5K5YA

Crystal structure of truncated flgd (monoclinic form) from the human pathogen helicobacter pylori (strain 26695)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
146
structure length
146
Chain Sequence
NSVSMIGKIAETDVSGANFDGNNKLSFSLFFDEKIDASKGVPAIQILNENNELVKTIPLKDYNGQKGYINFEWDGTNEKGEKVPKGNYKIKAEYNLDSHSKQYLQTRIGRGEVESVIFDKGKPMLRMGEMVLPIDSAIEFYQPDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Basal-body rod modification protein FlgD
publication title Structure and Stability of FlgD from the Pathogenic 26695 Strain of Helicobacter pylori
doi rcsb
source organism Helicobacter pylori (strain atcc 700392 / 26695)
molecule tags Motor protein
total genus 33
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5k5yA02
3C12A 4ZZKA 5K5YA 4ZZFA 3OSVA
chains in the Genus database with same CATH superfamily
1OTTC 3TA3A 2X2YA 3FO2B 2JJWA 1EMTH 5FFGA 3U7YH 3RGBA 3P4MB 4OLYL 5F3HB 3W37A 5BZWA 2NY5C 2GI7A 4A2GA 1YEGH 1I7RB 3VI3F 4XVJH 4UM9B 5TF1H 2EDXA 3W0WB 3QIUB 4X5RA 1BIIB 2WUCH 3DX7B 3PQYA 5DUBA 2Z4QA 3KPLA 4KXZH 1MJUL 3FTGA 2VISB 1IMHC 5FLVA 4AW4A 4OQ1A 2FBRA 2J8UF 2VE6B 2B3IA 2XG5A 3D3VA 2PP8A 2E7LA 3DX0A 5K93A 3H53A 5IB1A 2BSDA 3QFJA 1SXNA 2ZYIA 2VN6A 3EHBD 2FB4L 1NAML 2G2PA 5D7LD 5LNEA 3HZMA 4JY6B 1EVTC 1DEDA 4EZLA 5IQMA 1RZGB 1U58B 4QRSB 1YEIH 4AGQA 5E7BA 1SM3H 4MNGB 3BGFC 3QZLA 1QNZH 2I60L 3IGAA 1DVQA 2NMSA 5GJTL 5DHVH 1D5MB 3CHPA 5CKGA 3T1FB 4EXKA 2AXFA 4JS7A 4YHLH 2WKGA 3ES6A 5GZNC 3PCYA 1IGYA 4ZMYA 2WKOA 3JWNE 3BT2L 4C59B 3DGDA 4DK5A 1UWYA 3EO9L 5FYJH 2OXGA 2QSQA 2W9DL 3KGRA 1U3ZA 3MRCB 3QA3B 4L8DB 1O9WA 4G6KL 5F3BB 1SOSA 2JKNA 1H5BC 3QDMA 4KTEH 3MQIA 4Z7WB 5D7LE 1MHCB 3MUGA 4Z95L 3BGMB 5E0FA 3UG5A 5CJ5A 4XP6H 4Z3GA 2D0FA 1FNHA 1NDMB 1RK1B 1OPGL 3IXAA 1J8HD 2YD4A 1YPZB 4MB3A 4QIRA 3IXTB 1W0VA 1QO3A 2F5AL 2X88A 2WTPA 4HMCA 4JBSA 4Y4HC 1NZRA 2KZKA 4HUVB 3ARDD 2FUQA 4PJBA 4E41E 4RX4D 3WNPA 4RRPM 1W91A 4JZOB 4LPYA 3TBVB 2AVGA 1A4KA 5JW3H 4PJXB 5KEZA 3LKOB 3JWDL 4N4YB 4S1RL 1YRKA 1G1CA 1T5WA 3V4VH 5SWZB 3SQOH 1PD0A 2YPVA 2E75C 2DY2A 4ONHA 1S7RB 2KBGA 3BAJA 3Q44A 2J5LB 4YC2B 1YMHB 4FI8A 1OZUA 1L9OA 5AOKA 2ZCKH 3S98A 1X5HA 2B1HL 2WHVA 4HH9A 1DUYA 4EUPA 2P52A 2V4LA 1AYOA 2XU9A 3PGDA 1XF2A 4ZQKB 5E56A 2CRIA 1IBYA 3FTYA 4JFHD 4GUPA 5EU7C 4JM4H 1TPXB 3FBKA 1DJHA 1B9ZA 5BUPA 3FHEA 3KPRD 5HGBA 1DTUA 2CM5A 4LSVL 5B8CA 3V2AR 3VI3A 1A14H 1F3DH 5IJVB 3LIZL 1B4JL 2NXYB 3GSUB 4XN4A 1A4JA 4Z6AT 1X7QB 3V5KA 4L37A 4K55A 4MJJA 2BP8B 3HUJB 3IF1B 4BFIB 1AIZA 5IB5A 1WIOA 4LNVA 4Q2ZA 4ZFZB 2OW6A 5T3ZH 3U4AA 5BVPL 1DHKA 4Z3JA 4FNRA 5D2NC 4J2QA 1BXXA 3KJ6H 1U8LA 5F9DC 1TJGL 4XMLH 3BZEB 4POZD 2VDRB 3DJ9A 3C60D 5D6CB 4HUWB 4UQEA 4NQXA 4H5SA 2MPVA 4YO0A 5F72S 5E5MB 5B39G 4G80B 4GO6B 2DMGA 1E4WL 3MGOB 4QTHB 3ARXA 1G6VK 2C7UB 3CFMA 2CAKA 1TVBB 3RHWK 1N2RB 2QR0B 1HIML 2HTLD 3DDFA 2QGDA 4PGDA 5IKCB 5BW7A 1A3QA 3UG4A 5AD0A 1M7DA 5ACZA 2ZKMX 1W6LA 3S2CA 2VIRB 1TITA 5J1AA 2H1XA 4OGAC 1ETA1 3MBEB 1LM8V 4J3OD 4O9HH 4Q4EA 2OS7A 1NJ9B 3LKPB 1GTFA 4PB9H 3OG4B 4PJ7F 3EYVB 4ONGH 1SJHB 2NQ3A 2X28A 3CUPB 3SE4A 1IL1A 3BP6A 2MOQA 5FOBA 3SDDB 3UBXB 3VAEA 5C0GB 3RLSA 4L4VA 2Z9TA 1F6AB 4G42B 2FAUA 4F9PC 1K2DA 2BMKA 4LGPB 2EADA 4J8QA 2FWSA 4DKAA 2N7SA 5D2LA 3T2QA 4ZUSA 1J1OL 3DX2A 1KYDA 4FQXB 1LEIA 1KIRB 3IGFA 5IVXF 3N40F 5KYYB 4N2HA 1F6FB 2KLRA 3PNRB 5F9WC 5A43C 2CWRA 5CZVL 2KDYA 1N0LA 4AKQA 4WI9A 2NT0A 4LVOB 4NPYA 1V7MH 5HJ3B 3NJVA 3KR3L 5TK2A 5A3IC 4G6FB 1KGWA 4CC0A 1BZ8A 2ZUUA 5D7JB 4BZ2A 1WUZA 1GYWA 2IANA 5DFVD 2VLKD 2EH8H 2I69A 1NGYB 2QDWA 2VQTA 2K8MA 4WENB 4YVUA 2VLRA 3ARGD 1BBDH 4WKXA 1KPRB 4M29A 3ARFB 4KXAA 5JZ7D 2Q7AA 3M6DA 4F2EA 4ADGA 2CJSA 5FO7A 4E9LA 1ETJA 2W94A 4FNTA 4ZT1A 2EDWA 2IXQB 1HHJB 2A6JA 1Q9WB 3LRGA 3KS0H 4ENZA 3TPUA 4OF0A 3QWRA 4KKCC 3POCA 5D7IF 5I1DB 3SE3C 3QEGL 3SDAC 1LD9B 1FFOA 1UEMA 2NY0D 3WIFB 4X6EB 2PWEA 3GSOB 5BXFA 1DQLL 2WWKO 4WNSA 1JUFB 5EF1A 3MRHA 2VLKE 1Q8MA 3CVHB 5C0AD 4GG6F 4V33A 4W9IC 2PYFB 2A1WH 3CHRA 4ZAKA 3UDWA 2V2XB 3S37H 5HHMD 5FO9B 3X11A 3RVTD 3KPNA 1F13A 2QTVA 2V7NA 4M93B 1MDAA 1PU0A 5L2JA 3AROA 4A1RA 1TQTA 3FN0H 2GCYA 4A6YH 5B3SB 2P7TA 5DJZA 1JGUL 4GW1B 1IGML 1S5IH 3VTTA 1GY1A 1MW2A 3HMXH 4WK2B 2DM4A 4JZJA 3SE9L 5BCAA 3ET9F 3MJ9A 4O4YH 2OR9L 4ZPVB 1HINH 4PRNA 1RZPA 4AEHH 3HN5A 5LUMA 1Y6MR 1JGLH 4ZD3L 1CDCA 4MBRA 1BQHA 3I9GL 2DICA 1JF1B 2VQ4A 3V5HA 1QR1A 4ZFOL 3B37A 3KYOA 5CEZH 4YBQD 2HFEB 1BAWA 1IBHA 1TR7A 1ZA3B 4U7KA 3DX8A 4N2NA 1XVSA 4JNXA 4PJ7A 2WNXA 3TF7C 4GP5B 4KZDL 1TTAA 1J8SA 2FNWA 3KBEA 1WD8A 4XNMB 1Z9OA 1F11A 3B1TA 3V9FA 1UM4H 1TKWB 2AXGB 1SF3A 2Y7OA 2B59B 4LCYA 5I75C 4PJHE 2RACA 3O6ML 2GITB 2J1YA 3VRLE 5IVXA 4RLDA 1N6UA 3UH8A 4P46D 3V4UH 4LKCB 2LT9A 1CE1L 1NA8A 5EEVA 3WKQA 3LKNA 5I6XC 1SEQH 4HKXA 1JWSA 1SYVA 1JFHA 3ERXA 4GBXA 3T4AB 4GRWF 2GBUA 1R3HB 5EO0A 2PTUA 4G7QB 4UNIA 1BWWA 3VU2A 3BFOA 5E9DD 3I6GA 1DZBA 3QT2A 5CN2A 4M62H 1HAWA 1KBPA 3PE9A 3AY4C 3QZOA 2H8PB 1QEWA 2V3EA 4X4XA 1D6EB 2WBJB 1NKGA 3M1BB 1RJYA 2ENYA 6FABH 1ZJAA 5A2BA 1AQKL 2EXSA 4F93B 4WEUD 5C86A 4ZW3A 4JPWL 2QLYA 1R19A 3ML8A 2GT9B 3L4WA 4G8EA 1M9SA 2X6AA 4GEJA 3M8OH 1CLOH 