5K7RA

Microed structure of trypsin at 1.7 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-resolution structures from fragmented protein crystals with the cryoEM method MicroED.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5k7rA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5k7rA02
1W11U 8KME2 2FP7B 2Y7XA 2ZDNA 1BMMH 3KQCA 2QXIA 5C2ZA 1KSNA 1QRZA 4X0WU 3PLBA 2Y5HA 3BV9B 5HGGA 1HAHH 1F0SA 3DUXH 1JRSA 1K1IA 5C20A 2XC4A 1D9IA 2CMYA 1MCVA 3SJKA 3ZVEA 2IOTA 5ESBA 2CJIA 2FS8A 2H9TH 2W3IA 3MMGA 1HCGA 3ZZAA 1OPHB 4XBCA 2GZ8A 2J9NA 2JH6D 2ZHQH 1O34A 1P2MA 3BN9A 1CGJE 3RXSA 2STBE 2O8UA 4E06H 1GJBB 3BF6H 3V0XA 2H2ZA 4FU9A 1HJ8A 4GPGA 2XTTB 2P3UB 4IBLH 9ESTA 1MD8A 3M61U 1PPHE 2ZGCA 1O2UA 5DK1A 2FODA 2XRCA 1EPTC 3C1KA 1P2IA 1CSOE 4U2WA 2NU0E 1FPHH 2G4TA 2ZFFH 5EQQA 4NA7A 1L1GA 1W14U 3TU7H 1KXAA 1ELVA 1QFKH 4I32A 1TGTA 3UQOA 2ANMH 5DP9A 1HLTH 1QBOA 3K2UA 3OU0A 1NRQH 1W10U 2WPHS 2OQ5A 4B2BA 2JETB 2ZDLA 2ZU1A 2FLBH 2ZGHA 3DT0H 1QBVH 3GCNA 2BOHB 3E90B 1QJ6B 1BMNH 1PPCE 1GPZA 1L2EA 1P12E 1E36B 1C5YB 1ELEE 3RDZA 4JYVH 2GT8A 1C1VH 4WJG2 1G30B 1ZSKA 3U9AH 3K65B 4UE7H 3I77A 3SW2B 4AYVB 3ZV8A 1C5MD 1RRKA 3QZQA 4ISNA 7GCHF 2CV3A 3OYPA 1WQVH 1BTPA 2UWPA 3FZZA 1OWDA 5EU8A 1EJMA 2OQUA 2P95A 1XVMA 1C2HA 4K8BA 1P09A 2HWLB 3SUGA 4WMDA 6GCHF 3M5OA 3D65E 3SGAE 1T31A 2WPLS 4CHAC 4CR5A 2FXRA 4Y7AA 1DWCH 4ZHLU 3S0NA 2ZG0H 5A0CA 3BTQE 2O8MA 1AFQB 4DT7B 1Q2WA 3MHWU 3F9GA 2O8WA 1LVOA 2FMJA 1GCDA 4HFPB 1A4WH 3ZZCA 1TX6A 3ZVGA 4Y6DA 5F8ZA 4Q7ZA 1V2KT 4UFFH 1P03A 1UTQA 2VIOA 3A80A 1AIXH 2FZZA 1GHVH 1EOLA 2TGAA 3GDUA 2V3OH 1ELFA 2NU1E 2VWMA 3GY2A 1PYTD 1P3CA 1VR1H 1NT1A 3RMLH 1NFXA 1C5OH 2QA9E 1TA2A 3ZZ9A 2OTVA 1MTNC 1ANEA 2YNAA 2TIOA 3R3GB 3M37A 4RKJB 3SV9A 1P3EA 1O2KA 2G4UA 1PQAA 1AE5A 1UK4A 1F0TA 1V2OT 2A5IA 3VB7A 1EAUA 4FUIA 4BAMB 1EP5A 2A2QH 2XCNA 3LGWA 1B0FA 2NU3E 1OWJA 2OD3B 4BTUB 2KAIB 3NK8A 4K5ZA 1T8NA 1YLCA 3C27B 1C5LH 1RS0A 4MDSA 5PTPA 3SGBE 1CHGA 2FX4A 1O2TA 2AEIH 1FAXA 1A2CH 2VU8E 3PTBA 3DFLA 1MAXA 1CBWB 3KIDU 3BTWE 1SGCA 5GWZA 1OX1A 1DXPA 3V12A 5GPIB 2PW8H 4ABDA 1QB9A 2FDAA 1SL3A 4I8GA 2P59A 2CN0H 3SQHE 1QRXA 1QB6A 4B74A 4NSVA 3NZIA 1TNKA 4YTAA 2EA3A 3SQEE 1WU1A 2VVVA 3RXIA 3EA9A 1RJXB 1T8LA 4UFEH 1ZTLA 1FLEE 1O3HA 3UNSA 1C9PA 1DUAA 4WVPE 2C8ZB 2FOAA 1GHAF 3PB1E 4VGCC 3A8BA 1HDTH 3LGYA 1SG8B 5E0JA 1GI7B 1HXEH 2FESH 5FPSA 4FUHA 3TJOA 5GJ4B 