5K7RA

Microed structure of trypsin at 1.7 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Atomic-resolution structures from fragmented protein crystals with the cryoEM method MicroED.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5k7rA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5k7rA02
3SGBE 4AYVB 2A0QB 1SGCA 1TX6A 2WUCA 5T6GA 1UK4A 1WTHD 4OS7A 1CA0C 1W3CA 4X2XA 1V2LT 3RXUA 1S84A 1EQ9A 1P09A 3RXJA 3M35A 3W95A 2FOBA 3GY7A 4XFQA 3O8CA 3ZYEA 3ZVEA 1QJ6B 1C2DA 1KLJH 1SSXA 3B8JA 5TJXA 1TA6A 1WAYB 3FZDA 4MPXA 1TNHA 2P59A 3S7HB 3QLPH 2CHAB 1AVXA 2H9HA 3F1SB 4DT7B 4DY7B 1Z1IA 1GDQA 3HKIB 3I77A 1VCPA 3SU4A 2W3KA 2A5IA 3MHWU 1W7XH 1W0ZU 1UTMA 1L0ZA 2BD8A 1WBGB 1ID5H 3T28A 2P16A 1LPZB 1LKAA 3MFJA 2BX3A 2Y5FA 1RD3B 3WY8A 4CH8B 1GHBG 2OC1A 3RXBA 4O9VA 3QX5H 1YPGH 4NIYA 3ATIA 1CHOF 2Y82A 1EAXA 3TNSA 3VXEH 1UTOA 2EEKA 1HAXB 5BPEA 4ZXYH 2BDAA 2K1QA 1GBDA 1D4PB 1GJAB 3OY6U 2Z3DA 1BMLA 3LONA 1GHVH 1RGQA 5JBBS 1GI6A 4GAWA 3VB3A 1O30A 1V2OT 3IITA 4K1TA 2FOCA 1NFYA 4MPUA 4GPGA 4K8YA 1P02A 1TGSZ 1O5CB 1TMTH 3MU5A 5DGJA 5HM2A 1SOTA 2PLXA 2ZGHA 3UQOA 1GBEA 2H2ZA 1H9HE 1YPHE 1O3CA 1ZTLA 3SUEA 2OUAA 4NWLA 2EA3A 1GJ4H 4ABIA 1CGJE 1C5RA 1JXPA 1O31A 3TH3H 1C1MA 4LXBH 1K1LA 5L6NH 1BB0B 1OP8A 4Q80A 1DUAA 1GCTB 1O3NA 1P2JA 4CRCA 3MH4A 1P8VC 2AGGX 4D7FA 1LDTT 2GVFA 1FAXA 3VGCB 1P11E 3M7UA 1NN6A 3CS7A 4BXWA 4BNRA 5A0AE 1SLWB 3UOUA 3A8DA 2FP7B 2ALPA 1QNJA 1HGTH 3SUGA 1O34A 5ESTE 4X2WA 1MAYA 1SG8B 4IC6A 3GY8A 1YPHC 1RTLA 1C2FA 1BDAA 1OYTH 1MCVA 4ZHAA 3SJ9A 4NIVA 2ZHWH 4MQAA 3MNSA 2H5CA 1HCGA 4I7YH 1F5LA 1BQYA 4MG3A 1O2LA 1VR1H 4D9QA 1YBWA 2V0BA 1LCYA 1TFXA 3KQCA 5F8XA 4R8TB 1AFQC 4INHA 1TPSA 1ANDA 1DM4B 2OC7A 2NWNA 3GY6A 3M61U 4XBCA 3A7ZA 4JYTA 2GKVE 2I6SA 1S6HA 2Y5HA 2VIVA 5DP3A 1QCPA 4OS1A 4JZ1A 4ZUHA 2ZCLP 2TGAA 2C8WB 5A2MH 1BBRE 1C4U2 1J8AA 3GDVA 1A3BH 4TY6A 4JZFH 2VNTA 1WYKA 2QGRA 1GI1A 1KDQA 4OS4A 1CQQA 1CT4E 1G3BA 1O38A 1VJ9U 3E16B 3A88A 1HAYB 3QGJA 4WMFA 2BOKA 4ABDA 1D3QB 3L6PA 5C1YA 3TJNA 5AFYH 3BIUH 3TLOA 1PYTC 4LZ1H 3RXQA 4UDWH 1OXGA 1GHXH 1O5BB 2LPRA 3K6ZA 2JKHA 1ZRBA 1JRTA 1MTWA 1S5SA 1GJ9B 1J9CH 1YKTA 3E1XB 3TH2H 1P0SH 2GV6A 1E35B 1RTKA 1GHAF 2BY7X 3U98H 4MNYA 2UUFB 3Q3KA 3GICB 3M3TA 5BRRE 4KTSA 1MCTA 1SHYA 1W14U 2Y7XA 4CH2B 5JB9S 1MD7A 2ANYA 3RP2A 2CJIA 2HRVA 2VB0A 4IS5A 2XNIA 3TPIZ 5EODA 1AB9C 2JETC 1O2YA 3DFLA 3MU0A 2P93A 2YNAA 3MWIU 4RN6A 3ZVDA 1BT7A 1UTLM 4FUEA 1FN6A 1PFXC 3P8FA 4X6NA 3TJVA 4A1TA 1O0DH 4ASHA 1WCZA 2WYJA 3BTTE 4H42U 1KXEA 1EB2A 1DWEH 1GDUA 2ZTZA 1DSTA 1E34B 2PW8H 4AFZA 1SC8U 1BHXF 1TA2A 2ZTXA 2M5TA 1B0FA 1TIOA 2ILNA 2G5VA 5CHAC 2TGTA 4A1VA 5LGOA 3ATLA 4VGCB 1RTFB 2FWWA 1WV7H 5AF9H 3BG8A 2SGEE 1HUTH 3PMJA 3U1IB 1NS3A 3MU8A 1FAKH 2ZDLA 1ABIH 5CMXH 4NIWA 1CT0E 4NWKA 2Q1JA 3BV9B 1BBRK 1IQEA 2CHAC 4SGBE 1A0JA 1EZXC 5DG6A 3OY5U 1TNGA 4XE4A 1BRCE 1GBAA 3U69H 1C5LH 1D9IA 4IMQA 1ANCA 5L30H 1AU8A 2VH0A 4FUFA 1GJ8B 1T4VH 3FP8E 2EI8A 1AKSA 2PKSB 1C2LA 1TE0A 1O3AA 1TBQH 2IPHA 5LPEA 1O3PB 1QL8A 2GTBA 3T5FH 4WWYA 1P01A 1HB0B 1QB1A 1O2PA 3M5LA 3D23A 2XRCA 4AGKA 2XW9A 4ESTE 1VGCB 1W8BH 1QQ4A 2VIOA 1IQFA 2QC2A 1V2MT 2GMTC 3A87A 3KF2A 2PGBB 1DXWA 2R0LA 3SGAE 2WYGA 4KTUA 1QFKH 2ZDVH 4X8UH 8ESTE 3CENA 2BVRH 1G2MA 3RUOA 1GJ6A 1O2SA 3SU2A 1AE5A 4Y8ZA 1IQJA 3LT3A 2XWAA 1W0YH 5GIBA 2Z9IA 1KY9A 4K69A 2Z9JA 2FI3E 1UCYE 1GCTC 1NT1A 1LVBA 3BN9A 2ZDNA 3QUMP 5A8ZA 2FMJA 1BRBE 2XTTB 4A1XA 3VGCC 1GMDG 2FX4A 1BMNH 2ZKSA 3GY3A 3RLYH 4BAKB 2A7JA 3FANA 1ZHRA 1LPGB 4F4OC 1GVKB 1GPZA 3O8DA 3ZVGA 2AMPA 1ELGA 3OYPA 1AWHB 3GDSA 2OBOA 1ZJKA 1XUJA 3P70B 3RM2H 5GWZA 1ARCA 4YOGA 3BTFE 2GX4A 2PFEA 1NROH 4UFGH 1LVYA 1YPEH 2A32A 4DIIH 9LPRA 1IQLA 2VWNA 1TWXB 4AN7A 2FPZA 1O3EA 2NU3E 2ZIQH 2ZGJA 2AERH 2F83A 5EOKA 4TWYA 5DP9A 2HPPH 1C5OH 1JBUH 3URCA 2TRMA 2FM2A 1ELTA 3RXCA 1HXEH 4Y71A 1SQTA 4IC5A 3C1KA 1FI8A 2BZ6H 4INKA 4Q2KA 5DP5A 2A4RA 3HGNA 4ABJA 5DP4A 5ESBA 2ZDMA 1A46H 3TJOA 1LVMA 1P3CA 3SU3A 2BD7A 2FDAA 1C4Y2 3E0PB 3SQEE 1GMHF 1LPKB 1OKXA 4FU7A 1W2KH 3G01A 1O2GH 5GJ4B 3QGNB 7LPRA 3PV4A 2FO9A 2WPLS 2ZA5A 1FPCH 3ZZ5A 5FXLA 1MQ6A 3SI3H 5IDKA 1C2GA 2G5NA 3SV6A 3RMMH 5PTPA 1GHWH 1IAUA 2XCFA 1ETSH 3EE0B 3A7WA 2EC9H 1BBRH 4Y7AA 2FX6A 1S0RA 4CR5A 3R0FA 4TPIZ 3A81A 3M7TA 1MTNB 1ZSKA 3LKWA 3RXVA 1C2KA 4BANB 2H9EH 2PKAB 3STIA 1IQNA 4Z0KA 4Y8XA 3A7YA 4X1SU 2ZFTA 2WUBA 3SNCA 1O3IA 3SO3A 3M3SA 3UWIA 3ZZ3A 6GCHF 3TIUA 2GV7A 1UCYK 5EW2H 2FYRA 4K3JA 2XC0A 3SV7A 1TPOA 1PJPA 3Q3YA 1HAHH 1U6QA 1P2KA 3BEUA 4GUXA 3SNDA 3PO1B 4ZMAH 1P2OA 2QXJA 2PR3A 1KIGH 1SOZA 4MVNA 1OX1A 3RXKA 5FHTA 4B75A 1C1TA 3LH1A 1HJAB 1GJ5H 5DKMA 3LGIA 1P57B 1O2WA 4GCHF 1V2WT 1LHCH 3TVJB 2GT8A 1WSSH 3VEQB 3UR9A 1HPGA 1AFQB 3HKJB 1QRXA 4CRBA 2OXSA 2PTCE 1SLVB 5E0HA 1O3DA 4MNWA 1G3EA 4ABAA 4UFDH 2Z9LA 3L33A 3IWMA 1ZOMA 4YOJA 1NRPH 1H8DH 5C3NA 2OQUA 3V0XA 2ZGCA 4CRFA 5E0JA 3TGIE 1YYY1 1SGDE 2HLCA 5EW1H 3E3TA 1DE7H 3AW1A 2ZF0H 3HATH 3UNSA 3QZQA 1GBIA 2RG3A 1F0TA 1J15A 3M37A 1BJVA 2GT7A 3E91A 1BIOA 4B76A 2BVXH 2XBWA 8GCHG 1NRRH 2ZGBH 1C5MD 1C5ZB 2V3HH 4ISOA 3A89A 1X7AC 3F9FA 4BAHB 3NXPA 