1KBVA 3OKYA 4HIHA 4YSPA 1CVSC 3K8MA 2CHWA 4B5ZA 3SO3B 2LVEA 3PGFH 1W15A 1U8MB 1VACA 2CXGA 2AQRA 1TU2B 4L9LB 4NS0A 5D7IA 2ENSA 4ELDA 1TCRA 2NDFA 2DWTA 4IIZA 4Z7UF 5AAMA 3ZL4L 1AE6H 1Z3GL 3REVA 3C6LB 4Z9KB 5E9DE 1UA6L 2QVTA 4WKZA 1VEOA 4NO3B 1HXYB 1P1ZA 3K5SA 1QBMH 3Q06A 1AGCB 4LLVB 1S3RA 5GRUL 5IHWA 3MRNB 3TNNA 4FQIL 3P9MA 3GQFA 1CLZL 3WKMH 5I1JL 4PP1C 1RUQL 4IIQC 3OX8B 6CGTA 1IC1A 4RBPK 2XKSA 1KBWA 4FQ1L 1RUPH 3JTTA 2BSTB 4XO3A 5C97A 2E27L 4BELD 1HHGA 3PPSA 3V6FB 1TZAA 1OCOB 4HQQL 5LGYA 1XGYL 4ISVB 1GGCH 3IDJA 1A6TA 1C08A 1CFMA 1PCXA 2L7QA 5AB9A 4MSWB 2HG0A 3TJPA 1G9EA 1Q0YL 2YC1A 3VTMA 4LSTH 2FEEI 2EKJA 4Z7OF 3SZ6A 4F8QA 2YPLA 4ZUTB 5C70A 1CB4A 1UZ6F 4DP1X 2VM9A 1QFWI 1AKJA 2PABA 3MV01 3IPFA 3KAAA 4M7KL 4MXVF 3DROB 1BG1A 2FZ3A 3T3PF 5ADOH 3V0JA 1KCLA 3K0YA 1GGBH 1SMAA 1A7OL 3CZUB 4KFMA 4RFEB 1PFOA 2BOCB 1G6RL 4JVWA 4PM1A 1WCBA 4A7UA 2H6PB 2ISDA 1CU4L 1JBJA 1BFVH 4FQLH 1KPUA 4MNHB 3T65B 5AW1B 5ACLA 3NSYA 3TYGL 2WSKA 2WW8A 1EO5A 1GC1H 4S10A 1E9OB 2XN9D 4U6XB 5DO8A 5H4YA 1V3MA 4R97B 5F70A 4UM8B 1JF5A 1EZUA 1JZ5A 1FV1A 3ZDYB 5EZPA 5L0QC 1VEMA 5IIEB 1OB1B 4UQAA 3ZDXE 2B16A 5DJAB 2EVIA 1PX3A 5CP3A 1S6NA 2ZXDA 3A67L 1DQDL 2ZUSA 2P49B 3QI9B 5FYKU 4U3CA 1E5UI 4NQDD 4O2CB 1OAZH 4TNVF 5KVFE 4YHKH 1E4XI 2NY7L 3B7TA 3S96A 1F5WA 2B4CC 3JZ7A 3S5YA 1TYEB 5HYJB 3VD1A 1YYMH 2VXVH 1I1AB 1GGIH 4NUPA 3WTUA 1NCDL 2XN9E 3IU3B 4ICXA 1XIWD 4M1GL 3KCPB 3MUUA 1OM3L 3VGAC 4Y5XC 2J55A 1RJZB 2RQ8A 3VFUB 4LPVA 1CGTA 3AQYA 3RUGF 5IB4A 3S35H 1J9CT 4Z7UA 1WO2A 2GBTA 4ZFGL 3LS4L 1G5GA 3QZNA 2EIMB 4FTVA 3MLXL 2OI9B 5JMRA 4NQDE 3KLHC 1QD0A 5D7EA 3S5ZA 3SDYH 2IFFH 1EFXB 1FGNH 2VZTA 3QIWA 3WKNA 4PPTA 4BQCA 5IF0A 2E7CA 2ZICA 4APQC 3F6JA 4GP8B 3EOTH 3MV9B 1NUFA 1SNRA 2K45A 5KYUA 4K7FB 3DPBB 4KVPA 4NEHB 5FFOA 3S3SA 1R9FA 2MEJB 4FKHA 2IAMB 5DSCB 4U4IA 2DQUH 3NJXA 4AL8H 2A74B 4JM2D 4HWEH 5DTFA 1AXTH 3ZK0A 4M3KB 4KZCA 4G72B 1H19A 3WEAA 4NUGH 1CO1A 1FNEB 3SY0B 5IBTH 2AK1H 2LLGA 1RMFH 3U0WH 1YMMA 2FYVA 2YGOA 4XI5D 5CBAB 5EU6D 3HS9A 4EO5A 1TTUA 4GYBA 2EVHA 3WO4B 4YEFA 4AM0A 4ILDA 1NC2B 1OALA 2HTKD 4OSUH 5DVOA 4A68A 4OGZA 2EDHA 3RVXC 1DZ0A 4OLVH 4XWOC 2GJ6A 3FAWA 4GRMB 4M43L 2GK2A 5J9PA 2QGBA 3HC0A 5CD3A 1AO7A 1TVHB 1HDMB 3EJYD 5FEBA 4NRYB 2IALA 4F91B 4G8FB 4JY5L 4XXCC 3LPFA 1IFGA 3H9YA 4LLUB 2IWFA 1W16A 4F33A 4OZIF 1ADQL 1M6UA 1AZZC 3FJTA 3NSFA 4QHNA 4P3DA 3SJVB 3L4XA 4LVEA 5AZEH 2RGSA 1JNHA 3CU1A 4H2CA 4MDJB 5GSRB 4OI8A 1U8PB 5EU6E 5GRXG 3VMOA 1LE9B 1ET5A 1HHIB 1CICA 1M7IB 1YY9C 2OMWB 1AXSB 3MRBA 3UZEC 5JHMA 3GGWA 5IW6A 4DO6A 1SRDA 3NZUA 4LEOA 3ATAA 4CGUB 4PVNA 3KXFB 3M7FB 2QKIC 2J1KA 4R96A 3EGDA 4M7ZB 4ZX3A 3EYUL 3TGXA 5I1KL 4FAAB 5A40E 4FZ8L 5EO1A 5TE6H 1QQDB 3LXBA 3ZKND 1KFAH 1YQVL 1Z3RA 1M6OB 3LDBB 1CMOA 2UXFA 1SDDA 2Y2TA 4M4RB 5GSVA 5LBSL 1O5DT 4XH2B 4HUUB 1JZHA 3L3KA 3C9NB 2ZWNA 3BPLC 1I4FB 1Q4NX 4NC0B 3SHSA 1RPKA 1P5VA 1IBGH 5GRVK 1DQKA 5DO2D 5F97E 2DLFL 1U3HA 3RUGA 1S9VA 3U1SL 4XBMA 4Q4IA 1DSYA 2OMVB 3FS9A 4Y7MA 5I71C 2D3JA 5D1XD 1KENH 1KIPA 4PRDA 4MGXA 1NL0H 1WS7A 4P5TD 3S5LB 1A9VA 3VXRB 1QSED 1I8LA 4XP4H 2XHNA 3X12B 4NKMA 1SHSA 2DI8A 1GRWA 1KGCD 4G6MH 2P5ED 4RMQA 4XNQA 4EQ3A 2CO7A 1A5FL 4GAGH 4HJJL 1XXDC 5HDBF 3RGVD 1R0AL 4XMTA 3ULUH 1MWOA 2VR7A 3FO1A 1QW9A 4IHOB 1H6TA 1K4DA 2A9NL 3FN3A 5DU7A 3VRJB 2ADIB 2CLZB 4P3CL 2E4TA 1AHWB 2VXQA 1G0YR 3QEHA 2CGZA 4PS4H 2Q9OA 3F7VA 4XO8A 2B2XH 3QQ3B 2GJZA 3C5SB 1YEFL 3NCYP 5D1XE 4YDLB 4HKJB 4KNSA 4DQOH 4JY4A 4MNQD 1M9WA 2DM2A 1QSEE 5ELIA 3WNIA 1EJOH 4X83A 3JXAA 3NCJL 2HPTA 3AC0A 1YYLL 2J1ZA 2P5EE 3RGHA 4XX5A 3QYMA 3M7OA 1CFSB 2NW3A 4MMYB 3APFA 3JYCA 3QZWG 1B0GB 2FGWH 3FSWA 5C0BD 3TPKA 4RGMB 2ZUQC 4UV4H 3W9DB 2CR0A 4QT5B 3D34A 2Y3AA 3IAGC 3L81A 5JIPA 4HS3A 1T83C 3INUH 1M71B 3JV6B 4OZIA 4JPIA 3N9GH 3AMKA 2MQ0A 3C6SA 1AIFB 1KIUB 3MNZA 4RMWA 1C5BH 3KWWA 4O02L 4P05A 4U3SA 5DJCA 5EOCJ 1XGRB 3VX0A 9PCYA 3IJEA 1I1FB 5K9KB 2EYRB 3KLAB 2IQAB 4PJCA 1HWWA 5ILTL 4N85A 4MNQE 3VXSA 5ALBL 5TDPA 5CJOL 1IM3D 3UROR 3WE6B 4BWTA 5J1SC 2QADC 2D0HA 2CGRL 4N26A 3V0HA 1LWJA 2IO5A 1BJ8A 4X9HA 4DKEH 1UJTA 2G75B 5FDYA 1U33A 4WDIA 3L5IA 3LB6D 4DP8X 4HUNB 4NQEB 4LSRH 4U1JA 3F7YA 4GW5A 2LR4A 5ESQB 1MPAL 2Z8RA 1OAKH 1NLBL 1R17A 1J0HA 4YQXH 1VADA 2OQJB 2AJVL 5HHNA 3SCMA 3UEQA 5F96H 3RWEB 1BD2B 3FFDA 4OH2A 2Y36L 3LKRA 2C5DC 4NJ9L 3SQRA 3MYJB 3VWJB 4KRPB 1LP9E 3MCYA 3H56A 4UILH 4R90L 4FFYL 4PRPB 3HHSA 3Q8BA 4IOSD 2KHAA 2BSRA 4KKZA 2FR4B 3BKJL 2X0UA 3EAKA 2OBGA 5SWQB 4AEFA 2WJ5A 1AS7A 5JDJA 1CGYA 4AVIA 5C0ND 1HEZB 4WLCA 3L3JB 3BPCA 1JHLL 4PJGF 5GGSY 3WD5L 3TBBA 1MFAH 3L3GB 2J1XA 2D4DA 4QYOB 1EEYB 1OW0A 2BW5A 4JN2A 1DCEA 1QUNA 3QJHB 5GGRY 4OT1H 4FNSA 5C8JB 1M3JA 1I85A 1UVQB 4BFKA 2F19H 4GQRA 1VGKA 3FT3A 4X5WA 1H3PL 2R7EA 1YVLA 3DTXA 4JQIL 4A2LA 5IP4A 1XB8A 3HHMA 2VT0A 2EACA 3MRJB 4KJYB 2XXMB 4YVNA 5D4JA 3CZJA 4WQOA 2PWDA 2R9HD 1ZT4B 3FDWA 2Z0BA 5KSAB 3FFCB 3MRDB 3ELAT 5I1LB 1J1PH 4KTDH 2ZUWA 5MEND 4MCYA 3H85A 2ZOWA 1KTLA 3WIHL 1NBQA 1B88A 1EXUA 4JFYB 4Z0BH 1TZGL 3BWZA 4Y19E 5L88L 1HXMA 3BMVA 4PLKD 4H8QA 1IO4C 1J0IA 3P1VA 4KAQL 1T7XA 1MJJB 3US9A 4A7QA 2HG5A 3QJUB 4PUBL 5DJ0B 1NUNB 4OQTH 