2NU4E 2BD2A 4FXGH 1FXYA 3HPTB 1PFXC 5DJ7A 3VXFH 1K28D 1KDQA 3BEUA 2QXGA 1GI8B 5DPAA 2JKHA 1ETTH 1O39A 2ODYB 1UTMA 2QY0B 1GHBF 2HVXA 3TNTA 1EATA 1SGNE 2ZPRA 2F3CE 1BA8B 1YPGH 1EZQA 1FY8E 1CVWH 2UUFB 2UUKB 1EB2A 4IGDA 1LCYA 2WUBA 3AW0A 1A5HA 4Z6AH 1HAVB 1GI2A 1GBMA 3EQ0H 5EXLA 1KTSB 4XSKU 1NPMA 6GCHG 5K7RA 2PKAA 1D3QB 2ANKH 2QV1A 2ZDKA 2Z3EA 3GCHB 1ZZZA 2BD8A 5JBCS 3MU0A 3SJ8A 1AVXA 1C1MA 3GY5A 1FONA 1C2IA 3GOVB 4AFSA 1S83A 1TABE 1YBWA 2WV4A 1MAYA 3QK1A 3QUMP 4Y10E 1GHZA 2BY8X 5JB9S 3F68H 1C5ZB 1S5SA 1LVMA 4ZKNU 3TJNA 1P05A 5K0HA 1AUTC 4M7GA 2ANWA 2BD7A 1EX3A 3MU1A 1GI1A 1Y5UT 1DLEA 4X1QU 5CHAC 5H4IB 1BBRH 4WF8A 4ABJA 1D6RA 1C1OA 1ANDA 1CO7E 1O5CB 2ZF0H 5HXFA 1O5GH 1ZSJA 3BSQA 2WINI 4FVDA 1A0JA 2GZ7A 3O8CA 3VB3A 3UR6A 1S0RA 2J38A 3GY8A 2ZECA 1YP9A 3L6PA 3PMHB 1GCTC 2BDYA 2Q6FA 4FUFA 1MQ5A 1QY6A 3UNRA 2D2DA 4O9VA 4MLFB 5GCHF 2VIQA 1SGQE 1SLWB 1AKSA 2P8OB 4NZLA 2GZ9A 4ZROA 4ZKOU 1ID5H 2BQWB 5EXNA 1NY22 4FUCA 1FN8A 1JRTA 4HZHA 1N8OC 1GHYH 3CENA 4JK6A 3RXUA 1C1RA 4XDEA 1V2NT 2FOGA 2ZPSA 3FP6E 1EXFA 1ZGIA 2JH0D 1AHTH 1BTWA 4CREA 4MTBA 2SFAA 1TQ0B 2ZU4A 1O5EH 3EE0B 2A4RA 1BT7A 2NU2E 3NXPA 1P2QA 2BX3A 3ZZ4A 2OUAA 4B71A 4Q7XA 1C2GA 1WTHD 4A6LA 3M36A 2AYWA 2ZI2H 1D6WA 1H8DH 2XBXA 1NU9A 4CRGA 1HNEE 1MCTA 1T4VH 3SU0A 5GCHG 1VITF 3BTKE 1O0DH 2TPIZ 4X8TH 2R3YA 1AB9C 5BRRE 1HRTH 1G3EA 1T32A 4CBNA 1D3TB 3JZ1B 1ZMLA 4AOQA 1V2UT 2G8TA 1B5GH 1K1OA 2ALVA 5DP8A 4WXVA 4AZ2B 6ESTA 1HAVA 1ESBA 3TH4H 7LPRA 1D3DB 2ZO3H 3HKJB 5E0HA 3RXJA 3MH7A 1HJAB 3QTVH 1P2OA 2ZHWH 3DHKH 4MNVA 2RA0A 1UTNA 1FI8A 2BDBA 1AE8H 1FY5A 1H4WA 4NGAH 2PTNA 3A85A 5CMXH 2VIDA 1TGCA 2V6NA 1GVLA 1BB0B 1KIGH 4FU8A 3VGCB 3H7OA 2QXJA 5F6MA 1HAOH 4U01A 1XXDA 2BD9A 1AVWA 4F49A 4BAQB 5FX6A 2PHBA 2HPPH 1C1SA 4R8TB 1D3PB 1UMAH 4NCYA 4GSOA 4ABHA 1ARCA 1P8VC 2F91A 2BYAX 2BD4A 3ZZ8A 1GGDC 3SO3A 2F9PA 1H1BA 3H5CB 2GCHG 3UOUA 1LQDB 5EQRA 2EI7A 2FYQA 4CRDA 2FX6A 4AORA 4LOYH 1S0QA 3B23B 4MNWA 1OWEA 2GMTC 4H4FA 1JOUB 3A86A 5FPYA 2OBQA 1TQ7B 1DSUA 1BQYA 3M5NA 1SBWA 3PMAB 4Y79A 1O3GA 4LZ1H 4MNXA 1ZJDA 2Q1JA 4WWYA 1NN6A 2XCFA 2QIQA 4X1RU 2FTMA 1CQQA 4J2YB 2BD3A 4Y0YE 2GCTC 3LU9B 1TAWA 1HPGA 3TK5A 1BBRE 1TGNA 4I8LA 3VB6A 5LH8A 1GI3A 4NIVA 4YZUA 1O3BA 4OGYA 1E38B 1YPHE 1HUTH 1LPZB 5T6GA 3RXOA 1O5AB 1HBTH 2G5VA 1GMCF 3RXPA 1O2HA 5AF9H 1W2KH 3BEIB 1ETRH 1ZHPA 4Y76A 1JMOH 1W0YH 3UREA 2B7DH 4CH2B 2F9UA 4OS6A 3B9FH 