5DK1A 2R9PA 5C2ZA 1GBFA 2FIRH 3V12A 2OBQA 3U8OH 2PKSC 1AD8H 2CXVA 1K2I1 4M7GA 2A45B 1DVAH 2A4GA 3KQEA 2FOHA 3RMNH 4Q7ZA 1KTSB 2G55A 2ZDAH 1Z7KA 4FUIA 3TGJE 2OD3B 2XCNA 1HNEE 4UD9H 3GISB 1K21H 1E38B 4NZQA 1AUJA 1CSOE 1SPJA 5ETXA 1FIZA 4YOIA 1FMGA 4F49A 1VGCC 3U9AH 1B0EA 3SQHE 2ZPRA 2ANWA 3JZ1B 3UOPA 2HNTE 1P2QA 4KGAA 1LO6A 2OP9A 2JETB 1ANEA 1V2PT 1GGDC 3LOXA 1LMWB 1O39A 1P10A 1NU9A 1ESAA 4JMYA 4X6PA 4CRDA 1EOLA 5FPTA 4IMZA 3BTME 2DUCA 1SGPE 1FN8A 3MO6A 4WH6A 2ZNKH 3VB5A 1SFIA 3A84A 3S9CA 2R0KA 1PPBH 1E36B 4HTCH 1OWIA 1OYQA 2NU4E 3FP7E 2G51A 5JYIA 5CHAB 2KAIB 3M3VA 3U8RH 2A2QH 1FY3A 3PMHB 1ZTKA 1AWFH 3Q3XA 1GI2A 1P05A 2FS9A 2C4FH 1A5GH 1UTQA 1C2MA 2HNTC 1Y5AT 2A7CA 1V2KT 2FLBH 3ZZ8A 4CBOA 1EXFA 5EQRA 1C1UH 5JPMH 1DXPA 3RXGA 3BEFB 1UCYH 1GI0A 1TGCA 5EPYA 4E05H 3E6PH 2PWXA 2D1JA 2BY5X 1CT2E 4A7IB 1OWHA 1YF4A 1ZPBA 2PKAA 3BTWE 4K8BA 1EZSC 3TK6A 1EPTB 4Y79A 1QRWA 4X8VH 1SLXB 3UPEA 1Y59T 2ZU2A 1QQUA 1Y3UA 1Z8JB 1TALA 4U32A 1HAIH 3LGYA 3LH3A 2ZTYA 1J14A 4XBDA 2H1UA 6ESTA 3ZVFA 4FUHA 1SMFE 3V3MA 3GCTG 2PUXB 2BOHB 1O2ZA 5GPIB 1TGTA 4WY3A 2FESH 2J34A 1RIWB 4MPWA 3UREA 3K6YA 4NFEA 3LJJA 2J38A 1YPJH 3RXOA 2VVVA 2SGPE 2GMTB 2Y81A 1GI7B 4RSPA 5LH8A 1AVWA 1GBTA 1Y5BT 2CF9H 3F6UH 4K1SA 4AFUA 1BJUA 1TMUH 4MLFB 4YLUA 2QF3A 4X1QU 3RXTA 4ZH8A 2GCHG 1MTNC 5I46H 3LGWA 1HJ8A 1UVSH 1VJAU 3S9AA 1TBZH 1AKSB 2BTCE 6CHAB 1K9OE 3FFGA 5DO4H 4FVBA 1TX7A 1ANBA 3ZZ6A 3PMBB 4FUBA 1UMAH 1HBTH 1TOMH 3AW0A 2BY6X 4OS2A 4JK6A 4ABFA 3OTJE 2G4UA 1PQ8A 2FEQH 2FODA 2ODYB 1E37B 4LOYH 3A86A 1INCA 4FUDA 3PO1C 3SNEA 4KKDA 5AFZH 4ZKOU 2GZ8A 1AVGH 1E0FD 1GHZA 1PQAA 1UVTH 5I25A 1HJAC 1YLCA 1CHOG 1XXFA 2ZCHP 2QV1A 5A0CA 2GZ9A 1EAWA 3ZZCA 1AFEH 1Y3YA 3GOVB 4NSYA 1FLEE 1ZMJA 4YESB 2FI4E 4ABBA 2ZHFH 1KXBA 5EXMA 1O3OA 4H6SB 1K1MA 1O5FH 4D7GA 1YP9A 3S9BA 3HK3B 5FX5A 5TCAA 2G81E 4XOJA 1OPHB 3M7QA 4NG9H 1XUHA 3ZZBA 1C5XB 1XXDA 1ELEE 1WQVH 2BDGA 2FI5E 3F9HA 1OOKB 3SORA 2R3YA 4B71A 2FTLE 2FXRA 3GY4A 4K5ZA 1O2VA 4TPYA 1BUIA 3A7VA 4X1PU 5TCCA 3QK1A 1DY8A 3SUFA 4AX9H 1YCPM 1C5YB 2V6NA 1FUJA 3S0NA 2BD5A 2AMDA 5IYTA 1D3DB 1JMOH 3H7OA 4FU8A 1ELCA 2NU0E 5DP6A 3LU9B 1QL7A 3STJA 3BG4C 1EX3A 1W11U 1N6YA 1JIMA 4XDEA 2C8ZB 1O3HA 5C5OA 4HFPB 1DWCH 3TGKE 1IQMA 2P94A 4HGCA 1A2CH 1O32A 1T8MA 1GL1A 2KAIA 4DGJA 2F9VA 1D3PB 1K28D 2HNTF 2ZQ1A 1V2ST 2WPIS 3MU1A 3P92A 4LK4A 1P04A 3D49H 1YLDA 2VIQA 3PTNA 2GP9B 4JYVH 4AG1A 2J2UA 1O2XA 2Y80A 3SU0A 1C9TA 2FOEA 4IW4E 4Y0ZE 3RXFA 5A0BA 1SGFG 1TRNA 3P95A 5DPAA 1ORFA 2BY9X 1C1OA 2FZZA 2HOBA 2ZGXH 1BTXA 2XBXA 3U8TH 7ESTE 3P17H 3AASA 2BDHA 1SB1H 1F0RA 3SV9A 1DT2A 2EI6A 1EPTA 5FPSA 2VWLA 5C1UA 4Y0YE 1GBBA 2G52A 4UFFH 1BA8B 1WTGH 2JH0D 1KLTA 3GY2A 1QGFA 1QL9A 3QO6A 4OS6A 3O8RA 3FZZA 5A8YA 4Y8YA 1A3EH 2ZO3H 2QXIA 3Q00A 4H6TA 2UUYA 1O2RA 3CS0A 1P3EA 4MTBA 1ARBA 4B2BA 2HPQH 1TABE 2Z3EA 1PPEE 1T8LA 4U01A 5JBAS 1GI5A 2BY8X 2ESTE 2ZU4A 2TGDA 1GHAG 4MNVA 4LZ4B 4IBLH 1T31A 4FU9A 2VGCB 1FQ3A 2THFB 5L2ZH 2ZEBA 3FVFB 7GCHF 4NA7A 1S0QA 4FUGA 3MH7A 1H9IE 2VJ1A 5F8ZA 5C67A 2XXLA 3VB4A 1UTPA 1VCQA 2ZC9H 1A4WH 3TH4H 1EPTC 1ZGIA 1XVOA 2BDCA 1HV7A 5EU8A 1MU6B 2CGAA 4I8JA 5E8EH 2ZU1A 1EAIA 4SGAE 2J94A 1GDNA 5AHGH 5F8TA 1FZZA 1RFNA 1LQEA 5F03A 1EATA 3LJOA 1RIWC 2O8TA 5JB8S 1TNKA 3T29A 5K0HA 1L1JA 1LQDB 5F6MA 1EJMA 1MUEB 2VWMA 1ZMLA 5FX6A 4NIXA 3DA9B 1XKAC 2ZFSA 1MAXA 1GGDB 1LHDH 1EOJA 1AGJA 3T27A 3LIWA 2RA0A 2BDIA 1F92A 1UHBB 1QHRB 1Q2WA 4YT7H 4YTAA 4UONA 1A0LA 6CHAC 1CBWB 2J95A 3T25A 3ELAH 4AFSA 2TIOA 1G36A 3RXDA 3H7TA 2SGQE 3V13A 1S82A 2F9OA 1C1WH 2VIPA 5EXLA 3DD2H 1L4ZA 1O2KA 2BD2A 4U30A 1YPLH 1P2NA 4ZAEA 1BTZA 4JZDH 3MNCA 4HI3A 4BXSA 2AIQA 2SNWA 3PLKA 1FY5A 2PUQH 1NRSH 2OCVB 1ZHMA 2OC0A 4ZKNU 1P2MA 2ANMH 2P3FH 1T8NA 1IQHA 1XUIA 3ZZDA 2J4IA 2ZP0H 1GJBB 3DT0H 1O2JA 3ODDA 1O3BA 4JZEH 5GCHG 3ZZ9A 3RXSA 4I8HA 3LGUA 4A92A 1KXAA 5GDSH 1A5HA 3K9XB 1OWJA 3MYWA 4MPVA 1UTKA 5DJ7A 4AOQA 4ISLA 4GHTA 1D3TB 3BTHE 1BOQA 2OINA 1Z6EA 1XUKA 1THSH 1C2JA 1LTOA 1GCDA 1RJXB 1ZHPA 3KNXA 1DITH 1HDTH 4I8LA 2BQWB 4DW2U 1GBCA 2D8WA 2C8XB 2FOAA 2ZFPH 5E0GA 4NSVA 4NZLA 1SGNE 3TJUA 3D65E 2DE9A 5J4SA 4U2WA 3RLWH 1BITA 2F9NA 1QURH 4X2VA 1SGYE 1TPPA 3KCGH 4B74A 4ISHH 1QTFA 2BD9A 2HVXA 2ALVA 2BD4A 3VFEA 1TRMA 1SR5C 3SW2B 2P3TB 4CR9A 1NESE 2ZU3A 4GSOA 1VITG 2PHBA 3EA8A 1DWBH 1ZR0A 3GYLB 2UWLA 2BLOA 1C2HA 2F9UA 2SGDE 1QR3E 5ABWA 1BRAA 2SGFE 2W7UA 1A1RA 1NO9H 1LHEH 1C5VA 3T26A 1FY1A 4A6LA 1TQ0B 4B1TA 8GCHF 5EG4A 1SGTA 2GZ7A 1QB6A 4GVUA 1ZMNA 1TQ7B 2WPMS 1TRYA 4J1YA 4ZHLU 3M5MA 1GMCG 4I8GA 3TU7H 1FONA 3KL6A 1VCWA 2AYWA 1GI8B 1GMHG 1O2NA 3I29A 2QA9E 1Z8GA 5EPNA 4X1NU 1NY22 3E8LA 3VB7A 1SHHB 1OWKA 1BTPA 1ZSJA 3LGVA 1GL0E 4YO9A 3BTDE 1N8OB 1XUFA 4CHAC 1IHSH 1S85A 3PLBA 1FDPA 1EJAA 3GDUA 2GDDA 2ULLA 4I33A 4ABGA 4IN1A 3JZ2B 1YCPK 1AUTC 1KXFA 1GI3A 2Z9KA 1SQAA 4NA9H 5HXFA 2JH6D 3QWCH 3T2NA 9ESTA 2CV3A 2BDYA 1AIXH 3SN8A 4TYDA 2AGIX 2ZFFH 1TGBA 2FS8A 3A8BA 3OU0A 4ABEA 2BQ6B 2RCEA 3KGPA 1AZZA 5E2OA 1SGFA 4ZXXH 2VGCC 1O5DH 3PLPA 1ABJH 2IN2A 3QN7A 2AMQA 1Y3VA 4BTTB 6GCHG 3BG4B 4IGDA 1BMAA 1V6DA 1L4DA 1D6WA 3UNRA 