1YEJH 1QFHA 1ORSA 1WWBX 3O6FC 3QG6A 3FKUS 4NP4H 2C9PA 1QX1A 4K07A 4UT7H 3UMNA 4W81A 1BJMA 1IQWL 4PTUA 1AD9A 4C4BA 5DI8A 5DS2A 5LWYL 1TVDA 3LHAA 1XZ0B 5MENE 3OXSA 5CWSB 4RQQA 5HYIA 1TJHH 4KROB 5KJ4A 4MJ4A 3O4LD 1LLAA 1F2XK 3DSFH 4S0HA 2ICEB 3WJLC 3S5LG 2YA2A 3EYOA 4QRQB 1SZNA 1MRDH 1B3IA 3BDBA 1XGTB 4HCRH 2V9UA 1WJ3A 2V5RA 3JWNC 2X70B 4F92B 1QFWM 1OGSA 5K69A 4WWID 4PREB 2XUWA 3UO1H 2B15A 5ERWA 1P4IL 4XNUL 1XF4A 2JXMB 2Z35A 1F4XH 4KK6C 1CLYH 4OUUB 3D2UA 4AQ8A 5I5MA 2RR3A 5I6NA 4AGMA 5I8OL 1IV8A 4CVXA 4TUOB 5L2KA 1A3LL 2ZUXA 4LT7A 3KGSA 1P6WA 2YGPA 4G8GE 3IJ7A 3U7WL 5BZDA 4NHUA 4XWGH 4RISL 5DR5L 3FU6A 3O4LE 3T3MF 5IVZA 4DP7X 4A6YA 3PV7A 4TUUA 3DMMC 4DCQB 3L45A 1W72H 5TE7L 2HVKA 3RVWD 3ULVL 3HMXA 4PJGA 3HNSH 3PRZA 2CALA 2D2CC 3S36H 2UXTA 1A8ZA 2J3SA 2KH2B 2VXTL 4RAUB 2YXWA 2L04A 3TP4A 1NCIA 2XTJD 3RBGA 2BVOA 1MFDH 3MOBL 4F7TA 1NPNA 4FQ2H 5ITBH 3MJGX 2HUEA 1LK2A 1T1YA 3ZTJG 3DK0A 4N20A 1T66D 4G1MB 2FX7L 2PWHA 4F2MA 2H6OA 1G7HA 4XPFH 4O5LH 3TYFB 1IC4H 4MA3B 3PV6B 1CTNA 1HQRB 4MMZB 4NN6B 4AJ0A 2C1PA 2AGJL 2QV2A 4NZJA 4GKZA 2ZONA 1IM9D 1F4YL 2BP0B 2H9GA 4PJDF 1F42A 2DF3A 3B1UA 4R83A 3GMQA 2EVJA 1N59B 2AJSH 3HE7C 3QFDB 4W4OC 3QDJD 4PCKA 5JHLA 3T04D 1GZHC 2GUYA 3CJJA 1HESA 3QIBD 1T0NB 3WIIH 3MRFB 1DBBH 4ZUUA 5T5FA 3G6DL 1MSPA 1NMBH 4GS7B 3OQ3B 5I2IB 3N43F 2FO4B 3DX6A 3T4YB 1RLBA 4BWWA 3SQBB 5GZNA 3B2XA 3UTPD 1R24B 5DEGB 1NUGA 1R5IB 2BSEA 1WUNT 1YEEH 1J5IA 1OWWA 3KBHE 1E6JH 4C83B 1PGRB 1LO4L 2EH7L 3PJLA 2F5BH 3C2AH 3LZNA 1NDTA 5FYLL 1ZEAH 4K3EL 4G9FB 5BV7C 2HT2D 1PG7W 4M00A 1S8DB 1F6LL 2CK2A 4N8UA 1H5BA 3MRMB 1CE6B 2K1MA 3U6RA 4JB9H 2DQTL 4YHPB 3QDJE 1KJ2B 4JFPB 1A3RH 3TNMA 2IBGA 4ZXBB 2AABH 1QRND 1QRKA 2ZP0T 2PCPA 4QOKA 2G30A 2GC4C 5HVWA 5F7KC 3ULSA 3II3A 3OJMB 1DSFL 1H3WM 3EO1B 1NFAA 4Y4HA 1RFDH 1P7QD 1IC5H 2CK0L 4N0FB 4JKPH 2EIZB 2WTOA 3GI8L 5C0JA 4FS0A 3QUYD 2NR6C 3VJ6B 3IMWA 3ILPB 3PP4H 4OZHB 2EIKB 3UG3A 4J4PC 1YNTF 1WV7T 2VR6A 4WI3A 3BP5B 1N4XH 4BBWA 3CFIC 1VFAA 3O41A 4G5ZH 4PN6A 3QUXC 2J88H 1W9XA 1SPDA 1S9XA 1U41A 3KYKH 2FHCA 1M2VA 2VABB 1QRNE 4OLXL 1UEYA 1OARH 2VKWA 2ZF9A 2ZG3A 4E5XB 4XO9A 2PCYA 1KJVA 4GNKB 3HG0A 5FR3A 1UUNA 2DQCH 2DAVA 3LH2H 1JV2B 5FCUL 3ZKQD 2H0PA 2JH2A 2Q8AH 3QJRB 5T3XL 1KXTA 4QRUB 5T8IA 4OIFA 2NZ1A 5ICZB 4MJIA 1T3FA 1BOGB 3C08L 3RZCC 2VW6A 3HLAA 1SVZA 1OHQA 4M61B 1BQRA 2I32A 1MI5A 1ODAA 3P3RA 4WI5A 3BLKA 5JMOC 1N6QL 3V4PH 1J18A 4JPKL 5F9JB 3TONA 3AAZA 2APBA 3MOQA 4PEEA 1RZ8B 1MHHB 3FCTA 4TSAL 5D2NA 3U9UA 3TA3B 1HNYA 4AE0A 4XNYH 1CF8L 1JNNL 2HWZL 4AITA 2YAMA 4PJDA 3VNYA 3FZUC 2B1OA 4NAMA 4U1MA 1ZTXL 5BZWB 2R29L 5E23A 4HKZA 5KVEH 4YBLC 1A22B 4K8RC 1R4XA 3ILQC 5I0WA 4OM0H 4UTBH 5JIQA 2E9IA 4EXPX 1OP3H 1NIFA 2JKXA 4H7VA 1UCBH 5DUBB 1L3WA 1SUHA 2Z4QB 1QPPA 2LU7A 5JHBA 3FTGB 4X7SL 5EMYA 3D3VB 2XG5B 5DC9B 2UXVA 2E9WA 5IB1B 1UOWA 4MHHI 3DO7A 3QFJB 1TDQA 4OM1L 3RFZC 2FK9A 2BDNH 3KPQA 4HIPA 2IMNA 1GVIA 3SPVA 3CHOA 2O6FA 3HZMB 5IVOA 4F9PA 1JPSH 4O51A 3ZIYA 2P45B 2VDRL 3TJEH 3US0A 2BO0A 3QHTC 5D8JH 1FL3A 1ZVYA 3L5JA 1SFDA 4KK5D 3ARSA 3IGAB 3FTZA 2H6UA 1PEWA 1CDBA 5D4IA 2AXFB 3DC0A 4ZNCD 2H2PC 4NZRH 3ES6B 1IGYB 3R8QA 4AM0Q 4XNZC 4ZO6A 1TQUA 1ETB1 1B4TA 1INEL 2X40A 1Y18A 2W95A 3C8HA 3INOA 5MP6L 4WGKA 2A3TA 1DDTA 3FOLA 2K0RA 3NQIA 5BOZG 1O7VA 2OXGB 1IU1A 4OKVB 1SVBA 1FCGA 2JIXA 3QDMB 1SN5A 4BQ9A 1O9ZA 1YNTA 3T5WA 4DAGH 5C07A 1XSOA 3MUGB 2G5UA 1D5XA 3HA0A 1OE2A 5FOJA 2Y06H 3PXLA 4OBRA 3MRPA 2MCMA 1FN4A 1G7JA 3DECA 3UPCA 2AEOA 3IXAB 1AZVA 4OTXL 5DFWH 1JYXA 2UZYA 3P30H 1QYGH 1W0VB 1QO3B 2VMDA 4FGMA 1NFDE 3UPRA 3JWNH 4PJBB 3UBFA 1PSKL 4HU8A 3SE3A 4GRLC 3SDAA 1R75A 2OP4H 3CCHA 1A4KB 3H4HA 2IF7A 2LVCA 4PW4A 5LAPA 1TZHA 3CLEH 4FFZA 3ZE0E 1I7UA 1T5WB 3ZQWA 1UWGH 1ACYL 2ZQKA 4AQZA 1ZKAA 3UTSA 4EOWH 4ONHB 2HA1A 4NI6A 3RVVD 2HMID 3TIDA 2DD8L 3IKCB 4EUPB 1DUYB 3PGDB 1XF2B 3V0WH 1TQVA 3PWNB 4TLSA 2VDOB 4UTCA 3WMQA 4XCFL 5BO1H 5SX5H 4GUPB 3NJFA 3SKOA 1TOXA 3NK3A 2LGNA 4HT1L 4WSJA 5DUMH 2E6QA 4Z3FA 1E27A 3I75A 4W9KC 5HGBB 4URKA 4NENA 1JDDA 4OCWH 4OGXH 1WT5C 1H3GA 3HB3C 5CUSH 3VI3B 3WMSA 3QR0A 1DUZA 1A4JB 4NWTH 3V5KB 2OZNA 1RUKH 2JCCE 3II1A 2E74C 5TE4L 1YY8A 5IB5B 1F02I 5KSBF 4HJSA 1H3UA 4Q2ZB 4ZSOB 4CBZA 4PJ8D 4HD5A 3G5ZA 1U36A 3MX0A 5J1TC 2UY6A 4MA1B 2P5PA 5C92A 3CVHL 2WLJA 3K5RA 1U8LB 2NQCA 4FFVC 3BFWA 5EZOH 4MQXD 1FBIH 2PP9A 3K4DA 4XPTL 4Y4KD 3V10A 1DJSA 4H0LC 5K5YA 4F5CA 4NQXB 4H5SB 2HPOA 4HWUA 3O4OC 4YO0B 1KCSL 4ZQTA 1S7XA 2HT3D 1RJLA 4QF1A 2CO6A 4F8TA 2NLJA 4E9RA 5FWRA 2K3HA 4MJ5A 2P24A 5KVMC 1F1GA 4LL1A 4Y1AE 3GHBL 1BFOA 4PGDB 1P4LA 1FWXA 1Z9PA 3B9VA 1E28A 5AD0B 5I9QB 2NT1A 4L3EA 1M7DB 4OIIL 5ACZB 5EV7A 4E5XG 4FQHA 4G9DA 3G5VA 4IDJL 2EDEA 4PGEA 4FYTA 2KERA 4HSAC 4LSSH 5F6IB 5J1AB 5G4OA 3K1KC 1FJ1A 3O8XD 4K3JL 3RU8H 2DWEA 1IL1B 3BP6B 5FOBB 4KQ4L 1FDLL 2TSAA 4L4VB 3FYIB 2BSSA 4JG0L 2BMKB 4JCMA 1UWFA 1ODUA 3G08A 4F7MB 3QXTA 1TTGA 3RDTC 3AY4A 5D2LB 2HVBA 4ZUSB 5LXGL 5BV7H 5I15L 1XF1A 3QDGD 2Q1EA 4HAGA 4LSUL 1LEIB 3UC0L 3I3DA 5F7YC 1D7DA 5FUOL 3HE6D 4MDIB 3X1EA 2WYHA 5E6IC 2WXHA 1K5NA 1N0LB 1UASA 5I1AA 3H42L 5MHSD 2ZWYA 2YEZA 4NPYB 3UTZA 1QVOA 5HHXL 2VCOA 3V0IA 