5K5YA

Crystal structure of truncated flgd (monoclinic form) from the human pathogen helicobacter pylori (strain 26695)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
146
structure length
146
Chain Sequence
b'NSVSMIGKIAETDVSGANFDGNNKLSFSLFFDEKIDASKGVPAIQILNENNELVKTIPLKDYNGQKGYINFEWDGTNEKGEKVPKGNYKIKAEYNLDSHSKQYLQTRIGRGEVESVIFDKGKPMLRMGEMVLPIDSAIEFYQPDQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Basal-body rod modification protein FlgD
publication title Structure and Stability of FlgD from the Pathogenic 26695 Strain of Helicobacter pylori
doi rcsb
source organism Helicobacter pylori (strain atcc 700392 / 26695)
molecule tags Motor protein
total genus 33
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5k5yA02
4ZZFA 4ZZKA 3C12A 3OSVA 5K5YA
chains in the Genus database with same CATH superfamily
4U1LA 3HNTL 1DQML 1OP5K 1EVUA 3MMEB 4IBYA 1BW8A 3K72A 3R4RA 5BV7L 2QQLH 3NCJH 4AZ8B 3H54A 4QYAA 1ZVSB 5IQ7H 5MI0C 2DLEA 2OMTB 5EORH 3FJTA 4PRIA 4O51A 4HD5A 5GRZA 3LS5L 3NP4A 1K3IA 2FWLB 1T6BX 3GZKA 3IRPX 4Y16C 3HI1A 2QSTA 4ZS7H 2APBA 5BRZB 1G1CA 2P26A 5KVEE 4WFED 4TSBL 3CHOA 3LQZB 1WFJA 1NAKH 3V2AR 3RTQD 1GGUA 2COQA 1C5DB 5B4MC 4X83A 1J05B 4S1QH 2HX8A 3HMXL 3TFBA 1AKJB 3ULVF 4WWNA 3OG6B 3K81A 3KPLB 2OL3A 3PL6D 4NHUB 3D33A 3IKKA 3BLKA 3SDAB 4RAUB 3QH3A 1NWOA 3L2NA 2HTKD 4TTDC 1MRFL 2J8UF 4NO2B 3OBAA 4MB3A 2CM6A 2PR4L 1X9UA 5K59E 2VZ3A 4AIZA 2GUYA 4ZUTB 3HRZA 1OT4A 3D0VA 3S5YA 3V55A 1XWVA 1H3PL 4AGNA 1I82A 3WE6A 4YLBA 4Y19D 3IJHA 2MHAA 3DBXB 5AW2B 4RRPG 1T2QH 4KRMB 2KL6A 3RBSA 1UT2A 4L29B 2PMZA 5FM5M 3ZTNH 3WFDL 1WAAE 4RZCB 4PJ8A 2FD6L 4XP9L 4GSXA 4OSUH 4URKA 1D5XA 4JGJA 5D1QA 4TQPA 2ZF9A 2EUWA 2BOCB 5AW4B 3WNOA 5C6TL 2Y6TE 4LSQL 3WN6A 5JIMA 1H8NA 2E9JA 3PGCA 3PHQA 4PJFA 3BWAB 4GAJH 4X5PA 5HTSA 1UH3A 4U4BA 3V0VA 5F9WC 4PRAA 5AD0B 3AS2A 1UACH 2OYKA 3IAGC 1WFNA 3VI3B 1IFHL 2DIJA 5E2UL 3LCYA 3WGUB 4U3CA 1H5BB 3DX7A 4HS8L 4KROC 2W9DL 4H5SA 4PBWD 3WEAA 3EGSB 3SZKC 2J1WA 5LG6A 3MVSA 3O9WC 4GAYA 3U7YH 4NS0A 1T22A 5C0CD 4P5RA 2XKUA 4F7PA 3PJSB 1UJTA 1P9MA 4GUCA 4IM8A 3MC0A 1U93B 4PJ5B 3FU9A 1AXSA 5B22A 2WAHA 1E27B 1A6WL 4G6KL 4N0UB 2I32A 5ELIA 3L9BA 3AWGA 3VFSA 4ZS6D 5D6CA 5I2IA 4IRJB 1MHHA 3F7PC 4PRDB 5KBPA 1KSRA 5LBGA 3TVMC 1J9CT 1W6LA 2A3TA 3ARBD 3QUMH 2XETA 3EOAA 3KLHC 1S7UA 1I1AA 2J4WL 3NPSC 4AQZA 3D4ZA 3K8LA 1ZT1B 2YC1A 5HHMB 4CMMA 4NRYB 4PJEA 2YOAA 2HFFB 4PMFA 4X6FA 1CIDA 4TVPH 1ND0B 1A3LH 1X5AA 2KT6A 4D8PB 1ZPUA 1H3XA 5TTRA 3FO1A 1CK0H 5F0MB 3WIHL 1RUMH 3GB7B 5BV7C 1VA9A 4EN3A 3FK3A 2LOEA 4UUJA 1THAA 3UADA 1SEBB 1M42A 1U8JB 4QHMA 1V3JA 2N0KA 3FSOA 1IC5L 3WJJA 1TPXC 2YHGA 2Z31D 4UU9A 4YXHH 2ATPB 5DZVA 2IXQA 4JO3L 3EFOB 5ESAA 4BH7B 3FULA 3SDDA 4FQXC 3TLRA 3BKJH 5TFSH 3VRLE 1KYFA 4B5ZA 3W57A 4MA3B 3IDXL 2DOCA 4WWPA 4MJ4A 4JM2B 4H88H 4BCZA 3FW6A 4CRPA 1OT1A 2CO6B 3NIDF 4FNTA 4FZ8L 4PUBL 2EDOA 4UDUB 3KWWA 4TL4A 1IEHA 1Z9SA 2CK0H 4MMXA 3RVXD 4YIQA 1XXDC 5EUOA 4GQPH 2A6DB 1C5BL 2QHRL 1M56B 3HNSL 5LN4A 4JRXB 4YS4A 1BF2A 4F5CA 2CCWA 2K6YA 5D1QE 1BZ8A 3ALPA 4M62H 5CM1A 1TYJA 2CWRA 2VDMB 2D7MA 1SUHA 2W1NA 1IM3A 4OD1H 1IEAA 2WZ5A 5IWLA 3FXIC 4HPOL 4NXKA 4K5MA 5CEZL 1XGQB 2E9BA 2QT6A 1QFWI 2HH0L 3BX7C 3M46A 1INQB 4Y2NA 1T2JA 1HH6A 1R5WB 5E8DH 2DQCH 2VLRB 2XZCH 4OZIB 2J7LA 4UTAA 3HC3L 4IBWA 1LP9F 4QRUA 2UX7A 5DHVA 5D7JD 3HJ0A 5L4FA 1IGIL 2ID5A 4LSTL 1UURA 4LLWB 1QYGL 1K8IA 4NKDA 1JHTA 2NX5A 2DWSA 4NP4L 3QUYC 4DN3L 5A2CA 3S5LA 3FO2A 2R1WA 2R2EB 4U7MA 3SDXA 3KGSA 4WEUD 4ZX5A 5A3IC 1FORH 1WWCA 2P45B 5K9QI 3LZLA 2CZNA 5DURD 5K9OA 2OS7A 2MTPA 1CF8H 1CFBA 2I26N 1I4FB 1ZLVK 3BKCH 4ADGA 2PO6D 4BKTC 3DVNA 4Y16A 1ZLUH 4PJEE 4JDVA 2YGPA 4HJEA 3MYJB 4RX4A 5E03A 3X3GH 3ZPDA 2D9CA 1F4HA 3FC8A 3LN5B 3S88H 2EADA 1MJJA 1UUSA 2B1OA 1F56A 5C2BH 1RKRA 5HY9B 4P2QB 2P5WD 3RWGB 1AR1B 1AQHA 4R4FH 2VABA 1QSEB 2MTAA 3GO1H 1NLBL 1ES0A 5EZJB 4KPHL 5EO9B 3SCMB 5EA0H 3MV7A 3QXAB 1YA5A 2F1EA 1OTUD 2B08A 2XPYA 1GGYA 5FYLH 1Y1UA 2CDGA 3FQNB 3TNMB 3IJSA 3BRDA 1IGCH 4PRPB 1BJ1H 4S2SA 5JO5A 3VX0A 3DMMD 3P4NB 3QJOA 3VXNB 4KDWA 3QZWA 1CLYL 1AGDB 2R83A 5L7XL 5C09E 1JMXA 4Z3TA 4J2XA 3O45B 2VZVA 5EUOE 3BSHA 1K85A 4LVNC 1PYWA 1NGQL 4OIAA 1HHGB 2DF3A 3MRMA 3H3PH 2I69A 2VL5A 2YD0A 4YDVA 4F5CE 4AKOA 2EIDA 3QNXA 1DL7L 1HJCA 2C3WA 3HIZA 3W2DH 4JFZL 4NFDA 5AZUA 3IM1A 4I85A 2WVVA 1AZUA 5BUAA 1UB5A 2QPUA 3GC3A 1TETL 3HG0A 1HAWA 4G6ML 1KACB 3QFJD 3GI9H 3MRPA 2Y5EA 5GGSB 3VXSB 5JNYB 1WZMA 4MD5B 5CP7B 3HUJB 2V6HA 2VDRL 3SPGA 2NT0A 3ZKSD 1TO5A 2WQXA 4X7DC 5IFAL 4TUJA 4LAQH 3RIKA 3NTCH 4E42A 1CFSA 3W56A 4Q9RH 4TNVF 4X6BA 3STLB 3SDXE 3ECBA 4Y9GA 4FOMA 3STZA 4KKLC 4HQQL 1Q9LB 4L8DA 4IKNA 2QADB 4ZPVB 4HVBA 4N9GA 1Q0EA 2IDSA 4PS4H 4HA1A 3TVMA 5I6XC 3G08B 3GBNL 1GTFA 4U1MB 1JHKH 1RMFH 3B5HA 1HHJA 3ZT6A 1CICB 2CGRH 3BD4A 4LP5A 2X6UA 4O58L 2DB8A 3NSYA 3UO1L 4N0CC 4R0LC 5F7LB 2CQVA 4WHDA 4L3CB 5HDWA 2ITDA 2QHLA 4NKIH 2DQ6A 1D5BA 1UH2A 1WRFA 1Z3RA 3BZFB 3M1BA 4IEFA 4WU5A 4D7PA 1GW0A 1U9KA 3QEQA 4GW5A 1JVLA 4QAWA 1AY1L 3H7BA 1OSEA 2DBLH 3ZHLA 3WDIA 3MLVH 4NO0D 5IR1A 1RZGB 4NQSA 3HTLX 5D72H 2KYIA 1I7RA 1MEXH 1QI4A 2VDQL 5HI5D 