2UWPA 2UWOA 1UHBA 3LGTA 3VXFH 1L1NA 2Y6TA 1TYNA 3LPRA 1TNLA 4DCDA 2AEIH 1VZQH 2C90B 2A5AA 2OLGA 1MKXK 2C93B 2ZFRH 2ASUB 2EI7A 3DFJA 2ZECA 3MOCA 1K22H 1C5WB 3EDXB 3F9GA 3NWUA 1BTHH 1O36A 3S69A 1V2UT 3BF6H 4NFFA 4THNH 1V2JT 2ZPSA 1CHGA 3PWBA 1GVZA 2D2DA 3GCNA 3LC3A 2WINI 4UFEH 3SJOA 1P12E 1IOEA 3DUXH 3RM0H 1NRNH 1F0UA 3PB1E 1AQ7A 5CE1A 1IQIA 3QTOH 2Q6DA 4KELA 3PMAB 1EZUC 3ATWA 1ETRH 2XC5A 1V2NT 1FNIA 4CRAA 1GHBF 1ZYOA 1NU7B 3ATKA 2F9PA 2ZDKA 1V3XA 1F5RA 5A09A 1K1OA 4Y10E 1CBWC 5E2PA 4O3TA 2F3CE 1K1NA 3NCLA 3SU1A 4B73A 5SGAE 1FV9A 1XM1A 1BZXE 4ZROA 2G00A 2TGPZ 1ZPCA 1A61H 4JK5A 1HYLA 1DX5M 3UNQA 1CE5A 1CGIE 2ZHDA 1GHYH 1ESBA 1NZQH 1B5GH 2ZQ2A 1GBLA 1HIAB 5C20A 1NC6A 1NRQH 1CGHA 1Z6JH 1BTWA 2P3UB 3VPKA 2JH5D 5EQSA 2BXUH 2Q6FA 5FBEA 1O2UA 1CVWH 3ITIA 1KXDA 1T8OA 3ZV9A 1GBMA 5L2YH 4J2YB 2WPHS 2J9NA 3LDXH 4D76A 1ELVA 4ZKRU 3RXAA 1DY9A 1C9PA 1SGEE 2GCHF 3VB6A 4DG4A 3K2UA 1MZAA 3IG6B 1PPCE 1PQ7A 8KME2 4Y7BA 1DFPA 1WUNH 1TONA 2UUKB 5T6FA 1MZDA 2A4OA 1KXCA 3C27B 3PROA 4E7NA 1FJSA 4FVDA 2B5TB 1IQKA 4NGAH 2RDLA 3RC6A 1YM0A 3BTQE 3TK5A 3F9EA 2BXTH 4DIHH 1AZ8A 2Z3CA 1YCPH 2VH6A 1BTYA 1S83A 1MBMA 2BLVA 1PPZA 2QYIA 4ISIH 5EXNA 1SFQB 1W12U 3GCHC 2B7DH 1MQ5A 3RMLH 5J4QA 2ZU5A 5FCRA 4E7RG 2STAE 2BZAA 1T7CA 4BTUB 3URDA 1BRUP 1GJCB 2H5DA 1EP5A 1GG6C 2Z9GA 3SNAA 3MTYA 3BSQA 3QDZB 1W10U 3L3TA 1OP0A 3P8GA 1O3KA 3RXMA 2BQ7B 1CO7E 5FPYA 1MKXH 2Q6GA 2A4QA 1CA8B 1SVPA 1N1LA 2ZCKP 1KTTB 1MTVA 1XKBC 1S6FA 3KIDU 1OSSA 2HWLB 3NPSA 4ISNA 6LPRA 1K1IA 3SHAH 2Y7ZA 2GCTB 3NUMA 2O8WA 3PYHA 3SV8A 4K1EA 1MU8B 2FOMB 2AIPA 3E0NB 3HPTB 1LHFH 1C1VH 2O9QA 1PPHE 3U1JB 2BLQA 3D62A 1JRSA 1A5IA 3BIVH 1XVMA 3E90B 2FOFA 2QXHA 3ZVAA 1PPFE 3EYDA 3SU6A 1N8OC 4WVPE 3EQ0H 3GYMA 1OWDA 1FXYA 1OP2A 1HAGE 4AB8A 2A2XH 2CN0H 4AZ2B 2STBE 1UVOA 4TWWA 2D26C 4XBBA 2W3IA 1C1PA 1THRH 1ZPZA 1HXFH 2O8MA 1F2SE 2ZI2H 3GCOA 2C8YB 3H5CB 3KHVA 1GBKA 3RU4T 2OQ5A 2QAAA 1ZLRA 4OGYA 3BTGE 1GJDB 1EUFA 1MKWK 1NTPA 1T32A 1O5GH 3LC5A 3RU4D 1AE8H 2PV9B 1MH0A 2VVUA 1QRZA 2P95A 3EA9A 1TAWA 1GI9B 5T6DA 5K7RA 3N7OA 1O3LA 2H6MA 4WXVA 4B2CA 2VINA 2FLRH 4ZHMU 4UEHH 1QIXB 1ZGVA 2ODQA 1WQSA 4WJG2 1OWEA 1NFUA 1P9SA 2B9LA 2UUJB 3KQBA 2TBSA 1O2HA 3RDZA 2WPJS 1C5QA 3UR6A 1ELDE 2BLWA 1C2EA 1QBVH 3ZZAA 1SGIB 1EKBB 3KEEA 2BB4A 1C5TA 2F91A 1ELAA 2FOGA 4Y76A 1DUEA 4JYUH 2WV4A 4Y11E 1HIAA 3CP7A 3UWJH 3ZZ4A 2CMYA 3SGQE 2R2WU 1TGNA 2ZG0H 4GLYA 3M5NA 1DSUA 3KQDA 1ZSLA 1DS2E 4UE7H 2Z94A 1A7SA 3PM3A 4BTIB 2FTMA 1NFXA 3QTVH 1AMHA 3RXHA 1TNIA 2SNVA 1P03A 5LPRA 1UTJA 3A8AA 1DDJA 4K2YA 1FY4A 1W7GH 3O8BA 4Y6DA 1O2OA 1SGQE 3F68H 1O37A 4X8SH 2WV5A 3SHCH 3AAVA 1YGCH 4CHAB 3EA7A 1BCUH 3ZV8A 2V3OH 5FBIA 1EJNA 5FAHA 1G3CA 4YLQH 2XC4A 1GWAA 1MD8A 4X6OA 5AVDA 1Q3XA 2QN5T 2HALA 3MNXA 3RXEA 2A5KA 4DVAU 1Z71A 1C2IA 2A7HA 3UY9A 1KYNA 3A7XA 1IHTH 4RKJB 1C1RA 2PSYA 3A8CA 3RXLA 3HK6B 3RXIA 1JWTA 1KSNA 2A31A 1ETTH 1YPKH 3EGKH 1ZJDA 3SUDA 1C1NA 3MI4A 3A83A 4DOQA 1D6RA 1SGRE 2XWBI 1TNJA 1B7XB 4BOHA 5A8XA 1KLIH 5DP7A 2VWOA 1LHGH 2HGTH 2Y5GA 3SU5A 1GMDF 3AVZA 2GDEH 3OSYA 2PTNA 5LPFA 1O2TA 4BAMB 3BTKE 5EQQA 2V35A 1G37A 5T3HA 3HGPA 1RS0A 7KMEH 1RRKA 1YC0A 1HAVB 1FY8E 1W13U 1XUGA 2G8TA 4X6MA 4X2YA 3SJKA 2P8OB 1G2LA 4Q7XA 1NFWA 4WMEA 1V2VT 3MO9A 1DICA 3UTUH 1P9UA 1MKWH 2VIDA 3MO3A 1MTSA 4OS5A 4WH8A 2ZZUH 3Q77A 3PWCA 1UTNA 1T4UH 1PYTD 4B2AA 3RC4A 5HGGA 1C5PA 2QY0B 2DE8A 2G4TA 4I8KA 5GCHF 4FUCA 2AGEX 4D8NA 1F0SA 1TBRH 2WPKS 1WOFA 2QXGA 4I31A 4BAOB 3MNBA 1UVPA 3TITA 4TY7A 1Q31A 7GCHG 3AAUA 4O3UA 2ZHEH 1TPAE 1AY6H 3NKKA 4Z6AH 5EGMA 1QBNA 2BM2A 4KTCA 4CBNA 1ZTJA 1ELBA 4D9RA 4WF8A 2GCTC 3S7KB 2AFQB 3A80A 1CA0B 1Z8RA 4A5TS 1C5NH 2PGQB 1F5KU 2QF0A 1THPB 1MTUA 4AORA 3UIRA 2GD4B 1K1JA 4H4FA 1IQGA 2PSXA 2QIQA 2B8OH 3UFAA 1Y8TA 4PROA 1AHTH 2O8UA 1GBJA 2VU8E 4JZIA 1O3MA 2IJOB 2ANKH 1BTUA 1ZZZA 3SNBA 1JIRA 1V2RT 1VITF 4ABHA 1UO6A 1Z8IB 1V2TT 1GI4A 1O3GA 5HMAA 1HFDA 8LPRA 1AO5A 2SGAA 3A7TA 3SOSA 2B0FA 2YNBA 1C1QA 1DLEA 3K65B 1O2MA 4QT8C 2BX4A 2GGVB 4AG2A 2XBVA 1HAPH 1K1PA 1UK3A 2R2MB 1FPHH 1TOCB 3MU4A 1H1BA 2C3SA 1Y3XA 3GCHB 1RXPA 3SJ8A 1GMCF 1QA7A 1WU1A 5C5NA 1AN1E 1P06A 3MH6A 1BHXB 1EASA 3ZYDA 3BEIB 3ATMA 4MNXA 4MDSA 3ENSB 4X1RU 5HYOA 4WMDA 3R3GB 1HLTH 4FUJA 1O5EH 1QB9A 1NPMA 1G32B 1GG6B 2ZWLH 5JBCS 2J92A 1VITH 4I32A 2CF8H 5H4IB 4RKOB 4ZKSU 2RA3A 3SZNA 1H4WA 1C5UA 1DWDH 1TLDA 2Z6BD 1FIWA 3P6ZB 1MBQA 1GJ7B 4R0IA 2I6QA 4CRGA 4AB9A 4X0WU 1AI8H 4GHQA 4NCYA 1QBOA 1ZRKA 1SI5H 5HM9A 3ESTA 3OX7U 4INLA 2YOLA 3MMGA 2NU2E 1TX8A 1ELFA 3SBKA 4AFQA 5C1XA 1HRTH 3MH5A 2ODPA 2BHGA 5GXPA 4O97A 3PTBA 2OC8A 1SL3A 2AH4X 2SFAA 2QCYA 3FP6E 3A85A 3RXPA 1G9IE 3QZRA 1LVOA 3V7TA 2Z7FE 5DP8A 3RC5A 4FXGH 1Y3WA 1Y5UT 1EB1H 2FYQA 4XSKU 2VVCA 3SI4H 1JOUB 2ZHQH 3UUZA 2BYAX 3SV2H 1G30B 3B23B 2W5EA 1ESTA 1J16A 1L2EA 4X8TH 2OTVA 2ZFQH 4DURA 1O33A 2BMGB 1HAVA 3P8OA 1EZQA 3Q76A 1XX9A 3RMOH 4E06H 2W7SA 1C1SA 2O8LA 1SQOA 3I78A 2VIWA 1GBHA 3RXRA 5JDUB 1QJ1B 2W26A 2BD3A 1DOJA 1H9LB 3KN2A 4VGCC 1UJ1A 2XBYA 1XMNB 1BMMH 1TMBH 1A0HB 5JBTA 1DPOA 4CREA 3P8NA 4YT6H 3ZVCA 2F9BH 1J17T 1MMJN 4DJZB 3GY5A 3M5OA 5FCKA 1EP6A 4JCNA 4BAQB 1O2QA 1G3DA 2TPIZ 3TNTA 1V2QT 3ODFA 4AYYB 2BDBA 2H9TH 4K60A 3NZIA 3NK8A 2XYAA 3EAJA 1OS8A 4GCHG 1SLUB 4NA8A 1O3FA 4O03A 3BTEE 4AGJA 2IOTA 5B6OA 3W94A 3FAOA 1P2IA 1C5SA 1LKBA 2R3UA 3A82A 1O2IA 1QA0A 4YZUA 1NM6A 1ACBE 1C4V2 1HAOH 2ZPQA 2P8OC 1L1GA 3DHKH 3ZZ7A 2NU1E 2AS9A 1DLKB 3SJIA 4Q7YA 1UK2A 3M36A 3ZVBA 1M9UA 1QJ7B 1F7ZA 4YM9A 1H8IH 3TK9A 1O5AB 1HJ9A 1SBWA 1TB6H 4WXIA 1PPGE 3B9FH 1Z1JA 1N6XA 2LNCA 1AB9B 1KDQB 4OGXA 4HZHA 3RU4E 1DANH 1PQ5A 3GCTF 1HAZB 1YPMH 1O35A 4IN2A 2A1DB 5G4BA 1UVUH 1GVLA 3T62A 1S81A 2BVSH 1EAUA 1CU1A 3UQVA 1QY6A 4KP0A 1O3JA
