5K5YA

Crystal structure of truncated flgd (monoclinic form) from the human pathogen helicobacter pylori (strain 26695)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
146
structure length
146
Chain Sequence
NSVSMIGKIAETDVSGANFDGNNKLSFSLFFDEKIDASKGVPAIQILNENNELVKTIPLKDYNGQKGYINFEWDGTNEKGEKVPKGNYKIKAEYNLDSHSKQYLQTRIGRGEVESVIFDKGKPMLRMGEMVLPIDSAIEFYQPDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Stability of FlgD from the Pathogenic 26695 Strain of Helicobacter pylori
doi rcsb
source organism Helicobacter pylori (strain atcc 700392 / 26695)
molecule tags Motor protein
molecule keywords Basal-body rod modification protein FlgD
total genus 33
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5k5yA02
3C12A 4ZZKA 4ZZFA 3OSVA 5K5YA
chains in the Genus database with same CATH superfamily
4A2DA 2JKNA 5CD5C 1A5FL 3LQZB 4BIKA 1NEZB 3IF1B 5LKNA 1MFBL 4EI5B 3SOTA 1BGXH 2FT6A 4HUWA 4GYBA 4WSKA 2P4AB 3BP4B 2EUXA 3HG0A 1CXIA 5E6YA 4H8PA 1I1YB 2X0WA 4OZHE 4Y2NA 1U6AH 3BW9A 2C9QA 4QMEA 2W0FB 5EO0A 1NGZB 3BP5B 4HF5L 1RIUL 3O6KH 4PGCA 3CMGA 5DO8A 1P1ZA 4AC2A 4URKA 3L7FB 1E6OH 1CU4H 3HG1D 3C6LB 1OCOB 4Q6KA 1GGYA 3QHTC 1P9MA 2YA1A 1FNSH 1UH2A 1WFUA 4X4XA 3R0MA 1LP9B 5CILH 4ZS6C 4WUKL 1A9VA 3V5KB 3OF6D 2Y36H 3QEQE 3GS4A 1MJ8L 3X14B 4WW2A 1HEZA 4KI5D 3QT2A 1OEZW 1IC5H 1NEPA 2EUWA 2IPUK 1KCWA 4JMNA 4EBQH 4QNPF 1OSPL 1KTLA 4OZGB 1N68A 3QYNA 3T2LA 4UV4H 4KH2A 2AJXH 1Q9OB 1ZRUA 2R0WH 3DVNB 3MI6A 1GJWA 2WUBH 4J3OF 2EXYD 3NA9H 1ZVSB 1JZ3A 3GXUB 2LAAA 4H2AA 2WW8A 3D25A 1U2CA 1CN4A 4ORGA 2E9JA 3A3YB 4P2QE 4G5ZH 2QADB 1WBYA 2GUYA 3RVVC 3U9WA 1XF4B 3HAEB 4MSWB 4NNPL 3W9EB 4DGIL 2K7QA 3ZX1A 4F8TA 4P5KB 5SWQB 4GG6B 4GLRI 1MCKA 3JWNC 1BECA 1N7MH 2VW6A 3ARWA 1I1AC 4PLJD 5CCHE 2OJZL 1CQKA 3FRPA 1F90H 5L4FA 2VB5A 1EZSA 4IOFC 1T66C 1JJUA 3MRRB 3BO8A 2DB8A 3MJ6A 3SEPA 4MB3A 5T1MB 2K3HA 4LPVA 5FDYA 4ZD3H 1CS6A 1A3ZA 3EYOA 2X10A 3OKOA 5GHWL 5AW4B 2LE9A 2CUAA 1OP5K 3MU3A 2D9CA 1T6BX 3K71B 5EIVA 1MY7A 3AMKA 3DARA 5T3ZD 1NCBL 2WBWB 1NKRA 2BVUA 4M43H 1WHPA 2FHBA 3X13B 1W91A 3DX6B 4Y4KD 4BFNA 3N3EA 4JRYE 1WTGT 4R7DB 4ENEC 4G1MB 4JO1H 4J3XA 3DJRA 4M5SA 1VADB 2FZ3B 4OQTA 5DLML 3QQDA 2EE9A 2PWHA 3VXSD 1A4KA 1OVZA 1EPFA 4FXTA 2VR3A 1JZ2A 2OYKA 1EUTA 3NZ8B 4HAGA 4XPBL 1QFWM 2NY1B 5DHVA 1JHKH 1XQ4A 3CTTA 4BZ1L 4EI6A 4N0YL 1JYVA 1SM3L 2X2JA 5F3FA 3SKOB 5DS2A 4KUZH 2CKNA 2V8LA 2Z7WA 3QUYA 1X5MA 4MQXC 4NQCB 4NUGL 1FFNA 3CVHL 2IAND 2VXQA 4M61A 1ACYL 5C07B 1PZBA 2O6FA 4X8CA 2X9XA 1A7PH 4JRYA 1YHPA 4ZTOH 4OZIB 2ZOKB 1DBKH 4QRTB 2MTPA 4AT6B 1PDKB 1S9VA 5BOPA 3MRGA 5FDWA 4BFOA 2GPZA 2CH8A 3ARPA 2BM3A 4KRPD 2FUTA 4CVZB 3D1MC 2NR6D 5JOEA 3O2VL 4KAQH 3NP4A 4UAOC 1UCBH 3IRPX 3IVKB 4NQCD 3DECA 5CIPA 5D8JH 5CLZA 1JDAA 3UGXA 4RDQF 2YRBA 2NY7L 2G4GA 4HJEA 3AGVA 2CO1A 4M3HA 1NDMA 4F8NA 1U8LA 5CN3A 1UB6A 2PYEE 2PTTA 3HG1B 2B3RA 5EN3A 3RVXD 1LE5A 1AD0B 3MLVH 2EVHA 4NO3A 3WO4B 4FABL 4KZEL 1RLWA 3MRIB 1WWBX 2JK5A 2GQHA 1C5CH 1G7JA 2A2QT 1N2RB 2R2BB 4F15B 1JYXA 2R23A 4TKWA 3O45B 3HG3A 4X6DE 3QRLA 3TXAA 4HFUL 3QR0A 5C92A 2XJLA 4Y9BA 4JS7A 2JKLA 3ULVH 2AI0L 5E2WH 3CVCA 1E8XA 2PWDA 4Y19A 5ALBH 4B3VA 3O11B 5IGXH 3QRBA 4KRMB 2NX5A 1J9RA 1A7OH 3IFOA 4FQLL 3OXRA 3HVNA 2VDPB 3OMIB 4HS6B 4XOAA 4F9PC 2BS8A 2VLJE 3KCPA 3RVXC 1L0XA 4JO2L 1HOCB 1EQWA 1FE8H 4K5OA 3RWEA 5JDJA 1F4XL 1RERA 1FPTH 3L3KB 4NEHB 5FA3A 1L7IH 3WD5L 1XGYL 4M1GL 3HI1B 3MBEC 4JW3A 1G7LA 4ETQB 3D39A 3F05A 4WUUD 4XNZC 3TPUB 3MV8B 3AQDA 1A7BA 3Q48A 2AQTA 1JOIA 5IM7B 3VD4A 4G9FE 3VNZA 5CJ5A 5F3BB 4G3YH 4N5EC 4FYSA 3IDJB 1YEIH 2QPUA 3K4AA 3KD4A 3KPRA 3O3UN 1D5ZA 4NFCA 3SCMB 3UTOA 4E9QA 8FABA 1I9EA 1KIQB 1ZHLB 3GPEA 1JZJA 2YD8A 2CXGA 2DQUH 4LFHG 1LO2H 4HBCL 1OARH 5C0GA 1Q0XH 5GGRB 2UUDK 3FUNA 1BQLL 1NSNL 3CXFA 3P4LA 4R4BA 3RB7A 1G9MC 1DDHA 1VERA 4JPWH 3CVHB 4R84A 2VDNL 3QI9D 4F7EB 4B9YA 2JJVA 2D0FA 4WWID 4XMWA 3LKOB 3NCYS 3RGBA 5IB3B 3CFIC 5C0FB 4LPUA 1AJ7L 3L1FA 4PRHB 4PJ8B 3FSVA 3JTTB 1T3FB 5AD0A 2A6IB 4NUMA 2VIRB 3UYPB 5AG9A 1HJCA 3VXUA 2ADJA 1FFRA 2AEWA 3RY4A 2PXYC 3NIFE 4ODWB 2IBZY 1UD4A 1UOVA 1WP6A 2VLRE 1JYNA 1E4KC 1QACA 1YC7A 4RVBA 5D93C 1CD8A 4N2AA 2OYLA 4I1PA 1I8LA 1RJLA 1SHSA 1RK1A 3DBSA 3VFUA 2PABA 1AFVL 1F02I 2APVA 4M8VA 3CFBB 1ZE3H 4OF6A 3BPOC 4NKIH 2UY7A 5E00B 2CKBH 3FFDA 1JYWA 1BCIA 1H8OA 4QGTA 4UM9D 3O9WC 4EIZC 2NY0C 3RVWD 4CADA 3FTSA 4M1CD 2LVCA 1H9VA 2F54E 4N3UA 4ZW5A 1MQKL 1NCWL 1T0PB 4HWUA 5J11C 3WELA 4P06A 4RX4A 1SMOA 1F6AB 4XMPH 1JWUA 4Y8DC 3REVB 3ZRFC 4PYGA 5DCCA 2K6YA 4YBQD 5I6OA 2H1LM 1NDMB 1K3ZA 3BCDA 5C71A 5LAXB 3ZW3A 1BDYA 1WZLA 2JXMB 4I9XA 4KC3B 2F15A 2HAZA 2AV1A 2IOOA 3CXHJ 4APXA 2BIPA 5KSUA 5D4QA 5HP5A 4LGRB 1EAJA 3QCUH 2P8LB 4N2KA 2DIBA 4QRSB 4JO3H 4ZUTA 2NNXA 2WUCH 3MJ9H 1P1VA 1BQRA 5A6MA 4YLQT 1IGFL 2ZOLB 1CICA 4HPOH 3IPBA 3AUVA 3GUTB 3VRIA 4L05A 3NIDF 1FZKB 1K4DA 3SY0A 3ZDZF 1YUKB 1JPST 1A1OB 2FQEA 4IU3B 5EOQL 3VA2C 1IAIM 1RI8A 1SHXA 3VG0L 4Y19B 3V95A 3BT2L 3QNZA 2OSWA 1YMMB 4WY7L 3QULA 3CH8A 2GITA 4K23H 2PTUA 4KKRA 2ID5A 1SJEA 2E7MA 2YPKA 5CP3A 2R56L 4LSTL 3EF7A 4KDVA 3TCLA 3DI3B 1Q0YH 3LH9A 1THAA 1UADC 1GAFH 4DGUA 2IG2H 