1AO7A 4G42A 1BGXH 3QPKA 1B0RB 3EDJA 1NSNL 2B5IB 3WKMH 5K59F 3MV7E 2OULB 3JZ7A 3FCSA 3GDCA 3SD2A 3DX8A 2K4WA 3SDYH 2B9BA 1HYSC 4HJTA 3L1GA 4WHTA 2XWZA 5GS1A 1FVEA 4R3SB 3HMXA 2OSWA 4P04A 1S7SB 2PPCA 4BQ8A 5D55A 3MZTA 4WW2B 1JL8A 3WAJA 5IIEB 4B9JA 2LFGA 4ZW8A 5IHLB 1N7MH 1UH4A 4QRRB 4TVPD 4XNZB 2LAAA 1TZIA 3QR2A 3RWHB 1XZ0A 3KPRB 4PJXA 3WNIA 2G0KA 4P99A 3ZSTA 3VTTA 2MSPA 4GT0A 4AQ1C 2XYCA 1ET8A 2R29L 4YOKA 3L08A 3O4LD 4M6NL 5GRUH 1AKPA 3NZ8B 2HFGL 2GY5A 5I15H 1T3FB 2ICEB 4TUOB 3RWFA 2UZIH 1D9KB 4HBQA 1Q38A 3VG9C 4UB0L 4AYID 1Q94B 5IBUG 5BO1L 2A0LD 3EFDL 2W9EL 4Y5YB 1GGCH 3BAWA 3JWOH 5IK3B 2D7QA 3N43B 2XN9E 3KPSD 3S9DB 4N25A 1K9TA 4JRYB 4B9PA 3QUYA 2WKLA 2LTQC 3FSAA 1X4ZA 3RVWC 1KV3A 5BUGA 2Z64C 4F8OA 1EO7A 1J7VR 5J9PB 1DQQA 1QLEL 3PP3H 1WBXB 2OR9H 3SYOA 2RIKA 1O7VA 4ODWA 1A4JA 2K70A 1CL7H 2F54D 2H5UA 5BOZG 2FX8L 4QJ5B 1TUPA 4GO9A 3F6JA 4JFHD 2LQRA 2CLVB 5JOPE 4IU3B 2EINB 1UOWA 2BSED 4I0KA 5A16B 1YEDA 2PNDA 1Y0LA 1JF1A 1G6VK 4NRZB 3VB9A 5AVQB 3E6FA 2HKHH 2NR6C 1YYCA 5PCYA 5D1ZI 2CRMA 1TNMA 1CDUA 2KDGA 4OJFH 3GHEL 4RWYH 1S9YB 1AO7E 1X5HA 3K6FA 1GMEA 2ENPA 1P7BA 4TN9A 2NYYD 5D71H 3AG2B 4S0HA 5T8IA 3DO7B 1BFVL 4DGIL 1AH1A 1V05A 3VRLF 5I1DA 1CWVA 2WGXA 1J1XL 3ARDD 5HYIA 1SN0A 2R39A 3S8GB 2UY7B 1Z9NA 4FLQA 3ZKQD 4J7RA 3QGVA 4I18C 1RP9A 4HHWA 4JDEA 1UWEH 5BPPA 5ID1B 1LE9B 3P73A 1OAKL 4QKTA 4DVBA 5J06A 3SPCA 1A6ZA 4OCMC 5HGAB 4L3FA 3RFZA 4ABUA 3QUHA 4KQ0A 2FEJA 1MVUA 4RGNC 1D7CA 1PLAA 3TBCA 2IQ9H 3DGDA 2A74C 2WQWA 2QKIB 3D6GA 2WO4A 4KJWC 4PJXE 2UXTA 5ADPH 5IV2A 3GXTA 2V7HA 5E1AB 3R7QA 3B9KD 4ISVB 3ZDXF 5HHPB 3MV11 3CFQA 1Y18A 1AHWA 4ZMYA 4OAWB 2DYPB 2F61A 2L3BA 5KSBA 1MAKA 3MNVA 1XCTB 3MKKA 4JJ5A 1BG1A 3PFUA 3K8MA 25C8H 2A6IA 5A6MA 3GSVB 5LGYA 3QJHA 4LDCA 4AEHH 4F37F 2DMKA 2MH4A 1UJ3A 3IDIA 2WCSA 4P9HL 4HISA 4GP4B 4HLZG 2V9TA 5JXEA 5BS0B 3LDBB 2C9QA 2EE9A 5DZ9A 1K5NB 1B4LA 3ILDA 1X5YA 4N5EC 1BIHA 5IUSA 1N26A 3A0OA 5ACMA 2WSPA 1UYWL 1BBJB 3H8NA 3BFQG 2IAAC 1J88A 1WAPA 1MQKL 5IM7A 3AXHA 3Q43A 3HHSA 1A3RL 2YSTA 3HZMA 4PY8J 3TEUA 4MDIB 2ZXDA 2VQUA 2XC8A 1PIGA 3JTSA 1UM5L 4XB7A 2ARJB 3ZHDA 3PDDA 1URZA 1OAJA 3FSVA 4AUUA 1FFTB 4OZHF 4JZJB 4OCWL 4KXBA 3EDFA 1BYPA 2R69L 2OJZH 4ZZFA 4PJEF 1I3UA 1QW8A 3FBQA 5IG7A 4R0LA 4X6EB 3L9RB 3QDHA 3Q1EA 4XZUA 4FQJL 4O4YH 3JTTB 3MXVH 1QBMH 5HDRA 3SGDI 4NZJA 3UFIA 4NLHA 1RL1A 2WM0A 5FHBH 1CFVL 3K6IA 2WMPB 3IDNA 2O30A 2GTWA 4XC3H 2NX5D 2IV9A 1OAZH 3L16A 3OMAB 4URTB 3BEWB 5BQ7B 2IH9A 2HSIA 3HZYA 4L8SB 3GBML 3WSQH 2G4GA 2F7OA 1YQVH 5FIEA 1IX2A 3EYQC 1SDAB 2Y5TB 3PWJB 3V4UL 4RQQA 4CBZA 3BWSA 1L9MA 2K8QA 3D34A 2CKBH 2AEOA 2Y6SD 3WI9A 3T2PA 4WI3A 4DZBA 1T21B 1EHKB 4K2UL 5T1KA 5CD5C 1CFNA 5EEYA 4F7TA 2PP9A 4YSOA 2ZAGA 1BQRA 2VMFA 2DKSA 1N67A 2KC0A 5A2LH 4MWFB 4LSSL 3UTQA 3FTZA 4XO8A 4I89A 4UBDD 5C08B 2J8UB 2ZYRA 4HXBL 1FFOA 4LRIC 3GBDA 3MACH 4JW3A 5GRJH 2WB7A 3Q9PA 4RA0C 4OM0L 5T33H 5KYUA 5AZ2H 1T4KA 1J18A 5DD6B 1YEIL 2Y7QB 1ILUA 4B60A 1ZLEA 4JX0A 5KSBE 5T3XH 2XG4A 1RIVL 1A1OA 1PZ5B 2KPWA 2V2XA 1G9HA 4H1LA 3LH8A 4RMUA 3VXPB 3MV01 1IAOA 3HS9A 4B53A 1V54B 2FX7L 4E41D 1QI3A 5AOJA 1XB6A 1FHNA 2BOBB 5IMMB 3TJEL 1TTFA 1ZS2A 2OQJA 5JIDA 2V9QA 2EVJA 2WNWA 3PYCA 1NCBH 3REWB 4G6JH 1DN0B 1WK0A 5DJ6A 1OAXH 3SDXF 3SPVB 4C56A 4YX2H 5CEZE 4BUHA 5LKNA 5E8EB 4JBSA 2WVSA 3GRBA 3SKJL 1PLGL 1HSBB 2E6PA 1F4XH 2W59A 4I1PA 5I0YA 5G4OA 4PS8A 3KPOB 3PGDA 2AV7B 2CA3A 1PZDA 1I8KA 3GNMH 4KQ4L 1M1SA 1T0OA 3KPNA 2AHIA 1EFQA 5JOEA 5F7KC 2JIXD 3LRKA 3BN9C 2ZG1A 4P9HC 2E76C 3GBEA 1YN6B 1T1WB 5I5MA 3WY1A 3GS0A 1A9VA 2R0ZH 3TM6A 3T0DA 2K3TA 2ED9A 2QLVB 2Z92B 5J89A 3FB7B 2WXMA 5D1ZB 4J3OC 3WFCH 3K2KA 2Y06L 4K71C 3ZE1E 5E6UB 4G8EA 1AIFB 4UV4L 3CN0A 3CZLA 3KLAB 2TRHA 4FHBD 4M7JH 1BFOB 1M05B 1GL4B 1DQKA 4LSRH 5TGBA 4AEEA 5HVGB 3ARQA 2VIRA 3L7FA 5I0WA 1GS6X 4RGMB 4X6DA 1CD1B 3TZVD 4AGQA 4GG6A 2HTKC 4PY7B 1WA0X 4YNYB 3HG2A 1UM6H 4AEIH 1OP4A 4R7NA 3TCTA 1KC5H 4IBQA 1LE5A 2WZ6A 4I18A 1J87A 5E24E 1JUFA 3G6JF 3W5MA 3RA7H 4BDVB 3QNYA 4D9LL 3NBNA 3RZCD 3OAYH 4QHPA 3MRHB 3MNMA 3APFA 2R23B 3QEQD 4MNGA 5GGUA 4AJVA 2LU3A 5BXFB 3VD4A 1YPZA 5BRQA 4EDXA 5MEOA 4K7PL 2YPVL 3O11A 1DBAH 3O8XC 2FB4L 3ALWA 4GIPD 3TJPA 3QZOA 4QXUL 3ZIMA 2FHFA 2OTUB 3H85A 5F7YC 3AUWB 4YSUA 3H9HB 3GMPA 5DD5H 3BAYA 3VD3A 5F72S 4IYKA 4L37B 1J9SA 3TN0D 2P24A 4TMPA 1CZ8L 3NIDB 5ECGA 3K2MC 2B0SL 3DHUA 5JYLA 2HG5A 1N4XH 5DUMH 2BVYA 2XWXA 3QUXC 4NWUH 2H6UA 3P1VA 4I2XA 5F1NB 3PU7A 1Q72L 5HVFB 2YMTA 1PJWA 1KTKE 1B2WH 4FFZH 1SXNA 3RNKA 4K8RH 1MY5A 5E6ZA 5IF0A 1F86A 3LN4B 3NRQA 3EXJA 4JM4H 2R29A 3HC4L 4JANA 4HCRL 5D5MA 2HX9A 3AWEA 1NH6A 2ZXEB 4PW9A 4ZBJA 4ZS6C 2X4OB 1AQDB 1CLZH 1FZJA 1MI5B 4FQIL 1WE5A 3WENA 3B2VH 2BHUA 3HS0C 1GS7A 3GM8A 4KKCC 2C34A 5EEUA 4F7CB 1OWRM 1LP9B 5MEPA 2F18A 4I0PB 5F1OB 3TESA 2IPUK 1UOLA 4KXAA 3NCJL 1P4BL 5I75C 3RP1A 2XJLA 3AITA 1EAOA 1UA7A 3OAZH 5EV7A 4WFGD 1FJ1B 4Y8AA 4NP9A 4WFFE 3K0WA 5ISZA 5IQ7L 5EORL 4N8CH 4ODXB 3MNZB 1WGOA 4MCNA 1U8KB 4ODHL 4H0HB 1DJWA 4M8RA 1XAKA 1DZBA 2ZJSL 4CN6A 3CSTA 4X6DE 1KWGA 5BRPA 4XCYB 4GG6E 3BRGC 4PVMA 4AYDC 3N42F 1J1PH 2HX7A 2V5TA 4PGEA 3WYRA 4PREA 4Z7NE 4S1QL 1HU8A 2WQ8A 