3OB0H 2FLRT 2WLNA 4DVBA 3LQAC 2APSA 3V95A 5CEXB 1SEBA 2ZF8A 1OD7A 3KYMA 2IANB 4I13B 1NCWH 2C4FT 4Y0GA 3DSNA 4HPYL 2VLRB 7PCYA 5HPOA 3W2DL 2NY1C 3WNOA 2OK0L 4YFLI 1IGFH 2B1AH 2OZ4L 3S97C 4JPVH 5FO7B 1TMCB 4XT1C 2A6JB 4IIQA 5B4MD 1MCHA 2XQYA 3P11L 1K6QH 3TPUB 2ITFA 4Y2DC 4FABH 2BFVL 2DLGA 3BPOC 2WO3B 3D0VA 1QPKA 1FFOB 4EIZC 4DVRH 1MAML 1WWCA 3QC5X 2EJ1A 3RIFF 3FSZA 4XPGL 5BXFB 4J3OH 5EPMA 2N1KA 3VFWA 3MRHB 4PJAF 3QRFM 3K81A 4JRYA 2Z31D 5KSBA 1BW8A 4BSVA 5L7XL 4Z1PA 4ZAKB 4ZBJA 3HNVL 3X11B 3KPNB 5FW7A 2V7NB 1QLEH 3QWOA 5L2JB 3VFMA 4WO4D 5I8KL 4TUJA 2GCYB 2AXWA 5J11C 1JNLH 2NY2D 2P7TB 5DJZB 2V6HA 4JFZH 2EC9T 5FGSA 2Y07L 1H15A 4JZJB 2ZX5A 3I2CL 1EH9A 4NRZA 1IFRA 5BS0A 1A6PA 4PRNB 4BFJA 4FE9A 1FGVH 1ID2A 5E2UH 1BQHB 4ZOCA 4K8RH 3BZFA 4A7SA 1QR1B 2XKNA 3ZDZB 4HP5A 3O6KH 1T4WA 43C9A 3ABMB 4UI2A 3BVNA 4I4WA 2YIHA 3IBOA 4M48L 3DX8B 4AEIL 2PPCA 4PJ7B 4U1SA 1UTDA 5CJQL 5IBLD 4PVLA 3CFTA 5KOVC 2ZXBA 3JUZA 3ZTNL 3LEYH 1S7WA 1F11B 1KEML 1UJ3C 2ZCLH 5B7EA 1HL9A 4LCYB 2VLJA 4QRPD 1DJZA 3GSRA 5FGBC 5I8CA 4NX0A 4UIMA 3CSFA 3PFQA 4LKXA 4KXBA 5DVKA 2WNWA 4Q6YA 5IVXB 3BYYA 3D8MA 4DKTA 1WZ1L 3ZUCA 3E8UH 2H2SC 4EUPG 1L6XA 4AYSA 5CZXC 3LKNB 4HKXB 1JWSB 1SYVB 4GBXB 1NCCH 3SSGA 2F2HA 2VDML 5IHUL 5L9DH 1V10A 4JMNA 4D7PA 3QYCA 2YXVA 4Y5XA 5EO0B 3OD3A 1T21A 3BIKA 5TQ0H 1FAKT 3I6GB 4H20H 2F7QA 3HAEA 4TNWF 1Z1WA 2IBZX 5HGHA 3H3PL 2VN7A 1QEWB 4X4XB 2WK2A 1FH2A 1RJYB 4F80A 5TK4A 4LNRA 5T33H 4QRPE 4EJ1C 1XF3A 2VDNB 4HUKB 4XCEA 4G8EB 4APQA 1Q0XL 4HIHB 2ZAHA 3K6DA 2UWEF 1D9KD 3UCQA 3VQMA 2WXJA 4MAYD 4OQTA 3N2JA 4X2UA 4E68A 1RY7B 5D7IB 1VACB 4U1IA 4M56A 2D7NA 4LQFH 1TCRB 2JK5A 4PRID 1NPJA 2A73A 2EUWA 4HALA 4KX7A 3REVB 1NCBH 1BREA 3PPEA 1SMDA 1BEYL 2APXA 5D4HA 4AUJA 4PJAA 5JOPD 12E8L 4TRPL 1ERNA 3FO9A 4DTGL 1KLFA 4F3FA 3TNNB 3P9MB 3DXAD 3SB3A 1XTMA 1OAQL 4UUJA 1IEHA 1AGDA 1NCNA 3AS2A 3DYPA 4XNXH 4CA4A 4TQEL 3STBA 1WIUA 4HCRA 2NUTA 2H3KA 3JTTB 4YL4A 1BQLH 2GB2A 4GSRA 1O6TA 3EYFA 2NY4C 4YIQA 2G9KA 5GGQL 5GRYA 4MB4A 3IDJB 1A6TB 1C08B 2NXZB 3M46A 4GW4A 4HSQA 4U2ZA 2ED8A 3MLYL 4JGMA 4XXCA 2YC1B 2ETWA 2YKLL 4PRIE 4UMGA 3EYSH 4Q97A 1O7SA 4HIJB 3KBPA 3WI9A 2VERN 2YPLB 1NBCA 5A7EA 1HK6A 4QAMB 3Q2NA 1AKJB 2DH2A 5JOPE 2D9QB 3DJSA 3MV7D 3MLPA 2FZ3B 1LE5A 4KI5E 5DQJA 2YAOA 4OBSA 1ZGLM 3UZEA 1E4JA 1FFPA 1UT2A 3OLEA 4ODHL 3ZU8A 4A2FA 3CVIH 4OZGE 1WCBB 4CN6A 3AGVA 2A0LC 3P4LA 5EN2A 1KPUB 2QKIA 3MXVH 5C09A 1GR7A 2F58H 1XV8A 5DJ2A 1MN4A 4GQPH 3I3BA 2KYIA 1MW1A 1RQ5A 2HT4D 3WE1A 2XZAH 1FV1B 1HH9A 4GRWB 3MOAL 5C08D 3KWVA 2HKHH 2HJLA 3FUJA 4JHVA 5LBGA 1L9SA 4S1QH 1OSEA 4D0CA 32C2A 1QFWH 3QE5A 3OB8A 4P23C 1E3FA 3S96B 3VUAA 4QR7A 2QQLL 2YBGA 1R5VA 4V1DD 4ODVH 4JDEA 1RPUA 2WINA 3DUSA 2JCWA 4TMPA 2J20A 4PBDA 3IDMA 3M88A 2PUQT 3QJFA 4MA7H 1PKQE 4AC4A 4S1SH 3NGBC 2UWEA 3MYZA 5AKVA 4MASA 1DJYA 3TEYA 1N64L 5B1BB 4CC4C 4ICWA 1LK3H 2R2CA 1JHKH 1JSYA 1OCWL 1BZ9A 1H6UA 3IDNA 3NQKA 5EF2A 3FCGA 1LVEA 2P5WD 5AUMA 1R3KA 2W92A 3P4OA 4Z7UB 1FORH 3M86A 4FTVB 4QLWA 2BOLA 5KVFH 1ZK5A 4ZOBA 1BQHG 1MCBA 4RNRA 4ZUWB 2JQZA 3LB6C 3LQAH 2EXWC 5IF0B 2V5MA 3BH4A 3EDEA 4V1DE 2JELH 3D0LA 3U48A 5JHDD 3ARFC 4G6JH 5DVNA 1K5WA 2DV6A 2WVUA 4LCUA 5KYUB 1XXFC 3U2IA 1DVFC 2XIBA 15C8L 1TCMA 3NESA 3QAZC 3FF8A 4AIOA 2OMZA 4ZTPH 2CR6A 1L7IH 5DS1A 3UZQA 1MLCA 1MCDA 5DTFB 1I9IL 4XAKD 3MZGB 4GKSA 1B9KA 2BIPA 4Z7QE 1E3ZA 2F9BT 4KUZL 4IQHA 1T83A 2P5WE 3WFBH 3TT3H 4BXVA 5FC9A 3MJ7A 2NPLX 5FXCH 1YMMB 2HH0L 1OP9A 2AK4D 3T2NL 3PHAA 2M1KA 3ZTCC 1MNUL 4EN3D 4AM0B 5BOJA 5DK0A 3T3PB 5C6PB 4NUJA 3QUMA 5JHDE 4WTZA 2GJ6B 1MRFH 5J9PB 3PAVA 3HC0B 2WB1A 2WN2A 4F7EA 3EJRA 5CD3B 1AO7B 1JYWA 3O81A 4F37F 3MTXA 3P0GB 5DMJB 4DGWC 1YJDC 2OSLA 2IAAC 1F86A 2GIYA 5GHWL 2X1WL 2QMKA 5D70H 1MUJA 4F57L 4P3WA 5EIQA 1OHZA 2Z64C 3FQWA 4LBEB 1Y6NR 3SBWC 3OVUB 4N86A 2A6KA 4F33B 1RIUL 4HF5H 4K73A 1TEYA 2AQ1A 2ITCA 3JWOC 4LOEA 2H0FA 4PJFF 4QHNB 3SOTA 3OTTA 1JNHB 2PP7A 1YNKL 2AK4E 1CICB 2Y6SD 3MRBB 5IQ7H 1KFGA 4NJAH 3GGWB 3S36X 5IW6B 4IRSD 2R0LL 4LEOB 3NDZE 5ITFA 2IGFL 4GKOA 2RIKA 3HFFA 1LEKA 1YN7A 4R96B 4HJTA 3EGDB 4CKVX 4LLQA 4UBDD 3ME0A 3NTCH 4AVKA 4QUOA 2PO6D 1IKFH 3DOHA 4LGSB 2O61A 1VIWA 1MRCH 4OU3A 3FO0L 3Q3GA 3TWCL 2X4QB 3GRGA 3BDYL 1SDDB 2F53D 5GSVB 2GY7B 4G2AA 4G7RB 5CZKA 1I9RL 3B2PA 5DRXB 1V7NL 2NY3D 2DQDH 3L3KB 2DJMA 4XP5H 1P5VB 2BIHA 3CFEB 3FB8A 2GY5A 1U3HB 1JOIA 1S9VB 1SXZA 1Z9SA 2AXJA 4LHJB 5AW7B 1KIPB 4PRDB 2FQGA 5LCVA 1DEEA 4H1LA 5DQ9A 3ARUA 3P77A 4UT6A 5AOJA 3VTAA 3GSWA 4OVUA 2EDKA 5EZJA 3UIZA 4RH4A 2R2BA 5LG1A 4NKMB 3PAYA 2CMRH 1CZ8H 2WB7A 1EBAA 2OAAA 2CO7B 1IQDA 2M26A 2J57A 3QVAA 2CCLA 3FO1B 2DLEA 1D5ZA 1RZIA 2F53E 3HN3A 3OSVA 2YARA 3RWIA 3CXDL 3GINA 5I19L 1K4DB 3VFGH 5AVWB 5JR1L 4K71B 1MFBH 3DX1A 4U3XA 5HDOA 25C8L 2Z6FA 5IWLA 2EUVA 2MSPA 3F7VB 2D7TL 4KOBA 4U1KB 2GJZB 1M05A 4N2MA 3O6FA 4QRAA 1SLXA 2NDGA 3VVVA 4JM0A 2VJ8A 1RUAL 4WTWA 1E5YA 4JY4B 2R0WH 4XE5B 5DHDA 3TBSA 5K9JL 4N2LA 3TCLA 2W8CA 1H0DA 4PJEF 5JOFA 2N56A 4I3SH 4JMXA 3WTTA 1A66A 3ZHDA 5E4EB 1NCOA 3CFCL 2DH3A 3CDZA 3QNFA 3VFVA 3WJLA 4BHUA 4TULH 1ICTA 3HTLX 4UANA 3EJZC 3HS8A 3WOVA 2L7JA 5EF0A 3ULVD 1IAMA 1UH4A 4S11A 