3KM1A 2BSTB 4ZW6A 4RETB 3NZ8A 1P4BH 4ODBD 3TS8A 5GGUA 2ZE0A 4NKQB 4PVBA 5EO1B 2WO4A 1NOAA 5HHVL 2XG4A 3H0TA 4N0CC 3BUQA 4UWQB 3R18A 4HKXB 1PY0A 2VDLH 2A9NL 3HNSH 1D7DA 4G7VH 2YAEA 3NCCB 2GC4C 4LHUD 4O9HH 4HC1L 4ZSOB 3IS0X 5D1QA 5F9OH 3HKFA 1HXMB 3P0YL 5E2TH 1MZYA 1AQ8A 35C8H 1IC1A 5CEZE 3PJSA 3NFSH 1X5YA 1JXGA 3OR6B 4PMEA 1PDKA 1S9VB 4RNRA 5IQNA 4LKXA 1S7VB 1LDPL 5A2BA 5I8CA 1SY6A 4HX1B 4YO0B 3V52L 3Q8AA 1MFBH 1KYFA 2A6JA 1C12A 2QPSA 2CUIA 1CFVH 43C9B 4D8PA 1CXLA 4DP8X 4C54A 3SDXE 4AQZA 2DM4A 1T1XB 5C0IA 4XN7A 1E5AA 5JW3L 2GK0A 1JUFA 4JKPH 5GS1A 1QLEH 5B38G 4I0PB 4OBRA 1VCBC 5T33H 3HN3A 1U8KB 2XY2A 2ZWYA 4L37B 4QF1A 1JFQL 1A7OL 4GIAA 1BVLB 2N1KA 2ZF8A 3LIZH 2GTWB 3EDJA 2KERA 3G5YA 4PRPA 1NL0L 4OD1L 1F4XH 1YY8B 3V0FA 2FX8H 5FR3A 3V7MA 5FUCE 1KGWA 5H37G 4JE0A 1PG7X 5KVEL 4DO5A 3U1QA 2VL4A 3FSOA 3MJ9A 3QJUB 2Z91B 3Q8BA 9CGTA 2KLSA 2E56A 3GSUB 4N6RA 2HH0H 3G6AB 4HEME 5T3ZH 4PY8I 2R4SL 1WAAE 4U1LB 3F2LA 1CYGA 3RUGA 3C6SB 4YHKL 3FQYA 4XNUH 1JN6B 1A6AB 1QKZL 1ZS8B 2LU5A 2OP4L 3X3FH 4OR1A 2GBTA 3FOMB 3CLFH 4P0DA 4IRJA 3T3MF 2XA3A 3GSXB 4YFLF 4ZO8A 1CDHA 3CIAA 2XPZA 3F04A 3P11L 3SGDI 1RV6X 2GUOB 3IDNA 4XX5A 5HDBB 3VX0A 4ZX4A 4HSCX 3ARUA 1FVEA 3EGSB 2FT7A 1MH5A 4S11A 2VN4A 3QG6B 5AVSB 4UCFA 4RCAA 2OKMA 2FJFA 3S6CA 5EEZA 3EJQA 4Z7VF 5I1JH 1RUKL 3OKKA 9PCYA 1T89A 5E1AB 2OZ4H 2ROYA 1XCXA 4MLSA 3RTQA 1IGTB 3J8F7 3RE0A 3V55A 3PWVA 2EDFA 2ED7A 4DTGH 4AIZB 2ETWA 3LVEA 5C3TA 4MTMA 2J1ZA 5AOIA 5HJGA 1J05B 4KZDH 3SQBA 3WY1A 4PJGA 3GEFA 3RZCC 4UQ9A 1CZ8H 4JR9H 2X6VA 1JZ8A 2DQTL 4CN4A 1MQKH 2EKSB 2CIKA 4RWYH 2ISDA 1XBRA 5TGBB 1TNMA 2EIMB 2WQRA 2UYLB 4XI5C 2GSGB 5HYQA 4L8SC 4D0CA 5TQ0H 3ZTEA 4AMKH 4Y5XC 2EC9T 3CSPA 1BG1A 1A1MB 3IMUA 2IAMB 1ZANH 4OIFA 4M6ML 2X4PB 1N70A 2ZSVB 3LKNA 1R33A 3NSDA 4YSPA 2OQJB 2OMYA 3C5JA 3QUXA 1UYWH 3DV6A 3GMNA 4PGBB 4ZMTA 4ABWA 2QMJA 3MCYA 3FO2B 3MA7B 5GJTH 4DN4L 1DQJA 4X98B 3PXHA 4AQOA 3A6OA 4ERSL 5TDNB 2VUYA 3MRLB 4PJIB 2W60B 2ZXWB 3HHSA 1WCBA 2FR4B 1IB5A 3VMNA 3OWEA 3L3IA 3PWNB 4PJ5A 4O02H 3OKLA 4A7SA 2XTJE 4LCWA 2WBJB 1QFUH 4NN7C 2IQ9L 5JZ7C 5KANI 2GEEA 3BP7A 1ZV9A 1RURL 4L3EB 1G1YA 4JRYD 5DD5H 2P52A 1HE8A 4QRPD 2VUKA 3VXQB 4PUBH 4K23L 4HUUB 1W6LA 4KU1A 4MBRA 2BP3A 4MJ6B 5IJBC 3AS3A 3MLRL 3WLBA 3T3ME 3NQKA 2B9AA 3KLHC 2NY0D 2CWRA 2NQCA 1N6QL 2CUMA 1CI3M 2CO7B 1CB4A 2OMWB 2CJUH 2GYSA 4FCHA 3RTLA 1XDTT 1OTUC 3H85A 1DBAH 4JN2A 1Z3GH 4ATWA 4Z7OE 3WTTA 2G5UA 3LEYH 2VO5A 2WKGA 2MPAL 3UC0H 4JHAH 3UJJL 5J06A 4W6WB 5IB2B 3QJSB 1OAXH 5FYJL 3TBWA 4S2SB 2IXQA 3CSTA 4BE6A 1WPCA 2V3FA 3CFEB 2VL5A 2YBGA 1OAKH 4LSDA 4U6HA 4LRNL 5EU6A 5AW8B 4GBXC 2CDGB 3NJNA 1A65A 3H9SB 2DY2A 4P4KC 4WWKA 4UV7H 1FCGA 3TZVD 3WTUA 3SPVA 5G4OA 5SX5H 4MB4A 3NSFA 4F80A 4O2EB 3B43A 3LKQB 4M48H 4F1SA 3FT2A 3F3HA 4P5TC 2Z4TA 1OP9A 3PL6A 3RYMA 4PJ9B 4FEIA 3OKKB 3O41A 4NZTL 4G6KH 4TULH 2VDQH 2GTZB 3LS4H 3D7PA 4HIEB 3HC4H 4B0MM 3I6KA 4X5PA 3QZPA 4J8QA 1HE7A 1E2WA 3FOLB 1RZPA 1E43A 3BN9D 4YEEA 4FG0A 2FIKA 3F5WB 5DD1H 2Z93B 5K9QI 3NZHH 5DMGC 2VR8A 1SYVB 3CZJA 1S5HA 1NANI 1VGEH 3CFJA 3MJ7A 1MEXH 1SXCA 2X6AA 3CSFA 3S37H 4F58L 4Z3FA 1KXTA 5BMFL 1XGPA 3GGWA 4ZUWB 3VFVA 1R1CA 3II3A 3FO9A 5KYWB 1LK2A 1IBGH 4ZS6D 4ZMYA 2O5ZH 4RMBA 4XCYB 4MA8L 1AHMA 4JFUA 3L5XL 4DZ8A 3VXMB 3ARTA 3HJEA 2DJUA 1TQBB 3ZOAA 3QAZB 1NDTA 2V3DA 4DGYL 2WLJA 4RBPK 2VIRA 5DJ6A 5HI4C 5ESAB 5KBMA 5JORA 4W6XB 4IIQB 2PW1A 4KXBA 5KOMC 4JQIA 1XR8B 2HFGH 4HK3J 2O6DA 4LLDA 5T3XL 1HYSC 1PTZA 1XAKA 4KX9A 2WXHA 2C1PA 1T4KB 2IFFH 4RMWA 3DHPA 5F1SA 4PRID 4OFPA 5LNEA 3SBPA 3VXRA 2EDKA 3FB7A 2DWEB 1R6VA 5JHMA 4FOMA 1CDUA 1MOEA 1O9VA 2DQEL 2ZCHL 4L3CA 3S96B 2RB8A 1JIBA 1OIOA 4P46B 2W8CA 4U6VL 4UIMB 5FW6A 5KYYA 2JTDA 1IARB 3RVVD 1UFUA 3JYBA 3QH3A 5SV3A 3EYVB 1LE9B 2VISB 4ZFOL 3LKPB 4UOW0 5KVGL 4MMZC 3TJEL 4D94A 3HW7A 3MO1A 3ZT7A 3OLDA 4FGMA 4MS8C 2MCAA 5LQBH 2IIJA 5MENE 4G8GD 2CMRL 4YWGL 3VXPB 2EE2A 3M6DA 2QJDA 1KJ3L 3NAAH 1MWAH 4H4NA 1JZIA 2EIZB 1P5UC 1MFVA 5EUOE 2XPGA 3CFNA 4EAEA 5DEJA 3QGVA 2X12A 1FNAA 3QISA 1BJ1J 2JELL 3MRCB 4NWUL 1HQ4A 2HMIC 1I53A 1CXFA 1NJ9B 2Y6TE 3K2IA 3L7EB 3O4OB 2ZJSL 5KAQF 2FWUA 4NQDA 4EEEA 4HVBA 2PETA 1AKJB 3Q9QA 3D08A 5D1ZA 3QZOA 1VLXA 3OZKA 5FCUL 1BD2B 3MJWA 4X80L 3ULUC 5ADOH 4YZFE 4TV3A 2I07B 3V5DB 1RIUH 2R0ZH 2X1XR 5HYJB 5L7XL 3RPKA 4LE8A 4ELMA 1EERB 2Y7QA 3CFDB 3RU8L 4LSTH 4UU9B 2NXYC 1JNHB 2AJYL 4LLMB 3MNMA 4MMXC 2HLFD 4JO5A 4WTWA 4PRAA 3WXWL 1GGCL 3MACH 2A4ZA 4NFDA 3VGBA 3VI4E 5CEZD 3TEZA 1PW3A 2EABA 4KXAA 5BZWA 3LRSA 1QUNA 1KGIA 1AD9A 4C55A 4RFNC 4QYOA 4FQQB 4BV1A 3FT3A 2WPGA 4OKDA 4CJ1A 2RHEA 1NC2B 1QQDB 4P4RA 4LNRB 1KXQE 1TENA 2J1WA 3OLGA 5DO2C 3E6FA 5B8CB 3WO3B 4NQDE 2EXWC 1FVDB 4U05A 4GQ9H 3CHSA 2BVEA 1EVUA 4PJDF 3T3MB 4AK2A 4OIAA 3WY3A 1H9DA 4QOKA 1UZ6F 4Q9BA 4G43A 3HBZA 1MJ7H 5CJXC 4DZ8B 3OB8A 2P5ED 4IRJC 1LNUB 3MODL 4B9ZA 3DX0A 1NA8A 2HB0A 5HHME 1ZGLA 3KM2A 1KY7A 1MCWM 2BNRE 3U1PA 5I74B 1T1YB 3Q2CA 1J10A 2HT2D 4FC3E 5A2AA 2GIYA 2YXWA 3BH8B 1U3HD 3P2TA 4GEIA 2QKIC 1BQ5A 4XHJC 2V2WA 1EFXD 5C0RL 3VFTB 1LD9A 1MXGA 1PY4A 2AXGB 4D9QD 2VDOL 3LPPA 1AVAA 3MRJB 1ZOXA 1MFDL 2HFEB 1EGJA 4H88H 1U8PA 2KPWA 4JREC 