3QPQC 5AB9A 1P0SE 2RQ8A 3B2UC 4XBGB 4XP1H 1PY0A 3A6OA 1NGWA 1KLFB 1ZA3A 4TQEL 2NTFB 4AM0B 4GW4B 1ZGLM 1KCLA 5DZJA 2VN7A 3BPLB 5CN3A 4BFGA 5IJVB 4MNGE 2AJZA 1YPZE 4RGNE 4GBXD 2VAAA 3L3DA 4G9FD 1UENA 4XNAA 4A2FA 4M29A 1GJWA 1BPVA 4MFHA 4ZMOA 3O4OC 1QVOA 3KGRA 4Z3EA 4PJXF 1IARB 1LNUA 1ZPLA 4LRIA 1S7WA 4JVPA 3QW9A 4XP6L 3I9GL 1N6QH 4LGRB 5HGHB 5TH2A 2C26A 3V0WH 2VOTA 1T2QL 1W72H 3V5HB 3ZSSA 5SX4H 5IQOA 1PDKB 2WKGA 4K3EH 1FNLA 1L0PA 3ZYJA 4RH4A 4D2NA 5IROD 4OBRA 4JL2A 1JPGB 3FSZA 4BRVA 1JHLH 5FFGA 3QS3A 2CGZA 2V2WB 1HL9A 3FQUA 3ESVF 4I2XE 3VGGA 3FTVA 1OZTG 3D3VA 4GAJL 1A7PH 1U33A 3RLSA 6CGTA 5FYJU 3MTRA 5DMKA 2GC7C 1T6WA 2BSTA 2AVFA 5DJ2A 1G7LA 1L0YA 4BQCA 1A7OH 3HMWH 5E9AA 2AS5M 2J88H 3O3EA 3H4HA 5D5ME 1J11A 3EYOA 4QRBA 5IESH 1KXTA 5DJ8B 3W0WB 2AERT 3LRGA 2BIQA 4U6VH 3U7YL 4E0RB 1GYVA 1T1ZB 3D39E 4HKXA 3VAEA 3B9EA 3U6XA 4WUKL 4C4UA 1I8MB 2HJFB 4OFDA 4N8VA 2WZPA 1ZWIB 3IDJA 1M9SA 3VDCA 3FQWB 2L4OA 4MMZC 5EUKB 1K6QH 3MLTB 5T3XD 1T0MB 4P23D 4N28A 5F93C 1PTZA 5ISZE 5JXED 5D7SH 1SFDA 1KOAA 4ODVH 2BIOA 2NQCA 4FZEH 5I6OA 4L4JA 3KEDA 2BDNH 3C6LD 4AZUA 4WTQA 3HLAB 4ZFOL 1X7QB 3S98A 3MRBA 2ZCKH 3DRTB 4TVPL 1A7RH 1EANA 2MNJB 2AF2A 2R69A 4RA3A 5D93C 2NZIA 1MAMH 2YSSB 2OLDA 3KEHA 4Y1AA 3DROB 4LHUA 1NC4A 5B39B 4CBPA 3C12A 4KTGA 3IRCA 5TD4A 3DX9B 2DJMA 2FEEL 4XBPA 4KZ0A 1P1VA 3VU2A 3ZOAA 4YHOH 3GMRB 4RAHA 2CBTA 4GYBA 3WNMA 2APVA 2EE3A 3DMMC 5TPWH 3BKJL 3BKYH 2VWEC 2BNRD 4QY8B 1FAIH 3O8XA 3QXTA 1KFGA 5DYOB 3WIFB 4EZLA 5A2IH 1DFBH 4XN4A 3T0EC 3T6XA 4Y89A 4R90H 3MUUA 1ZLSH 3O2DH 4UM9A 2EO7A 1FN4A 2YARA 4BFBD 5EOQH 2FJGB 1XEDA 3FF7A 2CK0L 2ZCLL 3CDZA 3R06B 4IGBC 1RJLA 1FFNB 3FUHA 1U41A 2ESVD 3ZTEA 1DBBL 4F2MB 5IOPA 3W38A 3GS4A 1F02I 4FTVA 3DARA 2C9XA 3TA3B 3QUXA 4BH8A 5BMFH 1QWNA 15C8L 1OPGH 1L5GB 2G5RA 1GZHC 2N3JA 1DJSA 2YKLL 1GYAA 2IIJA 2ZOUA 3D3VE 3FYEB 4G7YH 5K9JL 4MZ2A 4JG0L 2BCKB 1M9WA 4NJ9H 5EZIH 1KBWA 3X1FA 4BFJA 1IC0A 2MOVA 3MJ9L 2CHZA 4H2CA 2HJKB 3K4ZA 1QSFA 3LKSB 5JW4N 1WLHA 1ZK9A 3FQXA 2UXFA 4AJ0A 4NUPA 1V3KA 2GW5A 4HIIB 1CLCA 3KDPB 2Z8WC 2CHWA 2G2RB 3P77A 4ZOAA 4OLZH 3EUDA 1U8PA 3L3OC 1KPVA 3IDMA 3GFUA 4PWKA 3F62A 3QSKB 4JLRA 1KY6A 5JDSA 1ZKAA 4B3EA 2C1PB 2E9GA 3BH4A 2W5PA 3DSFH 1UQSB 5L8JB 1DQTA 3B1UA 3LXBA 3NFSH 2BP5M 3GLZA 4Y0GA 4ZODA 5EIQA 3S4SB 4TVUA 2BC4B 4Z7OE 5KTEL 3GKWL 5CIPA 1FORL 3OLGA 5I6MA 4OFIA 3BAKA 3X2QB 1CF8L 3O3BA 2ALAA 4MJ5A 3S96A 4ESKA 2IG2H 1BOGA 5FM4A 3BFOA 4X9BA 2CLRB 1KDIA 1WD9A 3AWFA 2D8KA 4B50A 1KXVC 5DA0B 4IOSD 1MFBH 1V27A 5EPMB 3SE9H 3V5DA 5C97A 2V3EA 5I6NA 2DDQH 3X3GL 1SVZA 4G1MA 2M2DA 3ILQD 5IW6A 4KUZH 4JFFB 1FL3B 1WO2A 5DC4B 3S88L 3V7AG 5IGXH 2WW8A 4Y1AE 5ANMB 3UJJL 4XAKD 2E8ZA 2C9VA 4KV5F 5CSGA 1J0JA 2GY7B 4AQ8C 5LNGA 3FQRB 2NZ9D 2IQAB 3G9AB 3IYLW 4RNRA 5DS8A 5FCSH 5KYXB 3U36B 1NAMB 3GO1L 1MF2L 4NQDB 3N41B 4JQVA 1BWMA 1LD9A 4M7LL 4GSRA 4M3HA 3TF4A 5EA0L 3KCPB 4DP9X 2FL5A 1KTBA 2CXGA 5FYLL 1JN6B 1S2EA 3M7FB 2A6JB 5CEYA 3QIWC 3U25A 5DFWH 1IGCL 2E6JA 3P3RA 4IU2A 3MCG1 2BW5A 4Q4IA 1RHFA 2R56H 4XCEA 3QZPA 4JN1H 4P5KA 5E6IA 2O5XL 1MFMA 3IRZA 5CUSL 3DXAD 4YDJB 3G04B 4RISL 3DUSA 1TTCA 1UG9A 3VH8B 4GRMA 4I13B 3P54A 4OIBA 1HIMH 5EN2B 4BFFA 4ODTH 3H3PL 4FTVE 1WFIA 1X7TA 2V2TA 2YPLB 4DEPB 3MBEB 1R3IH 3GZQA 3Q6FB 1IBHA 2BFVH 4XVTH 4M6AA 4HUUB 1EFXD 2A6KB 4HWEL 3LQAL 4X8JB 2XPGB 3WL9A 2Z1KA 2RFXA 1U91B 1VGKB 4HBCL 1A25A 3FO9A 4M7ZB 1P4LA 1QR1A 2AEPH 2NNXA 2PXYB 5CWSB 3ZDXB 3C8KB 1JRHH 1TZOA 4KXDA 3SQOL 3C5SA 1DVXA 1DEEB 2ADIB 4D94A 3O6FC 1TXKA 1OAUL 1HCYA 3GHPA 4W1TA 1DLHA 1GIGH 2BNQB 1EHLH 4XMKH 1BLIA 1F00I 3HB3B 4F57H 1FNSL 2X4QA 2XZAH 3PIQA 1UM4L 3NJIA 4I4WA 1RZ8A 4Y4FD 5D70L 2WYHA 1JGLL 4GRWB 4QUOA 3P2TA 2VE6B 4X5WB 2AJUH 2VH5H 4XP4L 5JHAA 4PFEA 2EO1A 4I1NB 4L4TA 2HJLB 4ORGA 5F89B 1RURH 1JHKL 4HCRA 1RMFL 3CDGB 1D3CA 4KI5D 4I7ZC 5HDBE 4ZRGA 3UP6A 3II2A 4WWOA 3X12A 3EXLA 3ARXA 4OZHB 1JVOA 1IJNA 4DKEH 4Z7NF 4NKQB 5LGKA 4YFDB 1WICA 4MTMA 2OI9C 1OSZA 3BHBB 1F4WH 3B37A 5M7QA 2DBLL 1UB6A 4X7EC 5DRXB 5MP6H 1IZJA 5DC0A 2YAFA 3DNKA 4JZNB 3O3DA 1NFDA 4YFEA 3ULUL 5H4YA 4FCHA 5D1XB 1OE3A 3OGCA 2NXZC 4KU1A 1BGXL 1TJXA 1YPZF 3LIZL 1ID2A 4UTBH 3NSJA 2L0DA 5FX3A 2P7TA 1GSKA 1G7JA 4EQ2A 4MAZA 4K9JA 4QCIB 3UZVA 1MDTA 5HJ3A 5T5FL 3JSSA 2G5BB 1TVHB 4KH2A 4R84A 3T0EA 4TLKA 2OXHA 1M3IA 1TFPA 3W9DB 2BX5A 1N8ZA 3NN8B 4HKJA 3BISA 4A37A 3DVFA 4JFEA 3QNZB 2ADGA 3VGEA 1DDHB 3I3DA 4IGBA 1ZTXL 3L3GB 4MBOA 1N7ML 1R24B 3ARUA 1Q9WA 2ZOLA 1VKXA 1XF4B 4Q2ZA 4QHUB 1CGSH 1Z5YD 2ZCHH 2EIKB 4J3SA 1RK0A 1GZHA 1XGUA 3X1GA 2PWHA 3UTTA 4IS6B 4WI0B 2ZPKH 4HU8A 4UOQA 5HYSA 3JBG7 4LOVA 1TEYA 1QFHA 3NJJA 3S0PA 5DJAA 3MRGA 1Q1JL 4MD4B 3QQ4B 5D5MF 4B9ZA 3HR6A 3U7AA 1SHSA 5ITFA 3VXOB 1XBRA 4W6WB 2FH6A 3QEHB 5I16A 4Y5XB 3BUBA 2QGDA 2VZ1A 1B0IA 1CDIA 5TE7H 2PF6A 4JVWA 3RKDD 1GGCL 3L3OA 3NDZE 1JERA 1WC7A 3GSUA 4V1DA 3BRFA 4UIMA 2EDWA 4OD2B 2F5BL 1JBJA 5DVMA 4RCAA 4U6HA 2K6WA 3B7TA 2MQGA 2OMUA 2D7TL 3LQAC 1KB5H 4PJHA 3V9EA 1YJDH 3EBHA 1SY6L 4OJYA 2O6DA 5C0EA 5DJ0A 1M2VA 1FH2A 4IDJH 2OR9L 4NQEB 4L4TE 2Y36L 4FQHB 3BDBA 4U3XA 3QQDA 4EOWL 4OCSL 5LBVA 4DHLA 1EZVY 5LDUA 1J0KA 5HVHC 1CL7L 5C2UB 1NIDA 