1ZGLP 4OGQC 4HS3B 4D0DA 3SKMA 4FXGB 1BG9A 4KITB 4OZIB 4JPIB 3LQZA 3C6SB 4YDKL 5B1KA 3MNZB 4U3SB 4PJFA 4XN5A 3KWWB 3V52L 5DJCB 4W9HC 1FZOB 3NCBB 3IJEB 1NH6A 4PJCB 3B83A 1ES0A 4M5ZH 5IFJA 2UYLA 3VXSB 2VAJA 4ZMQA 1HYSC 3LZRA 3KPSE 1RH8A 2DIBA 4YHZL 4JFED 5TDPB 2JJVA 3WO3B 3EFOA 4JFQA 1GJIA 3GBNL 3FQ4A 2BS8A 5AG9A 4F27A 3WSQL 3BQUD 1USQA 2AAAA 1VJSA 4OCRH 4WDIB 4B5EA 1HSAA 3DMMA 4IK6A 4CAGA 2A77H 4X8JA 3GSNH 2BWDA 3ULVE 3HIZA 1RLWA 3F7YB 4WHTA 4E41A 1CD9B 4R4NC 1ZE3H 4GW5B 5B21A 4QO1A 5ICXA 1ZS8A 1BZDA 4U1LA 1IKOP 3UL4A 3FB5A 1VADB 1MQKL 5HHNB 3SCMB 4YXKH 3Q48A 2JF1A 2WTRA 4FXTA 5F89A 3LKRB 2X9WA 4UM9D 3BIAX 3W0WD 3QIUD 2CJUH 4LOUC 1CXHA 3HHSB 3LRLA 3VXMA 4BD4A 2BSRB 2WXQA 4NSKA 4JKLA 2J7LA 1A6WL 1PZ2A 5D1ZC 3BPCB 5CLWA 2W0FB 3DUHA 3V0DA 2OULB 4EEEA 1I1AC 5IY5B 3M45A 1PAMA 2K6ZA 3C5JA 4JN2B 3UEZA 4BFOA 2BY1A 2MOGA 3ASWA 3KNBA 3R1GH 2W81C 3HE7A 2GBVA 4W4OA 2BVPA 1GZHA 1VGKB 3FT3B 3T0WA 3CZLA 4I18C 4MZIA 4X5WB 2R7EB 3DTXB 2Y7MA 1IBBA 1U30A 1AI1H 5J6SA 3BAKA 3CSGA 3L1EA 3OZ9L 4P5SA 5CIPA 3CX2A 4I1RA 2V17H 3W0WE 1KLGA 1OTSD 4R84A 3X1FA 3IN0A 3J7HA 2X3CA 3GUTA 3FH7A 2FCBA 3U30B 4MCYB 1O6SA 2PMZA 1KTLB 3R06B 5FYLE 1IBZA 1EXUB 2DQIH 1JXDA 1FIGH 3PJSA 5KTEH 1U8HA 4PJEA 1HXMB 3VQLA 4LF3A 3F6IA 2R0ZL 4WUUA 5DMGD 1DVUA 5JIHA 1NGWA 1JYNA 5FUZH 3DURA 2A74C 3DIFA 4I85A 1LQSR 1IGCH 1PG7H 3G7TA 2M83A 1ORSB 4EI5C 4KKAD 1IUZA 3QG6B 2EE2A 1CYGA 4GQQA 3V6BR 2WVVA 2XQYK 4I77H 3D9AL 5FPIA 1S78D 3D4GA 3Q6GH 4N6RA 3IVKA 1AD9B 2QPDB 5DI8B 5T3XD 1V8HA 3ZKMD 1EGJH 1EBPA 3OXSB 4UU9A 4YBHA 4RQQB 4XGZA 1ZANL 1IT9H 4QHPA 2NR6A 3RPKA 4YK4B 2BPBA 3MA7B 4HZ1A 4ALAL 2BINA 5GPRA 1AH1A 4L48A 4J4PA 3EFFA 4A2MA 5SWZD 3EYOB 1JJUA 1BVNT 2W0PA 4KDWA 4PS7A 2PTVA 2XKUA 3QUXA 1I7ZA 4G7VL 1NLDH 4Z7WE 3CFJA 3D4CA 3GHEH 1JWUA 3WUWA 1KJ2L 1VF5C 1EHAA 1YJDH 3WTVA 1BIHA 4A39A 2IV8A 2VM3A 4PWEA 3FTWA 5ERWB 3TFBA 4X6DF 4JFOB 1PIGA 1XF4B 3X17A 2Z35B 4X4MA 1T5XA 3UYRH 4PHZA 3LEXA 3JWOH 4CVXB 1KXVC 4Y89A 2JKWA 2VMCA 2VXUL 4DW2L 3K8KA 4R6UA 4IKLA 5T3XE 3W38A 4IKNA 3RZCA 2NXYD 3VW3L 2ZPKH 4N0UE 4Z23A 4CRPA 5BZDB 4NHUB 2APVA 1FRGH 5IVZB 2AEPL 2YMXL 4A6YB 3NRQA 5SWZE 2HVKB 5E9AA 4RCAA 1QBLL 2HSIA 4O2FA 4PJGB 4Y16C 1HWHB 4XTRD 2DKMA 2GFBA 2AJZB 3GK8L 2XLLA 3AABA 2DTMH 4HPOH 4YDMA 4H25A 2BVOB 2EDYA 4CSSA 1ZTXE 1BMZA 1G9NL 2ESVA 4LDCA 4PGJA 4F7TB 4KQ0A 3GXTA 2I5YL 5CSZA 3ZGIA 4J27A 1LK2B 1T1YB 1MCOL 5IFHL 3WTWA 5ECGA 1CXEA 1A7PH 1GPOL 4BRJA 1EERB 3FQNA 3Q6FA 4F2MB 1KN2H 4GSQA 1G7HB 1NFKA 1UFGA 5JQ6H 1Q72L 2F61A 2C1PB 5CAYB 1PD6A 4H0IA 3MR9A 3WG7B 1XBDA 3VVWA 4GKZB 2XQBL 4TPRH 2G3MA 1QFOA 5C0FA 3RFZA 2H9GB 4DGIL 5C6TL 1H8LA 3MBED 4HUCA 4UTAL 4OD1H 5G4NA 3BVUA 3GMQB 3SDDD 4IGBC 4OLYH 2Q6WA 2O30A 4EDXA 1QA9A 3V9EA 2BZDA 3KVDD 1B6DA 5HVFB 4ZUUB 3U25A 2WCGA 3C09C 1GSMA 4WNJA 2J6EL 2B0SL 3BKCL 3DX6B 4CU6A 3CZSA 4FQXD 2HMIC 4EVNA 5BO0D 3DHMA 1MJUH 1I1CA 4I0PC 1OP5H 1OAUL 4YDLC 3U4KA 4M5SA 2P9RA 3UBXI 4U2YA 1UH3A 2G5RA 2YUZA 5IMOB 4G6FD 5HD8C 4FMFA 5D7JD 4NQQA 4X4ZA 1H5BB 1CXLA 2FB4H 2ICWA 3U6RB 1NAMH 1GGUA 1A65A 1U2HA 2CBPA 3D0AA 2CBMA 4HETA 1XO8A 4UOW1 3TNMB 3DRQA 4ZRGA 4GI9A 2PCPB 4QOKB 1AZRA 1KTJA 3ULSB 3ECBA 5JPNC 3B3BA 1B2YA 3QCUL 5B38A 1NMCC 2FNBA 4JLRA 1EJ8A 4X6DA 4Y4HB 1CGSL 1EHNA 1UM6L 3QPQD 4GRLA 3BT2H 3QCVL 3KL3A 3HVNA 5C0JB 3PHOA 4UV7H 3K6FA 3EO9H 4PLJD 3I6KA 2W9DH 3HR5A 5BUAA 4K94C 4R26L 4FERA 5L4MA 5DRZA 3T3MB 1A7NL 1AR2A 1RZKL 3O41B 2E8ZA 3K72A 1X9QA 4Z95H 1JI1A 3F00A 4P2QA 5A6MA 1DQML 2CO4A 2W9EL 4KK8D 3QB7C 2WJ7A 4BGLA 1NCGA 1KJVB 4N5UA 3U0TA 3TEZA 1DLHA 4R7XA 1XCXA 4B7LA 3WY1A 2F5AH 3LSOA 5I0XA 2I85A 1GGTA 5I82A 5MEQA 2WY3B 1WT5A 1KXTB 1ZOXA 4W9LC 4MJIB 5DEJA 1T3FB 1RD6A 3D52A 4YFDB 4YDVB 3HLAB 3QQ4A 2DKSA 3E6FA 1CDIA 3CVBA 3IK2A 1EAPA 2R4RL 3BVVA 3FPYA 4U0QB 3AAZB 4N2OA 2YPVL 3FCTB 5D2NB 3U9UB 4AQEA 3HE6C 3NIGE 1UD6A 1KTCA 5D1QC 3VH8A 3WHE1 2MTAA 3EADA 4PJDB 2B1HH 4GLRH 1KB5A 4FLSA 1IAOA 4XMKL 3S2AA 4U1MB 4WSGA 4RZCA 2QVMA 3UJTL 4PRAA 1U8CA 4HKZB 4AMKL 5ANMB 2NYKA 3BC9A 2OA9A 1BV8A 4DF9A 1XCQA 1PS3A 4RAHA 4LSVH 3UTTE 4UQBA 1PY4A 1XH0A 2ZNWA 1IARB 3LIZH 1B4JH 1CK0L 3N43B 5E0QA 3U4BL 5HVGB 3ZE1F 1G84A 3BW9A 2WXLA 2Y7NA 3B2UD 4X80L 1A21A 1XD1A 4BSJA 4F7CA 3NJKA 3STZA 4IW4C 4F58L 1OQXA 7PAZA 5BVPH 3IU4L 3MJ8A 3ZKSD 3KMDA 4WSKA 4NNPL 1TJGH 3SPVB 2VAAA 1MCEA 1HHKB 2HYMA 4O51B 3ZKXB 3RDTA 1HOEA 2L4OA 3AGWA 1CDYA 5E70A 1FL3B 3L95A 3PL6B 3PAUA 2MNWA 2PPEA 1JZ8A 1E4WH 3CFBB 4FG6C 5LLIC 3CSYA 4JFFB 1HIMH 1EXGA 1TEFA 1ONQA 4KV5F 1ZD6A 4HKBA 4KKBC 5E6IA 4RGNC 3O9WD 5C0EA 4LLAA 1Q90A 1PZUB 3GSXA 5FGRA 4HSCX 1Y18B 1NC4A 1QI3A 3D39E 3IFOA 3FOLB 1CG9A 2D7PA 1X6NA 3IJ8A 4WU7A 1JYVA 1ZSHA 4OLEA 2JIXB 4JO3L 3WAJA 2EEDA 2J12B 3CN3A 3C6LD 2BC4A 5C07B 4CVWA 3B9KC 5IQNA 5B39A 1D5XB 4F15C 3ATEA 1J1OH 1MJ7L 3MRPB 1FN4B 4B3EA 1G7JB 3FU7B 2D4FA 2ZXAA 3BOVA 4MZ3A 1GZPA 2UZYB 5F0MB 3NIDF 2BVQA 1IC7L 1G9MC 2FIKB 1WYJA 1YPZF 3BO8B 1A1OA 5CZVH 4Y2DA 1R3LA 1UFUA 4DGUA 2ATPA 4HJIA 5HHVL 3SDAB 2X6CA 3EH5B 4WTXA 3KR3H 1XGPA 4NQDA 2LHAA 1LO0L 1TZHB 1FNAA 2UX7A 4DEPC 1I7UB 3C8KA 1F18A 2V9RA 4PJXF 4W1TA 4HBQA 4BZ2L 5DLLA 3QS3A 5I23A 5JYMA 1KN4L 1SJVA 