4N24A 3VG9B 3VGGA 1CLOL 1E27B 1AZBA 3T0EE 3NA4A 3K6DA 5IFJB 1T7VA 2XWEA 1A1OA 4RIRB 3MNVA 1I8UA 3KPSB 1PLBA 2APWA 4JDTH 4MMYB 5CBAB 1WS8A 2XA8H 4HUMB 4KZ0A 1QYGH 5EG6C 3IGAB 1ZCRA 2JJTC 1TQSA 4KJYA 3GNMH 3MGTB 4PP2A 3HNTL 3GMMB 4UT7H 3S3DB 1NZRA 3WNLA 4F58H 5GGRY 4Q9QL 4W68A 3O41B 1HC1A 3ULSB 1IGJA 2UXVA 5AZEL 3VQMA 5GS2H 3W1ZA 4FXKB 1PGRB 3F7VB 5DUPH 2XWXA 1D7BA 1ZVNA 1CFNA 4M56A 4OJYA 5E1HB 4NFBA 5E08L 3ETTA 5DC0A 3KPLB 1VENA 3B6SA 4JDVB 1D5MB 3N40F 1PYWA 5F8QC 5JYMA 2DH3A 5DD0H 5IOPA 5D6CA 4UT6H 1AZNA 5SWZA 2JCWA 5IVXA 4MHHI 2R2EA 4WTXA 1YNLH 3GRWL 2OM5A 4UDUB 3QUHA 2XIBA 1NAML 3ARFC 1FUNA 4BZ2H 3HRZA 1FBIL 4JZOA 4DUXA 2GHWB 1R3KA 2NNFA 1BD2A 1D5XA 5MEOA 1AP2B 1HH6A 1KIPB 5LXGL 3I6GA 5EF3A 4H25B 3PF2A 2Y7OA 2WXJA 1W72H 3ECBA 5KTEL 3CXHK 2P9RA 5CJQH 4QXTB 4E5XA 1TVBB 1XGZA 5D8JL 4J3OC 5FGBA 4KROD 3FFCB 3RBSA 1KIRA 2DLTA 4L4VE 1ZTMA 3VQLA 1T2QL 1R3IL 5C0AE 3MUZ1 4AJWA 2V7HB 5CCJA 2YD5A 4YSUA 2QFRA 2CO2A 5IVNA 1TYRA 1O9WA 1XCTB 1UCBL 1IEHA 3ZIYA 3BUDA 6FABL 2BDNL 3HBGA 2P5WD 1U3HA 5D1QE 3BMWA 5EOCH 5F70A 5J57B 3VH8A 3SKMA 1SJHB 1KYAA 3FTGA 4I77H 4PWIA 1MCPL 4KJWD 3QG7H 4FABH 4M5TA 3EHBC 1QLFA 2QBWA 2GSIA 3F7LA 3CCHA 2BMKA 4R96A 4P4KA 1ZS2A 4ICWA 2XWJA 4WWKC 4XOBA 5EU7C 3L3OA 4ZMNA 1ZHLA 4Y4FB 1FE8L 3VAEA 4NPJA 4AL8C 3DJ9A 4XO4A 1YYML 5IFHH 3FTUA 2XV6B 5C0CD 4PJXA 3NJIA 4YE0A 1UD6A 4F7PB 1FYTB 4Q6YA 2OI9C 1NCCH 3AWFA 3O0LA 4XPHL 2Q8AL 5L88L 1KB3A 4JM4L 1IKFL 1AH1A 2J43A 1JZ7A 2NT1A 4F33B 3RIKA 5CUSH 1ZSDA 4Y5XB 4X6DF 1YEFL 3EO0A 4LLYB 3MLRH 5TDOB 5L6YL 5I1DB 12E8H 4OCSH 4X5WB 4R26L 4HCGA 3MRBB 3E9UA 4ZW8A 1BM7A 2VN3A 3TFBA 3VWJB 1CDCA 5JIDA 1SXZA 1J18A 3RWCA 2XYBA 4OLUL 4Q9CA 5KG9B 4K9EC 5D2LE 5A16B 2FJSA 3DVGB 2AVFA 1DE4A 3C8HA 2A0LC 4AW7A 1R47A 1VA9A 2CIIA 4YXLL 4FA7B 1PLGL 3GRGA 3WTVA 1MHEA 3FFCD 4AMXA 2YQGA 5HHOA 2Z1KA 4R4FH 5FYKH 4IGBB 4LFHD 2PKDA 4JO8A 4NNYB 3LXBA 3FCTA 2OA9A 2D0HA 2XG5A 4XT1C 3RWHB 4KHXH 3BEVB 3WFDL 5E8DH 3IGKA 4B5ZA 4YUEL 5FO9A 4IK6A 1F2XK 1ZEAH 4RGOH 4ELKB 5DK2A 4L23A 4K07A 1HHJB 4NZTH 1QTPA 1BQHA 2PO6C 1H15A 2WXKA 3KLLA 3FH5A 1G6RA 1NCAL 2A83A 4L4JA 2NUTB 2H32A 3ZE1E 2V2TA 4NRZB 5HGBB 4G8AC 2ZUWA 1XF4A 1NGYB 4IDJL 3BFWA 2BNRB 3ROLB 4PCSA 2IV8A 2M26A 3SDAB 2YD1A 4X6BA 4X99A 4ZFGL 1DQDL 1V3KA 4JCLA 1TTGA 1SDDB 3T2PA 1G4RA 4Z7OB 4JO3L 1IVTA 4XMKL 3HMXA 4HUVB 4RISH 3WFBL 1F6FB 3BMVA 1E4XI 4GRMB 4DQOH 1MCRA 1CWVA 3QXDB 4GQZA 1T4WA 4Q0XL 4BELD 3CK0H 5CEYB 3SDXB 2GY7B 2DIJA 3QDJE 5DUBA 1PMYA 4R4ND 1FL6B 1QRND 1XB8A 2WKLA 4NP9A 1HCFX 4KQ0A 4FHBD 3DTUB 1NGXA 5AL0A 4I2XE 1CGYA 4MQSB 4Y4FA 5D7JD 3P54A 4MDJA 3UTTB 1XR9B 3FSWA 1AOHA 4PRNB 1WICA 1N8ZB 1I1FA 1OP4A 1YNLL 4ODUA 5CSGA 5I71B 3ESOA 1B90A 2X4QA 1VDGA 5CZRA 5AENA 2BOBA 3ZVVA 2IBGA 5EUOA 4OLVH 4HJJL 1HN1A 1UGNA 3KPPA 4E41B 2J3SA 3KBPA 1JCVA 4QT5B 5ID1B 3AQYA 4LBEA 1BVZA 3BGMA 4MD0A 3ARFD 2BY1A 2YMOA 3LKRB 5F7BA 4BQBA 5CGYD 3UL4A 1T2QH 4EKJA 4OGYL 3VNYA 3EDKA 3DROA 1ETB1 1NUFA 1H5BC 4KXZH 2XN2A 3HRZB 2VDLL 2A9NH 3HNSL 4G7VL 4I9WE 4NWTL 4ZUUA 1HWGB 4ZODA 5IQ9A 4UQAA 3VXTA 5F9OL 1YG9A 3ZHFA 2V37A 4J6RL 3WHXA 4QHMA 2D7TH 4PBWD 3VWJC 4D3CL 5KSAB 1HCYA 4FMKA 4ZRGA 1MUJA 2J6EA 3VYPA 4Z78B 1GYUA 4UTCA 1R19A 3G04A 3KL5A 4J4PD 3QZLA 3BX7C 3QORA 1TLMA 3EGXA 1TZIB 1RK0B 2DMBA 4JB9L 3RL2A 1Q38A 4YDVA 3U6XA 3EFOA 5FGRA 3HC0A 1G7HA 3BUBA 3NZSA 5J13B 1QSEA 3RHWK 4PR5B 4WSGA 3T65A 3I75B 4PV9A 3DMMC 3UTSB 1T6VN 2NW2B 3AAZB 4IKLA 2Y5TB 5KANG 2EDXA 1OF2B 3K91A 4PQXA 3DX8B 2QVTA 3N42B 2X41A 3I6LE 3SDDB 2H3NA 2YFNA 5AOZA 4LESA 1UJTA 2RIKA 1YY9D 3FZUD 4GRLC 4NQXA 2OSLB 2H47C 2YSSA 1BQKA 1F58H 2HT4C 4IRJB 1GOFA 1PD1A 1QPXA 3IGAA 2CALA 2BCMA 4M62L 1DJXA 5D5MB 2W59A 4G9FA 4XC1L 1EDYA 2JIXB 5J11B 3JV5A 1CLZL 1UJ3B 3RUGE 3APDA 2G2NA 4XNUL 1ZWIA 1E4JA 3CN0A 3CAFA 2ADIB 4LKCB 1JPTH 3FFDB 4OLUH 1IZJA 5LDUA 4Z95L 2ZUQB 1XTLA 3ESNA 2Q5BA 1KB9J 4U0RC 3BVNA 5D2NB 4YHNA 3DJTA 1A6ZA 1XF5B 3HLAA 3SE9H 4Z3IA 4LCUB 5AW0B 3KPQA 2XQBH 3BSZA 3SDCB 2F7PA 1HI6A 3HBQA 4JG0H 1GGBH 2PPFA 4QUOA 4JDZA 4DN3H 1ZGLB 2YR3A 2JKXA 3BIKB 2Y06L 4LSQL 2PCXA 4OJDH 1FAIH 4OZ4A 2GJ6E 1UXWA 2J71A 5JR1H 1DDHB 3OVUB 1S7RB 5L0QC 1W6WA 4BZ2A 4M6NH 1OB1A 4F7EA 1U91A 1UZGA 4JFVA 2WN3A 3ARFB 4EDWH 1OALA 4RFNB 4X5XA 2APFA 3BAYA 4UANA 1BEXA 1E28B 4TSAL 3BPCA 4UUJB 3U0WH 4JKLA 4WTQA 3EHBD 4L0ZA 5FYLH 4FYTA 1WC7A 3DDGA 2Q0ZX 4MMXB 5D1XE 3DO7A 4GO9A 4RIRA 5DJDB 4FFZH 3DUSB 4ANUA 4OV5B 1KC5L 1Z5LB 3O3DA 1WBXB 1L7TH 2RCSL 5GZNA 1YNKH 3S37X 3OB0K 5I0VA 3EXJA 3TWCH 2COQA 2YAFA 1EHXA 4H44C 4UTAA 4QI3A 1JNHA 4I3GA 4LLMA 5GJTL 1QRNE 4GLRH 4G42B 2F53D 3OPUA 3T9WA 4U1MB 4TOYH 4R0LA 4XMTA 1J8RA 1KGJA 2VMCA 1JERA 1ZKAA 1OCCB 3OTTA 3GKWH 4BH8B 2JI1A 2PP7A 3AXLB 4X9YA 4Y16C 4WVRA 3GSRB 1SVBA 2PPAA 3GDBA 4MRCA 2DL2A 4JFEB 5C0AD 2CO7A 3VXOB 2AJZB 1HCZA 2AFNA 2N59A 5EZLA 4IOIA 1AQKH 3U30B 1FBIH 3NABL 4OFYA 4IK7A 1RZFH 3JUYA 4IMLB 3IPEA 5DHDA 2BWIA 2CLZB 4XI5D 4PV9B 1A6TA 4DFHA 4N8UA 2WJ7A 4XCFH 3P3YA 1J9SA 1D6VL 2YGPA 3LZRA 1JPGA 4P8QA 5D7IF 1CICB 4GT0A 3TPKA 2QTVA 5DJ0A 4XNDA 3GKZA 3AU0A 4GS7C 3ABLB 4JFFA 3NN8B 2FATH 1RULH 3MLZH 4Q6IB 5EDXA 1E5UI 4MZ2A 4XN2A 4HS3B 1UM6L 