5B7EA 4HF5H 4ENED 1BZ9B 2ZICA 4Q9CA 4WF7A 3FBKA 4Y2DB 1KXVA 3SYCA 1YAIA 1S78D 3QIUD 5ABAA 2D3VA 4CSSA 3QAZB 3R19A 2H6PA 2WIIA 1F11A 1GYCA 4NC0B 1S46A 4OCXH 4JHAH 4NQVB 3ZKND 1NCAL 1OY3B 1OD9A 1S9XA 4IRSA 1ODUA 1U0QA 2R0LL 2E4TA 4AQ8A 3WNNA 1NFDE 3MREB 1SDDA 1GGTA 3NJLA 5T1MA 2CJTA 3KHOA 4Z8FH 2Y1VA 2X4RB 2VWEE 3FTWA 3HVNA 3MNWA 1Q0XH 4BSVA 1MCSA 2ILLA 3BAIA 3L9YA 4ZFOA 1W0YT 5HPMA 4IJTA 1KWKA 4FDWA 3QIWA 4P59H 1L6ZA 3T0EE 2NY5L 3DOSA 3OHXC 4NC2B 2Q7YB 2HLFD 4WCYH 3T65B 1FGVH 1U8CB 3SOBH 2H9GB 2X4UA 1C12B 3OKOA 3RWJA 4P5MB 4ZFZB 4JFEE 4KUCD 2ZUQC 5BO0D 3IETA 3MBWA 3G6JB 2P8LA 3L1OL 3ULUC 4L3ED 2IQ9L 1LMIA 4J3XA 1B4RA 1VIWA 4U1JA 1JF5A 3TPUA 2DWEB 3AQYA 4LPCA 5BNXD 1TVBA 4XNMB 2AAAA 4NZDA 4Q6KA 5CJ5A 3EFFA 1LO0L 4YSCA 1MHCB 5GISH 3UTTE 3FTGB 4KNUA 3MV8A 1SQMA 4HEPG 4ZAKB 3NT0A 4LVHC 1KTCA 4BA8A 5CLYA 5E6YA 1DCEA 1OCRB 3WHXA 3U0PB 4BZ2L 3ZL4L 1JWUB 2WXQA 4U1KA 4JL1A 2VLMD 4OGYH 3UG5A 2J55A 2WWKT 2P8PB 4OGQC 2AJSL 1QRKA 2Q3AA 3BGFC 3O6FA 1HH9B 3P40A 4P06A 4ATWA 1LGVA 3T2QA 3HS8A 1NBCA 4LAJH 3FUJA 4V1DE 2CHNA 3HN8A 3MR9A 1RAMA 1O5PA 2YWYA 3O9WB 4ZYKB 1K4CA 2OK0L 1DJGA 3DPBB 5AYTA 4PJHE 5CNHA 1I3RA 1E9OB 3P30H 1YNKL 3SKNA 4L4VA 4JHBA 2XFXB 1B0GB 3EHBD 4Z7OF 5GQBA 1TO4A 2DTMH 3MJ9A 4J3OF 5BJTB 1CTOA 4PBDA 3K4AA 1RPUA 3BQUD 3JXAA 4NI3A 4YC2B 1S5IH 3D52A 3EDKA 2CR0A 1QSFD 3IGUA 3UTZA 1YMMB 3SD5A 4IOIA 4XNYH 4ZG1A 1A8JH 2A9ML 3JWOC 2GHZA 2LW3A 4JY6B 1W0VB 4IBZA 4UTCA 1IL1B 1UZGA 2FJHA 1P5UC 4O4YL 3SY0A 3W82A 3WXVL 2L8AA 1OALA 4A7UA 4HJUA 1DZ0A 4LHQB 2N4IA 4FXKB 2K45A 1SOXA 3P2BA 2FYVA 3HZVA 4M8QB 1E4JA 4ZUVA 1OAZL 3VXRD 1SJXA 2WQVA 5FEBA 1TCRA 1RUPL 4XCFH 5TE6H 5HDLA 2ZXCA 3GSRB 5ESQA 3W9EB 2CDFA 1AVAA 4YBHA 3RZCC 1YQVL 5HD8C 4GSUA 5L4JA 2AQ3A 1FZMB 1V5JA 1TPXB 1A6PA 1ZMYA 4W9HC 1A0QL 3C9NB 4LMQE 3TEZA 3SKMA 5KZCB 2DWDB 2I7SA 4FQXB 3HAEH 2YK1H 4ZW6A 3KGTA 3BIBX 1AS8A 3QT2A 1SJEA 2EEDA 2Z8SA 4OCRH 5DT1L 1OCCB 4FG2A 1UC6A 2YGQA 4O2FB 4WWID 4ENZA 2HKFH 5AKTA 2ED8A 4WO4B 1KMGA 3LZFL 2GK0A 2PW1B 1OGSA 2NPLX 3CDCA 1ED3A 3QXUA 4FQLH 1GC1L 4X98B 5FUZL 5A43C 3OR7B 5EEZA 2J6WA 5GRJL 3MACL 1NPUA 2NY6C 3QZNA 1J10A 2EDFA 1JV5A 3ARED 5J6HA 4YSPA 3MV8E 3LN9A 2I9TA 3AM8A 1VDGA 1TQVA 3NAAL 4PCSA 1U21A 5T33L 5AZ2L 4QOKA 5HHXH 2NY5C 3CFEA 2VQ1A 4JG1H 3B6SA 2YAMA 3WCYA 4DOHB 4GO6B 4DGVL 3GUTA 4Y5VB 4W9FC 4E9SA 4AV0A 5E6ID 1XGTB 1HN1A 2K7QA 3CHXA 3GSOB 5AAWC 5L6YH 1BVLA 1CVSC 2F08A 1JV2A 2XTLA 3C60C 2CRZA 4OJAA 3VFNA 3AROA 5AW9B 4U1SA 2VNCA 3BP5B 3QHZL 3OKLB 1OAXL 3Q6GL 2QV4A 5I1LB 4Z5RA 4XXDB 1TZ8A 1ERNA 1BBDH 1R3LA 3D18A 3FFDA 4L4VE 4R4ND 3KLKA 5G5DB 5KVDL 5CGMA 1KIRA 1J0YA 1U4FA 4HJGB 4XWOC 3GBLA 5KYNA 4GLRI 4G11A 5DD3H 4WSGA 5E2JA 1FG2A 4ZQKA 4DJMA 5I1IH 1DUZB 2JLPA 4Y4HB 3FUKA 3LD8C 1H8LA 4RFOH 4KRPC 4OQTH 5HDBF 2GSIB 2FATH 5GZOD 2XRAL 1NFIA 1AI1H 3KR3L 2YWZA 2WQAA 5K69A 4TLUA 4JFQA 5D2NB 1CPUA 1TMCB 4J12A 4U1IA 1LO4H 2KHAA 3QEUA 4NQCD 1M7IA 1GYWA 2XN0A 3C5JA 4YHPA 1KV7A 5DFVC 2G3MA 3CLWA 3HG1B 4KQ3H 1J8KA 3ASNB 3DURA 4JR9H 4FF9A 4M7JL 5I6KA 1YAZA 5J13B 4YBLC 5B39G 3V52H 1BD2D 5E5MA 1MHEA 1U3HD 3CV5A 2X38A 1G7IA 2X4NB 2R4SL 2VM9A 5EU7E 1FV1A 3IWVA 3KVQA 2WXNA 4NN7C 1XH3B 1GW6A 4K5NA 8FABB 3SGEI 2BLFA 4NC1C 3CVHA 1UKSA 4JZOB 4HUXB 3OHXA 3A24A 5DVNA 5DHYB 3BIAX 4N20A 1NDMB 5LGJB 1MCLA 4G8GB 1A7QH 4GXUN 1N5YH 1J12A 2GITA 2ITFA 3I84A 4X4XA 3NSDA 2XQYA 4FA8A 5J0BA 1S9KC 4KC3B 4PWJA 1UKTA 2V5YA 4MKTA 5DMGD 1QLRB 3DYOA 2AXGA 3LIZA 3POCA 5FO7B 2TSAA 2G3XA 3D69B 2DQJL 5EC1A 4LLQB 5FYLE 1G9NH 1YEEL 4OF8A 5CS7A 4YFLF 2AQ1A 3MRJB 1N2RA 5T5FA 5DGRA 1HEJC 4U6YB 1PMYA 5AOMA 3I9PA 1OE1A 3KDMA 3W39B 1HWWA 4LQFL 4DEUA 1CBVL 3L3KB 1N4XL 4X7FC 1XSJA 5DUML 1BX2A 7FABH 2CRIA 5KN5B 4WW1A 5FYKD 3WHE0 5J6GA 3CC5A 5MHSE 4NSKA 1GC1C 3VQMA 1R3HA 4MJID 4ANXA 1DE4B 5G4MA 1ZHBB 3DBSA 3GSXA 4HAKA 4K8RL 2H1PH 2R9HC 1HSAA 2XSKA 4Q9QL 1WA2X 3IXTB 4YE0A 5EF2A 1GZPA 2IPKA 2PPEA 1QWHA 4JM4L 2IFFH 5ERWB 5I17A 2GJRA 2VCOA 2VTFA 1CE1H 5KBDA 4HS3A 1R3KA 4P23C 4QNPE 1YDPA 5EU6B 4LCWA 3RY5A 1IGFH 3BYTA 4KFZC 3CSYA 2VXQA 1I7ZA 2NUTA 1CLZL 2ARWA 4E36A 3S4SG 5CFHA 1WYJA 1QOKA 5FDWA 1X6LA 1Y07A 4NENA 4APXB 3GJFA 1I85C 1NDGA 5L2KB 3KYKH 2APTA 3AU0A 4KJYA 3OPZH 3F6LA 3JT2A 3PWUB 4I87A 2X44D 2QFRA 5BW7C 1KTDB 2Z4QA 2ZUTA 1FZOB 2Y7MA 1SY6A 1NFDF 5JTWA 3DJ9A 2WXLA 4GEJA 2OMZA 4QXTA 4D9QE 2DAVA 3VXMB 1R5VB 4ZO7A 4MMYB 4AV4A 4TSAL 3ZKXC 4MB5A 1FE8H 3QYNA 1KJ3H 4D9RE 3EGXA 3H6AA 2A38A 4WFHD 3LH2L 5J4MA 4JFOB 3EG9B 3VFGL 3VVVA 3E2HB 2XNAA 1FDLL 5D96C 4JPIB 4LGPB 5IB2A 4DW2L 1IILE 2BFGA 2LT9A 5HBBA 4I9XA 1UWFA 2ZXGA 3P9LA 3UBFA 4Z78A 4ZDHA 3NJVA 4WVRA 2E27L 4F8LA 5F9JB 5HYJA 3ULUE 4DEWA 2XA8L 5IEKB 4IRSD 1M57B 1N6VA 4M5SA 4JE4B 3VH8G 4DAGL 3LKQB 4OFVA 5HGGS 2Q8AH 3A4FA 1G7QA 1ETZA 4EEEA 1KEGL 1QNZL 2DQTL 3L2LA 2QMKA 2AKRB 1IVTA 1J1OL 4PJ7E 5JORB 1G9EA 3V0WL 4JHUA 1IQDA 4L1SA 4OLUL 3HC0B 1G7HA 1GR7A 1KTLB 2C3HA 4MYPA 1ZXKA 4N2BA 3EJUA 4H26B 1KJ2L 2JK5B 4FEIA 2VSKB 4AQ1B 3GT6A 3HE7C 3FH8A 4PB9H 2NLJA 4JFXB 3EH4B 2VXSH 4UMSA 1JHLL 1MCOH 1QATA 1TVDA 1X5MA 1LEKA 1T0PB 1T1YB 1ZTXE 5FW6A 5I1KH 1BQ5A 4KTEL 1XL4A 4KO9A 1S3KL 5AAWA 1ODAA 1EAPB 