1W8BH 4DG4A 1GBCA 3GY3A 1SHHB 1O3LA 3RUOA 1GGDB 1DFPA 2ZPQA 4X6OA 1QL8A 1ELGA 1P04A 2ZDAH 4I33A 4ZKSU 1EAXA 2DUCA 2WYJA 1YLDA 3EA7A 3QN7A 3FZDA 2ZGJA 1SGDE 3SORA 3HGNA 4X6NA 3RM0H 1J15A 1OWHA 2TBSA 1QA0A 1Z6JH 3F9FA 3SJ9A 3E6PH 4ABAA 2CF9H 2GCTB 1TA6A 2Y81A 3BG4C 3UY9A 4GLYA 8GCHF 1Y3UA 2OC7A 1GMHF 5EPNA 3T25A 1INCA 3O8BA 1Z71A 1J16A 1WBGB 2AERH 1HAPH 2OC8A 1BTZA 1C9TA 4ZH8A 1DITH 1P02A 4YO9A 1O3KA 2ZFRH 1MD7A 3I29A 3F6UH 1C1NA 4I31A 1BJUA 1O31A 1XUIA 4JMYA 2F9NA 1C4U2 3U69H 1GHXH 5GDSH 5FAHA 1AMHA 3A8CA 3SU2A 4HTCH 3SU6A 1VCQA 4INLA 2CXVA 1THRH 1ELTA 1C2LA 1GJ5H 3TIUA 1DVAH 1T7CA 3MH4A 2AS9A 4A92A 3SNAA 3PYHA 4IMQA 5DP7A 1GI6A 1K1PA 2BM2A 1KYNA 1LO6A 1O2OA 2BZAA 1P11E 2FO9A 1FMGA 1GBTA 2VVCA 3Q3XA 5C1XA 3NPSA 4BTTB 1UVSH 5IDKA 3Q00A 2EI6A 4DURA 1YF4A 1TGBA 1FV9A 4I7YH 2Y80A 4BOHA 2OBOA 1O3NA 3ZV9A 2W26A 2VIVA 2FOCA 3QDZB 4B2AA 5HYOA 4ABFA 1PPFE 1KTTB 1E34B 4ZMAH 1IOEA 1Q3XA 4XOJA 4IN1A 1GBJA 1KXDA 4OS4A 2XBYA 3MYWA 3BG4B 4TY7A 2LNCA 4ABGA 1HB0B 3ENSB 1LDTT 3LJOA 6CHAB 2PV9B 1TONA 1NRNH 2FOBA 2PLXA 2XWAA 4TYDA 1TYNA 1ZMNA 3MFJA 4CRBA 3DA9B 1IQKA 4KTUA 1Z8GA 3PLKA 3T29A 3IWMA 2HPQH 5DG6A 2HGTH 1MTNB 1OSSA 3VB4A 1WSSH 1XM1A 4FUGA 1C4Y2 1GCTB 2PFEA 2C8XB 3FFGA 3KQBA 4O97A 3V13A 1JWTA 3EDXB 3B8JA 1LTOA 4Y8XA 1W7GH 4O03A 1VCWA 1C5WB 2ZQ2A 4YLUA 3ZZ5A 3A81A 1MTSA 2O8LA 1G3BA 4ZKRU 4UFDH 5T6DA 3BTEE 1IQFA 1C5XB 1O30A 1W7XH 1Y5AT 2QF3A 1CHOF 1UVPA 1DUEA 2R0KA 1NZQH 2QF0A 2FI4E 2P16A 5EW1H 1FIWA 1O2NA 3BTTE 3RXRA 4GUXA 1V2QT 3D23A 3LPRA 4IW4E 2ZWLH 3OY5U 1IHTH 1RXPA 4DIIH 1GJAB 2ZU5A 3TVJB 1EPTB 1GL0E 3MI4A 3A8DA 3ZVFA 1XUHA 2ALPA 3F9EA 4SGAE 2P93A 2R2MB 4WMFA 3SNDA 1P2KA 2PUXB 4J1YA 3T26A 1SGFA 5C3NA 1VGCC 5IYTA 3E1XB 2GT7A 1PPEE 2P8OC 3GY7A 3FP7E 1SQTA 1L4DA 1GG6C 2OP9A 3KNXA 3LONA 2UUYA 2H5DA 1O2YA 2OC0A 1XMNB 1O3AA 3QZRA 3S7KB 4AFQA 2FOHA 1GDUA 2ESTE 1OS8A 4X6PA 4OS7A 1WOFA 4ISOA 2ZHFH 2BDIA 2C8WB 3P95A 1IQLA 2QN5T 5A8XA 1V2MT 4X8SH 2G81E 2EC9H 2A4GA 1GVZA 2V0BA 5C67A 2BY5X 1UO6A 3W94A 1SGEE 2GCHF 4CBOA 1UTKA 1EQ9A 3U1IB 4GHQA 1PPBH 3UWIA 1O2GH 2G55A 5A0BA 1H9LB 4K2YA 2I6QA 2I6SA 1LKBA 3P8FA 2PKAB 5TJXA 1C1WH 1UHBA 2J92A 2BOKA 1K21H 1A7SA 2SNVA 4O3TA 3UIRA 2FI3E 1D4PB 5AVDA 3CP7A 1JIRA 4MPXA 2ZFTA 3KCGH 4FUJA 1O3MA 2ZP0H 3H7TA 4ASHA 1K2I1 4K3JA 4GCHG 2FWWA 2HALA 2C90B 1GBFA 1MKWH 3A7XA 3SV8A 4MNYA 4X1NU 1MKXK 3AVZA 2IJOB 2R2WU 1O3PB 1QCPA 