3FRUB 3GBML 1PIGA 1UXSA 3G5ZA 4B9FA 3SGKC 3AG1B 2W1NA 2BDNH 4DK5A 4Q4EA 5GS1C 4EF3A 3H42L 4LHUA 4QYAA 2IANA 3F01A 5CFHA 2W88A 1C08A 3ARDC 1RMFH 4G7QB 5ESQB 1DLFH 1XWVA 1ZA6A 3EW3B 3EGDA 3QHFH 2Y3NA 3S3CB 3WLWC 5FO2A 1E5YA 1RSFA 1GC1H 1DANT 1OP3K 3SE8H 4XPFH 1JZ4A 5T3XE 3ENEA 4N2MA 4BFIA 4FNQA 3S88H 4PJCB 1TETH 5EO1A 1YEHL 4NM4H 3WS3B 2G9HB 3IN2A 2VDMB 4OIIH 5SX4I 3LRLA 2D7TL 5EZJB 3RWFB 1P5UB 4HWBA 3EO9H 4FYQA 3EH1A 5FUOL 4DP9X 4TULL 3VXSA 5IMMA 3S36X 2FWSA 4BDVB 4Z7VB 3WNIA 1KXTB 4LSPH 1B4TA 1CU4L 4ORZC 4HJUA 3HC4L 5DMIH 1D7CA 5DSCB 2N4IA 2NOYA 3SGEI 1T0MB 3MLWH 3Q2WA 1CFSA 4DK6A 2CM6A 3BN9C 4XO3A 4YXHL 3CX5K 3LPOA 4AUJA 3U0TA 2PO6A 5IT2H 1Z7JA 4YSCA 1MRDH 2BHYA 3DJZA 4F7KA 1BF8A 2AV7B 4J23A 1M9SA 1ZVYA 3RKPA 3P4OB 4YQXL 1OSPH 2ZXDA 3ZKXB 3QORB 3B3BA 4ZO7A 3WEOA 1CD1A 1S7UB 2GK2A 3HR5A 4OI9A 4FZ8H 4PJAE 4XC1H 3KWTA 2CRZA 3LXCA 4L0PB 3QCUL 4LLDB 5JPNC 3BQUD 4UF7C 1AGCA 2R1WB 4Z5RA 1JGLL 5I1AA 4DEPC 3IEAA 2F61A 3OWRA 1CVRA 4ZS7H 1RCYA 5EEVA 3VW3L 4KTYA 1PLGH 3BSHA 3ARDD 2FGZA 1TCRB 2O5ZL 4N90E 1BMWA 3QEUB 2JCCE 5T3XH 2CLRB 3RDTC 3B7SA 3TOPA 3NESA 1YEKH 1P84K 2Y7MA 4EQ2A 1NFIA 5C9JA 5IB5A 4L3FA 4QXUH 1AGDB 3ARXA 2AXFA 4J3VA 2Z91A 5IREA 4L4TE 1D9KC 3IJYB 1AKPA 1A7QL 1BF2A 3MTRA 3TCXA 3GI8H 1TZOA 3AG4B 5FA3B 5DJAB 2IH3A 3WNJA 1N3NB 1O6SB 2ZCHH 1TQWA 4V2BA 4EN3D 5MHSD 4ZQTA 4RZCA 4DP5X 5IROA 4JK0D 2WBXA 3O2DA 3LY6A 3QUMA 3LNDA 5GS2D 4WGVB 2J6WA 3ZKND 1TVHA 2UWEA 4JZJC 1G94A 2HFTA 3QEGH 4OGXL 3SD2A 1F42A 1RP8A 2E47A 1NUGA 1P4LA 4OFVA 4LSRH 15C8L 2B4CC 1WHOA 4IRZH 4I4WB 4NDMB 3THMH 5E4OA 5FO7B 1DQQA 1HHGA 3GSVB 4LEOA 3V0IA 4CMMA 1XCQB 2R15A 2LR4A 2NLJB 4L1LA 5T3XD 2XFXA 1MWAL 2ERJC 3UTZB 1U8CA 3VSTA 3BRDA 4TNFA 1IC7L 1UWFA 5FFOA 1NC4D 5JW5B 3B8SA 1GYWA 3QA3B 4YAQA 4YSAA 2JKJA 5ID0A 3ZYIA 3DX7B 1KB5L 1QNIA 4A39A 4HC1A 1KCBA 1AACA 4X5QA 5ANHA 4JPIA 3TV3L 2QKSA 1N19A 1A8ZA 3FU6A 3L7FA 5ELIA 1RJYB 1PJWA 1RK0A 3PAZA 3VWJA 2GJZA 3LH2L 3US9A 5B38A 4U3HA 2OFQA 3BESR 3QQ3A 2FLMA 3CVHH 1UTDA 5HDWA 3EOTL 1NC2D 3RGVB 1FA4A 3FL7A 4MB1A 4NO5A 3RU8H 2XWZA 1SXAA 2GSGA 1G43A 4WQOA 2NYYD 5H2BB 3OXRB 2E27H 5D1ZD 4XGZB 4TNGA 4MD5A 2JI2A 1GC1C 2V17H 3KMDA 5C86A 2P5EA 4CMHC 5I23A 5HI3D 3WGVB 1BZ7A 1AOZA 4NQTA 5D5ME 1I7UB 3TNNA 3QFGA 4PJBB 2NY6C 3KXFD 1AC6A 4KKCC 2AJYH 4E41A 1VZIA 2ZUVA 2D3NA 4HHAB 5HYSA 3BGMB 4ZK8A 4EPSA 4MBOA 2PPCA 4ONGH 5T3ZL 1K8IB 4IOFD 2DS4A 2XN9A 1XSJA 1QRKA 4QNPE 4U4BA 4XWOC 1Y7VA 4XP9L 4HULB 4ABUA 2CHDA 1NANH 4DETA 1UGKA 4POZD 1EK3A 1C5CL 3CVIH 5JHLA 4P5MA 1X4ZA 3CDCA 4YR6B 1CF8H 5DHVH 1IIKA 1GS6X 1IUZA 1NAKL 4Y1SA 3PU7A 1XEDA 5IBTH 4F37K 4K8RD 3U4KA 1A8JH 4LP5A 2AXGA 4HAKA 1GC1L 3U0PB 1VJSA 2DKUA 1DQKA 2K45A 2K7PA 5EFIA 2ICWA 3STLB 3U25A 5I19H 5JW4N 1I7TA 5DJXA 3R06B 2ZZUT 3D2UB 1A1NA 2VKXA 2OV0A 4NPKA 4PVMA 3A6CH 1KULA 2Z7YA 1H6UA 3DHUA 4JFTA 3D9AL 4FQLH 4IRZA 2Q10A 4HBQA 3GIVA 1A6PA 2C1PB 1MFDH 3EJZD 4FZEH 1RHHA 1OT2A 3SDAC 3C9NA 1FZMB 1KELL 4X6EB 4PJ7B 3WJJC 4ZMQA 4L3AA 5HD8C 3QRFM 1KCVH 3ZDWA 2J56A 4ZW3A 1MCHA 1QYGL 1L9RA 3AVEA 2B08A 4NUQA 2H3NB 2UWEE 3RTQD 2AQRA 4FI6A 5F21B 3QI9A 5DFAA 4QTFA 2L7UA 5T1DL 3S2CA 5DFVD 1J1PH 4UTBH 2R7EB 2XOTA 1A3RH 1E3FA 4IQHA 1ODAA 2OL3A 4JFYA 1PJ9A 1WIOA 4A7VA 1CI5A 5D6DC 1LWJA 3BYTA 3VACA 5D7IE 4L4TA 5DD3H 3EJJX 1OSZB 1ZLDA 5E24E 3MCG1 2ZX5A 3MZTA 4HMEA 4M8UA 1J1XL 4QXVA 5HHNA 2F53A 1F3DJ 5DWUL 3WKQA 3L5JA 4UT6L 5CBEA 1OD9A 4NJ9H 3FT9A 4PEEA 4KQ4L 3AZUA 3VRJA 1B4JH 2BFVH 4CKVX 1UACH 3N6YA 3DKHA 1QTYT 5IIEB 3STBA 2EEBA 4J28A 1DQVA 1XCTA 4MMZA 4KKCD 3BIAX 3I6LD 4ZOEA 4QXUL 1HX0A 2A74A 4NPYA 1S7UA 2ZPKH 4GG6E 4KO7A 3C6LA 3MLSH 5E5MA 4WDIB 3ZPDA 1A4JB 3CIQA 4J8RB 4Z7NF 2Z1PA 3V0GA 1P4IL 4FFVD 2FIRT 3UZVB 5HVFB 3FSAA 2HJLB 4GMSH 4JCWA 4PRHD 1SF5A 2F7RA 8PAZA 2DD8L 1OE1A 2RJMA 1TJGH 2EC9U 3IDXL 4XRCA 3DGGA 5H94A 1YECH 3GB7B 2EIJB 4B9IA 3E1ZA 1KEGH 3MLXH 4IEFB 1DBAL 1WDAA 4GI6A 4E9RA 3V7AE 2ATPA 1DSYA 3QEHA 4Z18A 5EOCL 1TIUA 2D31A 3ULUH 3FSZA 1R3IH 4G8FA 3HB3D 4PGDB 4KGLA 5IBLD 2MCPL 2QSVA 2X44D 5KN5A 4N8VB 2B9BA 3HHMA 1WBXA 2Y5QA 1F4HA 2G5BA 4B9KC 1YUHB 2ZKHH 1KXVC 1CYWA 3U48A 1KTDA 5E4EB 1R5IB 3IJSA 5KSVA 3S3JA 1NEUA 3R1GL 3FHQA 2Y25A 4O4YL 4DKEH 5KBDA 4PWJA 4Z3EA 4Z7VE 1IGFH 1FO0L 4HCIA 1X4XA 1T1ZA 3G5VA 2AQNA 3MRNB 4G72B 4H20H 4UINL 3HFFA 4ETYA 1SDAB 1XCQA 3GJFK 3I02A 1BAWA 3HS9A 1IGYA 1GOGA 4Z7QE 2QPFA 3CU1A 1ES0A 5IB1B 4JKWA 1HIML 3MTXA 3C60C 3FT4A 5BW7C 4EI0A 3C5ZD 1A14L 1F2QA 2WBKA 5DJ8B 1N0LA 3RX7A 4OSUH 4OLYH 4N0RA 2BVPA 1XIWC 3FU5A 1HZHH 2WKOF 3MJ8B 3N06B 5JIKA 3RKDC 3IAGC 5A2CA 3WS6C 5IJKC 1QG3A 3ULVC 2KZKA 5CINL 5HDBF 3ZL1A 3UP1A 5FAAA 2EDYA 3TF4A 3K6OA 4LDLB 1AI1L 3VFWA 3VG9C 1Z5YD 3ZGHA 4Y4HC 2BP8B 3KYMA 1RULL 4BFBD 4S1QH 5HPOA 2EXTA 4WHYG 3E1F1 2XKUA 1U8OA 3JQOB 1BMZA 4PJ9D 4NQED 3AY4C 3N43F 3JV0A 3VSQA 3V0EA 3NEXA 4RRPG 4XGZA 2VXSL 3GM0A 2OJ1A 1DLFL 1QA9A 4KKLD 1M3JA 2H6PA 4P2OD 3V9FA 2A0LD 4KUCF 4PV1C 5F7YC 1E8WA 1HHKB 3MLUH 3M7OA 3O2WH 1EZLA 3Q1EA 4KMLB 4PS8A 3S4SG 1U93B 1AHWC 4F9LC 2C7UB 2DN7A 4QTHB 5KOVC 1RJLB 1ECZA 1VADA 2FZ3A 4FQIH 4IRSB 2Z35B 4Q14A 4PU2A 3VYNA 5BV7C 1FWXA 4L5FE 1YAZA 4UT9H 4QYOB 2EIBA 