3C60A 4Z76A 1QFWM 4RRPA 4IHOB 2DQGH 1EPFA 2VDNB 1NGPH 2Z35B 4KI1A 4PJHF 1ZLWH 1A7OL 2G0LA 3HMWL 3QHFH 1FVDA 3I85A 5CFAA 2AJVH 1LL1A 1X7SA 3CLEH 4LCYA 4BZ2A 3P3SA 1KB9K 4FFVC 4U6VL 3K91A 4BFKA 5F1SA 4PTTB 2R7EA 5KOVC 5DO2D 2IAMB 3QIBB 3G5YB 2C7FA 5BZDA 4GKOA 5DEGA 2BVOB 5JHDD 2F8XC 1YY9C 2UZYA 1H3TA 4OF3A 1Z7JA 2JKSA 2ZWYA 4ZSOE 3MV9A 3FN9A 4WENB 5DCCA 4CSPA 5F7EL 2PYED 4FJYA 1L7TL 3VTMA 2PCYA 2WO2B 3ARZA 3MLSL 4YBQD 5DJYB 1BMWA 3ME0B 4JKKA 4K8RC 4P46D 5MEQA 5IB4A 4ANVA 4IMLB 1K2DA 4RAVA 4ODVL 3HR5A 1JGVH 4FZEL 3L3JB 4X7SL 1JTOA 3F64A 2RALA 2OW6A 2VDOH 3ECVA 5KAQG 4GUPB 2X28A 2X6AA 5GIRB 1A7BA 4G71B 2QDVA 4HIJB 5ADOH 2MKWA 3H3KA 4DKFH 2X4TB 4AT6A 1EAJA 3FL7A 4TSCL 3ZVVA 4Z7AA 4M1CD 5KSUB 4ZO8A 4XPGH 1I9RH 1AJ7H 2JELL 1FPTH 2OZ4L 2BXYA 3A23A 3Q8CA 1EXHA 5DEJA 1UWXK 1JCVA 3CXHJ 3VFUA 4N4YB 5I26A 1N64H 1ET5A 1QA9B 2CNZA 4FERA 3B1TA 1ZGLA 5I73C 3PG2A 1AE6H 1E2VA 4P0DA 2XZQH 5KSAD 2KERA 3OB0H 3LEYL 5HYJE 2VDKB 3L7EA 4S1RL 3D9AH 3RX9A 3L1FA 1FYTA 4MNQD 5F9OH 3NCWA 4MCYB 3MLZH 1TZHB 2CCVA 4B9GA 5D7LD 5ABZA 4F8QA 3KL0A 4JPWH 3BJLA 2WOBA 4R90L 5K93A 3VM5A 3EOBA 4Q6IC 1XVSA 5E95B 4DGYL 1MCHA 1A6VH 1E42A 1CCZA 1ORQB 3IPFA 1CFMA 5SWZB 3JV6A 4WWKD 4AQEB 2X7LA 3KS0H 4MD0A 4H8VA 2YEZB 3TBWB 2IDTA 3QORC 4W9LC 5FWRA 5IQ9A 4YHNA 4WNQA 3FRUB 5BQDA 4G8IA 1G5GA 4LF3A 4CILA 1A6TA 2BZDA 3CDYA 3ZDYB 2E59A 2FWOA 2GAZA 5ICZB 4M1GL 3TP4A 3QCUH 4XVJL 3VTAA 2PCPA 4YWGH 2Q20A 5EZIL 5CEXA 5MENA 2WINB 1XF3A 2XX0A 1NJ9B 4XN8A 2Y72A 3UAFA 3CZNA 3O6KL 2DKMA 3E8UH 4H40A 5ILTH 2F2HA 1WIUA 3MUGA 2HP4A 1HDMB 3QDMA 4QOKD 3EO1B 4LKCB 4ABQA 1FSKC 4UZUA 3VGAC 1FFPA 4P4RB 2FYYA 2VAJA 3L8QA 1HHIA 2VN4A 3MV9E 3MCKB 2X4PA 2H26A 3QAQA 1EHNA 1I85A 3ARGD 5HHNA 3APDA 3G5XA 3DSFL 4P5SA 3IMBA 5DK2B 3FFOA 2X9ZA 1A5FL 2WXOA 1D6EB 3FCTA 2EDQA 2EYTB 1UVQB 4YHMH 5BW7A 4X5XB 1A7NH 1F1DA 2EQDA 4I77L 4JRWA 5TF1L 2ZSWB 3BCDA 2IG2L 3SJVD 3FZUD 4HDIA 4KO6A 4KOCA 3VG0H 4U2ZA 5E8OB 1DJHA 5L8KB 3SE9L 4ILDA 4XT1C 1BPLB 1ADQA 2GJ6B 1W2KT 4KUZL 5IBTL 1RJYA 3WU1A 2EH7H 2XQBL 1E4KC 2VSDA 1OGAA 1DJIA 2RR3A 4NC1E 2Y24A 3P0VH 5C6PB 2AW2A 4JE0A 4XCNA 4MCMA 1INEL 3WV0A 3TIDB 4P2OC 3IJEA 3IEAA 4L5FL 2A77H 1O6VA 2X6CA 1EMTL 2ZX5A 2X89D 3DIVA 2P42B 1UT9A 4I3RH 5D7IA 1J5OL 1RZ7L 1FYTE 3X11B 2OR8A 2PYFA 2FQGA 4HALA 4UILH 3NSCA 4KTDH 3SEPA 3T2NH 2NW3A 1EDYA 4LLVB 1DLFH 2FGZA 4BXVA 1QRNB 5K1NA 1T5XB 4HX1B 2R56L 1E4XI 1T66C 3OPUA 4JN1L 5K33A 1Y6NR 2LLNA 4XMPH 3G6AB 4NO3A 3ARSA 2YD5A 4RMQA 4WZ9A 2X9WA 3HE7A 5HI3C 4MLIA 1E6OH 3CFJA 2Z8VC 2KZBA 4LRNL 3O6LH 2BWIA 4JFDD 5FGRA 4QT5B 3PPEA 2BFVL 3ALXA 4XVTL 3PHSA 4PJCE 1JPSL 4HUWB 3JV0A 2Q5BA 1JNNH 2WVUA 4HLEA 3GMLB 3P4OB 5MENE 3RKDC 5HI4D 4DP7X 2OTWB 3SIKA 4NM4H 2WUBH 5AW6B 2AEPL 3BO8B 4G6FB 2R2CA 3CPLB 1JRHL 5I19H 3ULSA 3RHWK 3FT3A 1UEMA 1XGYL 4ICWA 3QDME 4P5TD 3OF6D 3FHQA 2Q6WB 1Q9OB 3GMMA 5D2LA 2X6VA 4XMKL 4F57L 3MLYL 4ZMLA 2F53D 4KZEL 4EJ1C 2E74C 2H0FA 4UZGA 1N70A 4G3YH 2CRYA 3MHZA 3ZTCC 5K39A 3B7UX 3LMJL 2ITCA 3S3PA 3FFCD 1TTAA 3QIUC 3CX5J 3G6DH 3TBTB 4U3SB 1WVZA 5TDNA 4YHZL 3EH5B 5KVDE 1BQUA 1RURL 1MLBA 4P3DB 5F7FA 5ABDE 1UADC 1AS6A 4GKZB 3GI8H 3NH7L 4RIRA 4Z7OB 3RTQB 4MQXD 1WCBA 5AFAA 1WFUA 3FTSA 2H2SC 4ZMNA 4OTXH 2FAUA 5E9DA 3KXFA 4YAQB 3TH4T 1IBDA 2BNUB 4BM7A 1A21A 4NGHH 2D3JA 5AB0A 3PL6B 4L9LB 4LCWD 1OGAE 4N3TA 4X8CA 2D7PA 5B1JC 2DD8L 4OGAD 2P5EA 3KVPA 3HNVL 4XPAH 1LILA 3UPRB 3EIFA 2VXUL 1VFUA 2JJVA 4P49A 1U6AH 4KKAC 5C7XH 1O5DT 4KAQH 5D7IE 4XCCH 1N59B 3MLUL 1ZTMA 3HC2A 4LGSB 1MFCH 1IAIH 4KVNH 1KJVA 3ZY7A 4Y19B 5F3BB 4G6AC 1BZ7B 4R8WH 2YZ8A 1GRWA 3ATAA 4UQ3A 1C8QA 4KKBC 5JW3H 4BWUA 4PJ7F 3P9MB 3K71B 2H7WA 3CZFA 3RDJA 5CMAB 2IALA 5IBLC 4ZTOL 3V0AC 5KUMA 3QG6B 4JO1H 3IF1A 2BVUA 3CG8A 3PWLB 3FUMA 5HGDA 4BUQA 3EF7A 5DZNA 3SDAC 4AVHA 3QORA 4RLDA 4LSVL 5ES4B 3D30A 3GKZA 3OSKA 2ZCHL 3MRKA 4P4KA 2WLJA 1HXYA 3EYSL 2VDML 2IANA 3OKDB 1EA9C 3LZPA 3MX0B 5TDPB 4E9YA 4HZ1A 4XHJD 2ZPKL 4UZSA 2AXJA 5DRZA 4AL8L 5FGCE 3S6CA 2HRPH 5DI8A 2EVHA 3DJRA 1PSKH 4HJSA 5SWSD 2ODHA 4XX1G 5C0CB 1VJSA 3LVEA 4NHCH 4U49A 3NPZB 3G5ZB 4K3DH 2YRBA 1KJ2A 4GFTB 2UZXA 2PWFA 4LSDA 3RB5A 1PZ2A 5H35B 5TE7L 3VXTB 4XWGL 5D2LE 4X0NA 3S3JA 3ETBJ 4F8PA 1E65A 1QO3B 3FUNA 3BQUC 3H56A 1EO8H 4YN3A 1KIQB 1U8LA 3IXAA 4RBPK 4ELMA 3D87B 5C3IA 3D2UD 2OYMA 4OIIH 3ARBB 3NCXA 4PWIA 5IJCC 1DO5A 1AFVL 4D7BA 4NJAL 3HS0B 4N2KA 2BMKB 1BQLL 3C6SA 2UY6A 3N0AA 4BD4A 3LHPH 4IJ3B 5H94A 3QDAA 1H5BC 5JXAH 2AQRA 1MNUL 3KYAA 1D5IH 4A2DA 5AW7B 4WO0A 2UYLB 4HJ1A 2B4CH 2AJ3B 3KXFE 3NEEA 2W95A 4YGVA 5E9DE 2J25A 1W0WA 5EBMA 4DZ8A 5JR1L 2XICA 2Z31B 3QZMA 2H8PA 2ITEA 2P5EE 2PN5A 4U3HA 4XX5A 3W1ZA 4M5YH 1QACA 2CIKB 2FLRT 4IRJC 4L1LA 4P2OA 2APWA 4X7TB 1L6XA 3SDCD 5JA9A 4ZMPA 3GK8H 4F33A 1JXDA 1XTLA 4X0KA 3BZEA 3I3BA 1DBJH 1U95B 3IU3A 1JWSA 3EDDA 3QJQB 2VLKD 3C08L 1YCSA 4X5LA 2JXMA 3GSQA 4XP5L 4GY4A 2P52A 2VSMB 1DVFD 2DJSA 3QCTH 4P59L 5CGBA 2DQDL 4WCYL 5BZZA 2VLLA 3OV6A 2ZONA 5DA4A 1FO0H 3F5WA 5AB1A 4ODUB 2OZ4A 1MWAB 1BAFH 2K78A 4AJWA 3WELA 4P2RD 2WOYA 4PRHD 1EEYB 4DP5X 3VFOA 1JPFA 5SX5H 4Z0XA 4JQIH 5DUBB 1C7SA 1DBKL 1U8MB 1LO5B 3KNBB 1EEZA 3I75A 2NY7H 5C0GB 3I6GA 