chains in the Genus database with same CATH superfamily
5IK2D 3SGBE 4AYVB 2A0QB 1SGCA 1TX6A 2WUCA 5T6GA 1UK4A 1WTHD 4OS7A 1CA0C 1W3CA 4X2XA 1V2LT 2J98A 3RXUA 1S84A 1EQ9A 1P09A 3RXJA 3M35A 3W95A 2FOBA 3GY7A 3PRBA 4XFQA 3O8CA 1BMFD 3ZYEA 3ZVEA 1QJ6B 1C2DA 1KLJH 1SSXA 3B8JA 5TJXA 1TA6A 1WAYB 3FZDA 4MPXA 1TNHA 2P59A 3S7HB 3QLPH 2CHAB 1AVXA 2H9HA 3F1SB 4DT7B 4DY7B 1Z1IA 1GDQA 3HKIB 3I77A 1VCPA 3SU4A 2W3KA 2A5IA 3MHWU 1W7XH 1W0ZU 1UTMA 2JJ1D 1L0ZA 2BD8A 1WBGB 1ID5H 3T28A 2P16A 1LPZB 5T1VA 1LKAA 3MFJA 2BX3A 2Y5FA 1RD3B 3WY8A 3GS9A 4CH8B 1GHBG 3AK5A 3FO8D 2OC1A 3RXBA 4O9VA 3QX5H 1YPGH 4NIYA 4DT4A 3ATIA 1CHOF 2Y82A 1EAXA 3TNSA 3VXEH 1UTOA 2EEKA 1HAXB 5BPEA 4ZXYH 2BDAA 2K1QA 1GBDA 1D4PB 1GJAB 3OY6U 2Z3DA 1BMLA 3LONA 1GHVH 1RGQA 5JBBS 1GI6A 4GAWA 3VB3A 1O30A 1V2OT 1WDIA 3IITA 4K1TA 2FOCA 1NFYA 4MPUA 4GPGA 4K8YA 5CHBA 1P02A 1TGSZ 1O5CB 1TMTH 3MU5A 5DGJA 5HM2A 1SOTA 2PLXA 2ZGHA 3UQOA 1GBEA 2H2ZA 1H9HE 1YPHE 1O3CA 1ZTLA 3SUEA 2OUAA 4NWLA 2EA3A 1YY3A 1GJ4H 4ABIA 1CGJE 1C5RA 1JXPA 1O31A 3TH3H 1C1MA 4LXBH 1K1LA 5L6NH 1BB0B 1OP8A 4Q80A 1DUAA 1GCTB 1O3NA 1P2JA 4CRCA 3MH4A 1P8VC 2AGGX 4D7FA 1LDTT 2GVFA 1FAXA 3VGCB 1P11E 3M7UA 1NN6A 3CS7A 4BXWA 4BNRA 5A0AE 1SLWB 2WZQA 1H8HD 3UOUA 3KYGA 3A8DA 2FP7B 5HIYA 2ALPA 1QNJA 1HGTH 3SUGA 1O34A 5ESTE 4X2WA 1MAYA 1SG8B 4IC6A 3GY8A 1YPHC 1RTLA 1C2FA 1BDAA 1OYTH 1MCVA 4ZHAA 3SJ9A 4NIVA 3H09A 2ZHWH 4MQAA 3MNSA 2H5CA 1HCGA 4I7YH 1F5LA 1BQYA 4MG3A 1O2LA 1VR1H 4D9QA 1YBWA 2V0BA 1LCYA 1TFXA 3KQCA 5F8XA 4R8TB 1AFQC 4INHA 1TPSA 1ANDA 1DM4B 2OC7A 2NWNA 2GJGA 3GY6A 3M61U 4XBCA 3A7ZA 2YMSB 4JYTA 2GKVE 2I6SA 1S6HA 2Y5HA 2VIVA 5DP3A 1QCPA 4OS1A 4JZ1A 4XD7D 4ZUHA 2ZCLP 2TGAA 2C8WB 5A2MH 1BBRE 1C4U2 4ASUD 1E1RD 1J8AA 3GDVA 1A3BH 4TY6A 4JZFH 2VNTA 1WYKA 2QGRA 1GI1A 1KDQA 4OS4A 1CQQA 1CT4E 1G3BA 1O38A 1VJ9U 3E16B 3A88A 1HAYB 3F3BA 3QGJA 4WMFA 2BOKA 4ABDA 1D3QB 3L6PA 5C1YA 3TJNA 1K0HA 5AFYH 2V3MA 3BIUH 3TLOA 1PYTC 4LZ1H 3RXQA 4UDWH 1OXGA 1GHXH 1O5BB 5B6LA 2LPRA 3K6ZA 2JKHA 1ZRBA 1JRTA 1MTWA 1S5SA 1GJ9B 1J9CH 1YKTA 3E1XB 3TH2H 1P0SH 2GV6A 1E35B 1RTKA 1GHAF 2BY7X 3U98H 4MNYA 2UUFB 3Q3KA 3GICB 3M3TA 5BRRE 4KTSA 1MCTA 1SHYA 1W14U 2Y7XA 4CH2B 5JB9S 1MD7A 2ANYA 3RP2A 2CJIA 2HRVA 2VB0A 4IS5A 2XNIA 3TPIZ 5EODA 1AB9C 2JETC 1O2YA 3DFLA 3MU0A 2P93A 2YNAA 3MWIU 4RN6A 3ZVDA 1BT7A 1UTLM 4FUEA 1FN6A 1PFXC 3P8FA 4X6NA 3TJVA 4A1TA 1O0DH 4ASHA 1WCZA 2WYJA 3BTTE 4H42U 1KXEA 1EB2A 1DWEH 1GDUA 2ZTZA 1DSTA 1E34B 2PW8H 4AFZA 1SC8U 1BHXF 1TA2A 2ZTXA 2M5TA 1B0FA 1TIOA 2ILNA 2G5VA 3KYFA 5CHAC 2TGTA 4A1VA 2KX4A 3ATLA 4VGCB 5LGOA 1RTFB 2FWWA 1WV7H 5AF9H 3BG8A 2SGEE 1HUTH 3PMJA 3U1IB 3W1EA 1NS3A 4P02A 3MU8A 1FAKH 2ZDLA 1ABIH 5CMXH 4NIWA 1CT0E 2F43B 2Q1JA 4NWKA 3BV9B 1BBRK 1IQEA 2CHAC 4SGBE 1A0JA 1EZXC 5DG6A 3OY5U 1TNGA 4XE4A 3FOAA 1BRCE 1GBAA 3U69H 1C5LH 1D9IA 4IMQA 1ANCA 5L30H 1AU8A 2VH0A 4FUFA 1GJ8B 1T4VH 3FP8E 2EI8A 1AKSA 2PKSB 1C2LA 1TE0A 1O3AA 1TBQH 2IPHA 5LPEA 1O3PB 1QL8A 2GTBA 3T5FH 4WWYA 1P01A 1HB0B 1QB1A 1O2PA 3M5LA 3D23A 2LP6A 1H8ED 2XRCA 4AGKA 2XW9A 4ESTE 1VGCB 1W8BH 1QQ4A 2VIOA 1IQFA 2QC2A 1V2MT 2GMTC 3A87A 3KF2A 2PGBB 1DXWA 2R0LA 3SGAE 2WYGA 4KTUA 1QFKH 2ZDVH 4X8UH 8ESTE 3CENA 2BVRH 1G2MA 3RUOA 1GJ6A 1O2SA 3SU2A 1AE5A 4Y8ZA 5FL7D 1IQJA 3LT3A 2XWAA 1W0YH 5GIBA 2Z9IA 4ACBA 1KY9A 4K69A 2Z9JA 2FI3E 1UCYE 1GCTC 1NT1A 1LVBA 3BN9A 2ZDNA 3QUMP 5A8ZA 2FMJA 1KMHB 2IPQX 5HIZA 1BRBE 2XTTB 4A1XA 3VGCC 1GMDG 2FX4A 1BMNH 2ZKSA 3GY3A 3RLYH 4BAKB 2A7JA 3FANA 1ZHRA 1LPGB 4F4OC 1GVKB 1OHHD 1GPZA 3O8DA 3ZVGA 2AMPA 1ELGA 3OYPA 1AWHB 3GDSA 3N99A 2OBOA 1ZJKA 1XUJA 3P70B 3RM2H 5GWZA 1ARCA 4YOGA 3BTFE 2GX4A 2PFEA 1NROH 4UFGH 1LVYA 1YPEH 2A32A 4DIIH 9LPRA 1IQLA 2VWNA 1TWXB 4AN7A 2FPZA 1O3EA 2NU3E 2ZIQH 2ZGJA 2AERH 2F83A 5EOKA 4TWYA 5DP9A 2HPPH 1C5OH 1JBUH 3URCA 2TRMA 2FM2A 1ELTA 3RXCA 1HXEH 4Y71A 1SQTA 4IC5A 3C1KA 1FI8A 2BZ6H 4INKA 4Q2KA 5DP5A 2A4RA 3HGNA 4ABJA 5DP4A 5ESBA 2ZDMA 1A46H 3ZIAD 5HKKD 3TJOA 1LVMA 1P3CA 3SU3A 2BD7A 2FDAA 1C4Y2 2J98B 3E0PB 1GMHF 3SQEE 1LPKB 1OKXA 4FU7A 1W2KH 3G01A 1O2GH 5GJ4B 3QGNB 7LPRA 3PV4A 2FO9A 2WPLS 2ZA5A 1FPCH 3ZZ5A 1W0JD 1MQ6A 5FXLA 3SI3H 5IDKA 1C2GA 2G5NA 3SV6A 3RMMH 5PTPA 1GHWH 1IAUA 2XCFA 1ETSH 3EE0B 3A7WA 2EC9H 1BBRH 4Y7AA 2FX6A 1S0RA 4CR5A 3R0FA 4TPIZ 3A81A 3M7TA 1MTNB 1ZSKA 3LKWA 3RXVA 1C2KA 4BANB 2H9EH 2PKAB 3STIA 1IQNA 2AHME 4TSFD 4Z0KA 4Y8XA 3A7YA 4X1SU 2ZFTA 2WUBA 3SNCA 1O3IA 3SO3A 3M3SA 3UWIA 3ZZ3A 6GCHF 3TIUA 2GV7A 1UCYK 5EW2H 