5SWZB 1G7QA 1RZ8B 2KQMA 3G5XB 4KI1A 1BEYH 5GIRB 1LO3H 4YXKH 1B2WH 1FRGL 3H3PH 4ES9A 1UVQA 2WHVA 1F90L 4U31A 2Y6SC 4FXKA 4L3CB 3IJ9A 4OGAD 5DI8A 3S96A 3BUYB 3AC0A 2FNBA 4IBYA 5BJTB 5AVYB 3ZO9A 4JGJA 2GTZA 1P5VA 3CNKA 5L2KE 4CW1A 4FZEL 3VD9A 1BAFH 4N0UA 3OZLA 3E6HB 5B3NA 3A6BL 3BDYH 4HK0B 2AGJL 1DO5A 4KRLB 1JXKA 5C3IA 4LEOB 1KIUB 2JB5L 3QIBD 1EEUA 4XPGH 2Q2EB 3CDZA 1T0OA 4D7BA 3MRQB 1M42A 2AV7A 4XMKH 3OAWA 5D5MF 1GZHC 3O0RL 2APBA 2ADYA 1MFEH 1Q9LB 5D7KD 3DYPA 4JFPB 3MLPA 3G08A 1PZSA 4HJGB 4JM0A 4LSSH 1ACCA 4IHOB 3FO1A 2R4SH 1PSKH 1T83A 2VO8A 1CL7L 4YSSA 4AC4A 2KL6A 2ADFH 2L04A 4GPVA 4DCQA 2ZUSA 5CIPH 4X6FA 3B8YA 1TU2A 4M8QB 4YN3A 5ID1A 3B7YA 5DZNA 1MVUB 2WSPA 5GS3A 2EIDA 1FVCA 4IS6B 5DHMC 3ULUE 3H9YA 5JIIA 1SQMA 4DKFL 5BV7L 3W5NA 1B0WA 1ZLVH 2A4CA 2XETA 4G7YL 1NQBA 3ZDZE 3L3HA 1JZHA 1OGAA 3QDJD 3L16A 3WFZA 5E6SB 3N2JA 2WD0A 1RPKA 3O45A 4P2OB 5F7LB 5HYIA 2RGSA 4Z7UA 2QKIB 5F97E 4LEEA 3KH4A 4BXVA 4KOCA 4X6DB 1M05A 4HEPA 4HSAC 1I9IH 4HX1A 1OPOA 4YO0A 2OMNA 2A1WH 2CLVB 4MGXA 5JO5B 5CFAA 3SJVD 4MAYD 4Z78A 4QHMB 2NXYB 1EVTC 4IRZL 5DMKB 2DMKA 2E46A 4FXGB 2VDQB 2FBOJ 2RFXA 2X0VA 4NC2B 1AIZA 4JO4L 5IUSA 1ASPA 1GZQA 1RZKH 1RUAH 2NY5L 2ZOWA 2VLRD 2FECL 3KDPB 4QTIL 2XZQH 1JL8A 4WK4B 3DGDA 5HJBA 4YBQC 1XH3B 4PJDB 1QSFD 2KLRA 4AT6A 4NWTH 2MWCA 2C9VA 3CFEA 1T04B 2DQFB 3F64A 5I17B 2N3JA 1M57B 4M93B 2NSQA 4Y5VC 1DTUA 5AW6B 2DWXA 3AG2B 2EDTA 3OGCA 2ZYRA 4OF7A 5CGTA 5HI4D 4XRCB 3GO1H 3OKMA 3BN3B 4QRPA 1IMHC 3OD3A 2CO6B 3AG3B 4MNQA 4N68A 5EC1B 4UIKH 1MRFL 3FQRA 1UB5B 3UGEA 5GGTH 1OXYA 2DQCH 4OLXH 4DGWC 3MC0A 5IHZA 4ZJ9A 1LQSR 7PAZA 1DEDA 3NCJL 1G7JB 1A0QH 4WNQB 3IKCB 3QIUA 2XKSA 5D7LD 2VJXA 4MJ5A 2Z8VC 4OB5H 4FFYA 4HA1A 4KQ3H 3KR3L 1AXTL 1L9NA 3WSQL 4I89A 2I27N 1DUYA 1JZ5A 2O6EA 3QI9C 1AI1H 4LARH 2JLPA 1MH5B 3EYUH 3WENA 4ZBJA 2UX6A 3PFUA 2YMXL 1KXVA 4DGVH 2A74C 2LT9A 1OPGH 2EC8A 4MAYC 1LMIA 3PPSA 4NO2A 3BH9B 5KS9A 5I66B 1NGQL 1I82A 1YEWA 3TBSA 2AS5M 5JDSB 4JFDB 3WUZA 1AMXA 4N9GB 4LK4A 4MCMA 3PG2A 3SIKA 4WJG3 2VXSH 1YMHA 1NLBH 1ZT4A 2FYYA 3FK3A 4AQ8A 5CD3B 3QDGD 5AL8A 2F8VA 3ATEA 5LN4A 3L8QA 1RIHL 4J3WA 4LLVA 1ZT7A 4M48L 2Z31A 4WHTB 3EDEA 4PWFA 3R06A 1N67A 3FUMA 3KDMB 1SGKA 3ARED 2C4FU 2CBTA 5EUOF 5JORB 2DMGA 5T8IA 2R4RL 1T89C 4QRQA 2AJVH 2MQGA 4WO0A 4B50A 3CUPA 1SBBA 3Q1SH 1G9ML 4ZQKB 5JUEH 4AIZA 4OZIF 4GMTL 3ZZSA 3T0DA 3LSOA 1BXXA 1TSRA 3I9GL 5HBBA 2OMZB 3QJTB 4DO4A 4ZUVA 2HLFC 4KOBA 2VOTA 3L3JB 3QWRD 2A6IA 2CKBL 2YA2A 2WVTA 1WJ3A 3BAWA 3FQTA 4YBHA 3FBQA 5A6IA 3SQOL 2Q20A 1M56B 1E3XA 1INEL 3VXNB 3QAZC 5I8KL 3TBCA 3WUWB 2JB5H 4ZUSB 5A2FA 2WSDA 4XCNB 4M6AA 3G6DH 4TTGA 5J6GA 2DLFH 5HY9B 3IFLL 4R7XA 1K5WA 1PQZA 2YWYA 5D4JA 3T6ZA 1KB5B 3OC5A 1AY1H 2EJ1A 4RBPH 1TITA 5DD3L 2D8KA 3O8XD 1AHWA 3VXTB 4MSWA 2AEPH 5I1GL 3KLHD 2DI9A 2QADC 2CUHA 1EGJL 5D71L 1IL1A 3TT3H 4ALAC 2XV2A 1CFTB 1TMQA 3NPSC 4IBQA 1B4JL 1H3PL 2BFVL 1AS7A 4XN8A 2KDGA 3GZQA 4UQ3A 5D7LE 3WN5A 1NLDL 2WM0A 2QSTA 3P3RA 5IVXB 4P2AA 4R3SB 4POYA 2ITCA 2IPTL 5EU3A 4NBZB 1J8HB 5A1AA 1UXSB 4WHYH 4F33A 3SCMD 2UXGA 2E75C 4QRRB 4JLRB 4ZMOA 5ETUA 3NABH 3BAIA 5FM5O 3S4SA 1GZPB 3FCBA 2AW2A 3BWSA 4FQCL 4GAYA 1O7DC 3JWDC 4WUUB 5K1JA 5I1HL 2DD8H 3JWOH 4PTUA 3LOWA 5DJXB 4I18C 2GK0B 5TE6H 4JPVL 1XF2A 2OSLA 5DRXB 3P3SA 1EAPB 3DVFA 2I26N 3E7JA 1Z2KA 5I1EH 1HYSD 3GIVB 5K93A 2VLJA 2ZWLT 4PJXE 2ZYSA 4NN7B 3RX9A 1HK6A 4BSVA 4K7FB 2IDQA 4UOJA 1IBBA 2Y5TA 3D12B 4EVNB 2XVKA 2GVYA 3GD1C 3EBAA 4XBGB 2X4QB 4P2OA 4BKLB 2FH6A 1KEMH 1CFQB 2NDFA 3DMMA 4KTEH 4I5BA 4GKSB 4PI2A 2VCOA 1F0LA 5FO8B 1M9WA 4Y2DA 4K5LA 1QLFB 1JK9B 4H8VA 4EUPB 1S78C 3S8WA 1XMEB 3UC2A 1A9BB 1AO7B 2YUWA 4ZMAT 5FOBA 2Y22A 2OX5A 4GUOA 3V4VH 1IT9H 5BO1H 3HMXL 3PDGA 3IU3A 4LQ1A 3OLIA 2B1HH 1CFBA 2VDPL 3C2AH 3MXWL 4PLOB 4FNLL 5GISH 4UIKL 4N2LA 4F2MA 3WTSA 1HZKA 3RAJL 1HOEA 3N0PB 1B6DA 1NC4B 3Q2NA 4MQ7B 2EEXA 4Y16D 3VFOA 1Q1JH 1S5HB 2G30A 1CTMA 5E03A 4YQXH 1HFUA 2EDMA 2V9RA 2YUZA 3F6LA 2FX8L 5JXED 2FX7H 2OCFD 4YMPA 3T1FB 4NQEA 4ZNCD 3CLEL 4Y1AE 1KBPA 2WP3O 3O3EA 1NPUA 3U6RB 1J05A 3J07A 3FQWA 2ZD0A 3QEUA 4NQDD 5H4YA 1UQSB 4PGEA 1G9NL 2EEDA 1TJXA 2D7NA 3RI5K 1HKFA 3C8KA 3WFBH 2YC1A 4OI7A 3PWVB 5B1KA 1G7HB 3WNNA 5GZNC 1QLRA 4LARL 2LU7A 3UZVA 3WKML 5C2BL 1W0YT 2WQAA 1R24A 2QPEB 2JQAA 3FUKA 3I74A 3KGRA 1A4BA 4AXWA 3TZVC 4P9HC 2X2YA 1QFWL 5M7QA 5C7ZA 5CZXD 1CICD 2OMBA 4H1LB 5I18H 1UURA 1EO8H 3B2PA 5DS8B 1BZQK 3TA3A 3ZDZB 5FS5A 1PG7W 2XDHA 1KTBA 3QR2A 4ZSOA 2DTML 1KSRA 1D3CA 3CDGB 1QZNA 1FL5A 4G6JH 5EB9A 4OUUA 1K6QL 2P24A 3DSFL 1X9UA 4N2NA 1JFHA 3QFDB 4M5ZL 2BVOA 1TCMA 4OGXH 4JJHA 4UM9B 1B2WL 4LCIL 4U3SB 3QXTA 3WTWA 2GJJA 1O9ZA 3FQUA 1EAQA 1MAKA 2H6OA 4Y9GA 3T2NH 5IROD 3BVNB 3C60B 4L9LB 4PRBB 2F19L 5KW9L 5IVOA 5ESVB 3GTNA 4HZLA 2WNXA 4U1KA 4QAWA 5CSZA 4KO5A 1F3RB 4I3RH 5G55A 1IC7H 2MOGA 3IDUA 2ADJB 1CURA 1C7TA 2XX0A 3OKNA 3FT4B 4RWYL 3NBNA 4LHUB 4LOFA 4DFIA 1QW8A 5C0FA 3WDHA 1CXEA 4IBSA 3KYNA 2Y72A 3FN9A 2WQVA 3PAUA 3PWPE 4FFWC 1IFHL 2ARJB 4HIPA 1ZHKB 4JFZH 4C56B 5HHMD 5IVZA 2HG0A 2X09A 2R51A 4RA0C 4ELDA 4DEUA 1FFOA 4M7ZB 3P2BA 2MPVA 3MCLH 1DVUA 1U8MB 3UAAA 4HIXH 1XSKA 3QDMA 1O5DT 3EFOB 3QYMA 