1TQCB 1T0NB 1BIIB 4F7MA 3PV7A 2FQDA 1E8WA 1MSPA 3ARPA 3RURA 1UGNA 3WLBB 1ACXA 1TJIH 4JM2C 3SE6A 5E4AA 2O26U 4EKJA 5AW8B 1WWWX 3MRRB 1KY7A 3AY4C 3FOMA 5D7JB 2TRYA 4ABVA 3U2JA 3OX8A 1FRGH 4R4NC 5J3HD 5E08H 1M3JA 2GG1A 4OFYA 5EFIB 3R8QA 1A14H 4R7XA 3FT0A 4NQUA 3KHQA 3O41B 5GS0L 4ELME 3N9GL 1UCTA 1LLAA 1UD6A 2E9WA 1S9VB 4CVZA 5E6SB 4OD3H 2FWSA 2FIKB 2B2XH 5DURB 3ARFD 5C0BA 2PWEA 3MFFA 4AL8C 2HLAB 5I30H 2RCSH 1FNEB 2DTML 2PO6B 2D0FA 1OSPL 4MMZB 4F92B 4AVKA 4XN2A 3DX6B 5HYQB 4N6RA 4QDGA 3GLAA 3VFTA 3QWNA 3EO0A 4Q4EA 5L9DH 4J3VA 1IT9L 3BP6B 2DTSA 4WGVB 3KYNA 1RUKL 5IVXA 4FNPA 3MLXH 1USZA 4H7VA 4NPJA 4UINL 2ENYA 1YEHL 1VEOA 2P5WB 3C5ZD 3D50A 2Y07H 1JNLL 3OXRB 5D9SB 4M61A 2WBWB 2WSKA 5B1CA 3MMEA 4XVSL 4R2GD 2VRKA 5B1JA 4AZ8A 4HUCA 4FG6C 4R5VA 4ELDA 4ZFGH 1MRCH 5EZOH 1ZVSA 2OMTA 5TE6L 4CDHA 1IFGA 3BUQA 2IWKA 4OZFH 4U1GC 4YVNA 1BQSA 4AC2A 3GIZH 3EJYC 3RPKA 3L5WB 4Z95L 5BRZA 3BP4B 4Z7WE 4JKWA 3DMMB 3ASWA 4EBQL 4ANWA 3TO4D 3LQZA 1ZT4B 4JFTA 1C5DA 1MWOA 5FYJL 1J05A 1IUZA 4KJPD 1NMCB 1G7PB 1GCFA 1AKJA 4PR5A 2JB6B 3NACH 3S3BB 3WTWA 4ZTPL 1AR1C 3KPLA 4NHUA 4M48H 3KPMB 1KEML 3SDAA 4RAUA 4JKMA 2E7HA 4YHKH 2J1YA 2ZKWA 1PNDA 4NO2A 2AK4D 2E7CA 3UMNA 5AL8A 4OCNC 4PJCF 1EAQA 3SCMC 3L48A 4LP4A 3UEZA 3MXWL 5FPIA 3QWRA 2IWGA 1F5WA 4ZUTA 1DYZA 3DRQB 3QFJB 1R33A 5HHXL 3JT0A 3VD2A 2XQYK 1JXJA 1NPJA 1GGBL 3ARYA 4ONGH 4IOFD 3WKYA 4HSAC 2WNKA 4JG1L 3V4PH 4DTGH 5GZND 1JGDB 2G4EA 3DBXA 4HT1H 5DF0A 5EOCL 5H37H 3SODB 4FS0A 1CXLA 4L29A 4FXGB 1TSHA 3TIEB 4XPTH 5J56B 1BVKB 2Y2YA 1J5CA 1CU4L 3G5WA 3L4WA 3QO1B 3ZO0A 3TT1H 1X9RA 1JK9B 2BOCA 4CVWA 4S1DD 5DEFB 4CC0A 4YXLL 1PD0A 4UT6L 1OTTD 3BWAA 1BBDL 1Q8MA 4X8XA 2J44A 5AD0A 3VI3A 5DD3L 4BK4A 5ITBH 3NJFA 2B3IA 3FB6B 2GBVA 1H5BA 4ANKA 2F7PA 1JFHA 1Z32X 3ERXA 1OP9A 3EGSA 2YR3A 4OQTL 4XB3A 5IVXE 3T3MF 4ZXBD 3U0WL 4Q58C 2BK8A 4CUCA 1OWWA 4A63A 1S3RA 1AI1L 2J5WA 4I9WD 2YEVB 1U8OB 3HZKB 4LOUD 4PJ5A 2NMSA 1U93A 2P3YA 2XFGB 1Z1WA 4NO0B 1U30A 2UWEB 1ZE3H 3EYFA 2KH2B 3IB4A 4QRQB 3SY6A 1E27A 2B59B 1BEYH 1BXAA 1T7XA 4N0UA 3WKPA 5DJXB 3ISWA 4AIEA 4KQ3L 5E2WH 2HN7B 3LYRA 4PRDA 3V4VH 1PZUB 1HXMA 1YO4A 3GJFK 1BF8A 3PAZA 5D7IF 1B0WA 3V52L 4AUYA 3RVVD 4XMXA 5E4OA 3SBWC 2COVD 1XHHA 3E9TA 1B2YA 1CICC 3QUMB 5IW1B 5BRZE 5B1KA 4BKLB 1R6VA 1ZT1A 5C07D 3AQDA 4XNUH 5F21B 4NRYA 2HFFA 1WSST 2I24N 2TSBA 4FABH 2X0UA 1ND0A 4HAGA 1PKQB 2B1HH 3F7QA 4EKXA 5I74C 4D8PA 1SM3H 3GSWB 5CSZB 4TULH 5IFHL 4PJGB 5CJQH 2E6QA 3GB7A 2ATAA 3AS1A 4NZUH 1BQHB 2EC9U 4DF9A 4XNBA 1Q1PA 1JZFA 1WHPA 1U8JA 3QH3B 3PWNB 3TTYA 4FG0A 4L5FE 1XGZA 3IU4L 5ALCH 5E2VH 2Q8BH 5C8JB 1B4JL 2ATPA 1KFAH 1NZRA 3EFOA 3ISYA 4F20A 1WF5A 2B5IC 3LPPA 1Z0MA 3O4LB 4MA3A 4WY7L 4KDVA 1I1YB 3PNWB 2UV3A 4JM2A 4NI6A 1Y7VA 1F13A 2C1OB 1BVNP 2CO6A 3QZLA 2QEJA 1HOCB 3VW3H 4QHNB 4W6YB 3AY4A 4UDUA 4WW2C 5DFTA 7FABL 5JUEH 1HQ4B 3KPSB 1MIML 5D2LF 2A6DA 3IJ9A 4LO9A 5JA8B 4XNZC 3EJZD 3GM0A 1NC2D 4FNLH 1J5IA 4HP5A 3HG5A 2YD9A 5I0DA 4ICXA 1DQIA 3PGCB 4OZGF 2ICWJ 3JUZA 4N90D 4IKIA 1JZ4A 4PCKA 4QXGH 1EVTC 4YSRA 3U83A 3BIKB 2IAND 3CH1B 1XGQA 1W91A 3VI3E 1INQA 2F54B 1TOXA 1RULH 1IGFL 2YZ1A 3MRQB 2ICEC 1R5WA 1JOIA 3C2AH 4FTDA 2VLRA 1D9KC 4OZIA 2VN3A 2BERA 4AIXA 1AP2B 1O7DC 3ZKMC 4LVEA 1KIPA 4Y5YC 3UL4A 4F7PB 3FRPB 5KBMA 2CO7B 3D51A 3B3IB 1J8HD 4YHIB 4PJ5E 2DMBA 4LLWA 4G8FB 3IJYB 4Y2OB 3E7JA 4M9OA 3IDGB 3NCEB 4N0UE 1D2PA 4NX0A 2R2EA 4MDJB 3QG7L 4HKZB 5JQ6H 1CGUA 1MPAH 4PG9B 3ARDB 3K8KA 2Y3AA 2FVNA 3H55A 4X80L 1I4FA 3NCBB 2AQ2A 1A1NB 4DP1X 1X5KA 2DEYX 5HHME 3VQ1C 4U0QB 1NEPA 3O2WH 4O02H 3MYJA 4JCMA 4C4KT 1G1KA 2BSRB 2HMID 3LN5A 4F9LC 4K3HA 1CL7I 1PG7L 4ONHB 1CDJA 3RVTC 5HY9A 2MCPH 4P2QA 3RWGA 4XMTA 1EQWA 3M8OH 3DHMA 4HGKC 1NOAA 3U4BL 4HFUH 2EIEA 2MCG1 5AVSB 1QSEA 4NM8H 4B0MM 3B9KB 1NCTA 2EXTA 5EZJA 1ZV2A 3T3PF 1JZGA 2N7SA 3H9SD 4JVUA 1QKZL 1MLCB 1NGYB 5DHEA 3CCHB 5EO9A 3SCMA 4X9FA 3QXAA 4NZTH 1JZ5A 4GUQA 3TNMA 2LAGB 4L8CB 3LNDA 1KCSH 1NBZB 1NEZB 2AZAA 4HV8A 4PYHA 1M7UA 4PRPA 3P4NA 3VXNA 5E1GA 6PAZA 5I1EL 4GQRA 3Q8AA 1AGDA 1Z9SB 2P9RA 1Z5HA 4D0DB 5T1DL 2ZWZA 2VN6A 3O45A 3RRQA 1A9EB 5I1KL 2FEDC 2HA1A 4OLEA 4JRXE 1HHGA 2A9NH 3IFLL 1L9PA 1YSOA 4JO8A 4NFCA 3SE8L 2V8LA 2XKNB 3BAEH 2QKIC 5C71A 4ELMF 4TOYH 7TAAA 4HC1L 5CZVH 3H0TB 2FX9H 1IQWL 4KI5F 3SYAA 4YSAA 4X4ZA 4FFWD 2FJFB 3TH2T 4MXWL 5FR3A 2AJVL 5CLTA 2QVTA 4NQCE 1OARH 1TCMA 5CZKA 4GMSH 1QPXA 2HVBA 2VLRE 3CFBB 1Z5LB 3BVWA 3VYNA 5GGSA 4XXWC 3VXSA 3ZJAA 5JNYA 4OZIE 3UYPB 1XD1A 4CKQA 1EXUB 4MD5A 5T3ZL 4KK9D 2QR0B 1WJ3A 5CP7A 3T4AC 3HUJA 1RUAH 3ZT7A 4Z7QB 2YGVA 1XIWD 3FZUC 3LV3B 1MFEH 3G5VB 4ONOA 5HVHB 3IFNH 3LDBC 3O2VL 2XVGA 2NX5B 1W8NA 4HS6B 3UTSD 4K94H 3S34H 2UXGA 1IC4L 1IGJB 1MJ7L 3PXLA 3UJIL 3STLA 1A9BB 2O6CA 5IW3A 1Q9LA 1UD4A 2BH0A 3ESNA 2EIBA 2AV1B 2ERJB 4N86A 4Z7UA 3A6BH 2PETA 4ZPVA 5C0BD 4E9QA 5IZ7A 4A6YH 4M02A 4U1MA 3THML 4JZJC 3SBWA 2OMXB 4M1DH 1CICA 3FH7A 3EOTL 4XPGL 4Z7WF 5IFJB 3L5IA 3I02B 1AJ7L 3CBJB 5DYFA 5JLZB 2YUZA 4Z0BL 3IK2A 4L3CA 5HHOD 3V4LA 1RZIB 2VMDA 4WEMB 4EI6B 3BZFA 1SOKA 3PHAA 1QSZA 2ZOOA 1RIHH 1N64L 3P3UA 1OAQH 3CSFA 4WEBH 1U2YA 1DTUA 4P2QE 1MH5B 2P43B 1PZSA 3ROLB 3ES6B 3VFPB 1GY2A 