2GDEH 1TALA 3P17H 1QTFA 2CF8H 2Y6TA 4NIYA 1DSTA 3S7HB 3RC4A 1GWAA 4MVNA 3RC5A 1GDQA 1HIAB 5FHTA 1O3OA 5A8YA 3LGUA 3LT3A 1IQIA 3SOSA 2ZTZA 3PROA 4JYUH 2TRMA 1E35B 1G3DA 2ODQA 3STIA 2WPMS 5LPFA 1C2KA 3BIUH 4KTCA 3ZZBA 2BMGB 2VGCB 3GYMA 2PUQH 4O3UA 2GKVE 2PGBB 1MBMA 3S69A 1JIMA 1FAKH 1DY8A 1WV7H 2QC2A 3LH3A 3A83A 2VH6A 3RXCA 3SJIA 1ZHRA 4GHTA 1FN6A 5T3HA 4Y8YA 1QL7A 3HK3B 8ESTE 4WH6A 2SNWA 4BAKB 5EXMA 1TBQH 2XWBI 1UK3A 1BJVA 5JDUB 1TMBH 2GMTB 2XW9A 1BITA 3SU5A 3RP2A 1KXFA 1IAUA 2J95A 3AAVA 2GD4B 3VB5A 4CR9A 1V2PT 3RMMH 1AB9B 3WY8A 1V6DA 3MU4A 2Q6DA 3FANA 4K1SA 2J94A 1HAXB 2A7JA 2RCEA 1NU7B 4BAHB 2P94A 1O2JA 1QQ4A 1F7ZA 1MH0A 2FEQH 1DLKB 1FY4A 5AFZH 1O2PA 1QJ1B 1UK2A 2ZTYA 2QAAA 1Y59T 1ANBA 2FPZA 3GCTF 3TK6A 1XKBC 1MMJN 3TJUA 3VFEA 4AGKA 4X6MA 1OWIA 5L2YH 1EJNA 2DE9A 2C8YB 3JZ2B 1AGJA 2ZKSA 4YLQH 1T8MA 1ZTJA 1P9UA 5I46H 1C2EA 2THFB 1KDQB 1M9UA 4OS2A 1HAIH 3P8OA 4GCHF 2CHAC 4TPYA 2ODPA 2V35A 1NTPA 4ZAEA 3EGKH 3RXBA 3RLYH 1SLXB 1MKWK 3LDXH 1DX5M 1ELAA 3KQDA 1YPEH 2A5AA 3A7YA 2AMQA 3SUFA 4DY7B 1FZZA 1YPKH 2WPKS 2SGDE 3KHVA 3KL6A 1GDNA 5LPRA 3L3TA 1ZPZA 2WUCA 4A7IB 1YGCH 1QBNA 3Q76A 2IN2A 3PO1C 4MPUA 1PQ5A 1BMLA 3ZYDA 1V2LT 2H1UA 1UVUH 1V2ST 5ETXA 1UJ1A 2XYAA 3RXMA 4YT7H 1BTYA 5DP6A 1O3CA 4XE4A 1C2JA 4MPVA 3UTUH 1A1RA 3ZVDA 2D26C 2PWXA 4FVBA 5L2ZH 3LGIA 4K1TA 2JETC 2VVUA 5DP3A 1ANCA 4YM9A 2WPJS 2WPIS 3ATMA 4IN2A 4U32A 3STJA 3MO9A 2VH0A 1HGTH 3OSYA 2ZC9H 1CA8B 2BTCE 3A7ZA 1H9HE 4D7GA 1TPPA 3ATLA 2ZIQH 4B1TA 1NRRH 3KF2A 1BTHH 1TMUH 3RXKA 3NCLA 1GMDF 3TJVA 3U8RH 2ILNA 3TLOA 4JZFH 2RG3A 1EAIA 1ZMJA 1XXFA 3URDA 3BTFE 5A0AE 5FPTA 2GX4A 3MNCA 3TK9A 1MKXH 9LPRA 2A0QB 1Z6EA 3TH2H 2Z9KA 1MTUA 2R9PA 4HGCA 4ABBA 3BTME 3T27A 3RC6A 4NFFA 2BLOA 5DP5A 2ZCLP 5A09A 4LXBH 1HJ9A 2A7HA 3GY6A 3HGPA 4IS5A 2PSXA 4BTIB 4DIHH 3ODFA 1LKAA 2BDGA 3SBKA 1XUGA 5G4BA 1DWBH 3ATKA 1H9IE 1KXBA 4Z0KA 1MU8B 1CE5A 1NESE 1GBHA 2J2UA 3G01A 3T28A 4ZXYH 1ZLRA 1W0ZU 5L6NH 4ZUHA 1ZGVA 1BRBE 1LHGH 1SOTA 1GMDG 1LPKB 2AH4X 2BXUH 2SGPE 4IC6A 4UONA 3TGJE 5JB8S 2ZTXA 2VB0A 2ZNKH 4DGJA 1ZRBA 3P8NA 1ARBA 3GCHC 1SMFE 3M7UA 4YT6H 4YOJA 4GAWA 2ZQ1A 1GI0A 2FI5E 3AAUA 5EQSA 3RXFA 3IG6B 2AIPA 4KKDA 1C5NH 1CT4E 1ELDE 2ULLA 2A45B 3K9XB 1CGHA 3A84A 4D9RA 1HAYB 4CRFA 1DICA 4F4OC 1SR5C 3ZZDA 1UCYE 2BHGA 4H6TA 3CS0A 4OS5A 3A88A 1QIXB 1SB1H 1L0ZA 2M5TA 4E7RG 4B2CA 2STAE 1G2MA 5EPYA 2Z3DA 1TNIA 4D7FA 1F5KU 