5FYJE 3WXVL 2C3XA 4LEBA 1R5WB 5E8NB 2EQDA 5DVOA 4TL5A 5SWZE 3SGKA 3A21A 3NK3A 4FP8H 1NFDB 1MJ8H 4X50A 1J0JA 1T20A 2Y1YA 3FUIA 3O4LA 5D7IA 4N0UE 1YDPA 3GINA 1TQCC 4QHNB 3K80A 2DM3A 1Y6NR 1MCEA 3MR9A 1SQ2N 2DQHH 3C5ZB 1CCZA 1DVFA 1HHKA 2OS7A 3CQQA 4YFLI 1J0YA 4FQHA 3SGEH 5L2KB 3TN0C 4ONGL 1I85C 4YHIA 4M62H 1HQRB 1WA0X 4NAQA 4N0FA 4JRXB 3QK0A 2XLLA 1AG0A 3NA9L 5J7CC 5F9WC 2WXPA 3K1KC 4AW4A 3VDBA 3CBRA 4Q2ZA 4K3DH 1V7NL 4BYHA 3RQ3A 2LABA 4CSPA 3I50H 1QFPA 3PQYD 5EO9B 2JIXD 4G1EA 4UV4L 5D7HA 5E9AA 3T6VA 1AQDB 3FOLA 2BK8A 4Y0GA 2UZYA 3QHZH 2P47B 4V1DB 5D93B 1GY1A 3FUEA 5HTSA 1V54B 1XL4A 2KH2B 4KFMA 5DJCB 1BMGA 2HRLA 5DYFA 1PZ2A 1QASA 2ZX6A 3SE9L 4LQFL 1MJJB 5T5FH 1QFWI 4LDOB 1KCSL 5TD4A 3QZBA 2CO3A 4JY5L 5IMKB 2K78A 4HHWA 1J5IA 1OM9A 3H54A 5DJZB 4DN3L 3LS5L 1CFVL 1I3RA 1MVFA 3NMEA 5I1KL 1TQVA 2QQNL 5F6HI 4XXWC 4GKZA 1SFDA 4H0HB 4L3EE 5T1MA 3RVTC 4XAWH 3ZN6A 3S5LB 4HOWA 5I82A 3ERXA 3T77B 5F0PB 2NZ1A 3LZOA 4N9OB 2R7EA 2ED8A 2IMMA 4TUOB 1U8PB 2FBJH 3ZZLA 1BZ9B 3L95B 4ODTL 2OL3B 4KVPA 5DHYB 1NCBH 3IJEA 2VC2H 3ASWA 1CE1H 2YD0A 3MNZA 3NUKA 5KSBB 2PNDA 1DFBL 4FFWD 4OCYL 4Z77A 3D85A 2P8MB 3IMSA 4Z6AT 1GJIA 1WV7T 4AV0A 5ICZB 3ROOB 3WIFA 2HG5A 5LBSL 2VM4A 5C0BE 3EYQD 2X6CA 2KZBA 2IPUG 2VM9A 2X38A 3CXDL 3ABZA 1M71B 4L9LC 4OY9A 4PJ7E 3WSQH 1NBVH 1QR4A 3F7YB 4WENB 3KPOB 5F9DC 4ADJA 1EJOL 3L9BA 4WWPA 1C16B 3IU3B 3TX4A 3ATBA 1LM8V 2UWEB 2LOEA 4JEGB 1ZWIB 2V5YA 2XNAA 1OPGL 2NR6A 3EJRA 3HS0B 3WE6A 1BXVA 5FK9B 1SEQL 2CPUA 1FFQA 1LTXA 1UACL 2ESVB 3T09A 4GKNA 3T1WA 1WZ1L 1QVOA 5GGQH 4X0NA 1OARL 2G2PA 2Q8BH 5B7MA 1FG2B 3F7PC 4HXAL 5ANME 1SDYA 3EUDA 3Q2VA 4MA8H 3TCTA 1BQLH 1DJHA 1NSNH 2HJLA 1ZA3B 5AB0A 5F1OB 4GG8A 2W94A 2CBOA 4OIBA 1AIFA 4XCCH 5I15H 3T3PB 4X0KA 4F2ME 2YK1H 3PXJA 5JXEA 4PRIA 3S8FB 5I6NA 2WZAA 2Y3AA 3CVDA 4HWNA 4JFXA 4WEEA 4KNQA 5EBMB 2FT8A 2MQ3A 5EBGA 5IB4A 4M9PA 4P23D 1QHPA 5DYOB 4DPAX 4GSQA 1EEYA 1FJ1B 3O6MH 6TAAA 3LKOA 2NY6B 3LMJL 2VZTA 3KWUA 2X3AA 3QIWD 2DQMA 4XNQB 2XY1A 2B5IB 4EI5A 1MHHA 4F7CB 1NFAA 2Y7QB 4I1RA 1S7SA 2NW3B 3OC8A 1EXHA 4P3CL 2IDCA 4XP6L 2N7BA 3STZA 3SE6A 3D0AA 1NMAL 4AE0A 2FBRA 3PPEA 4Q56A 5K33A 4KZDL 2CO6A 3PV6A 5HYSB 4KZEH 4LHUG 1YECL 3VTMA 3W0WA 4I18A 1T6WA 3GEWB 3LKRA 2TRYA 5B1BB 1S6NA 2OJEA 3D34A 4HLJA 1FYTA 2XVGA 3R1GH 3TIEB 2I60L 5IESL 3ULUF 5F9JB 1NCWH 1MIEL 2BHFA 1D2PA 4PP1D 4ONHA 1GHFH 1QX1A 3JBG7 3PHQB 2F5BL 2NY4D 1X7SA 3QNYA 4GP8B 4NI3A 5LO7A 2EYTB 4UINH 2JSFA 4PGZA 3ZT5A 4Z8FL 1FFTB 1N0XL 4UQ2B 4P2RA 2BVPB 1PF3A 3H8NA 4K0OA 2GSMB 5AW5B 4DKEL 4RFOH 4N2BA 4OZGE 2EDOA 2MKLC 4MXWL 4M7JL 4LASL 3PP3H 4AYSA 4QRUA 3KJ4C 5KBLA 4H20L 5ECJE 1G7IB 3ZZ1A 3HTLX 3RWIA 2V4LA 4K3JH 1C5DB 3GC3A 3LD8B 4JY6B 1IVLA 1XF1A 4X80H 2JCCA 2BP5M 3GXPA 3KPRD 2NY4B 5EOQH 4NIYE 3PWJB 4WO4C 2BS71 4DAGH 4XNXL 4OT1H 4Z3HA 5ES4B 4OLYL 4QR7A 2EVIA 2EP6A 3OAZK 4HBCH 2O5YL 4X5RA 4FQCH 1QBBA 3IMRA 5HVWA 1JPFB 4IJTA 2Q2LA 5B1JA 3TA3C 2EH7L 3JT2A 4JPVH 4AJVA 1OAZH 3MA7A 2LLNA 5ABZA 1KPVA 3P4NB 1UT9A 3HPLA 1XH1A 2E7BA 4PV8A 4ZXBC 1NFDE 5E2UL 5IW3A 4KK5C 3ZHLA 2X4PA 4Z7WF 1LO2L 2J25A 4LDEB 3VFNB 5HHOD 2OMZA 5BRZE 2AZAA 1I9RL 5EEUA 1R46A 5JHBA 3GMQB 4U6XA 4N2OA 3ZE2E 2MMXA 3HS0A 4KFZC 1DJZA 4JANB 4YGAB 3WE6B 3WNKA 4JPWL 4UZGA 4XP1H 2ICEA 4NRZA 5HGHA 5C9JB 5L8KB 1BOYA 3TZVA 4HC1H 2CE6A 1KNOA 4BQ9A 4MS8D 5D96C 1XSOA 3IJYA 1U58A 3LN9A 4P23B 5LGJB 2H32B 4HT1H 3OGOE 2EYRA 2OK0H 2E0PA 2X4SA 2VSCA 3L3GA 4RZKA 3M1BB 2AK1L 4FCAA 1IGJB 3D51A 1N64H 3MOBL 4RAUA 3IXTA 5JQIB 2XPGB 4OCWL 4MFHA 3E6FB 4JL2A 4YX2H 5FWRA 1G7PA 4LP4A 1NH6A 3F58L 5DHVB 3A6BH 3LAFA 1MW2A 2XACC 3QEGL 4N2FA 2HJKB 3VWKC 2R1XA 2CSPA 3CC5A 1D5MA 1P9MC 3CHXA 4LVEA 5C09D 4FQXB 1JMZA 2HZHA 2E76C 1OGTA 4YK4C 3GRBA 3T8VA 1E9QA 1ESOA 1GGUA 2CRYA 3S36H 2LW3A 2RA1A 3QQ4A 4U3CA 1I9JL 5DJZA 5ANMA 3DXAD 3MCKA 1AO7D 3WJLA 5J1TC 5C9KA 5EU5B 5IV2B 1Y18A 4OZGF 2DM7A 2WUCL 2BVQA 3C6LC 3QUXD 1KV7A 5GGSY 4YHYB 3EYSL 4R7NB 5FM8A 1JGUL 1SHWA 2OXGA 1YQ2A 4HUXB 2PLTA 2VZ1A 3EOAB 4FG4A 4FS0A 1L4IA 1ZV2A 4X4ME 2HN7A 1X5IA 1J5OH 1F13A 2XG4B 3K0WA 2HVJA 3LH2H 1YMMA 2D7MA 1THCA 1PZUB 2JF1A 4AQ1C 3ZSTA 3HAEA 4XTRC 5H2BA 4PJ5E 4GAJL 2UZPA 4Y5VB 1N4XL 4U7KA 3PP4L 4OKVA 3I85A 3P11H 3U9UB 3DBXA 3MFFB 1RZIA 5DFWH 5DU7A 2C3VA 2IWEA 2Y6SD 4M1DL 3UBGA 1MPAH 4PJHB 4L29B 5DJ8A 3FO9B 2ROXA 3NCXA 3VRLE 2YN5A 2DI7A 2OBGA 3ESUF 5BS0A 2L3BA 1M1SA 4IRJD 5A3ID 5HGAB 3E9TA 3MOAL 2X53A 5BRZD 1S5IL 1RZKL 5IMLB 1H3GA 4A6YA 4GS7B 1S9XB 5KVGH 2DQ6A 2Y2YA 5F7EH 3J27A 5JMOC 1Q9WB 2A6JB 3SJVA 4LOVA 3UJIL 3VI3B 3CFQA 1A21A 1WG3A 1GGIL 1T1XA 5F93C 2J12B 4JFDD 4A04A 1CR9H 2ZUTA 3CQPA 2N7SA 3I75A 4E9XA 1IGML 2ZXBA 4N1EA 3HC0B 1BFOA 4KK5D 2ZUQC 1MIEH 1M1XB 5INCA 5JIHA 3LRHA 3EFFA 3EGXB 3RL2B 3AUWB 1KDJA 3GMRA 3KCWA 5TQ0L 1U9KA 2ORBH 1B2YA 4QHLA 4Y4FD 5D7JA 1N0XH 5IWLA 4G6MH 2H2PC 3MCLL 2WNWA 4KK6C 4ODWA 3DVIA 3TVMD 2BY2A 1NUNB 4TRPH 3NVQA 1CE6A 5IMMB 4Y5YA 5ADOL 3MROA 3QDHA 4UDTA 4JKPL 2WGXA 1TEYA 4FP8L 1KELH 1V27A 1MRFH 2OMUB 4UT6A 4ERSH 4OZFB 3LEXB 4PJ7F 2HVKA 1JFQH 2NY2D 5D4IA 1KXHA 2RACA 3CN1A 2P5EB 1JHTA 3IDIA 4BXSV 3LZFL 1AZCA 1KLFA 1D6VH 5CO1A 4N0UB 4G9DA 4L4VA 4J3BA 