2FYRA 4K3JA 2XC0A 3SV7A 1TPOA 1PJPA 3Q3YA 1HAHH 1U6QA 1P2KA 3BEUA 4GUXA 3SNDA 3PO1B 4ZMAH 1P2OA 2QXJA 2PR3A 1KIGH 1SOZA 4MVNA 1OX1A 3RXKA 5FHTA 4B75A 1C1TA 3LH1A 5C0TA 1HJAB 1GJ5H 5DKMA 3LGIA 1P57B 4M9FA 1O2WA 4GCHF 1V2WT 1LHCH 3TVJB 2GT8A 1WSSH 3VEQB 3UR9A 1E1QD 1HPGA 1AFQB 3HKJB 1QRXA 4CRBA 2OXSA 2PTCE 1SLVB 5E0HA 1O3DA 4MNWA 1G3EA 4ABAA 4UFDH 2Z9LA 3L33A 3IWMA 1ZOMA 4YOJA 1NRPH 1H8DH 4P00A 5C3NA 2OQUA 2EY4C 3V0XA 2ZGCA 4CRFA 5E0JA 3TGIE 1YYY1 1SGDE 2HLCA 5EW1H 3E3TA 1DE7H 3AW1A 2ZF0H 3HATH 3UNSA 3QZQA 1GBIA 2RG3A 1F0TA 1J15A 3M37A 1BJVA 2GT7A 3E91A 1BIOA 4B76A 2BVXH 2XBWA 8GCHG 1NRRH 2ZGBH 3F2FA 1C5MD 1C5ZB 2V3HH 4ISOA 3A89A 1X7AC 3F9FA 4BAHB 3NXPA 5DK1A 2R9PA 5C2ZA 1GBFA 2FIRH 3V12A 2OBQA 3U8OH 2PKSC 1AD8H 2CXVA 1K2I1 4M7GA 2A45B 1DVAH 2A4GA 3KQEA 2FOHA 3RMNH 4Q7ZA 1KTSB 2G55A 2ZDAH 2WSSD 1Z7KA 4FUIA 3TGJE 2OD3B 5EJLA 2XCNA 1HNEE 4UD9H 3GISB 1K21H 1E38B 4NZQA 1AUJA 1CSOE 1SPJA 5ETXA 1FIZA 4YOIA 1FMGA 4F49A 1VGCC 3U9AH 4RI0A 1UW7A 1FX0B 1B0EA 2KFWA 3SQHE 2ZPRA 2ANWA 3JZ1B 3UOPA 2HNTE 1P2QA 4KGAA 1LO6A 2OP9A 2JETB 1ANEA 1V2PT 1GGDC 3LOXA 1LMWB 1O39A 1P10A 1NU9A 1SKYE 1ESAA 4JMYA 4X6PA 4CRDA 1EOLA 5FPTA 4IMZA 3BTME 2DUCA 1SGPE 1FN8A 3MO6A 4WH6A 2ZNKH 3VB5A 1SFIA 3A84A 3S9CA 2R0KA 1PPBH 1E36B 4HTCH 1OWIA 1OYQA 2NU4E 3FP7E 2G51A 1YLNA 5JYIA 5CHAB 2KAIB 3M3VA 3U8RH 2A2QH 1FY3A 3PMHB 1ZTKA 1AWFH 3Q3XA 1GI2A 1P05A 2FS9A 2C4FH 1A5GH 1UTQA 1C2MA 2HNTC 1Y5AT 2A7CA 1V2KT 2FLBH 3ZZ8A 4CBOA 1EXFA 5EQRA 1C1UH 5JPMH 1DXPA 3RXGA 3BEFB 1UCYH 1GI0A 1TGCA 5EPYA 4E05H 3E6PH 2PWXA 2D1JA 2F4LA 2BY5X 5CDFE 1CT2E 4A7IB 1OWHA 1YF4A 1ZPBA 2PKAA 3BTWE 3OEED 4K8BA 1EZSC 3TK6A 1EPTB 4Y79A 1QRWA 4X8VH 1SLXB 3UPEA 1Y59T 2ZU2A 1QQUA 1Y3UA 1Z8JB 1TALA 4U32A 1HAIH 3LGYA 3LH3A 2ZTYA 1J14A 4XBDA 2H1UA 6ESTA 3ZVFA 4FUHA 1SMFE 2HLDD 3V3MA 3GCTG 2PUXB 2BOHB 1O2ZA 5GPIB 1TGTA 4WY3A 2FESH 2J34A 1RIWB 4MPWA 3UREA 3K6YA 4NFEA 3LJJA 2J38A 1YPJH 3RXOA 2VVVA 2SGPE 2GMTB 2Y81A 1GI7B 4RSPA 5LH8A 1AVWA 1GBTA 1Y5BT 2CF9H 3F6UH 4K1SA 4AFUA 1BJUA 1TMUH 4MLFB 3N7EA 4YLUA 2EQNA 2QF3A 4X1QU 3RXTA 4ZH8A 2GCHG 1MTNC 5I46H 3LGWA 1HJ8A 1UVSH 1VJAU 3S9AA 1TBZH 2PP6A 1AKSB 2BTCE 6CHAB 1K9OE 3FFGA 5DO4H 4FVBA 1TX7A 1ANBA 3ZZ6A 3PMBB 4FUBA 1UMAH 1HBTH 1TOMH 3AW0A 2BY6X 4OS2A 3F0PA 4JK6A 4ABFA 3OTJE 2G4UA 1PQ8A 2FEQH 2FODA 2ODYB 2LELA 1E37B 4LOYH 3A86A 1INCA 4FUDA 3PO1C 3SNEA 4KKDA 5AFZH 4ZKOU 2GZ8A 1AVGH 1E0FD 1GHZA 1PQAA 3F2GA 1UVTH 5I25A 1HJAC 1YLCA 1CHOG 1XXFA 2ZCHP 2QV1A 5A0CA 2GZ9A 5KEDA 1NBMD 1EAWA 3ZZCA 1AFEH 1Y3YA 3GOVB 4NSYA 1FLEE 1ZMJA 4YESB 2FI4E 4ABBA 2ZHFH 1KXBA 5EXMA 1O3OA 4H6SB 1K1MA 1O5FH 4D7GA 1YP9A 3S9BA 3HK3B 5FX5A 5TCAA 2G81E 3EE7A 4XOJA 1OPHB 3M7QA 4NG9H 1XUHA 3ZZBA 1C5XB 1XXDA 1ELEE 1WQVH 2BDGA 2FI5E 4RT1A 3F9HA 1OOKB 3SORA 2R3YA 4B71A 2FTLE 2FXRA 3GY4A 3OEHD 4K5ZA 1O2VA 4TPYA 1BUIA 3A7VA 4X1PU 5TCCA 3QK1A 1DY8A 3SUFA 4AX9H 1YCPM 1C5YB 2V6NA 1FUJA 3S0NA 2BD5A 2AMDA 5IYTA 1D3DB 1JMOH 3H7OA 4FU8A 1ELCA 2NU0E 5DP6A 3LU9B 1QL7A 3STJA 3BG4C 1EX3A 1W11U 1N6YA 1JIMA 4XDEA 2C8ZB 1O3HA 5C5OA 3MQKC 4HFPB 1DWCH 3TGKE 1IQMA 2P94A 4HGCA 1A2CH 1O32A 1T8MA 1GL1A 2KAIA 4DGJA 1COWD 2F9VA 1D3PB 1K28D 2HNTF 2ZQ1A 1V2ST 2WPIS 3MU1A 3PV5A 3P92A 4LK4A 1P04A 3D49H 1YLDA 2VIQA 3PTNA 2GP9B 4JYVH 4AG1A 2J2UA 1O2XA 2Y80A 3SU0A 1C9TA 2XOKD 2FOEA 4IW4E 4Y0ZE 3RXFA 4RT0A 5A0BA 1SGFG 1TRNA 3OAAD 3P95A 5DPAA 1ORFA 2BY9X 1C1OA 2FZZA 2HOBA 2ZGXH 1BTXA 2XBXA 3U8TH 7ESTE 3P17H 3AASA 2BDHA 1SB1H 1F0RA 2KCAA 3SV9A 1DT2A 2EI6A 1EPTA 5FPSA 2VWLA 5C1UA 4Y0YE 1GBBA 2G52A 4UFFH 1BA8B 1WTGH 2JH0D 1KLTA 3GY2A 1QGFA 1QL9A 3QO6A 4OS6A 3O8RA 3FZZA 5A8YA 4Y8YA 1A3EH 2ZO3H 2K0QA 2QXIA 3Q00A 4H6TA 2UUYA 1O2RA 3CS0A 1P3EA 3N7DA 4MTBA 1ARBA 4B2BA 2HPQH 1TABE 2Z3EA 1PPEE 1T8LA 4U01A 3DSPA 1GI5A 2BY8X 5JBAS 2ESTE 2ZU4A 2TGDA 1GHAG 4MNVA 4LZ4B 4IBLH 1T31A 4FU9A 2VGCB 1FQ3A 2THFB 5L2ZH 2ZEBA 3FVFB 7GCHF 4NA7A 1S0QA 4FUGA 3MH7A 1H9IE 2VJ1A 5F8ZA 5C67A 2XXLA 3VB4A 1UTPA 1VCQA 2ZC9H 1A4WH 3TH4H 1EPTC 1ZGIA 2RDEA 1XVOA 2BDCA 1HV7A 5EU8A 1MU6B 2CGAA 4I8JA 5E8EH 2ZU1A 1EAIA 4SGAE 2J94A 1GDNA 5AHGH 5F8TA 1FZZA 1RFNA 1LQEA 5F03A 1EATA 3LJOA 1RIWC 2O8TA 5JB8S 1TNKA 3T29A 5K0HA 1L1JA 1WXRA 1LQDB 2J97A 5F6MA 1EJMA 1MUEB 4I86A 2VWMA 1ZMLA 5FX6A 4NIXA 3DA9B 1XKAC 2ZFSA 1MAXA 1GGDB 1LHDH 1EOJA 1AGJA 3T27A 3LIWA 2RA0A 2BDIA 1F92A 1UHBB 1QHRB 1Q2WA 4YT7H 4YTAA 4UONA 1A0LA 6CHAC 1CBWB 2J95A 3T25A 3ELAH 4AFSA 2TIOA 1G36A 3RXDA 3H7TA 2SGQE 3V13A 1S82A 2F9OA 1C1WH 2VIPA 5EXLA 3DD2H 1L4ZA 1O2KA 2BD2A 3UAIC 4U30A 1YPLH 1P2NA 4ZAEA 1BTZA 4JZDH 3OTPA 3MNCA 4HI3A 4BXSA 2AIQA 2SNWA 3PLKA 1FY5A 2PUQH 1NRSH 2OCVB 1ZHMA 2OC0A 4ZKNU 1P2MA 2ANMH 2P3FH 2QF5A 1T8NA 1IQHA 1XUIA 3ZZDA 2J4IA 2ZP0H 1GJBB 2M2AA 3DT0H 1O2JA 3ODDA 1O3BA 4JZEH 5GCHG 3ZZ9A 3RXSA 4I8HA 3LGUA 4A92A 1KXAA 5GDSH 1A5HA 3K9XB 1OWJA 3MYWA 4MPVA 1UTKA 5DJ7A 4AOQA 4ISLA 4GHTA 1D3TB 3BTHE 1BOQA 2OINA 1Z6EA 1XUKA 1THSH 1C2JA 1LTOA 1GCDA 1RJXB 1ZHPA 2V7QD 3KNXA 1QZ8A 1DITH 1HDTH 4I8LA 2BQWB 4DW2U 1GBCA 2D8WA 2C8XB 2FOAA 2ZFPH 5E0GA 4NSVA 4NZLA 1SGNE 3TJUA 3D65E 2DE9A 5J4SA 