1B6DA 3AC0A 4P3CH 3D9AL 3LB6C 1RZGA 1WWAX 5HP5A 4O9HL 1QSEE 1ITCA 3OC8A 5F6IC 3KWUA 2ZUQB 4ELKB 3MLZL 2WBKA 4UT7H 4EUPH 3JYBA 3INUL 1B0RA 1NIBA 3QA3B 4G5AA 4IRZH 1PJ9A 1FCGA 3L3HB 3OJDA 1A6VL 2BSSB 2WYTA 4IK6A 4PRPE 2IPTL 4O2CB 4R3SA 4E41B 5GGRB 1S7SA 2K6ZA 3JWDL 4WW2A 2OBGA 4K5PA 4PYGA 4ATTA 5IIEA 3P69A 2VQTA 4QRRA 1BQKA 1TQTA 1WEJH 3O0RH 1KCUL 2P80D 3NESA 4Y8DC 3QCUL 3RWHA 1A3ZA 5IREA 5FC9A 4BGDA 5IB1B 4OM1H 1PG7X 3KPRA 3AXLB 2W0FB 4DN4H 1SF5A 2Q7AA 2K9UA 2UZPA 1JZ8A 4N1CA 3LRSB 3E8UL 1RZPA 2ZP9A 3RGHA 2VKWA 3B5TA 1I1RA 2JIXB 4NPKA 1KJMB 1KELH 4PJAB 3WO4B 5BUPA 5KVGH 1OP5H 1MCRA 1T3FA 2ICEA 3VXSE 4TUOA 5IVXF 1TEGA 2CM5A 5DZLA 1D9KA 4LLDB 1IM9D 5JOFB 3HUJE 2YBGA 1Q94A 1PY9A 4IIQC 2EIJB 1ZEAH 5IK3A 1PBYA 3MFGB 3KWTA 2CGYA 2V7NB 5K1JA 1F4YH 4JRYA 4PRBB 4X6BB 4UT6A 1JYVA 2QSCH 4CU6A 4GFXA 1P5UB 3PDOB 3TZVB 5AG9A 4L8BB 5J9PA 1PZ3A 1WBXA 2ZKHH 2L7EA 5FO8B 5E00B 4OGAC 3VG0L 5IJKC 1FFQA 4P48A 2L7UA 3MLRH 3OKEB 3EZJB 4K5LA 3L6FB 4KK8C 2M8XA 4OKDA 3UIYA 3VYPA 1RCYA 2EH7L 4NQQA 4C4KO 1ZDQA 1BYOA 1YUHB 3RZCB 4PP2B 2CLVA 3VSQA 2YA2A 4ZTEA 4IU3A 3HBZA 4FQ2H 3QEQB 3CTTA 5A16A 4B41A 5D1ZC 3S37L 1NGXB 2A77L 2L7QA 3Q3GB 1JPEA 2IBZY 3BE1L 4UILL 5MERB 4ZFFB 1KN4H 1S9YA 5ESVB 4OUUB 5E23A 3T2NL 4KO5A 2ROXA 1EJOH 4RGMC 1QASA 3VA2C 1NCGA 5C0RH 3DO7A 4GT7A 4GQ9L 3TN0B 2H2PC 5EIIB 1NCHA 2UY7A 1ID5I 3QQNA 1L7IL 5CU9A 2R4RH 1JXKA 4TVSa 1L6PA 5ID1A 5FYJE 3PP4H 2XWBB 2MOGA 5HGAA 4J4PA 5C0JB 4JMXA 4WGWB 1E6OL 1W16A 3AMKA 5DVOA 4QRRE 3L95B 4LDEB 1KCVL 3GZPA 1P5VB 1JNNL 2NZ1A 2QKIA 3KCWA 4M56A 2D31B 5D4QA 4XMZA 4HCFA 5DUPH 1NCIA 2EDEA 2IH3B 3M45A 5E1AA 2WUBL 5TE4H 4ISVA 3RVUD 4HJJH 5HHPA 3A67L 4KXCA 3VI3F 4PD4J 3DDGA 1ZHLB 4OAWA 4HJ0D 2DH3A 2DYPA 3IMSA 2J8HA 1IGMH 1XCTA 1XB8A 4S0TD 3WFEH 3HBPA 3KLQA 4MS8D 3GSVA 4FLHA 2BP0B 4XXWA 3Q05A 5FLVA 4JUTA 1O7DE 4W9ZA 4FNSA 43CAB 4PU2A 4G3YL 2BVQB 4ALAH 5BS0A 3TGXA 4YXKH 1KGCD 3QULA 3CUPB 1K5NA 3G6DL 4JRYE 3RNQB 5C0AD 3RI5K 1EDQA 2IO5A 4AJYV 3NCCB 3U6RB 1BBJA 2ZWNA 1T1XB 3IBOA 2NSMA 3NIFF 1K72A 2B7DT 4DQOL 1QFOA 4R5XA 3GI8L 3UC2A 3VXUD 4HK3N 5AAMA 4F7EA 5IKCA 2QVMA 3IE9A 4POUB 2ARJA 1VFMA 3CSBA 1KBGH 2H4EA 4OTXL 4JZJA 4NGHL 2Y69B 4NEHB 3ESOA 1CDHA 5F70A 2KLRA 1E5BA 5I1HH 4X6EA 1RIUH 3ETSA 2V8MA 2WN2A 2ZX7A 1BDYA 4ZUSB 1QD0A 3JTTA 3NA9H 4XPAL 1DVFC 3SE3A 4IBTA 4GBXB 3RWCB 3VWJA 4G9FB 5LBSH 1U6AL 2WMPA 3DETD 1NANH 4MA8H 1KCRL 4Y1SA 4NUMA 2WXPA 3BEWA 4PLJD 5BQ7A 4MXVE 1IAIL 3F7VA 3V7AE 4PG2C 2J57A 4L8SA 1I9EA 3MOAL 1HI6B 2W80C 2CO2A 5I1DB 4XNDA 3MA9H 2Y5TA 3PWJA 4XB8A 5KANI 4JM2F 1U8QB 5B3SB 2HT4D 4EIZC 2DKUA 2CKNA 1T21A 4OLVL 4AEFA 4DPRA 2CKBB 4FI6A 4GSDL 4G70B 3D0LB 1QTSA 1O9VA 3OR6B 1YEKH 4CW1B 2VRQA 2E0PA 1FAKT 4MWFA 4LFHD 3OJ2C 4KX7A 3UJTH 5IHBA 5J3HC 2HTLC 2P5PA 4RGOL 2I5YL 5C08A 2J8UA 5ECJE 5J1TC 3UBXI 3S37X 2AK1H 5TQ0H 4PJCB 1PSKL 1M7XA 5IHHA 3S2AA 1ORSB 1DFXA 2H1LM 4BBWA 3QQ3B 5JPNB 1S7RB 2WXGA 4NHCL 1KT2B 1AHWB 3MLWL 5DD6A 5AL0A 1I9JL 2Y7QA 3N85L 3NRPA 3W3BA 4CVXB 4XMVA 1L9SA 3QPXL 3M88A 1PZ5A 5KBNC 3Q44A 4F8TA 4OZIF 4HIXH 4IDLA 3LOWA 3O3AB 3VXPA 4P23B 3OKKB 1PGRB 2DIEA 1H6EA 2O5ZH 1JGUL 3TJHC 9CGTA 5LHDA 1K3ZA 3OAUH 4R83A 2BOBA 5IMMA 3EW3B 2BP8B 5BS0E 1NCJA 3AVEA 4HC1A 3FMGH 1ZLVH 3K1DA 3DTXB 3REWA 2QTEA 1DN0A 1KBPA 1MG3C 2GEEA 3C6LB 2IOOA 3U46B 1S4IA 2IMMA 3SPVA 5I1CH 2ZT9C 1CI3M 2CH8A 5E8EA 3V0GA 1JWMB 2ZAHA 5JW5B 1HSBA 3DA0A 4NLAA 2OJEB 3IJ7A 3KPOA 4LOEA 3T1FB 1VFAB 2AV7A 2B4CL 2PTUA 5IVNA 5E2TL 4MYWB 1RUQL 5AW5B 3T3MB 1N0LB 3UTPE 4M4PA 1YN6A 1T1WA 2FGWL 5AUMB 4JPVL 1P7QD 5CO1A 4LARH 1RFDL 4W70A 4QYOA 1CR9L 2Z92A 4EDWL 3KE0A 4Q9BA 3FB7A 1NAML 2BNRB 4FQCL 5D1ZA 3V6ZB 2VLJD 3LXAA 5SWQB 1AIFA 1MCCA 1DBJL 3D25B 3JQOB 3KLAA 5EMYA 4KOBA 2W60B 1BFOA 1M05A 1QPPA 1QR4A 2I60H 3HZYB 4D8OA 1HHHB 1LDPL 4MAUH 3UZQB 1BQHG 3AMLA 4MA1B 1CD1A 1EGJH 3TWYA 5A1AA 4RQQB 4I3GA 4PY7A 4RFNB 2WUCH 1E67A 4YNYA 2FRGP 2YAPA 2X2JA 1URLA 4YDKH 2ESVB 4DZBB 4PPTA 3ULVH 4G7VH 1D7DA 4LL4A 1RXLA 1GMIA 4WJG3 1MW2A 4WKXA 1S7TB 3MUJA 1H9VA 2IC2A 2YLHA 3QR0A 4BDVA 1CD8A 2XJKA 5LXGL 4JQIL 2DQIH 2FBJH 1NCOA 4WUUD 2YA0A 3KJ4C 2X1WL 4OW6A 5GJSL 2NY7L 3MRHA 3T5WA 5TK4A 2R23A 2E5EA 1I7UB 3GSNH 5BOPA 5BXFA 4JO2L 3E6HB 4XVUD 2F7IA 4HEMA 2J8UE 3X14B 3ZZSA 2EIZB 1OGTB 1T7YA 2OTUA 2YFNA 3Q2VA 2B77A 4A68A 3H9HA 5I18H 1SXCA 4L1BA 3CZGA 4L37A 1KN2L 4DPBX 2NY3D 2DIBA 1FRGL 2X1OA 1AZBA 5CP3H 3KH3A 1A14L 3VO0A 1F41A 4FI7A 2NY1D 3HUJF 4HEPA 4UOW1 3TA3C 3ZMEA 1E3XA 5DZPA 4OJCA 5DK0B 1NM4A 2DICA 5F1NA 4OD3L 4S10A 1KNOB 3LEXB 5CD3B 3TV3L 2H47C 5F71A 4GINA 5AVXB 2QV2A 2Q2LA 4PJ9A 3REVA 4UM8B 4B6ZA 1OW0A 2EDNA 4OZGB 3FRPG 2WQUA 2FQEA 3HE6D 3U4EB 2EZ0C 5KS9B 3MCYA 2YIHA 2KLTA 2R1YB 4PHXA 3MNDA 3MLXL 1YECH 3QQ9C 2X4OA 2C4FU 3KPNB 3FUIA 3INOA 3QRGL 1AQDA 5AALA 5C0ND 1MI5A 4N22A 3L2MA 4OVVA 4R97B 5T3ZE 3RVVC 2HXAA 4TPRL 2MNUA 4F7CA 1KYOK 1LP9A 3DJSA 4I0PA 2DZEA 4NCC1 1HS6A 4BHUI 3CGTA 4E68A 1GOHA 5EZOL 4YK4B 4JY5L 4LKXB 3QDGD 4TYUA 5EO0B 5IMOB 1JIBA 2UUDH 4M5ZL 4ODXA 1TJHH 1NMBH 1R0AH 1U8KA 5TGBB 2BHYA 5GGVY 4G5ZL 1YC7A 2H3KA 2ZXBA 2HFTA 2B4CC 4PG2A 3DXAB 4XCYA 1C7TA 3V0JA 4JO4L 1IAKB 2ALWA 2M26A 