2VLLB 3MRPB 3RURA 2PYEB 3HZYB 2AQQA 1D5BA 2GTQA 1OTSC 5A2KH 4FFZA 1L6XA 3O3BA 3EG9B 2AC0A 2CGZA 2Z4QB 1UVQB 3CZLA 4R26H 1UM4L 7CGTA 3ETSA 4KJPC 3UAJA 4FADA 1TJHL 5EF0A 1EDQA 3U7YL 3H42H 3CLFL 4YJZL 1IX2A 3T6XA 5H35A 1P5VB 2F53B 3LNHA 3BP6B 1UJ3C 1B9KA 1U3YA 4GQ9L 1X9QA 1UZ8B 4TF4A 2ITEA 3GMPA 1EHNA 1ML0A 4P3DB 3NIGF 3SKJL 3X1GA 4GINA 5LGKA 4G2AA 1JWUB 1M2OA 5I1JL 1VZHA 4OZFG 3B9KA 5EBLB 3FMGL 4AIXA 5FPIA 2NY5C 4XCEB 3NDZE 4JCMA 2AV1B 2VDMH 1AS8A 4HLZG 3CFBA 2KKQA 43CAB 1E4XL 4UV7L 4GRLB 5GGSA 2V2XA 4MHHG 5DMIL 2ZAIA 4YDLB 1JV2B 1IC4L 4AYFA 1HWHB 4P49A 1WIPA 2DQIH 3GXMA 2H26B 5AVWB 3N04A 2Z92A 4Q7DA 2AEQL 1OF0A 1KTLB 3A22A 2BXYA 5E6ZA 2BNRD 4PREA 2L7JA 5TE7L 3BE1H 4ODXB 1FV1A 2XV0A 3TH2T 1NC2A 1QQDA 4TPRH 2OTUA 4X7CC 3ULUL 1KN4H 3EJSA 5F44A 1XV8A 4A63A 2VDQL 1BQUA 1ET7A 4UQ3B 2LTQB 2P5WA 3G5XA 1HHIA 3EYFB 1IBHA 4LO9A 3FH7A 5DUMH 4ZYKB 1R3HA 4R90L 3OJMB 1KCLA 2WC7A 3A4FA 5AW1B 4IRSC 5DI8B 4JHVA 5AVRB 1QHOA 3IMBA 2X6BA 1PAMA 4AUUA 1ET5A 3W11C 1NCOA 4PJIA 3NFNA 1YCSA 2ITDB 2WYZA 3BZ5A 1BIIA 4RMQA 1G0YR 3C5SB 4OF8A 4R2GB 4Q0XH 2VLJD 1F3JA 5EORL 5DD0L 4AM0A 5DURB 5ENWB 3VX1A 43C9A 4XCCL 5LBSA 4DN4H 3GS7A 1NJ9A 4PTUB 4KY2A 5BO0D 1KJ2B 2AK4B 1H0DA 3SKUD 5IP4A 4H26A 3GHEL 1NAMH 3HB3B 4S2SA 2ZUYA 1TPXC 3FS9A 3MROB 3HLKA 1N4XH 1RSYA 2MQ0A 1QTSA 1ZTXH 2FJGA 5CJQL 2YUVA 4KKAC 2EEFA 4NN6C 4K4KA 1BOGB 2AJSH 4CC4A 4GFTB 4V2CB 3BVVA 2BP8A 1KPUB 1NMAH 3H4FA 1SLVA 3IWUA 3LPGA 5ERWB 1U8HB 1TQCB 3O9WA 4KMTH 4OVVA 4P2QA 3IMVA 4UQCA 4H8WH 4TLKA 2R0LL 5LCVA 5TE6L 3FTYA 2ZT9C 5JYLA 4I87A 2CJUL 1NIEA 3Q6FA 2E4FA 5A2IH 2X4NB 2VR5A 5MI0C 1NICA 3UYRL 5B39G 3OV6A 3ARQA 1CTNA 3QUZD 2XWBB 1IQDA 4P46A 2FCBA 2BOBB 3FB8B 3ASNB 4XBEL 2VH5L 2J8UA 1JF5A 1LE9A 3VRJB 7PCYA 3ARBB 3C8DA 4IKNA 2BXZA 1MJUH 1U8IB 4X4KA 3TLRA 2JJSA 4GJTB 4NHUA 1B6UA 5T1LA 2GUOA 3IDNB 1J1OL 5L8JB 5KYUB 1YMME 1JGVL 4LL1A 2QVMA 2Z31C 3MBXL 4I0PC 5J12B 2ZOKA 4GG6A 2V9UA 3KYKL 2R59A 2ORBL 4FYRA 3RUGB 3NIDB 1X7QB 3KXFE 4BUQA 2WZPD 4F8QA 5E6IB 2YQ3A 3PIQB 3QUMH 4JQIH 5ITFB 2AK4D 2NCEA 2PO6D 2EUZA 2YARA 4LAQH 1V5JA 3MBWA 3MUGA 4HOZA 4YOKA 1MLCB 3GWJA 2IVFC 1Q9KB 2K1MA 1YQVL 3MRMB 3VXMA 1GL4B 4AQEB 1JAEA 2R8SH 4DAGL 2JJUA 3US1A 1AGBA 1X6LA 2Y7NA 1IC5L 2DPKA 4K9EH 2WWKT 1G9NH 2V0AA 1PD0A 2A6DA 2O5YH 3K4DA 3L9EA 4ADIA 1YEDB 4NYLA 2AEIT 3S97C 4QKXB 4AVHA 2LVEA 3G9AB 4U33A 1F11A 3D39E 3SB3A 3NSXA 2CR3A 2DWSA 2X2UA 3RDJA 3H4HA 2WUBL 1E5CA 2X4TB 2D2OA 1SMAA 4E2OA 4U3SA 1FC2D 1A4KB 2XN9E 4BHUA 3K0YA 3WIAA 3CU7A 1IEAB 4ZMPA 4G42A 3QG6A 1ZHBA 2MOVA 5C2BH 3T4YB 4CAGA 2NY0B 3W82A 4MJIA 2P26A 1FZJA 3C08H 3RDTA 4X4YA 1MCQA 2IWGA 4H8UA 5I8CB 1T5WA 3CX5J 4M5ZH 5C09E 1Z5LA 4K71B 2JFCA 5IEKA 2P7TB 4O58L 5D1QD 3FU0A 4HIIB 4XXDB 5FKPA 3EH5B 3S35H 2JI3A 5E8DL 1OP5H 1NAMB 1XX9C 3VFSB 5KEZA 1QSVA 3H9ZA 1GS7A 2SEBA 1A9EB 5F3BA 3KGUA 4XNAA 1E42A 1PY9A 3L5WA 3SKNA 2ZNXA 3EYVA 2HX8A 1MUJB 3D09A 1Z9SA 3ZHNA 2R2CA 5AZ2H 3DXAA 2HLEB 2PCFA 5MEPB 5SWQA 3TJEH 4X5WA 3A4DA 4BFEA 2XWDA 2I85A 2WLIA 2FQGA 1L3NA 2IH1B 3QO1B 4P2YA 2CK0H 1A6WL 1EV2E 3EHBB 2XVLA 4G8GA 4I2XA 1EX0A 3JWOC 5C0JA 5KBNC 4PJEE 4WKZB 3ZYZA 1KN4L 2EACA 3RG1C 4NO5B 5JLZB 5DLMH 4R2GC 4LCVA 3FKUS 4XWGL 3U2JA 4Y5YC 4FNTA 3QUYD 4X7SH 4JFZL 3K8LA 1ED3B 1OAQL 5AUMA 3K6SB 4CSSA 5JQHC 2ZAHA 3MLTB 2FO8A 3LHPH 4PTTA 5JA8B 1UA7A 4HGWB 4GKSA 4G9FB 4PJEF 4BFGA 1SM3H 3HNTH 4UT7L 4QHLB 3FRUA 1S9KC 2YZ8A 1MXDA 4FNSA 4X7FC 3X14A 2XWTA 1FI8C 1QHQA 2KLTA 2HT2C 2M1KA 5EUKB 4PWKA 5AYUH 3UROR 1U3HC 4PV8B 2V5MA 3KE0A 4EVNA 2DQCL 1T5XA 2BNQE 4LPWA 2UZIH 4XNYL 1OAUH 3DC0A 2VXVH 1RKRA 4NQSA 5GGVY 3S7GA 3P02A 5I0DA 1BV8A 3VU2A 5TFSL 1OWRM 1H8NA 4ZI8A 3QCTL 3M8OH 3TBYA 4HIHB 2Y2WA 3V6OA 3BP4A 4LB8A 3ZUNC 1QP1A 2YZ1A 1TQTA 1JHLL 3QXDA 1GGCH 3MACL 3HMWL 5GRUH 2EE3A 4TQIA 1TFPA 3TJHD 4ICXA 4QY8B 1S5IH 1D5XB 5MEOB 5D55A 1IBYA 5AFAA 3BRGC 1ZV5A 4YSOA 5F7EL 1KENL 4NHCL 3TV8A 4QLWA 3RIAF 1G6RL 3QNZB 1N8OE 2ZONA 4JAMA 1C5BH 1P4UA 3CZKA 3WL9A 3L1EA 4N5UA 3B3IA 3AB0C 1IGMH 1NMCC 4AGLA 5JHAA 1QA9B 1QBAA 3BQVA 5FC9A 4A1RA 1K8DB 4MRBA 5JOPE 4HYTB 4HFUH 4X8GA 2O4EA 3VU1A 4GKLA 4DP7X 5AD0B 4G8IA 4BD4A 2BERA 3QW9A 4LQFH 5T5FL 1PFCA 1AGDA 3Q5OA 4OIIL 1I1FB 4ODUB 1A2YB 2F8OA 4AGPA 3C09B 3RFZC 4TUKL 4ALAH 1FORL 2VMEA 1ZGLP 2DMCA 2IBBA 1AAJA 1OM3L 3W9DB 5J6SA 4EZLA 2QSCL 4J3OD 2FEEI 1IO4C 4K7PY 3ZL4L 2WNGA 2YPLD 4GAFB 2HXAA 2ERJB 3L3IB 4MJ6A 3ABMB 4XVJH 3LZFH 2E6JA 1EJ8A 5IT2L 3WUWA 1J0ZA 3K7UA 5I74C 5K9OA 1ETZB 4I8DA 4NT6A 3IGLA 4L4TB 4X42A 1D7FA 3PUCA 3NRPA 3GJFB 3I9IA 4EI5D 1ZMYA 1W8NA 1CLZH 3BCFA 3LVTA 3OKOB 3WCYA 4M03A 4PRIB 1SZNA 4JFHD 1XGRB 4PCTA 3PFQA 4F8PA 1UXLA 5EF2A 2VLKE 1FN4B 4HXAH 4HPYH 4HUVA 2E9IA 4OH2A 1I31A 2I9TA 2OMTA 4Z95H 4F15C 4ZMLA 2L7QA 3PRZA 4LL4A 3K6SA 2HTKD 3ESVF 4JZNA 3LIUA 2A73A 1VEPA 3X11B 5ICYB 2DLGA 4I0PA 4E42B 2APTA 5PCYA 4NB7A 3UADA 1F6LL 1IE4A 4NO0B 5C0IB 2XT1B 1YEKL 3MXVH 2AERT 2G75A 4GB9A 4NQXB 5DDHA 3U4EB 3D0VB 3B4NA 2GTWA 1F11B 4FKEA 4J27A 4PJFF 2FD6L 4X8JB 5DJYB 3CSGA 4Y2OA 1A7QH 1ULVA 3BDXA 3HUJB 2J2ZA 3T3PE 3D4CA 3MUJA 1V3LA 2NNAA 4HU2A 4WFEE 1LYQA 4G6AC 3IFPA 3O3AA 1MCJA 4P46C 3RNQB 3PHAA 2J6EL 