3FN8A 4U2WA 3RLWH 1BITA 1EFRD 2F9NA 1QURH 4X2VA 1SGYE 1TPPA 3UB0A 3KCGH 4B74A 4ISHH 1QTFA 2BD9A 2HVXA 2ALVA 2BD4A 3VFEA 1TRMA 1SR5C 3SW2B 2P3TB 4CR9A 1NESE 2ZU3A 3PV2A 4B6FA 4ACAA 4GSOA 1VITG 2PHBA 3EA8A 3SZEA 1DWBH 2VBCA 1ZR0A 5F53A 3GYLB 2UWLA 4Q4LA 2BLOA 1C2HA 2F9UA 2SGDE 1QR3E 5ABWA 1BRAA 2SGFE 2W7UA 1A1RA 1NO9H 1LHEH 1C5VA 3T26A 1FY1A 4A6LA 1TQ0B 4B1TA 8GCHF 5EG4A 1SGTA 2GZ7A 1QB6A 4GVUA 1ZMNA 1TQ7B 2IJD1 2WPMS 1TRYA 4J1YA 4ZHLU 3M5MA 1GMCG 2KM0A 4I8GA 3TU7H 1FONA 3KL6A 1VCWA 2AYWA 1GI8B 1GMHG 1O2NA 3I29A 2QA9E 1Z8GA 5EPNA 4X1NU 1NY22 3E8LA 3VB7A 1SHHB 1OWKA 1BTPA 1ZSJA 3LGVA 1GL0E 4YO9A 3BTDE 1N8OB 1XUFA 4CHAC 1IHSH 1S85A 3PLBA 1FDPA 1EJAA 3GDUA 2GDDA 2ULLA 4I33A 4ABGA 4IN1A 3JZ2B 1YCPK 1AUTC 1KXFA 2KR7A 1GI3A 2Z9KA 1SQAA 4NA9H 5HXFA 2JH6D 3QWCH 3T2NA 9ESTA 2CV3A 2BDYA 4HG6A 4OM9A 1AIXH 3SN8A 4TYDA 2AGIX 2ZFFH 1TGBA 2FS8A 3A8BA 3OU0A 4ABEA 2BQ6B 2RCEA 3KGPA 1AZZA 5E2OA 1SGFA 4ZXXH 2VGCC 1O5DH 3PLPA 1ABJH 2IN2A 3QN7A 2AMQA 1Y3VA 4BTTB 5DSFA 6GCHG 3BG4B 4IGDA 1BMAA 1V6DA 1L4DA 1D6WA 3UNRA 2UWPA 2UWOA 1UHBA 3LGTA 3VXFH 3NRLA 1L1NA 2Y6TA 1TYNA 3LPRA 1TNLA 4DCDA 2AEIH 1VZQH 2C90B 2A5AA 1MKXK 2OLGA 2C93B 3OE7D 2ZFRH 2ASUB 2EI7A 3DFJA 2KCOA 2ZECA 2YMSD 3MOCA 1K22H 1C5WB 3EDXB 3F9GA 3NWUA 1BTHH 1O36A 3S69A 1V2UT 3BF6H 4NFFA 4THNH 1V2JT 2ZPSA 1CHGA 3PWBA 1GVZA 2D2DA 3GCNA 3LC3A 2WINI 2L6OA 4UFEH 3SJOA 1P12E 1IOEA 3DUXH 3RM0H 2WHXA 1NRNH 1F0UA 3PB1E 1AQ7A 5CE1A 1IQIA 3QTOH 2Q6DA 4KELA 3PMAB 1EZUC 3ATWA 1ETRH 2XC5A 1V2NT 1FNIA 4CRAA 1GHBF 1ZYOA 1NU7B 2HVYB 3ATKA 2F9PA 2ZDKA 1V3XA 1F5RA 5A09A 1K1OA 4Y10E 1CBWC 5E2PA 4O3TA 2F3CE 1K1NA 3NCLA 3SU1A 4B73A 5SGAE 1FV9A 1XM1A 1BZXE 4ZROA 2G00A 2TGPZ 1ZPCA 1A61H 4JK5A 1HYLA 1DX5M 3UNQA 1CE5A 3FKSD 1CGIE 2ZHDA 1GHYH 1ESBA 1NZQH 1B5GH 2ZQ2A 1GBLA 1HIAB 5C20A 1NC6A 1NRQH 1CGHA 1Z6JH 1BTWA 2P3UB 3VPKA 2JH5D 5EQSA 2BXUH 2Q6FA 2J5UA 5FBEA 1O2UA 1CVWH 3ITIA 1KXDA 1T8OA 3ZV9A 1GBMA 5L2YH 4J2YB 2WPHS 2WV9A 2J9NA 5EJZA 3LDXH 4D76A 1ELVA 4ZKRU 3RXAA 1DY9A 1C9PA 1SGEE 2GCHF 3VB6A 4DG4A 3K2UA 1MZAA 3IG6B 1PPCE 1PQ7A 8KME2 3F0OA 4Y7BA 1DFPA 1WUNH 1TONA 2UUKB 5T6FA 1MZDA 2A4OA 1KXCA 3C27B 3PROA 4E7NA 1FJSA 4FVDA 2B5TB 1IQKA 4NGAH 2KCYA 2RDLA 3RC6A 1YM0A 3BTQE 4TT3D 4ZCNA 3TK5A 3F9EA 2BXTH 4DIHH 1AZ8A 2Z3CA 1YCPH 2VH6A 1BTYA 1S83A 1MBMA 2BLVA 1PPZA 2QYIA 4ISIH 5EXNA 1SFQB 1W12U 3GCHC 2KZ4A 2B7DH 1MQ5A 3RMLH 5J4QA 2ZU5A 5FCRA 4E7RG 3WWFA 2STAE 2BZAA 1T7CA 5KGOA 4BTUB 3URDA 1BRUP 1GJCB 2H5DA 1EP5A 1GG6C 2Z9GA 3SNAA 3MTYA 1YWUA 3BSQA 3QDZB 1W10U 4AC9A 3L3TA 1OP0A 3P8GA 1O3KA 3RXMA 2BQ7B 1CO7E 5FPYA 1MKXH 2Q6GA 2A4QA 1CA8B 1SVPA 1N1LA 2ZCKP 1KTTB 1MTVA 1XKBC 1S6FA 1VKYA 3CNRA 1OSSA 3KIDU 2HWLB 3NPSA 4ISNA 6LPRA 1K1IA 3PRDA 3SHAH 2Y7ZA 2L74A 2GCTB 3NUMA 2O8WA 5C94A 3PYHA 3SV8A 4K1EA 1MU8B 2FOMB 2AIPA 3E0NB 3HPTB 1LHFH 1C1VH 2O9QA 1PPHE 3U1JB 2BLQA 3D62A 1JRSA 3OFND 1A5IA 3BIVH 1XVMA 3E90B 2FOFA 3DSOA 2QXHA 3ZVAA 1PPFE 4XRNA 3EYDA 3SU6A 1N8OC 4WVPE 3EQ0H 3GYMA 1OWDA 1FXYA 1OP2A 1HAGE 4AB8A 2A2XH 2CN0H 4AZ2B 2STBE 1UVOA 4TWWA 2D26C 4XBBA 2W3IA 1C1PA 1THRH 1ZPZA 1HXFH 2O8MA 1F2SE 2W6JD 2ZI2H 3GCOA 2C8YB 3H5CB 3KHVA 1GBKA 3RU4T 2OQ5A 2QAAA 1ZLRA 4OGYA 3BTGE 1GJDB 1EUFA 1MKWK 1NTPA 1T32A 1O5GH 3LC5A 3RU4D 1AE8H 2PV9B 1MH0A 2VVUA 1QRZA 2P95A 3EA9A 1TAWA 1GI9B 5T6DA 5K7RA 3N7OA 1O3LA 2H6MA 4WXVA 4B2CA 2VINA 2FLRH 4ZHMU 4UEHH 1QIXB 1ZGVA 1WQSA 2ODQA 4WJG2 1OWEA 1NFUA 1P9SA 2B9LA 2UUJB 3KQBA 2TBSA 1O2HA 3RDZA 2WPJS 1C5QA 3UR6A 1ELDE 2BLWA 1C2EA 1QBVH 3ZZAA 1SGIB 1EKBB 3KEEA 2BB4A 1C5TA 2F91A 5EIYA 1ELAA 2FOGA 4Y76A 1DUEA 4JYUH 2WV4A 4Y11E 1HIAA 3CP7A 3UWJH 3ZZ4A 2CMYA 3SGQE 2R2WU 1TGNA 2ZG0H 4GLYA 3M5NA 1DSUA 3KQDA 1ZSLA 1DS2E 4UE7H 2Z94A 1A7SA 3PM3A 4BTIB 2FTMA 1NFXA 3QTVH 1AMHA 3RXHA 1TNIA 2SNVA 1P03A 5LPRA 1UTJA 3A8AA 1DDJA 4K2YA 1FY4A 1W7GH 3O8BA 4Y6DA 1O2OA 1SGQE 3F68H 1O37A 4X8SH 2WV5A 3SHCH 3AAVA 1YGCH 4CHAB 3EA7A 1BCUH 3ZV8A 2V3OH 5FBIA 4F48B 1EJNA 5FAHA 1G3CA 4YLQH 2XC4A 2RFKC 1GWAA 1MD8A 4X6OA 5AVDA 1Q3XA 2QN5T 2HALA 3MNXA 3RXEA 2A5KA 4DVAU 1Z71A 1C2IA 2A7HA 3UY9A 1KYNA 3A7XA 1IHTH 4RKJB 1C1RA 2PSYA 3A8CA 3RXLA 3HK6B 3RXIA 1JWTA 1KSNA 2A31A 1ETTH 1YPKH 3EGKH 1ZJDA 3SUDA 1C1NA 3MI4A 3A83A 4DOQA 1D6RA 1SGRE 4B6EA 2XWBI 1TNJA 4YXWD 5EJ1A 1B7XB 4BOHA 5A8XA 1KLIH 5DP7A 2VWOA 1LHGH 2HGTH 2Y5GA 3SU5A 1GMDF 3AVZA 2GDEH 3OSYA 2PTNA 5LPFA 1O2TA 4BAMB 3BTKE 5EQQA 2V35A 1G37A 5T3HA 3HGPA 1RS0A 7KMEH 1RRKA 1YC0A 1HAVB 1FY8E 1W13U 1XUGA 2G8TA 4X6MA 4X2YA 3SJKA 2P8OB 1G2LA 4Q7XA 1NFWA 4WMEA 1V2VT 3MO9A 1DICA 3UTUH 1P9UA 1MKWH 2VIDA 3MO3A 1MTSA 4OS5A 4WH8A 1W0KD 2ZZUH 5KECA 3Q77A 3PWCA 1UTNA 2OK5A 1T4UH 1PYTD 4B2AA 3DSGA 3RC4A 5HGGA 1C5PA 2QY0B 5GNDA 2JIZD 2DE8A 2G4TA 4I8KA 5GCHF 4FUCA 2AGEX 4FETA 4D8NA 1F0SA 1TBRH 2WPKS 1WOFA 2QXGA 4I31A 4BAOB 3MNBA 1UVPA 3TITA 4TY7A 1Q31A 7GCHG 3AAUA 4O3UA 2ZHEH 1TPAE 1AY6H 3NKKA 4Z6AH 5EGMA 1QBNA 2BM2A 4KTCA 4CBNA 1ZTJA 1ELBA 4D9RA 2WPDD 4WF8A 2GCTC 3S7KB 2AFQB 3A80A 5DN6D 1CA0B 3WWBA 1Z8RA 4A5TS 1C5NH 2PGQB 1F5KU 2QF0A 1THPB 1MTUA 4AORA 5C17A 3UIRA 2GD4B 1K1JA 4H4FA 