3OTJE 2SGEE 1K9OE 1G2LA 3RXVA 1LMWB 3V3MA 1OYQA 1DOJA 2VINA 1KXEA 4RN6A 2RA3A 2Z6BD 1GJ9B 4JZ1A 2W7SA 3EA8A 3TNSA 1VGCB 1SPJA 4UD9H 1OKXA 2BDAA 2A32A 1KLTA 4LK4A 1SLVB 4RKOB 2OXSA 3SZNA 2ZGBH 4D9QA 4XFQA 3UQVA 1NFYA 2KAIA 2BD5A 1G3CA 1OWKA 1AO5A 3S9BA 1RGQA 3M3TA 2C4FH 4UEHH 1EZSC 4WY3A 1FQ3A 4HI3A 1N8OB 3A7VA 3M3VA 2EI8A 3RMOH 3U8TH 1EOJA 2HRVA 2PKSC 2WV5A 3S9AA 1TRYA 3MU5A 1IQHA 1YCPH 4MG3A 5TCAA 3O8RA 4K69A 1C5QA 1F0UA 1GJCB 1O2WA 2C3SA 3SI3H 3NKKA 3M5LA 3E91A 1UVTH 4NIXA 3VGCC 2VWLA 3UWJH 3M5MA 3A8AA 4THNH 1F92A 1MUEB 5EOKA 1NM6A 1ESAA 3ZZ7A 1O5DH 1L1NA 1V2TT 1WCZA 1A5GH 5JBAS 1LHDH 2QXHA 2D1JA 2C93B 1A46H 1KY9A 1W13U 3KQEA 4KELA 1Y3XA 1S85A 1Z8IB 4INHA 2F9BH 3BTHE 1V2RT 3S9CA 3D49H 3ZVAA 3R0FA 1HJAC 2BY9X 3RXGA 5JPMH 1GJ8B 1TPOA 1O2SA 3V7TA 1BRAA 2W3KA 3MTYA 3DD2H 1K1NA 3GISB 3OY6U 4ISIH 4ABEA 4LZ4B 3HKIB 3M7TA 4BAOB 2RDLA 2FS9A 2XC5A 1A3BH 5HM9A 2XC0A 2Y82A 2OLGA 3FAOA 1QNJA 2PGQB 3ZYEA 3ODDA 2BZ6H 1K1MA 4DVAU 1A0HB 3T2NA 3ZZ3A 2PTCE 3RXLA 3GDVA 4I8JA 3QWCH 1O3JA 3ZVCA 1TMTH 1O33A 2XBVA 3MH5A 1V2JT 1Y3WA 2FYRA 8LPRA 1G32B 1CA0C 1W3CA 1P2JA 1UCYH 1Z8RA 5C5OA 1GI9B 3TITA 1NRPH 2Z9IA 1UVOA 1AFQC 4K8YA 1C5PA 1C2MA 4X8UH 1IQMA 5EODA 3ATWA 1TPAE 3RXDA 1E0FD 1TIOA 2GVFA 1C1QA 1N1LA 1FNIA 1O2MA 3LKWA 1QJ7B 1TX8A 2ZU3A 1EJAA 1GI5A 4CRAA 1K22H 1EZUC 5JYIA 2BY7X 4BNRA 3MU8A 1BHXB 1K1LA 4FU7A 3IITA 1O2ZA 5EW2H 4CH8B 1SQOA 1C1PA 1W12U 3SV6A 6LPRA 1A3EH 4YESB 3GCOA 1QB1A 3LH1A 4D8NA 1QURH 1EPTA 1HIAA 1BRCE 2BX4A 1O32A 1TRNA 1GVKB 2FM2A 3AASA 4BXWA 1J8AA 3AW1A 1RTLA 1VITG 2H9EH 1GBLA 1QL9A 3RU4E 3SN8A 1MQ6A 4A1VA 2SGAA 3SHAH 2ZA5A 1SVPA 1DT2A 2F9OA 1FPCH 2ZCKP 3RXQA 1C1TA 1XUFA 2Z9JA 5F03A 1P57B 2IPHA 3E0PB 1HYLA 3MNSA 1GHBG 4Y0ZE 5E2PA 4AB8A 4H6SB 1DS2E 3QX5H 5T6FA 1DY9A 1AU8A 3GY4A 1LVBA 1TOCB 4DCDA 4AB9A 3MH6A 1PYTC 3PV4A 4KGAA 2W5EA 3PO1B 4YOIA 1YPMH 1TPSA 1HAGE 1MTWA 2JH5D 1GHAG 2NWNA 1QQUA 2R3UA 1GJ4H 1O37A 2GV6A 1GJDB 1HFDA 1ABJH 3A82A 3SU4A 5FCRA 2ZZUH 2BVSH 2TGDA 4Y7BA 7ESTE 1ELBA 2FOFA 5EG4A 3RM2H 1VITH 1DM4B 1QGFA 1THPB 3SV2H 4DJZB 1FY3A 1X7AC 2BLWA 2AMPA 2BVRH 1AD8H 1SSXA 1WYKA 5E2OA 2Z94A 5JBBS 1CHOG 1ACBE 2B9LA 1OP8A 1C2DA 5SGAE 1YCPK 1Y3VA 3GICB 1F5RA 3E0NB 3LC5A 2K1QA 5DGJA 1GJ7B 1AQ7A 4NSYA 1O3IA 1Z1JA 2P3TB 2QYIA 2R0LA 1P01A 2H9HA 1IQNA 1YCPM 5E8EH 1CT2E 3RU4D 4A1XA 1T8OA 5LGOA 1ORFA 5DP4A 4Q2KA 3KGPA 2BDCA 1E37B 1N6YA 