5E8EB 1DP0A 1VEMA 2TSBA 3H53A 4AZ8B 6FABH 3T08A 5MEQA 4MXQD 1MNNA 3RVUD 1T03L 3ZTCC 4CN1A 2N7AA 2FLBT 4ZZFA 3RDTB 4F2EA 1X6NA 5C0CA 1E8YA 4XHQA 3WFHA 2WIIA 3U0WL 2NY3C 2YXVA 1MHPH 3UX9B 4C58B 4CRPA 4X9FA 4MWFA 3QXWA 2O30A 5BRZB 2CK0L 4XXDA 3LKSB 5FKPB 3TFKC 4UMGA 4ELMB 2AHIA 3ARYA 3FOMA 1A6AA 4PLKC 4WF7A 3FHEA 1NKOA 3D05A 2K9UA 3M46A 3QDAA 1G9EA 5AW2B 3A67H 1IAOA 3VCLB 1VFMA 3BQUB 1AQDA 4JGNA 1G7IA 3QS2A 5IR1A 2HLAB 2MKWA 3FB5A 5IJKA 3CBJB 4RFOL 1XB3A 3MJ9L 4X7SL 2FO4B 4M93C 5KWYC 3KW8A 2NY4C 1NGZA 1T04A 2DQFA 3BP5A 4PGCB 4AY0A 4LCWD 2ATAA 3CN3A 1AG6A 4X5LA 2VKWA 2OLDA 2X1OA 3PGDA 1NCIA 1PBYA 3L5IA 3V4PA 5CWSB 2X4UA 1MHCB 3RUGF 1I7ZB 4MJ2A 3TFKD 5SWSA 1E30A 3HE7D 1OV8A 2W0KA 5GISL 2YBRB 2YEZA 3QJHA 3O6KL 4RQQA 4LCYA 1H0DB 5DJDA 1G7MB 1DR9A 3EOTH 5JHLH 4XNXH 2XIDA 4OT1L 3VGDA 3NACH 4HZAA 4FA8A 1PCSA 2XX1A 3S3BB 2DEYX 1HILB 2H32H 2FGWL 3L4CA 4LOEA 3LPFA 1NGWB 2FX7L 3N41F 4Z7QB 1KBBA 3MRFA 5K9KB 4UBDC 2DBJA 1J8KA 1QNZL 4K3EL 3DUSA 2J5LC 1RZJC 1TT6A 2ALAA 5BZXA 3RFZB 3V0VA 1ZLUH 3UBXA 3UTPE 3IAPA 3ZYJA 4P5TB 4UAHA 4TNVF 1MF2H 4P23C 2CRIA 3DPBB 4DP1X 5DGRA 1SHMA 3FQ1A 3T71A 1EFQA 5I76B 5JPMB 4WTZG 3ARDB 1E6JL 2XIIA 1KENH 4NHCH 4P2CG 2WAHA 4AITA 3IKKA 3AADB 4FQ2H 1WBZB 2DICA 3K81A 4IMLA 2I5YL 1QZ1A 1VKXA 3FCSA 4YHLH 1ORSB 4KX8A 3GLZA 3LD8C 3L4VA 4N2EA 4YUEH 2QVFB 4ZMVA 3MRLA 1U95A 1SOQA 4WW2F 3VQ2C 4W9FC 3RIFF 2VAAB 5DMGD 3VM5A 1NCHA 4HKBA 1P2CB 5F72S 1K4CB 2QLYA 1XGTB 3VFTA 3VD7A 3DURA 1T1WB 3HC2A 3ATFA 1MCBA 4MA7H 2G75B 5DDHB 1Q4NX 4E9TA 1RZJL 5D1ZB 5E00A 1G4MA 1G6RB 2A83B 4OLXL 2V2TB 3HG5A 4BSWB 3I6GB 2DWDB 2FEDC 5K69A 4XBMA 5I0ZA 1PYWB 2P45B 4IHOA 3RX8A 4E5XB 4OGZA 1E3ZA 3P73B 4H0GA 4NQVB 1S7QB 2NZ9C 3M17B 5IHHA 1XGQA 3V6OE 5AAMC 5AOMA 1F3JB 1BLNB 4MMZB 1SUJA 4KQ3L 4RFEB 3SO3C 3SY0B 2HKHH 4I3RL 5L2JA 2WVVB 4MA1B 4HFWB 5E7FA 2IALB 4J4PA 4QXGL 1XXDC 5HHPA 2DW5A 4JRFA 5KUMA 1AE6L 5J13C 4WHDA 3MKKA 2B39A 3MPCA 4X4XB 4UTBL 4ZUTB 4YDJB 1PL3A 3ZR6A 4TNVK 1X5JA 4KNSA 4TUOA 2EDLA 4JDEB 2ZWZA 1CQYA 4A7GF 2NZIA 4Y1AA 5DTFA 5TF1L 1ACXA 5IY5B 4DZBA 5CKAA 2R0WL 1MWOA 4PCKA 4ANKA 4NZRH 4P57A 4ABVA 4O2EA 1KG0B 3RFRA 3C09C 3ECWA 4HPYL 3VW3H 5IOKA 3VXSE 2BNQB 2Q3AA 3QE5A 1GCFA 4GW4B 3GXTA 1BP3B 1P84J 1HINH 2R69L 2H8PA 5TPWH 3VD5A 3T0BA 1ZVSA 2PXYA 4YHOH 2JKRM 4O58H 1RUKH 5DZAA 2R0KL 3PAVA 5FYKU 2CR6A 2AQ1A 2X4UB 4NUGH 4OCRH 3QPKA 4OCXH 2AJVL 3U1SL 3WJMA 4FHJA 3C6EA 1BYOA 4MQ7A 4GBXB 5BVJB 1L5GA 5DT1H 2NQ3A 1KT2B 2YGOA 1A6ZB 1XF5A 1CTOA 4I1NB 1Y07A 5SV4A 1KFGA 2YAOA 4MD0B 4KPHH 3AMLA 2GB2A 4OFDA 5IHLB 2X4OA 4XO9A 3SDDC 1I8MB 1OGPA 1HNGA 2Q6WB 1FAIL 3SDCC 4DWHA 3PWUA 1U8NB 4JZJA 3V6OC 3BZ4A 1YEGL 3GHPA 2ZNWA 1JVKA 2UZXB 2X70B 5D2NC 4DP6X 3DUUA 5I8KH 2C9AA 3QSKB 2BC4A 3P4NA 4RDBA 3DRQB 4PRDB 1NWPA 3QUZA 3COOA 5ICUA 5FB8A 4PMFA 5ITFA 1MNUH 1CYXA 2KT6A 4LAJH 4A66A 5FA4A 4XE5B 2X5PA 4L37A 4QF1B 2XQYG 4PJ9C 1OF2A 4EOWL 3FU8A 5J1AA 1RZQA 4FNPA 5F7AA 2EDWA 3EJZC 1CFQA 4C4UA 3LHPL 5L2KD 2HRHA 4NUJB 3BKYH 3RVTD 4MNQD 5E4EC 3KPMB 1GOHA 1G5GA 2WTPA 4PCYA 1FO0H 4YHPB 4R4BB 5KJRH 4NM8H 3RWJB 1WAPA 3D48R 3IU4H 1H5BB 4I48A 3E2HB 1ZHNA 3LV3B 2B59A 3D39B 4UOZA 3EH2A 2IQ9H 3RI5F 1RIVH 1SOKA 1TEFA 3QUXB 4OJAA 2XKNA 3ZT6A 2BHUA 2I9LA 5HHQB 5GXBB 1YUHA 4IJ3C 2B16A 4J2QA 3QUYB 3FPYA 5IEHB 3BUTA 5ICZA 4MX7A 3ATAA 4PJFE 5E9DA 4G71B 3VXME 3LQZA 4C56D 3X1NA 3FQXA 1C1EL 2EEAA 4TQPA 4HU8A 1IAIH 3HI1A 1XSIA 4TNEA 1NBZB 2FL5B 3TBBA 3QJRB 3U7YH 1FQ9C 2B77A 1DVYA 3ROLA 4MKTA 4EXPX 5GS0L 2YD6A 2HTKC 3JTSB 2YFOA 4NSKB 4U1IA 1L6ZA 2ZP8A 1XGPB 1Q0XL 2FJFB 2NTSP 4UTAH 4LGSB 4WFFD 2QHRH 2XXCB 2ZUUA 3SKJH 3L45A 4KK9C 1ERNA 2VQ1A 4C47A 1XIWB 3NFPB 1F3DH 5I1LA 5A6LA 3EOAA 4LEXL 3FB6B 2R23B 1U8MA 3PJLA 3TURA 2VDML 1BQSA 4NAMA 2Q9OA 2PR9A 3X1FA 1ADQH 1REIA 2BWDA 4U1LA 4JFDE 5HDQH 2CK2A 5DYOA 2JTYA 1AD0A 2HKFL 2NX5E 4X7TA 5AYQA 3FU3A 4HUCA 3NJHA 3VXNA 4M7ZC 4EDWL 1PG7H 5CLXA 1GYAA 3OXSA 4A2EA 5MENB 4NX0A 4ZYKA 3BE1L 4BZYA 1UWXK 1SN0A 2A77L 4KK9D 1HTYA 2QSCH 5JR1L 4FKHA 2CU9A 4APQA 4TPRL 1OZTG 4ZO6A 3EBGA 5EF1A 3QJQB 4LSPL 1L7IL 4L8BB 3TZVB 4BFKA 4KJPD 2ZSVA 1NDGB 3LKNB 5AVXB 3RY6C 5HSFA 4XVJL 4N2CA 3KWWB 1LGVA 2AEOA 4CA4A 1QRNB 3KW7A 3APNA 3N9GH 5T5FA 3UTTE 2YAMA 1YEEH 2X89D 1CGTA 4B0MB 3RIAK 3F7YA 2FEEL 3L4TA 1K2DB 3WHE0 4N8PA 4F7MB 3OJ2C 1DCEA 2ZKMX 5IROC 5EZIL 4LRIC 2Z3FA 5HYJE 4J1UA 3RWGB 5FHBH 3APMA 2Z93A 3U0PA 1RXLA 4B27A 1E0OB 3LJ3A 1DSFH 5JO5A 2WMPB 1EZUA 3D18B 3O9WD 4JFQA 2HYMA 1A1NB 3WTYA 4FJZA 2EZ0D 5C0AA 1J8HE 1CJYA 3HN5A 1KLGA 3NIDE 4EIGB 4G80A 1R4XA 3T77A 4L3EA 4NBXB 5ICYA 1A4CA 1FSKB 2W38A 4HCRA 3BW9B 5DJ0B 5TQ2L 4F24A 3L6FA 3OKDB 3MCKB 1KLUB 5IG7B 3PJSB 4KV5E 1UOKA 1J12A 3SE4A 3ARBC 1HINL 2R69H 1EIBA 2P5PA 1RJZB 2X4NA 4G1MA 1MHEB 3ILQD 1NBYB 1WIUA 2G3ZA 2ZAGA 3GXFA 4RNRB 4U7MA 4XCFL 3H7LA 5GRZA 5I0YA 4IGBA 2XWBA 3U1SH 5TE4H 4CUCA 2H6UA 3BD3A 4IBLT 4BSVB 3H0TB 4XVUC 5AWNL 3KPSD 5DT1L 3FONA 2BO0A 4NAJA 5CCKL 1OSZA 4JFHE 4OZIE 4IJ3B 2CDGA 4K15A 3W57A 4MNQB 1AC0A 1V55B 4TN9A 2VABB 3LX9A 4JFYB 3DTXA 5JW4M 3KEDA 2EUVA 2K6ZA 1QSFA 3TEWA 3UAJC 2B20A 4CVXB 1RUMH 3MA9L 4CU8A 2XZAH 4U1IB 1MJUL 2WYIA 3TIEA 2YGNA