1MKFA 2C9RA 3L4TA 2KQMA 4N8UA 4BFEA 3CSPA 3N50A 3ZHNA 2GFBB 4XBGA 5GGTL 4AM0A 1KLFA 2NTFA 4GW4A 5LCVL 5ALBL 4M93B 2AP2A 4Q6IB 3V0IA 3MDJA 3DSNA 5CJXC 3FKUS 5G2NA 3D08A 1FIGH 4WW2F 2O5NA 3HZ3A 5C0IB 1EFXB 1JI1A 1NWPA 5IJVA 1NEZG 2WWOA 2DQHL 2C5DC 4Z7VB 1JD7A 3N0PB 3UBXB 1TFHA 3WXWL 5EEWA 4HEME 4NUGH 2LU5A 3VWKD 5AAPA 1TLKA 3T3PB 3B7SA 4NWTH 1IEBA 4ONGL 4QF1B 3FONB 3MJGX 3MODH 1KB3A 5HGHA 3QJFB 2XV2A 2BRRH 4CC4A 3TCXA 1NLDH 1X44A 3V5HA 5I76A 2XWTB 4A04A 3SE4C 1UCBH 3CBKB 3NIDE 1H8OA 2DM7A 3I6LE 4Y4FB 4PLKC 1W72B 5F1IB 1JPGA 5IQMA 4K3GA 4QHKI 1AZVA 4TM9A 3FT2B 4DEPC 1A8ZA 3MBEC 3T04D 2V2WA 3PY9A 3OXSB 2FO4B 2NCEA 4DP2X 4HFWB 4TRPH 3N43F 4AG4L 3TBBA 1OTSD 1HCVA 4EO5A 4LSPH 2WHVA 5ITBL 4H8WH 4M7ZC 3P3TA 5LNDA 2J43A 8CGTA 2GKIA 4K07A 3T8VA 2O5YH 1OB0A 3ZL2A 2YD7A 5DJ8A 3W0WA 5HGBA 4QTIH 1CDBA 2YQGA 2X2IA 1OAYL 4E0RA 2RGSA 1FZJB 1MI5E 1T1ZA 2Z91B 3B8YA 3HB3C 1JRHI 4MCZB 3EJJX 1I8MA 4QD2E 1T80A 1LP9E 2HJFA 3GIVB 5DD0H 1ZWIA 4HLJA 2JLLA 3LSOB 3FQWA 2HUHA 3MLTA 3QJVB 4DQAA 1T0MA 2JCCB 3SN6N 5CZXC 4NBYB 1JZDC 4EI5D 3QEGL 4M43L 5I28A 4Y9BA 1R5IB 4ZO6A 2CJUL 3FO0L 4KXZH 4NN5B 3ZR6A 3PGFL 3EZ8A 3BUTA 4LSUL 3HLAA 4OCYH 1X7QA 3DRTA 5FGBC 2B1HL 1S6NA 1LO2L 1LMKA 2DMHA 4Z7WB 3RGVD 3V79C 2YSSA 1NL0H 3P4MB 3WJLC 3ZL1A 3RB7A 3B8SA 1DQLL 5CJQL 1MWAH 3DROA 1YVLA 5B39A 4NZUL 1DO6A 1AANA 1BVNT 3H42H 3VRJB 3DX9A 4KITB 2WLNA 4AH2A 1HHKB 1XAUA 5E1HB 3WFBL 6FABH 2CBQA 3X3FL 5D1XC 3GMRA 2XTJD 4BFIB 2UVEA 2NNCA 2VAAB 5KJ4A 4PI0A 3VWJD 4IKJA 1UD8A 3D85D 3T6QC 2VO5A 3DO3A 4LCUB 1LNUB 2XA3A 4OI7A 5DYOA 3Q2LA 4ZT1A 2AMGA 4UQDA 3ZBMA 5BOJA 1UWGH 4AVIA 3K2IA 1ECYA 4LE8A 5FO9B 3VW3L 4FFYH 1MCPH 2FJGA 4NZ8A 4K23L 1OXYA 2PKDA 3T77B 3PQYD 3R06A 3IMWA 4FFWC 1FFNA 3TFKC 1LK3H 3RU8L 1DJXA 5EDSA 5CILH 3FB8B 4F2MA 4FNLL 1LWRA 4XI5C 4L2YA 2OFQA 3TA3A 3FQUB 4YZWA 3ZRSA 2NW2A 1L5GA 3BESR 2CPCA 3ULVD 5AWNL 2FECI 5JPMB 3BFWA 4QXGL 1JPTH 1PD1A 1ZVNA 2ZG2A 1AAJA 4N2GA 2BCKA 2FQFA 4NCDA 2ZWSA 4YGAB 1YQ2A 4JFVA 4QWWC 3WUWB 3LKSA 5D7KD 3CVBA 1RULL 2ZUVA 5AVYB 2OR7A 1Z9PA 5KW9L 3QIUB 3W0WE 4HIIA 5LGHL 4KK6C 2F8OA 3W81A 3NIGB 3P9WB 4Y5XC 2G2RA 2WK2A 5F7UA 1FL5B 4UQBA 2VO8A 3IMTA 3ZRFC 3BPCB 4POZD 3ZUNC 2QDWA 1DEDA 4OT1L 3UAAA 1FNAA 2AJXL 4JKPL 2C1PA 3QHTC 2BXZA 1XF1A 4AQAB 2YN3A 3AG4B 1IGTB 1UQSA 3AT0A 4G7SB 4DIXA 4XC1H 3DVGB 2RJMA 3S4SA 2BC4A 4BXSV 2W65B 3L5XH 2X42A 4OBSA 4AGOA 2Z8RA 3P0YL 5DR5H 2CLRA 1MUJB 3HBQA 4Y2DC 2Q86A 2D0HA 3O2WL 5HHVL 4HGWB 4KK5D 5EPMA 3QAZC 2FLBT 1SVBA 3P11H 1SJHA 2K8MA 3CK0H 1FL3A 4JFFA 2FWUA 5ANMA 4J6RH 4DUVA 1BAGA 2MQ3A 2VR9A 1DBMH 4L3EB 2MCPL 2KI6A 4OZ4B 4PIBA 4Y7MA 1KLGB 4FYSA 3BW9B 3FQRA 2IQAA 5EIIG 4JCLA 3U36A 1NAMA 4NM8L 4NQDA 2B1AH 2PUQT 5CSBA 2WBJD 4X4YB 2K1MA 1MCFA 4JPKL 3KCPA 4G83A 4O2EB 3HI6H 2NNAB 1JN6A 1C08B 2WLZA 5EC2A 1G6RH 1HL8A 1P2CB 1KBKA 1HCFX 4WKZB 3KPPB 1CYXA 4X9IA 1HQRB 3WS6C 2GPZA 3A4AA 4YDJA 3CDZB 3VH8A 1H9DA 3SO5A 1ZDSA 3SE4A 4MAYD 1OCWH 3RUGB 3VXQB 2MCAA 4P8QA 4F2ME 2WAQA 5CCGE 1RZKH 2YPLA 3EHBB 3MBEA 3GMOB 3Q6FA 2FX9L 3RDTD 4ZNCD 4HUUA 2A6KA 4X8JA 2XG5B 4ZAKC 3BQUB 3TCLB 1URIA 2XPGA 3MRLB 4HIEB 4KHTL 4BQ9A 5INCB 5LUMA 1I8LC 2W0LA 1U91A 5CR1A 1QSFB 1VGKA 3ZQ9A 5B7FA 4AYMC 2AJYL 2GUOA 2PXYA 1PZAA 1T2XA 3IAPA 3DK0A 3QDJD 2ADIA 1DEEA 3HI5H 1L9TA 1NCDL 3NFPB 5I23A 2YA1A 1G9ML 5DGQA 3CLFH 1RUAL 5KSVB 1I8IB 3JUYA 4UV7H 1KPVB 2BNQA 2F5AH 2GK2A 1HILB 4AK1A 4QRPD 3C8DA 4WI9A 3VXRB 2H3NB 1FF5A 4PRNB 2V5SA 3N44B 2VE6A 1VPOL 4X5WA 3T6WA 2MJWA 4NAMA 3L17A 3O6MH 1CE6B 1D5RA 4ODSH 1W6WA 3UO8B 1A65A 1GY1A 1A6AB 2HJLA 3J8F7 5F89A 1PLCA 3D4GA 2HT3D 4YC2C 4CGUB 3NIFB 4PJ9D 4M1DL 1N12A 3CDGA 3DWTA 3PWPD 4X9HA 2CDEB 5ID0B 2EDMA 5CBAB 4N85A 1JTTA 3ABGA 2DQFB 3DUHA 5DXWA 5KYYB 4OZHA 5FGBA 2D2CC 4QAMB 4JFFE 2MKLC 3QI9A 5ANME 3KW8A 1GPOL 4FXKC 4NKMB 3BHBA 1C5CH 3RWEB 4Y4KA 5ICUA 2OL3H 5FA3B 2WTRB 2CMRH 4JZNA 4H4NA 5TQ2L 5FCUH 4NQDE 2J56A 4Q52A 2JB5H 3AREB 1ZD6A 4NPYB 4UT7L 5D1XA 3RY6C 2R1XB 1OOAA 5LQBL 1NBYB 3ZDZB 3ZGIA 3WTTA 1PAZA 1LK2B 1XR9B 4EF3A 4ETYA 4DWHA 4QCIA 4R26H 2PP7A 1NBVH 2G5BA 1TVHA 3BQVA 5E6IB 1TQSA 4PB0L 3W9DA 3NN8A 4RFEA 2X3AA 5GGTA 12E8H 2NTSP 3QNZA 5LCVA 3VFRB 4LLUA 1DDHA 2GTQA 5DLMH 2BM3A 3S3DB 4WO4C 5IJDC 4XRCB 1QTYT 1XF4A 5C09A 1G4MA 2BSBA 3QUZD 4QHUA 2YPLE 4ZNEA 2W8CA 1KTRL 1RU9H 2EDHA 4YSDA 1VLXA 1IIIA 3UAJC 2EXYD 3QNFA 3CN3A 4IS6A 4WI0A 4GKSB 4WI8A 2Z7WA 3RX5A 3N1FC 3OQRA 3IBEA 1FH5L 1AYRA 1IC7L 3C87A 1HEHC 1KELL 1DQDL 3ZDXE 4MD4A 1UASA 2ZYIA 3QQ4A 4KRLB 4ZOCA 3VXOA 3EYUH 1QUNB 4NOFA 1OVZA 3QEHA 4Y5VC 1OIOA 4M6MH 2CO1A 5K1VA 2X4SB 4Y5XA 3ABMB 4GAGH 4NQCB 1U58B 2BNQE 2WC7A 3U7WH 1CQYA 1Y6MR 4OD2A 5CGYD 4GRWE 5FB8B 1JAEA 2EDRA 3KJ6H 3L4VA 4W9KC 1HJBC 1BD2B 2QSCL 1XTMA 4TNEA 3U1SH 4BELD 2WLIB 1U3HB 1F3JB 3WNKA 2ZKHL 4NQEA 1KB5B 1AG6A 1TU2B 4YJZL 4FQHA 3SKOB 2F19L 4F58L 4F80A 4P57B 1ZSHA 5HYFA 1G7MB 3TT3L 1V10A 4QPEA 4Y4HC 1G9MC 2LGNA 5FK9B 5T1LD 3CNKA 3CFDB 1OANA 3CQQA 3GXFA 2FSEB 1BZ9A 3MBXH 3MGOB 4XNQB 3SBQA 2WY3B 1IBBA 5GRWA 4U1GB 4Y2DA 1MFDL 3ZUCA 1V7NH 3CVCA 4OZHE 5D2NC 5EZLB 2AEQH 2MNWA 2Y0SA 3FU7B 3CC1A 1NIAA 1KENL 1PG7W 2HT2C 4NQVA 1QLFB 1EERB 2XUWA