1Z1IA 5HM2A 2ZDVH 5CHAB 5FCKA 4CRCA 5B6OA 2VNTA 1A0LA 1THSH 5A8ZA 1VCPA 1SGYE 1SQAA 4AYYB 3MNBA 1ZRKA 2P3FH 1TLDA 1TBZH 1ZSLA 1QRWA 1AWFH 2ZGXH 3VPKA 1H8IH 3MOCA 3I78A 4DW2U 4UFGH 1C5SA 3MO3A 2F9VA 1C1UH 1SGTA 2ZFPH 5CE1A 1O2LA 2BB4A 4E7NA 1SGIB 2ZHEH 3F1SB 3P6ZB 3UR9A 1F0RA 4ZHMU 1TNHA 1V3XA 5C1UA 4NA9H 4FUEA 1O2RA 1CT0E 4KTSA 3QO6A 2ZCHP 2OINA 1G36A 3PTNA 3PM3A 4RSPA 5C5NA 4IMZA 1XKAC 4NG9H 1XVOA 1GJ6A 5TCCA 4XBBA 1IQJA 4VGCB 2BVXH 3RXEA 2VWOA 1EASA 2AIQA 2YNBA 3PWCA 1SGFG 1MZAA 1DDJA 3SUDA 2HOBA 1K1JA 3SJOA 1TGSZ 1O3DA 4WXIA 5ESTE 4BXSA 4UDWH 3RU4T 1F2SE 4OGXA 4AG1A 1GBAA 1NC6A 4JZEH 1A5IA 3KN2A 4R0IA 4TWWA 1SOZA 3L33A 2HLCA 4JYTA 4JZDH 1O5BB 2BY6X 4IC5A 2TGPZ 1RTKA 1RD3B 4B75A 4K1EA 1ZJKA 1TFXA 2ASUB 1C5VA 3UNQA 1C5RA 2HNTC 2AFQB 1GMHG 2A31A 1DE7H 1Y5BT 2ZFSA 4I8HA 1AUJA 1S82A 3P92A 1VJAU 5L30H 1L1JA 1HV7A 1C5TA 1HAZB 1DANH 2Z9GA 1ELCA 4FUBA 3DFJA 1WQSA 2OC1A 3SHCH 2UWLA 2VIPA 2HNTF 4WMEA 1V2WT 4ISLA 2FLRH 1EUFA 1QR3E 6CHAC 1RIWB 2PR3A 3ZVBA 1UTLM 1F5LA 5E0GA 2CHAB 1TBRH 3SU3A 5DO4H 1RFNA 1XUJA 2GTBA 4NFEA 3MWIU 2A4OA 3NWUA 4K60A 4MQAA 4JCNA 3T62A 2D8WA 1WTGH 1YM0A 3SNBA 1FY1A 3A87A 1FJSA 3LJJA 1CBWC 1EKBB 4FUDA 1AWHB 1OXGA 3FP8E 3QGJA 1PPZA 1TE0A 1NROH 1S84A 1CA0B 2EEKA 2Z9LA 4ISHH 1Y3YA 2B8OH 2Y5FA 4B76A 4Y8ZA 1BMAA 1PJPA 1S6FA 1Z8JB 4ZXXH 1LPGB 3ZZ6A 1DWDH 1DXWA 3BG8A 4ABIA 1YPJH 3E3TA 2A1DB 1EP6A 2BLQA 3VEQB 1QHRB 3A7WA 1TNJA 1SFQB 1O36A 3P70B 3LGTA 3KEEA 2ZEBA 1TX7A 3URCA 4ESTE 4PROA 1LHEH 3M7QA 3TGIE 1OP0A 2XXLA 2A4QA 1OP2A 1S6HA 1YPHC 2AGGX 4X2WA 4B73A 4X1SU 1O3EA 1UCYK 7GCHG 3E16B 3W95A 4OS1A 2G5NA 3D62A 2GGVB 1BTXA 1LQEA 1P2NA 4BANB 1FIZA 1PPGE 1Z7KA 3PMJA 4CHAB 3SNEA 5A2MH 3LOXA 1ZOMA 1TNGA 2Z3CA 5F8TA 2HNTE 3QGNB 4X1PU 1AY6H 1GBBA 4SGBE 4XBDA 1GBEA 1PQ7A 1LVYA 3PLPA 3FVFB 4AGJA 2YOLA 2ZU2A 3RLWH 1KXCA 1BHXF 4Q80A 4TY6A 2GP9B 1BTUA 2ZHDA 3UUZA 1SGPE 3HATH 3GDSA 1ZHMA 1IHSH 2UUJB 1L4ZA 3ATIA 3UPEA 2W7UA 1O35A 3Q77A 5GIBA 1JBUH 1J14A 1YPLH 3A89A 4X2VA 3LC3A 4JZIA 1SFIA 3MNXA 1GBKA 1GG6B 2Y5GA 1O2XA 4GVUA 3U1JB 3QLPH 1YC0A 1ZPBA 1MU6B 2G00A 1Q31A 1N6XA 1J17T 4YOGA 1GHWH 2XBWA 1SLUB 2H5CA 1IQEA 1ETSH 3SU1A 7KMEH 2B0FA 3UOPA 4DOQA 1EZXC 4WH8A 1GI4A 4NA8A 1HXFH 1V2VT 1GBIA 3BIVH 2J34A 4TPIZ 1MZDA 1ZPCA 2LPRA 4JK5A 2V3HH 1SC8U 2O9QA 3BTDE 2G52A 3O8DA 2SGQE 4KP0A 2A2XH 3GYLB 4AX9H 1UHBB 5C1YA 3RMNH 1AZZA 1BRUP 1IQGA 3EAJA 3BEFB 