1IQGA 1E79D 2PSXA 2QF4A 2QIQA 2B8OH 3UFAA 1Y8TA 4PROA 1AHTH 2O8UA 1GBJA 2VU8E 4JZIA 1O3MA 2IJOB 2ANKH 1BTUA 1ZZZA 3SNBA 1JIRA 1V2RT 1VITF 4ABHA 1UO6A 1Z8IB 1V2TT 1GI4A 1O3GA 5HMAA 1HFDA 8LPRA 1AO5A 2SGAA 3A7TA 3SOSA 2B0FA 3DCLA 2YNBA 2JDID 1C1QA 1DLEA 3K65B 1O2MA 4QT8C 2YMSC 2BX4A 2GGVB 4AG2A 2XBVA 1HAPH 1K1PA 1UK3A 2R2MB 1FPHH 1TOCB 3MU4A 1H1BA 2C3SA 1Y3XA 3GCHB 1RXPA 3SJ8A 1GMCF 1QA7A 1WU1A 5C5NA 1AN1E 1P06A 3MH6A 1BHXB 1EASA 3ZYDA 3BEIB 3ATMA 4MNXA 3U28C 3KQ5A 3ENSB 4MDSA 4X1RU 4WMDA 3R3GB 5HYOA 1HLTH 4FUJA 1O5EH 4FOUC 1QB9A 1NPMA 1G32B 1GG6B 2ZWLH 5JBCS 2J92A 1VITH 3WW7A 2XNDD 4I32A 2CF8H 5H4IB 4RKOB 4ZKSU 2RA3A 3SZNA 1H4WA 1C5UA 1DWDH 1TLDA 2Z6BD 1FIWA 3P6ZB 1MBQA 1GJ7B 4R0IA 2I6QA 4CRGA 4AB9A 4X0WU 1AI8H 4GHQA 4NCYA 1QBOA 1ZRKA 1SI5H 5HM9A 2W6ID 3ESTA 3OX7U 4INLA 2YOLA 3MMGA 2NU2E 1TX8A 1ELFA 3SBKA 4AFQA 5C1XA 1HRTH 3MH5A 2ODPA 2BHGA 5GXPA 4O97A 3PTBA 2OC8A 1SL3A 2AH4X 2KCPA 2QCYA 2SFAA 3FP6E 3A85A 3RXPA 1G9IE 3QZRA 1LVOA 3V7TA 2Z7FE 5DP8A 3RC5A 4FXGH 1Y3WA 1Y5UT 1EB1H 2FYQA 4XSKU 2VVCA 3SI4H 1JOUB 2ZHQH 2K8IA 3UUZA 2BYAX 3SV2H 1G30B 3B23B 2W5EA 1ESTA 1J16A 1L2EA 4X8TH 2OTVA 2ZFQH 1SQRA 4DURA 1O33A 2BMGB 1HAVA 3P8OA 2QE7D 1EZQA 3Q76A 1XX9A 3RMOH 4E06H 2W7SA 2JJ2D 1C1SA 2O8LA 3F2HA 1SQOA 3I78A 2VIWA 1GBHA 3RXRA 5JDUB 1QJ1B 2W26A 2BD3A 1DOJA 1H9LB 3KN2A 4VGCC 1UJ1A 2XBYA 1XMNB 2CK3D 1S6LA 1BMMH 4F55A 1TMBH 1A0HB 5JBTA 1DPOA 4CREA 3P8NA 4YT6H 3ZVCA 2F9BH 1J17T 3SYJA 1MMJN 4DJZB 3GY5A 3M5OA 5FCKA 1EP6A 4JCNA 4BAQB 1O2QA 1G3DA 2TPIZ 3TNTA 3VG8A 1V2QT 3ODFA 4AYYB 2BDBA 2H9TH 4K60A 3NZIA 1NBME 3NK8A 2XYAA 3EAJA 1OS8A 4GCHG 1SLUB 4NA8A 1O3FA 4O03A 3BTEE 4AGJA 2IOTA 5B6OA 3W94A 3FAOA 1P2IA 5C0UA 1C5SA 1LKBA 2R3UA 3A82A 1O2IA 1QA0A 4YZUA 1NM6A 1ACBE 1C4V2 1HAOH 2ZPQA 2P8OC 1L1GA 3DHKH 3ZZ7A 2NU1E 2AS9A 1DLKB 3SJIA 4Q7YA 1UK2A 3M36A 3ZVBA 1M9UA 1QJ7B 4Z1MD 1F7ZA 4YM9A 1H8IH 3TK9A 1O5AB 1HJ9A 1SBWA 1TB6H 4WXIA 1PPGE 1MABB 3B9FH 1Z1JA 1N6XA 2LNCA 1AB9B 1KDQB 4OGXA 4HZHA 3RU4E 1DANH 1PQ5A 3GCTF 1HAZB 1YPMH 1O35A 4IN2A 2A1DB 5G4BA 1UVUH 1GVLA 3T62A 1S81A 4Q63A 2BVSH 1EAUA 1CU1A 3UQVA 1QY6A 4KP0A 1O3JA
chains in the Genus database with same CATH topology
3SGBE 4AYVB 2A0QB 1SGCA 1TX6A 2WUCA 5T6GA 1UK4A 1WTHD 4OS7A 1CA0C 1W3CA 4X2XA 1V2LT 3RXUA 1S84A 1EQ9A 1P09A 3RXJA 3M35A 3W95A 2FOBA 3GY7A 4XFQA 3O8CA 3ZYEA 3ZVEA 1QJ6B 1C2DA 1KLJH 1SSXA 3B8JA 5TJXA 1TA6A 1WAYB 3FZDA 4MPXA 1TNHA 2P59A 3S7HB 3QLPH 2CHAB 1AVXA 2H9HA 3F1SB 4DT7B 4DY7B 1Z1IA 1GDQA 3HKIB 3I77A 1VCPA 3SU4A 2W3KA 2A5IA 3MHWU 1W7XH 1W0ZU 1UTMA 1L0ZA 2BD8A 1WBGB 1ID5H 3T28A 2P16A 1LPZB 1LKAA 3MFJA 2BX3A 2Y5FA 1RD3B 3WY8A 4CH8B 1GHBG 2OC1A 3RXBA 4O9VA 3QX5H 1YPGH 4NIYA 3ATIA 1CHOF 2Y82A 1EAXA 3TNSA 3VXEH 1UTOA 2EEKA 1HAXB 5BPEA 4ZXYH 2BDAA 2K1QA 1GBDA 1D4PB 1GJAB 3OY6U 2Z3DA 1BMLA 3LONA 1GHVH 1RGQA 5JBBS 1GI6A 4GAWA 3VB3A 1O30A 1V2OT 3IITA 4K1TA 2FOCA 1NFYA 4MPUA 4GPGA 4K8YA 1P02A 1TGSZ 1O5CB 1TMTH 3MU5A 5DGJA 5HM2A 1SOTA 2PLXA 2ZGHA 3UQOA 1GBEA 2H2ZA 1H9HE 1YPHE 1O3CA 1ZTLA 3SUEA 2OUAA 4NWLA 2EA3A 1GJ4H 4ABIA 1CGJE 1C5RA 1JXPA 1O31A 3TH3H 1C1MA 4LXBH 1K1LA 5L6NH 1BB0B 1OP8A 4Q80A 1DUAA 1GCTB 1O3NA 1P2JA 4CRCA 3MH4A 1P8VC 2AGGX 4D7FA 1LDTT 2GVFA 1FAXA 3VGCB 1P11E 3M7UA 1NN6A 3CS7A 4BXWA 4BNRA 5A0AE 1SLWB 3UOUA 3A8DA 2FP7B 2ALPA 1QNJA 1HGTH 3SUGA 1O34A 5ESTE 4X2WA 1MAYA 1SG8B 4IC6A 3GY8A 1YPHC 1RTLA 1C2FA 1BDAA 1OYTH 1MCVA 4ZHAA 3SJ9A 4NIVA 2ZHWH 4MQAA 3MNSA 2H5CA 1HCGA 4I7YH 1F5LA 1BQYA 4MG3A 1O2LA 1VR1H 4D9QA 1YBWA 2V0BA 1LCYA 1TFXA 3KQCA 5F8XA 4R8TB 1AFQC 4INHA 1TPSA 1ANDA 1DM4B 2OC7A 2NWNA 3GY6A 3M61U 4XBCA 3A7ZA 4JYTA 2GKVE 2I6SA 1S6HA 2Y5HA 2VIVA 5DP3A 1QCPA 4OS1A 4JZ1A 4ZUHA 2ZCLP 2TGAA 2C8WB 5A2MH 1BBRE 1C4U2 1J8AA 3GDVA 1A3BH 4TY6A 4JZFH 2VNTA 1WYKA 2QGRA 1GI1A 1KDQA 4OS4A 1CQQA 1CT4E 1G3BA 1O38A 1VJ9U 3E16B 3A88A 1HAYB 3QGJA 4WMFA 2BOKA 4ABDA 1D3QB 3L6PA 5C1YA 3TJNA 5AFYH 3BIUH 3TLOA 1PYTC 4LZ1H 3RXQA 4UDWH 1OXGA 1GHXH 1O5BB 2LPRA 3K6ZA 2JKHA 1ZRBA 1JRTA 1MTWA 1S5SA 1GJ9B 1J9CH 1YKTA 3E1XB 3TH2H 1P0SH 2GV6A 1E35B 1RTKA 1GHAF 2BY7X 3U98H 4MNYA 2UUFB 3Q3KA 3GICB 3M3TA 5BRRE 4KTSA 1MCTA 1SHYA 1W14U 2Y7XA 4CH2B 5JB9S 1MD7A 2ANYA 3RP2A 2CJIA 2HRVA 2VB0A 4IS5A 2XNIA 3TPIZ 5EODA 1AB9C 2JETC 1O2YA 3DFLA 3MU0A 2P93A 2YNAA 3MWIU 4RN6A 3ZVDA 1BT7A 1UTLM 4FUEA 1FN6A 1PFXC 3P8FA 4X6NA 3TJVA 4A1TA 1O0DH 4ASHA 1WCZA 2WYJA 3BTTE 4H42U 1KXEA 1EB2A 1DWEH 1GDUA 2ZTZA 1DSTA 1E34B 2PW8H 4AFZA 1SC8U 1BHXF 1TA2A 2ZTXA 2M5TA 1B0FA 1TIOA 2ILNA 2G5VA 5CHAC 2TGTA 4A1VA 5LGOA 3ATLA 4VGCB 1RTFB 2FWWA 1WV7H 5AF9H 3BG8A 2SGEE 1HUTH 3PMJA 3U1IB 1NS3A 3MU8A 1FAKH 2ZDLA 1ABIH 5CMXH 4NIWA 1CT0E 4NWKA 2Q1JA 3BV9B 1BBRK 1IQEA 2CHAC 4SGBE 1A0JA 1EZXC 5DG6A 3OY5U 1TNGA 4XE4A 1BRCE 1GBAA 3U69H 1C5LH 1D9IA 4IMQA 1ANCA 5L30H 1AU8A 2VH0A 4FUFA 1GJ8B 1T4VH 3FP8E 2EI8A 1AKSA 2PKSB 1C2LA 1TE0A 1O3AA 1TBQH 2IPHA 5LPEA 1O3PB 1QL8A 2GTBA 3T5FH 4WWYA 1P01A 1HB0B 1QB1A 1O2PA 3M5LA 3D23A 2XRCA 4AGKA 2XW9A 4ESTE 1VGCB 1W8BH 1QQ4A 2VIOA 1IQFA 2QC2A 1V2MT 2GMTC 3A87A 3KF2A 2PGBB 1DXWA 2R0LA 3SGAE 2WYGA 