2WYIA 4I2XB 3UTSB 3WUZA 4PI2A 2BHYA 3TIDB 2CO2A 4KH2A 2XETA 1MFEL 2YSSA 2AXHA 3KPMA 4G6AC 4Q9BA 2K3TA 3SKOB 4FXKC 3FUHA 3KLDA 1E27B 2YD1A 3I75B 2OTWA 4KVCL 4NENB 3O0RL 1X5AA 1HTYA 1ZV5A 3MRQA 3QEGH 5F7NC 1H8NA 2UZIL 4LCIL 4U6HA 1KWKA 4QGTA 5K59F 1YY8B 2EIJB 1DQLH 2Z8VC 2JB5L 2E9JA 3HUJF 5KBMA 3VXPA 1X5ZA 3G5ZB 3MX0B 5EOCL 2UY6B 1OP3K 3AVEA 1DP0A 3NABH 2WO2B 2MQ3A 2X42A 2K9FB 2FDBP 5EORL 3KWTA 3VG0L 2Q8BH 3P0YL 3QI9D 1JXJA 1LMKA 1S7XB 1UJ3A 1RJLB 4QF1B 1U8NA 2CO6B 1IILE 3H2QA 3KH4A 1IGMH 4ATWA 5I75B 2NLJB 3SYOA 5CEYA 3ZZQA 5B3JE 4MJ5B 5KUMA 2BERA 2P24B 4M1CD 4FQJL 1OGAA 5FGBA 3SE9H 1BFOB 3MUZ1 5HYJD 1P4LB 2OR9H 3MJ9L 4WCYH 3UAEA 1E28B 5AVXB 4L3EB 1SY6A 3GTNA 4ZD3H 4KI5C 5I6XB 1RXLA 3I9GH 1C7TA 4KRNA 1P4UA 4WWNA 1NGXA 4FQHB 4G9DB 3G5VB 4AEEA 4AYMC 4PGEB 3ZYOA 1OANA 5G4MA 1FJ1B 4ANXA 5KYWB 5FECA 3PF2A 3ZDYE 5IBUB 2BSSB 4JRXE 2OXHA 4JR9L 2CIKA 3G08B 3QA3A 4XCNA 4KZDH 5F3BA 5F3FA 1YDPA 5FW8A 3QORB 1BLIA 5A2FA 2ZXWB 1J9TA 4G5AA 1BFTA 3O6MH 4GAJL 1SJXA 2I7OA 1NDMA 1K5NB 5I1AB 1UA3A 2B20A 3MV9D 3UTZB 2YEZB 3QPXL 1QVOB 2YD0A 4JFDA 2FYYA 3KVPA 3K2KA 2AI0L 2IAMD 2YRZA 4F37K 1NOAA 3MLRL 4DVBB 4WGVB 1CCZA 1SEBB 3TBWA 4LL9A 4Y1TA 1E2WA 2DLHA 3KYMB 3Q8AA 3SY6A 3HHRB 3NEOA 1LO2L 3DSNB 5F1KC 4JGUA 1B0RA 1H3XA 4HLJA 1UCTA 3KEDA 2GJJA 4AV5A 1RL1A 5EG6C 3FONA 1FFRA 1OAXL 3K7UA 1Q1PA 1F58L 1AQKH 2VW4A 2ZNXA 5BRPA 5FUCE 1CBVL 4PV1C 1NC2D 4JPWH 1UZ8A 4Z7AA 1XGUA 3WENA 4IEFA 4X9FA 3DJTA 3MV9E 4FHKA 1CL7H 1MFNA 3D0VB 1XF5A 2XT1B 1N8OE 5SX5K 1DJWA 2FEJA 2YMOA 3Q5YA 4QRRA 2QPUA 3ABGA 5CN1A 5EPMB 1KBGL 4GKNA 3VFWB 3ZL4H 4JRYB 1X4ZA 1X7QA 1Z3GH 4BSVB 1WWAX 3HUJA 1DL7L 1UA6H 2XFGB 5TQ2L 2JQMA 4UT9A 1Y1UA 3SJVD 3QWOB 5AW3B 5GRUH 3VWKD 2KLSA 4FQIH 4H8WL 4HULB 1CLZH 4TUJB 5I1JH 2OL3L 1XSIA 1RUQH 2AVFA 5GRJL 4BWUA 4TQHA 3GSNA 1H15B 4RA0C 4FQ1H 3KCWA 3MCG1 1PW3A 1LWRA 3KXFD 2E27H 1ZSDA 4NRZB 5BS0B 1BECA 3SIKA 5DT1L 3MGOA 4HQQH 4YH6A 1XGYH 4KJPD 3T77A 4QCIA 4HXAH 1IVLA 3BZFB 3EYQC 1Q0YH 3NIFB 2XKNB 5D7SL 1ZLSL 5KSUB 4G11A 4K4KA 5IROC 43C9B 2BJML 3VRIA 3BVNB 4I4WB 5L0QB 4FYRA 4C8XA 2BIMA 4S1DC 3GBDA 3DHJA 1KYOJ 4U1SB 2WLLA 4M7KH 4HZAA 5DD0H 3SJVE 1BAFL 1L7TL 2QFPA 3IDXL 2WXRA 1S7WB 4LE8A 1A7OH 4FNLL 1QLRA 2DMHA 2VLJB 2ZP8A 4P23A 4G42A 3MAWA 1G6RH 1MY7A 3OQRA 3GSRB 4Y9GA 2IQ9L 1CU4H 1RVFL 3VXRD 5I8CB 3QYNA 4C47A 4UIMB 4LKXB 3KXFE 4ZYKA 1ULVA 2EVGA 1LL1A 1KCRL 5ECJE 2ICES 1KIRA 3ARBB 4XRCA 1MFVA 3G6JB 4YXHL 1VESA 4CC4A 5C0CA 2EDDA 4B3VA 3VGAB 4Y5XB 4M4PA 4EIUA 4NQTA 1T21B 4G3YL 4JFUA 4ZDHB 1EJFA 2FBJL 5BPPA 2PETA 2XN2A 4WWKC 1XGZA 4OFYD 3HAEB 3A67H 1DQDH 1KGUA 1QFPA 5HGHB 4L8BA 3BT0A 1LWHA 2EDMA 3OB0K 4I48A 1NGYA 2SEBA 4KHXL 2NY7H 1S9WA 2ICWJ 3HBGA 4LNRB 5TD4A 4B0MM 4YDJB 3L13A 3RE0A 4YSQA 2ODIA 2AZAA 1XF3B 4XCEB 3ARFA 4APQB 1QTPA 1NAKL 5FHBL 5T5NF 1DVFA 3FHQA 4OKDA 3CZKA 3QRBA 1P6AB 4DSYA 1NCDH 4XBEL 5GGSA 5CF3A 3U6XA 3TX4A 4U1IB 4M1GH 1OM3H 4HIEB 2WIMA 5H37H 4HS8L 4MCZA 5GGRA 2A73B 3DK2A 4B9GA 3WIFA 1YN6B 2F8XC 1TFHA 2DQFA 2F0CA 4ZFGH 4PJAB 4ELME 4KJWC 3MLXH 3T9WA 3QS2A 2LU3A 1F97A 3FO9B 1KLFB 4F3FB 3GRBA 2QHLA 5EUOE 4Y19A 4UUJB 2FGZA 2VW7A 1NPUA 3SGEI 1QTYT 5IBUG 2H0EA 2NUTB 3LZLA 3TVMC 4AIEA 1DR9A 1UXLA 3EYFB 2JKRM 1WFMA 4YIQB 1NBZA 2GSIA 4GW4B 1FNSL 4FHJA 3D6GA 1ETZA 3N0PB 3SBWA 4NQED 3V8CA 5AVZB 1UYWH 4Z3TA 1WISA 2J56A 3P9LA 4Q74A 2FWOB 2Y5EA 1BYPA 1J86A 5GQBA 4AVHA 1QEXA 1J12A 1CT8A 1LE5B 1RIHH 5ABZA 5DQJB 2HRLA 1C5DA 1FFPB 1BD2D 3BIBX 5KJ7E 4M43H 4I7ZC 3VWJD 1NGPL 4KRPD 4GMSL 5EN2B 5C09B 1G1OA 2QKIB 2HLAA 4IKIA 4PRPD 5DJ2B 3N44F 1JK9A 4YHYC 3NJJA 4H8UA 3DRTA 4PJIB 2WQVA 3P02A 4JY5H 2HAZA 3HMWL 3DIDA 1AOHA 1NOLA 5EIIA 2XQYG 1ADQH 1EEUA 3C5ZD 1HH9B 3T08A 4PVBA 4CL7A 5GS0C 1MELA 3BPLB 2IV9A 4TVUA 5TDNA 4G8GA 4KKRA 2W59A 5FX3A 1FH5L 5HHQA 3OKNA 2GK0A 2HJLB 4B9JA 4KUCD 2QZ5A 3VI4B 3F3HA 4D0CB 5I71B 4HBCL 32C2B 1PIFA 1JDAA 2O5YL 5ADPH 1RJCA 1NBVL 1V3KA 3EF7A 1M3IA 1R5VB 1QSFE 3DUUA 4JDEB 2WINB 3DUSB 5D55A 5KSAD 1D6EA 4CUCA 2YAHA 1S3KL 3H4FA 1JIBA 3EYUH 3IDMB 3QJFB 3IMBA 1N9PA 5I1KH 3CNKA 4NQCD 2DQMA 3O2DA 4FZ8H 1X5XA 1E0OB 4FKEA 2WOBA 1YQVH 1PMYA 2DYPA 2RMNA 2IFGA 5TF1L 5LBSH 3IJSA 3WNMA 1BZ9B 3ULAB 3IDNB 3K91A 3ZN6A 3QDAA 3B8SA 5AUMB 4AMWA 3P4OB 3V0VA 4NQVB 1WAAE 2DLFH 1IB5A 2LAAA 3L4CA 2JJSC 3U1SH 2H1PL 2P4AB 4RFNC 4RNRB 4HHAA 3P2TA 4P04A 3ZE2B 4AYDC 2Z0UA 3LTVA 2DIEA 5ISZE 1U2YA 4GIAA 3RYMA 1T22B 4X5QA 1HXYA 2WYZA 2EECA 3D0LB 5L6YL 1WBYA 1PG7X 2K7QA 3B5TA 1S2EA 1NCAL 4LCUB 3WXWL 1G43A 3EJTA 1A4BA 4L3CB 3FMGL 4NQCE 4WEBL 1HJBC 1R0AH 1A5FH 2OMZB 4HJJH 1YA5A 3RVUC 3FAXA 4OVVA 3UZQB 1CFTA 4KROD 5KS9F 4RWYH 1MLCB 4R7LA 4LLDA 4LRNL 4GKSB 4ODXA 4Z7VE 1SHXA 4OZFH 4W6WB 2A9NH 3WFEH 3NFPA 2XV3A 4P3CH 5TDOA 1RZQA 1XTLA 2E3VA 4OF6A 5DJ8A 2VXQL 3TU6A 4QHUA 4X6BA 3MJ7B 5JIMA 4AJWA 3PAZA 2B5IC 2YAEA 4X4KA 2E7HA 1DN2A 1AR1C 4LO9A 3AM8C 3WKPA 4ZUTA 5FYJL 5DK0B 4IBZA 2CIIA 4NUJB 3QUMB 4N1HB 2VZ3A 5GS1C 4FDWA 2NZIA 4MDRA 5AOZA 2CDGA 1DE4A 2ZKHH 1SN2A 4F7EB 3NCJH 3S8FB 2VKXA 1AGEA 2QADB 4UQ2A 1LTXA 1CI5A 2OSLB 3MMEA 4W9EC 2PTTA 1MUJB 2WIIA 4L0YA 1J8KA 1HFUA 2A6KB 2X53A 1I3GH 2ITCB 3TJHD 4EAEA 3I3EA 4EDWL 