4NZQA 3RXAA 3TGKE 1FDPA 2BXTH 5AHGH 1NFWA 3SI4H 1UTOA 2BQ7B 3Q3YA 1KLJH 1RTFB 1ZR0A 2J4IA 4D76A 2FIRH 3CS7A 1BBRK 1TRMA 3NUMA 3RXHA 8GCHG 4Y11E 3GCTG 2A7CA 3UFAA 1LHCH 3PWBA 1TB6H 1ZTKA 5LPEA 4AFZA 1BOQA 5HMAA 1AN1E 2G51A 1YYY1 2SGFE 2GDDA 1BIOA 1OOKB 3VXEH 5DKMA 1AVGH 3LIWA 2H6MA 1PQ8A 2FTLE 2FOEA 4Y71A 1ABIH 1C4V2 1NO9H 4AFUA 2VWNA 3PMBB 2BQ6B 1BUIA 1O2VA 3RXTA 3M3SA 3LGVA 5JBTA 2WYGA 3Q3KA 1RIWC 2XNIA 1T4UH 2PKSB 5I25A 3SUEA 1O38A 1P06A 3ESTA 3ITIA 4INKA 2PSYA 1GMCG 2AGIX 2GV7A 1A61H 1WUNH 1XX9A 2B5TB 1AZ8A 5FBEA 1OYTH 3SV7A 3ELAH 2Q6GA 3K6YA 4X2XA 2A5KA 5GXPA 1C2FA 3U8OH 2Z7FE 3OX7U 3E8LA 2AGEX 1EAWA 4A5TS 1O3FA 1FUJA 1WAYB 1JXPA 1TNLA 1O2QA 2ANYA 3BTGE 1BDAA 1P10A 4AG2A 4E05H 3EYDA 1CU1A 1EB1H 1U6QA 1VZQH 1Y8TA 4I8KA 4NWLA 1UTJA 1S81A 5ABWA 3MO6A 3TH3H 1J9CH 1LHFH 4X8VH 1B0EA 1VJ9U 2Y7ZA 3SNCA 1SHYA 1UTPA 4MPWA 1AKSB 2F83A 1G9IE 4Q7YA 3HK6B 3SGQE 1P0SH 2TGTA 1NFUA 2VIWA 2VGCC 4A1TA 3F9HA 5F8XA 5EGMA 3P8GA 1XUKA 1C5UA 2OCVB 4ZHAA 4AN7A 4H42U 4QT8C 2QCYA 1P9SA 1NS3A 1DPOA 2BLVA 1BCUH 2UWOA 2BDHA 1B7XB 3QTOH 2CGAA 1DWEH 1ZYOA 2ZFQH 2O8TA 2DE8A 1MTVA 1QA7A 1YKTA 4NWKA 3U98H 1G37A 1TOMH 5J4SA 1CGIE 4NIWA 1SI5H 3M35A 4U30A 5FBIA 1SGRE 5AFYH 1ESTA 1GBDA 1AI8H 2ZDMA 1AFEH 5FXLA 1NRSH 2FOMB 3T5FH 1GL1A 2VJ1A 2AMDA 1O2IA 3K6ZA 5FX5A 1KLIH 3A7TA 5BPEA 4X2YA 5J4QA 1BZXE 1TWXB 1O5FH 1MBQA 3N7OA 3TPIZ 4TWYA 2QGRA
chains in the Genus database with same CATH superfamily
1W11U 8KME2 2FP7B 2Y7XA 2ZDNA 1BMMH 3KQCA 2QXIA 5C2ZA 1KSNA 1QRZA 4X0WU 3PLBA 2Y5HA 3BV9B 5HGGA 1HAHH 1F0SA 3DUXH 1JRSA 1K1IA 5C20A 4B6FA 2XC4A 2IPQX 1D9IA 2CMYA 3FKSD 1MCVA 3SJKA 3ZVEA 2IOTA 5ESBA 2CJIA 2FS8A 2H9TH 2W3IA 3MMGA 1HCGA 3ZZAA 1OPHB 4XBCA 2GZ8A 2J9NA 2JH6D 2ZHQH 1O34A 1P2MA 3BN9A 1CGJE 3RXSA 2STBE 2O8UA 4E06H 1GJBB 3BF6H 5EJZA 3V0XA 2LELA 2H2ZA 4FU9A 1HJ8A 4GPGA 2XTTB 2P3UB 4IBLH 9ESTA 1MD8A 3M61U 1PPHE 2ZGCA 1YWUA 1O2UA 5DK1A 2FODA 2XRCA 1EPTC 3C1KA 4ACAA 1P2IA 5CDFE 1CSOE 4U2WA 2NU0E 1FPHH 2G4TA 2ZFFH 5EQQA 4NA7A 1L1GA 1W14U 3TU7H 1VKYA 1KXAA 1ELVA 1QFKH 4I32A 1TGTA 3UQOA 2ANMH 5DP9A 1HLTH 1QBOA 3K2UA 3OU0A 1NRQH 1W10U 2WPHS 1E79D 2OQ5A 4B2BA 2JETB 2ZDLA 2ZU1A 2FLBH 2ZGHA 2XOKD 3DT0H 1QBVH 3GCNA 2BOHB 3E90B 1QJ6B 1BMNH 1PPCE 1GPZA 1L2EA 1P12E 1E36B 1C5YB 1ELEE 3RDZA 4JYVH 2GT8A 1C1VH 4WJG2 1G30B 1ZSKA 3U9AH 3K65B 4UE7H 3I77A 3SW2B 4AYVB 3ZV8A 1C5MD 1RRKA 3QZQA 