4KTUA 1QFKH 2ZDVH 4X8UH 8ESTE 3CENA 2BVRH 1G2MA 3RUOA 1GJ6A 1O2SA 3SU2A 1AE5A 4Y8ZA 1IQJA 3LT3A 2XWAA 1W0YH 5GIBA 2Z9IA 1KY9A 4K69A 2Z9JA 2FI3E 1UCYE 1GCTC 1NT1A 1LVBA 3BN9A 2ZDNA 3QUMP 5A8ZA 2FMJA 1BRBE 2XTTB 4A1XA 3VGCC 1GMDG 2FX4A 1BMNH 2ZKSA 3GY3A 3RLYH 4BAKB 2A7JA 3FANA 1ZHRA 1LPGB 4F4OC 1GVKB 1GPZA 3O8DA 3ZVGA 2AMPA 1ELGA 3OYPA 1AWHB 3GDSA 2OBOA 1ZJKA 1XUJA 3P70B 3RM2H 5GWZA 1ARCA 4YOGA 3BTFE 2GX4A 2PFEA 1NROH 4UFGH 1LVYA 1YPEH 2A32A 4DIIH 9LPRA 1IQLA 2VWNA 1TWXB 4AN7A 2FPZA 1O3EA 2NU3E 2ZIQH 2ZGJA 2AERH 2F83A 5EOKA 4TWYA 5DP9A 2HPPH 1C5OH 1JBUH 3URCA 2TRMA 2FM2A 1ELTA 3RXCA 1HXEH 4Y71A 1SQTA 4IC5A 3C1KA 1FI8A 2BZ6H 4INKA 4Q2KA 5DP5A 2A4RA 3HGNA 4ABJA 5DP4A 5ESBA 2ZDMA 1A46H 3TJOA 1LVMA 1P3CA 3SU3A 2BD7A 2FDAA 1C4Y2 3E0PB 3SQEE 1GMHF 1LPKB 1OKXA 4FU7A 1W2KH 3G01A 1O2GH 5GJ4B 3QGNB 7LPRA 3PV4A 2FO9A 2WPLS 2ZA5A 1FPCH 3ZZ5A 5FXLA 1MQ6A 3SI3H 5IDKA 1C2GA 2G5NA 3SV6A 3RMMH 5PTPA 1GHWH 1IAUA 2XCFA 1ETSH 3EE0B 3A7WA 2EC9H 1BBRH 4Y7AA 2FX6A 1S0RA 4CR5A 3R0FA 4TPIZ 3A81A 3M7TA 1MTNB 1ZSKA 3LKWA 3RXVA 1C2KA 4BANB 2H9EH 2PKAB 3STIA 1IQNA 4Z0KA 4Y8XA 3A7YA 4X1SU 2ZFTA 2WUBA 3SNCA 1O3IA 3SO3A 3M3SA 3UWIA 3ZZ3A 6GCHF 3TIUA 2GV7A 1UCYK 5EW2H 2FYRA 4K3JA 2XC0A 3SV7A 1TPOA 1PJPA 3Q3YA 1HAHH 1U6QA 1P2KA 3BEUA 4GUXA 3SNDA 3PO1B 4ZMAH 1P2OA 2QXJA 2PR3A 1KIGH 1SOZA 4MVNA 1OX1A 3RXKA 5FHTA 4B75A 1C1TA 3LH1A 1HJAB 1GJ5H 5DKMA 3LGIA 1P57B 1O2WA 4GCHF 1V2WT 1LHCH 3TVJB 2GT8A 1WSSH 3VEQB 3UR9A 1HPGA 1AFQB 3HKJB 1QRXA 4CRBA 2OXSA 2PTCE 1SLVB 5E0HA 1O3DA 4MNWA 1G3EA 4ABAA 4UFDH 2Z9LA 3L33A 3IWMA 1ZOMA 4YOJA 1NRPH 1H8DH 5C3NA 2OQUA 3V0XA 2ZGCA 4CRFA 5E0JA 3TGIE 1YYY1 1SGDE 2HLCA 5EW1H 3E3TA 1DE7H 3AW1A 2ZF0H 3HATH 3UNSA 3QZQA 1GBIA 2RG3A 1F0TA 1J15A 3M37A 1BJVA 2GT7A 3E91A 1BIOA 4B76A 2BVXH 2XBWA 8GCHG 1NRRH 2ZGBH 1C5MD 1C5ZB 2V3HH 4ISOA 3A89A 1X7AC 3F9FA 4BAHB 3NXPA 5DK1A 2R9PA 5C2ZA 1GBFA 2FIRH 3V12A 2OBQA 3U8OH 2PKSC 1AD8H 2CXVA 1K2I1 4M7GA 2A45B 1DVAH 2A4GA 3KQEA 2FOHA 3RMNH 4Q7ZA 1KTSB 2G55A 2ZDAH 1Z7KA 4FUIA 3TGJE 2OD3B 2XCNA 1HNEE 4UD9H 3GISB 1K21H 1E38B 4NZQA 1AUJA 1CSOE 1SPJA 5ETXA 1FIZA 4YOIA 1FMGA 4F49A 1VGCC 3U9AH 1B0EA 3SQHE 2ZPRA 2ANWA 3JZ1B 3UOPA 2HNTE 1P2QA 4KGAA 1LO6A 2OP9A 2JETB 1ANEA 1V2PT 1GGDC 3LOXA 1LMWB 1O39A 1P10A 1NU9A 1ESAA 4JMYA 4X6PA 4CRDA 1EOLA 5FPTA 4IMZA 3BTME 2DUCA 1SGPE 1FN8A 3MO6A 4WH6A 2ZNKH 3VB5A 1SFIA 3A84A 3S9CA 2R0KA 1PPBH 1E36B 4HTCH 1OWIA 1OYQA 2NU4E 3FP7E 2G51A 5JYIA 5CHAB 2KAIB 3M3VA 3U8RH 2A2QH 1FY3A 3PMHB 1ZTKA 1AWFH 3Q3XA 1GI2A 1P05A 2FS9A 2C4FH 1A5GH 1UTQA 1C2MA 2HNTC 1Y5AT 2A7CA 1V2KT 2FLBH 3ZZ8A 4CBOA 1EXFA 5EQRA 1C1UH 5JPMH 1DXPA 3RXGA 3BEFB 1UCYH 1GI0A 1TGCA 5EPYA 4E05H 3E6PH 2PWXA 2D1JA 2BY5X 1CT2E 4A7IB 1OWHA 1YF4A 1ZPBA 2PKAA 3BTWE 4K8BA 1EZSC 3TK6A 1EPTB 4Y79A 1QRWA 4X8VH 1SLXB 3UPEA 1Y59T 2ZU2A 1QQUA 1Y3UA 1Z8JB 1TALA 4U32A 1HAIH 3LGYA 3LH3A 2ZTYA 1J14A 4XBDA 2H1UA 6ESTA 3ZVFA 4FUHA 1SMFE 3V3MA 3GCTG 2PUXB 2BOHB 1O2ZA 5GPIB 1TGTA 4WY3A 2FESH 2J34A 1RIWB 4MPWA 3UREA 3K6YA 4NFEA 3LJJA 2J38A 1YPJH 3RXOA 2VVVA 2SGPE 2GMTB 2Y81A 1GI7B 4RSPA 5LH8A 1AVWA 1GBTA 1Y5BT 2CF9H 3F6UH 4K1SA 4AFUA 1BJUA 1TMUH 4MLFB 4YLUA 2QF3A 4X1QU 3RXTA 4ZH8A 2GCHG 1MTNC 5I46H 3LGWA 1HJ8A 1UVSH 1VJAU 3S9AA 1TBZH 1AKSB 2BTCE 6CHAB 1K9OE 3FFGA 5DO4H 4FVBA 1TX7A 1ANBA 3ZZ6A 3PMBB 4FUBA 1UMAH 1HBTH 1TOMH 3AW0A 2BY6X 4OS2A 4JK6A 4ABFA 3OTJE 2G4UA 1PQ8A 2FEQH 2FODA 2ODYB 1E37B 4LOYH 3A86A 1INCA 4FUDA 3PO1C 3SNEA 4KKDA 5AFZH 4ZKOU 2GZ8A 1AVGH 1E0FD 1GHZA 1PQAA 1UVTH 5I25A 1HJAC 1YLCA 1CHOG 1XXFA 2ZCHP 2QV1A 5A0CA 2GZ9A 1EAWA 3ZZCA 1AFEH 1Y3YA 3GOVB 4NSYA 1FLEE 1ZMJA 4YESB 2FI4E 4ABBA 2ZHFH 1KXBA 5EXMA 1O3OA 4H6SB 1K1MA 1O5FH 4D7GA 1YP9A 3S9BA 3HK3B 5FX5A 5TCAA 2G81E 4XOJA 1OPHB 3M7QA 4NG9H 1XUHA 3ZZBA 1C5XB 1XXDA 1ELEE 1WQVH 2BDGA 2FI5E 3F9HA 1OOKB 3SORA 2R3YA 4B71A 2FTLE 2FXRA 3GY4A 4K5ZA 1O2VA 4TPYA 1BUIA 3A7VA 4X1PU 5TCCA 3QK1A 1DY8A 3SUFA 4AX9H 1YCPM 1C5YB 2V6NA 1FUJA 3S0NA 2BD5A 2AMDA 5IYTA 1D3DB 1JMOH 3H7OA 4FU8A 1ELCA 2NU0E 5DP6A 3LU9B 1QL7A 3STJA 3BG4C 1EX3A 1W11U 1N6YA 1JIMA 4XDEA 2C8ZB 1O3HA 5C5OA 4HFPB 1DWCH 3TGKE 1IQMA 2P94A 4HGCA 1A2CH 1O32A 1T8MA 1GL1A 2KAIA 4DGJA 2F9VA 1D3PB 1K28D 2HNTF 2ZQ1A 1V2ST 2WPIS 3MU1A 3P92A 4LK4A 1P04A 3D49H 1YLDA 2VIQA 3PTNA 2GP9B 4JYVH 4AG1A 2J2UA 1O2XA 2Y80A 3SU0A 1C9TA 2FOEA 4IW4E 4Y0ZE 3RXFA 5A0BA 1SGFG 1TRNA 3P95A 5DPAA 1ORFA 2BY9X 1C1OA 2FZZA 2HOBA 2ZGXH 1BTXA 2XBXA 3U8TH 7ESTE 3P17H 3AASA 2BDHA 1SB1H 1F0RA 3SV9A 1DT2A 2EI6A 1EPTA 5FPSA 2VWLA 5C1UA 4Y0YE 1GBBA 2G52A 4UFFH 1BA8B 1WTGH 2JH0D 1KLTA 3GY2A 1QGFA 1QL9A 3QO6A 4OS6A 3O8RA 3FZZA 5A8YA 4Y8YA 1A3EH 2ZO3H 2QXIA 3Q00A 4H6TA 2UUYA 1O2RA 3CS0A 1P3EA 4MTBA 1ARBA 4B2BA 2HPQH 1TABE 2Z3EA 1PPEE 1T8LA 4U01A 5JBAS 1GI5A 2BY8X 2ESTE 2ZU4A 2TGDA 1GHAG 4MNVA 4LZ4B 4IBLH 1T31A 4FU9A 2VGCB 1FQ3A 2THFB 5L2ZH 2ZEBA 3FVFB 7GCHF 4NA7A 1S0QA 4FUGA 3MH7A 1H9IE 2VJ1A 5F8ZA 5C67A 2XXLA 3VB4A 1UTPA 1VCQA 2ZC9H 1A4WH 3TH4H 1EPTC 1ZGIA 1XVOA 2BDCA 1HV7A 5EU8A 1MU6B 2CGAA 4I8JA 5E8EH 2ZU1A 1EAIA 4SGAE 2J94A 1GDNA 5AHGH 5F8TA 1FZZA