1EVUA 3VD5A 2E47A 4O02H 1A6VH 1A4CA 3X13A 5KJRL 5HGAA 1PYWB 5E8OA 5ILTH 2PWFA 4ABQA 2X4NB 1SJMA 5F7BA 1NIDA 1LEKB 5CJOH 5T1MA 2W38A 1MCFA 2CGRH 2PYEB 3ME0B 3QZWA 1QHPA 2J8OA 3SKJL 2Q10A 3LPWA 3ROOB 2O61B 2O6EA 5D1ZA 1V3LA 3T0EC 2JB6A 4E9QA 3Q3GB 1I1AA 3CIQA 3HBQA 4JM4L 1TENA 5J13C 1S78C 1JVLA 1RZ7L 3I9PA 1V05A 2R8SL 4KPHL 2R51A 2FJFA 2Q5BA 4X7DC 1MPAH 5I1HL 1MCPL 3IU3A 2IADA 2F8IA 4HOXA 3UYPA 3FB8B 2CLRA 1O0VA 2A6DA 3MHZA 1NLBH 4I18A 5JOEA 2AFNA 1Z9SB 2AJVH 2GPZA 2EDRA 1TQCB 2W1NA 2J4WL 2V3FA 2Y36H 1K72A 1DEEB 3IPEA 4FJYA 4NJ9H 4KXDA 4H1LB 4WU5A 5CHNA 3P77B 4G7SB 5DQ9B 5HI4D 3GSWB 4K23L 4R90H 3TN0C 4FFYH 4XPAL 5EZJB 2DZEA 3KDMA 1NCTA 1RAMA 1AC6A 3BKJH 4PY8J 1EFXA 4M7JL 2Z4TA 2FJSA 3RHWF 2GABA 1SVCP 4LP4A 1JHLH 1IQDB 4Q6IC 3WD5H 5HXMA 3RAJL 4FCHA 2AF2A 1RZIB 3RWIB 5J57B 1X5KA 1OT1A 5HYFA 1ZA6A 4ZX5A 2RCSL 4C56E 5BQ7A 5KS9A 2X1XR 1S7TA 3FU0A 3HJ0A 4HV8A 2C3WA 1ROCA 1OTUD 3BSGA 2A74A 3NCFB 4AGOA 5HHOE 4ENED 5A2IH 4FFWC 1H3PH 1M05B 4ZXBD 4EI5A 3O6FB 4JQIH 4MX7A 4ABWA 3BSZA 3WDJA 1ZS2A 8CGTA 4CJ0A 1GHFL 3L7EA 3MCLL 5CBAA 3TCLB 1YQ2A 4L5FL 4K5MA 2YN3A 2KPWA 1FFNA 1H0DB 4X9GA 5DC2A 4LU5H 2NX5A 5JOFB 2IDCA 3WIHH 1URLA 4XXWC 2V7HB 4YUEH 2A9AA 3D50A 1NANH 1TZGH 4QTIL 1P69B 2F7OA 3EF4A 3S3CB 5L88H 1M56B 3CDZB 4RAVA 3VFVB 3TBCA 1BSIA 4NHCL 3ZQXA 5E2TL 5K39A 4YSOA 4QMEA 4KAQH 2DPKA 3SKMB 3I50L 2N7AA 4PUBH 5DZNA 5CMAA 4PR5A 4ZTOL 3MLWL 3LQZB 2CDFA 1BXVA 4UQCA 4Y2OA 4DUXA 4OUOA 4PJFB 1C1EL 4M1DL 5IW3A 1ES0B 5IFJB 1IQWH 2UYLB 5CFHA 1KXVA 5GSRA 4PBWD 5HDLA 5LWYH 4PJ9C 3EFOB 4JFQB 5CGBA 2ZCHH 4HK0A 2CGYA 1BAGA 3RKDC 3BCFA 2IBZY 2YWYA 1TETL 1HSAB 3DMMB 1HEHC 4TLKA 4LDOB 3KW8A 4ELKA 4X8JB 2K8QA 1ZRUA 4BZ1A 1BBJA 4Y16A 1N67A 4WHTB 3PHSA 2EYSA 3H9SE 4LPWA 3TA3D 4E41B 5HYSA 1J11A 1LYQA 1ZS8B 4NOBA 4RFOL 5E2WL 1CURA 3ILEA 2QMJA 1ZLWH 1WFNA 3FB5B 4NQUA 1L3NA 1P4IH 4XNUH 4N0YL 3IDIB 5DC4B 2WTRB 4OJYA 4XOCA 5E2VL 5F89B 1UB5A 5I8OH 2VRAA 1A3LH 2Y0SA 3VXMB 2EZ0D 2VLME 3PQYD 4TNGA 2FT6A 3S37L 2J8HA 2I9TA 2HFGL 4NSKB 1TLMA 3MRIA 3G5WA 1EEZA 4RISH 5DR5H 1FNLA 4JO4L 3D3VD 4LSPL 2NYYD 4YXLL 3LVTA 5TE7H 1UG9A 3ULVH 1E4XL 1HZHL 3C5JB 3GSQA 4WTZG 5EOQL 2XFXA 3QFJD 4XC3L 3KNBB 4IHBA 3QPQC 3HE7B 2VXTH 3WN5C 4ZMAT 3BAXA 4IGBA 5AW8B 3TWYA 2VO8A 3BVXA 4IHOA 2NY5L 3MOBH 1GL4B 3CQQA 5GS3A 5KBNC 1HVXA 4B96A 1I1RA 2YA0A 3HG1A 5F7FA 1PEZA 1KLGB 1WD9A 2FX7H 4DKFL 3PQYE 1XEUA 2W07A 4I0PA 2GTZA 1IZJA 4AZ8A 1GS6X 3QNZA 1O6SB 2FJGA 4KNUA 4AQ1B 5L4JA 2AGJH 5BV7B 4NWUL 3PJSB 2AMGA 1F4YH 4Y4FC 1U8HB 4LF3B 2XV6B 4MCNA 4WUUB 5D7KD 4Y1AA 4I89A 5H94A 1QHQA 3QDMD 2X9YA 1NGWB 4NFCA 4WNQA 4TTGA 1UKSA 4K9JA 3DURB 3DIFB 5JHLL 1OCCB 3KWUA 3ZJAA 4GFTB 2CJTA 3NFSL 3W9DA 1YZZA 4ODWA 3G6DH 5K9QG 3QWQB 4N5ED 5E6ZA 5T5FL 5JPNA 3CC5A 3TZVC 2WVVB 4Z3HA 2DYSB 4XOBA 4KC3B 4KK9C 4HGKC 3VD4A 4BFEA 2NOYA 4N6RB 3WEXA 3IVKB 3BAEL 1KIUA 1FSKC 3FU3A 2J73A 1I3VA 3ABLB 3PLYA 4HFUL 4ES9A 4UU9B 2D3LA 2AQ3A 3BP4A 3ESNA 1GZQA 1LO4H 1J0KA 5FYLH 4XGZB 1DQJA 1HH6A 4HK3J 1TUPA 3EJJX 4K3EH 2WQSA 1XR9A 2YD3A 2JLLA 4LASL 2EUXA 5KWYC 3X3GL 3EFFB 5AWNL 3BUQA 1QBAA 2DQTH 3QDME 2CRYA 3QUXB 3QC6X 4R2GD 4XP9L 1I7ZB 1T6WA 2G75A 1OT2A 3CFJB 3JYBA 4ZMZA 4K5OA 1JWUB 3CQFA 4K3DL 3SGKC 3L3DA 5ABAA 4KKPA 1OP4A 1JZ7A 5EN3A 4NFDA 3GLDA 2YD7A 2WBWB 4B9PA 2BNRD 3DVGA 3OAUL 2JKLA 4NT6A 3VE0A 3LEXB 1DSFH 2I07A 3ZHFA 1IJNA 4I3RL 4PS8A 2CK0H 4FN0A 1KDJA 3P2DA 4PJBE 1DBML 3RIAK 4BSWA 3GI8H 3RWEA 3RZCB 1KT2B 1QLEB 1CFBA 1BEXA 3I6LD 1AS8A 4N2EA 2MCG1 1A8JH 4KJQD 5IJCC 4MLIA 4KBPA 3S34L 3R18A 5DZPA 4JKMA 2PR4L 2E8YA 4O2FB 5GRWA 4ZMVA 5D1QA 2J1WA 4MXQC 2GFBB 2XG4A 3D05A 4JG9A 4OLXH 2YQGA 4H25B 4CSZA 3HI6L 2CPUA 4YBLB 4YGAB 5DZLA 5IK3A 3UACA 5CSZB 1TJXA 2BNRE 5FCUH 5C8JA 4QJ5B 3SYPA 1QOKA 4HG4K 5T3XH 1PZ5A 1CGUA 2IG2L 3JWNG 3K2IA 3VI3E 2FT7A 3N42F 3C08H 3RTQC 3TBTA 5IFAL 1R3IH 3NJHA 3SKUD 1TF4A 4QWWC 3MR9B 1N6QH 2XN1A 4R8WL 3FFCA 4JPKH 5C0FB 3RFZB 4TSAH 5CGYD 5E4AA 2J8UE 1CF8H 1JNNH 2HWZH 4MZRA 3MGAA 4EBQL 2MNJB 4JFYA 2Q6WB 1IJ9A 4EDXB 4L4VD 1QA9B 1T04A 1ZTXH 4HW6A 4ACTA 3NCCB 2R29H 1CDHA 2HJFA 3MVSA 4ZO8A 3DARA 4WW1A 1WEJL 1BGXL 4N28A 3OR7B 4P9HC 2GHWB 1VGEH 2D3NA 2R39A 1UOKA 2CUMA 2BSBA 4XNZB 4XCYB 3RNKA 1GSKA 5DF0A 1NCUA 4X7SH 4QD2E 1C12A 4EIGB 4L29A 3VD7A 1PBYA 3FSVA 4B9ZA 5AB0A 4GO9A 3UAAA 4PJHB 1CLCA 3IWUA 4OM1H 1TTBA 2BXZA 2ICWB 2IAND 4E9WA 4H0HB 5K1VA 4DPAX 5KANG 5PAZA 5LGKA 3PWLA 1CGVA 3ZHNA 4N9OB 2AQ2A 2VDPB 4JG5A 3OAYK 1BQSA 4L4VE 3A6BH 3B9KA 2VLRD 4ZMXA 2GUOB 2PR9A 3ESOA 5DJDA 1GCYA 2YJQA 3ECBB 3EDJA 2MKLC 4GSDL 4OJCA 4FXGC 5B38B 4GMTL 5HP5A 4J8RA 4JLRB 4U1HA 4X6DB 2HX8A 1CIUA 1W0YT 3QWRD 4GRLB 5H35A 1INEH 1CIDA 5HPMA 2X87A 5MP6H 3QQ9C 4Z5RA 3PHOB 1WBXA 3VQ2C 5I6KA 4OUUA 4K15A 1L9QA 2A83A 4KMTL 5KBPA 3LAFA 3I6KB 4PIRF 3HR5B 1FGNL 3K4ZA 3WXVH 4OZHF 1ZJBA 1L9TA 2IANE 5DRZB 4FEMA 1R34A 2R15A 4ZAKD 3RWGA 4LDEB 2QKSA 1Q9KA 3FU5A 4P2QB 1WHPA 4DCQA 5CR1A 2MIZA 2MRYA 5A1AA 5GS2D 2C3VA 3CZEA 2CBQA 3KM2A 4OTXH 3U0TB 4V2CB 5IOPA 1DLHB 4FXKA 1FVEB 3N6YA 4QRTB 4RAUA 3LSOB 3V0GA 5MEQB 1NSNL 5IMKA 3HB3B 1PSKH 1OGTA 4OI9A 3SBRA 2CU9A 3D4YA 5AYQA 2Q3XA 4PV9A 4S0SD 2DDQL 3UC2A 