMHB 3BZEB 3G5ZA 5IFAH 4B27A 2FQGA 2YAOA 3BUBA 4G59C 4YHKH 4LQFH 1IO4C 2AAAA 3MNMA 4U6VL 1Z9MA 3AG4B 3NJGA 1Q1JL 4M4PA 3WTVA 2BHFA 3FAWA 1CTMA 2E4FA 3WJMB 2AEQH 3QULA 3CPLA 2ID5A 3WXWL 3A4EA 4JHWH 5IJDC 4HVBA 2B8OT 1BAGA 3TFKC 3EO1B 3KYOB 1T20B 4PJFB 2ICES 3O41B 2HTKC 2OMYA 3HKZA 5DDHB 2VQ4A 3TO4B 3BFQG 4KRPC 3ZTCC 1IMHC 4OZIB 1WD9A 3PNRB 1YEIL 2DQFB 4JFZL 4AV0A 4GG6B 1NFKA 5C0BE 1N2RA 3RE0A 1AGFA 1W6LA 2MPAH 3T77B 1XF5A 4MNGB 5IEHB 5DF0A 3TASA 1KXTA 1S6NA 2A9DA 2F53D 4GP4B 4TKWA 3OAUH 4QTFA 4JFOA 2E7LA 1OGSA 3EOYG 3TYFB 1RH8A 3TA3C 5AFAA 5F7UA 3MLXH 1HEZB 4FQQB 4MSWA 5HPOA 2X88A 1IL1A 1NFDA 2APTA 2ADIB 5I6LA 2XJKA 2QADD 1HNYA 3CVIH 3ZKQD 5J56B 4H1LB 2E7CA 1ITCA 4PJIB 5CGYC 2YKKA 1UTDA 2V5YA 5E1AB 5BQ7B