1T1ZB 1FL5A 3E6FB 4FFZL 3CVCA 4G1MA 1HAUA 1IBFA 1WZLA 2MPAL 2XWZA 5IR1A 1ACYH 1EAPB 4JO2L 3NJLA 4NXKA 1ESOA 4D9RD 2PNDA 3HG2A 3VH8B 1U6AH 2FT8A 1I53A 2EE6A 3FYEB 4X7TA 3LNGA 1KB5B 1IAOB 4P59L 4RZCB 1L0XA 2HLFC 3O4OB 4XCFH 4PRAB 1U8CB 2LLLA 2P80A 2CD0A 4HT1H 4ACPA 4NERA 4TL5A 3U9PH 1AMXA 1XCQB 2FATL 2F68X 5BRQA 3K3QA 4DN4L 5KYNA 2HN7A 2X4PA 1ZPUA 1L5GA 35C8L 5TE4H 4F7CB 3GC3A 1D5IL 3STZB 4R3SB 4J3OG 5B1JC 1P84J 3DVNA 4GBXD 1R24A 3G5YA 4LK4A 3CVHH 3UYOD 3MJ8B 3U30C 5B22A 2HXAA 3P3SA 4D9RE 1QG3A 1FG2B 3TBYA 4FLHA 3E6HA 5E5UB 2FUTA 2VAAB 3ARRA 3AWGA 5HI3D 4XPTH 1OP5K 5I0YA 4G9FA 4N2BA 4LL4A 4PJ7E 3RDTB 2E76C 3JTBA 1KCSH 3L95B 1KCUL 5E1IA 2CG9X 4PWHA 1MWAA 3OMNB 3HC3L 4XVUC 3RQ3A 3CSYB 3GHBH 3UABA 5LAXA 5E6IB 4HKBB 4CKQA 5C0EB 3OC8A 1BF2A 3GSXB 4OIIH 3F7LA 4PY7A 3BZ5A 1VPOL 1NC4B 4ZS7L 4X6FA 4QTFA 3IFOB 3EH3B 3SKNA 4IDJH 3EO1A 1CG9B 3HPJA 3IFLH 4WU7B 1EANA 5I6OA 2OJ1A 1NL0L 1RU9L 1G4MA 2WXOA 1KXHA 4K3JH 2ZTBA 4KQ4H 2WSDA 1FDLH 4AUYA 4JG0H 2WLIA 4MD0A 4XE0A 2BC4B 3DIVA 3NEXA 2NY1B 3KHOA 3VCLB 4PJ5A 5LXGH 3V0AC 5I15H 4PCTA 4TVPL 4BFRA 2VUKA 3L1OL 2CJ3A 4LSUH 1I8AA 1X5IA 3UC0H 3NCWA 3LH9A 2CKBA 4G71B 4JW3A 2BVQB 1GW6A 3MPCA 1Q0EA 5FUOH 1A1OB 3CBKB 4Y2DB 3NAAL 5CO1A 3SDXF 1R3LB 3BPOB 3H42H 4D3CL 1JTTA 2ATPB 4XP1L 4UWQB 1BVOA 4QHKJ 5HHXH 1XGPB 4NQDB 1GGYA 4PS4L 2DQEL 2G4EA 1MW0A 3C8KB 4IOFC 5IREA 1IGIL 5D7IE 2NXZD 1PZCA 4DQOL 2K70A 4HPYH 3P0VL 4P8QA 4WFHD 4D9LL 5EA0L 2YPLD 3W2DH 5CR8A 3TO4C 1AKJD 4GJTB 2OK0H 4HIXL 5CLXA 4GG6E 2YSSB 3EJSA 2OZ4H 4JN1L 5IEHA 3KPMB 4NCC2 5J11B 1AHKA 2JKIS 3AY2A 2G3ZA 3AS1A 3AW5A 2UV3A 2Z7WA 4BQ6A 3P11H 1IE4A 4TLTA 2OTWB 4EKXA 1QABA 2P5WA 4U05A 3V7AE 2BFVH 3AITA 3IFPA 5DHMC 4HOWA 4NPKA 2XWRA 3MRQB 3BLPX 1MAMH 3ZZ1A 4U6HB 3B7RL 3N9GL 1KLUA 2VZ1A 4MQSB 4H0GA 4XPGH 3ZE1B 4HJ0D 2GBAA 1NEPA 3VXPB 5E7FA 3A4AA 2AW2A 5B38G 5BUGA 1MG2C 3LJ3A 5IROA 4FF9A 3ZMRA 5L7XH 3RY4A 1F90L 4WFHE 3HNVH 5D5MF 1X4YA 2QDVA 5C7ZA 2YPLE 3ZBMA 4OB5L 4OKVA 4XVSL 3MFFA 4LHUA 5I8KH 4JM2B 1XD0A 1UJ3B 2D8KA 4NZDA 5DHYB 1T6VN 1U8NB 5EEZA 5CCKL 1P84K 2Y07H 3H3KA 4MKTA 5CEYB 2WYTA 5DMIL 1OGAB 4I5BA 3QEUA 3I2CH 2GG1A 2ZWLT 5J56B 4MYPA 1JPTL 3B3IB 2JKTM 4M7LL 1JZ4A 4FC3E 5LGJA 5EU6B 2C9UA 2LQRA 3DKHA 4D8PA 3N3EA 2GW5A 2BIQA 4YQXL 1NGXB 3CZNA 4JFVA 3NUKA 3CHSA 1ED3A 4P9HH 4ETYA 1FYTA 4M48H 5FECB 4UILL 4AEIH 1BCIA 4WWKA 4GRWE 4KZ0A 3W1ZA 2C9XA 2OXHB 2CIKB 4XCNB 2Y23A 1WC7A 4JUSA 3L4UA 5FGCE 1YDPB 4FTVD 3ZTNH 3ZY7A 3K4AA 3WLBA 3TFKC 1KEMH 2PN5A 4K9EL 3RP1A 4XHJC 4P2YA 5D2LF 3QIWD 4U1GC 2B4CL 3GUFA 4YHNA 4NN7C 4HC1L 3VH8G 4NKDA 4DT2A 3JQOB 3OR6A 3UP6A 1WZ1H 3NIDB 3HZYA 4JFDB 4BDVA 2FYYB 3SDXA 5E03A 1VKXA 4J5VA 2VDMH 4KKLC 5IHUH 1F00I 2AQTA 4HCIA 4DZBA 3TBWB 3IWVA 3TH3T 2EXYD 3E0GA 2DL2A 3IETA 2ZUTA 4LMQI 1B0RB 4NAQA 1L4IA 1MF2L 3N04A 3T71A 4A63A 1LO5A 5IT2L 4Z7UE 3H3PH 5ESVB 3WIHA 1OV8A 1YMMD 4FTVE 3FONB 2UUDH 2NQDA 5CLYA 2BVEA 1E9PA 4LLWA 5AW5B 4LMQE 4CN1A 4ECNA 5IM7A 3NPSC 3THML 4PTTA 1DBKL 1UZ8B 3IKCA 3D87B 1UD3A 3NCEB 2WXNA 1XMWA 4XN7A 1XGUB 3UGEA 1Q0XH 3ZXAC 1AZBA 2GJ6D 3PWNA 4IEFB 1EPFA 2JVUA 4UF7C 5DD1L 1ZCRA 1J8HE 2XA8L 3TVMA 1AO7D 2ZWZA 1XF5B 2ZIDA 2NY4B 4JKKA 3FCBA 3VFTA 1WRFA 5ABDE 4QRRB 3WELA 3L2LA 1NMAL 4P2RA 4GKNB 4WGWB 1FLTX 1QSEB 3ECWA 1JPEA 3F8UB 5DQDL 2FWLB 3KHQA 2Y5TA 2DWSA 1BMGA 1BEYH 1JD7A 3KYNA 1Z0MA 4TRPH 4ZSOA 3V0EA 2VDKB 4Z7OE 4DTGH 1YMME 4CILA 3AG4B 5D5MA 4M02A 4X8GA 1K9TA 1OAQH 1UZ6E 1EAJA 1OE3A 2Z65C 3IYLW 5CILL 4XVOA 1CICD 2KC0A 3DSFL 4QXTA 1QWUA 4MXVE 5GGVL 4TQEH 3GSNB 3T3PE 3H1ZA 3L6FA 3IDYC 2V2TA 2GJ6E 4HCRL 7TAAA 2PXYC 4JFHE 1GC1C 1ZSDB 5ES4B 4ZUVB 1AO7E 1R1CA 4EZKA 2PPAA 1ITCA 3KPRE 1PLGL 4QCIB 5GGQH 3T77B 2ZUVA 1UD8A 2IBBA 3OC5A 5GJTH 2KUTA 3MLYH 1J5DA 2YKLH 4DESA 3QXWA 2WAHA 3W56A 3X1NA 3KPSA 4XVTL 5JDSA 3VRIB 3R4DA 3ZDZF 3IS1X 2BK8A 3W9EB 4FJZA 1ZLVH 1E7VA 2M2DA 4HA1A 2WLLB 1NGQL 3MN8A 4AJYV 4I9XA 1U3HD 3HG4A 2FEDD 4XMPL 1I8MA 4M9PA 3OF6A 1MLBA 5E8PA 4ODHH 3CLFL 2VRKA 1QLRB 3L1GA 4P23B 4P4KC 3ZKXC 3BRDA 4F7MA 2HVJA 1UA7A 4BFGA 5DJXA 2B9BA 4F7PB 3EDFA 3SN6N 4ZYKB 4CU8A 3PL6C 2QVIA 4MVBC 4F20A 3KH3A 2IH9A 1MXGA 2ADGA 4MAZA 4RETB 4XRCB 3NGBB 1X3DA 4C55A 4PMEA 5DZOA 3UMTA 4H8PA 5C0CB 4MDIA 5CGMA 1WFIA 3GJEA 2AQSA 3GM0A 2DN7A 1LP9B 1HU8A 4RGOL 1EEQA 4FI6A 3VSQA 2Y1ZA 2RTTA 3DV4A 3MOAH 5AOIA 4D7BA 2AHIA 2FE0A 4YR6A 3G6AA 4X98A 2JJSA 1KZYA 4L8BB 3RUGE 3ALWA 4I48B 2SEBB 5F9WB 3VXUA 1S9WB 4JHWL 3BI9X 5FYJD 2QQLH 3FUMA 1TO5A 4H88L 4ZJ9A 3P73A 1A1MA 5C3LD 3K0WA 3QUZC 1XL4A 1DVFB 4AL8C 1VRSA 3LN4A 3QAZB 4Q58C 4HWZA 5GGSB 3Q43A 3WIIL 5JXEC 4XAWL 1U95A 1N64H 5DRWB 5J4MA 1FA4A 4ONFL 2WWMC 4S2SB 1NMBL 1RERA 2WQXA 4KRMB 2QJDA 1Z9NA 4MCZB 5GGRB 4PLOB 4JUTA 4J2XA 5F0JB 1D5BA 2DQFB 5AYUL 1YEEL 2OYKA 4NO0A 3X2QB 1CFVH 3V4LA 3AG3B 4GIPD 4YNYA 2F5BL 3C2AL 3EJCA 3P2BA 4NGHL 3V8OA 4Q8BA 3V9CA 4Y19B 3AM8A 5DWUL 4A2HA 2OM5A 3H7BA 4P5MA 5GS1A 4BUGA 1A02N 3CH8A 5F7LB 3FRUA 1G7QA 3VXSD 1R6VA 3QEQA 3F12A 5IUCA 4FHBD 15C8H 1P53A 1A3RL 1XAUA 4P2OC 2AABL 3OMZA 1FCCA 1NBZB 2GSIB 3FF7A 3VD9A 1I9IH 3GMMA 2R56L 1ETZB 1PPIA 1CXKA 2FJHA 5HJDA 3C8DA 1ZTMA 4KUZH 1SQ2N 5G2NA 1UUSA