4ISNA 7GCHF 2CV3A 3OYPA 1WQVH 1BTPA 2UWPA 3FZZA 1OWDA 5EU8A 1EJMA 2OQUA 2P95A 1XVMA 1C2HA 4K8BA 1P09A 2HWLB 3SUGA 4WMDA 6GCHF 3M5OA 3D65E 3SGAE 1T31A 2WPLS 4CHAC 4CR5A 2FXRA 4Y7AA 1DWCH 4ZHLU 3S0NA 2ZG0H 5A0CA 3BTQE 2O8MA 1AFQB 4DT7B 1Q2WA 3MHWU 3F9GA 2O8WA 1LVOA 3DSGA 2FMJA 1GCDA 4HFPB 1A4WH 2JJ2D 3ZZCA 1TX6A 3ZVGA 4Y6DA 5F8ZA 4Q7ZA 1V2KT 4UFFH 1P03A 1UTQA 2VIOA 3A80A 2FZZA 1AIXH 1GHVH 1EOLA 2TGAA 3GDUA 2V3OH 1ELFA 2NU1E 2VWMA 3GY2A 1PYTD 1P3CA 1VR1H 1NT1A 3RMLH 1NFXA 1C5OH 2QA9E 1TA2A 3ZZ9A 2OTVA 1MTNC 1ANEA 2YNAA 2TIOA 3PRDA 3R3GB 3M37A 4RKJB 3SV9A 1P3EA 1O2KA 2G4UA 1PQAA 1AE5A 1UK4A 1F0TA 1V2OT 2A5IA 3VB7A 1EAUA 4FUIA 4BAMB 1EP5A 2A2QH 2XCNA 2IJD1 3LGWA 1B0FA 2NU3E 2F43B 1OWJA 2OD3B 4BTUB 2KAIB 3NK8A 4K5ZA 1T8NA 1YLCA 3C27B 1C5LH 1RS0A 4MDSA 5PTPA 4RT1A 3SGBE 1CHGA 2FX4A 1O2TA 2AEIH 1FAXA 1A2CH 2VU8E 3PTBA 3DFLA 1MAXA 1CBWB 3KIDU 3BTWE 1SGCA 2KCYA 1OX1A 5GWZA 3OEED 1DXPA 3V12A 5GPIB 2PW8H 4ABDA 1QB9A 2FDAA 1SL3A 4I8GA 2P59A 2CN0H 3SQHE 2WPDD 1QRXA 1QB6A 4B74A 4NSVA 3NZIA 1TNKA 4YTAA 2EA3A 3SQEE 1WU1A 2VVVA 3RXIA 3EA9A 1RJXB 1T8LA 4UFEH 1ZTLA 1FLEE 1O3HA 3UNSA 1C9PA 1DUAA 4WVPE 2C8ZB 2FOAA 1GHAF 3PB1E 4VGCC 3A8BA 1HDTH 3LGYA 1SG8B 5E0JA 1GI7B 3KYFA 1HXEH 2FESH 5FPSA 4FUHA 3TJOA 5GJ4B 2NU4E 2BD2A 4FXGH 1FXYA 3HPTB 1PFXC 5DJ7A 3VXFH 1K28D 1KDQA 3BEUA 2QXGA 1GI8B 5DPAA 2JKHA 1ETTH 3WWBA 1O39A 2ODYB 1UTMA 2QY0B 1GHBF 2HVXA 3TNTA 1EATA 1SGNE 1SKYE 2ZPRA 2F3CE 1BA8B 2J5UA 1YPGH 1EZQA 1FY8E 1CVWH 2UUFB 2UUKB 1EB2A 4IGDA 1LCYA 2WUBA 3AW0A 1A5HA 4Z6AH 1HAVB 1GI2A 1GBMA 3EQ0H 5EXLA 1KTSB 4XSKU 1NPMA 6GCHG 5K7RA 2PKAA 3H09A 1D3QB 2ANKH 2QV1A 2ZDKA 2Z3EA 3GCHB 1ZZZA 2BD8A 5JBCS 3MU0A 3SJ8A 1AVXA 1C1MA 3GY5A 1FONA 1C2IA 3GOVB 5DN6D 4AFSA 1S83A 1TABE 1YBWA 2WV4A 1MAYA 3PV5A 3QK1A 3QUMP 4Y10E 1GHZA 2BY8X 5JB9S 3F68H 1C5ZB 1S5SA 1LVMA 2F4LA 4ZKNU 3TJNA 1P05A 5K0HA 1AUTC 4M7GA 2ANWA 2L74A 2BD7A 1EX3A 3MU1A 1GI1A 1Y5UT 1DLEA 4X1QU 5CHAC 5H4IB 1BBRH 4WF8A 4ABJA 1D6RA 1C1OA 1ANDA 1CO7E 1O5CB 2ZF0H 5HXFA 1O5GH 1ZSJA 3BSQA 2WINI 4FVDA 1A0JA 2GZ7A 3O8CA 3VB3A 3UR6A 1S0RA 2J38A 3GY8A 2GJGA 2ZECA 1YP9A 3L6PA 3PMHB 1GCTC 2BDYA 2Q6FA 4FUFA 1MQ5A 1QY6A 3UNRA 2D2DA 4O9VA 4MLFB 5GCHF 2VIQA 1SGQE 1SLWB 1AKSA 2P8OB 4NZLA 2GZ9A 4ZROA 4ZKOU 1ID5H 2BQWB 5EXNA 1NY22 4FUCA 1FN8A 1JRTA 2XNDD 4HZHA 1N8OC 1GHYH 3CENA 4JK6A 3RXUA 1C1RA 4XDEA 1V2NT 2FOGA 2ZPSA 3FP6E 1EXFA 1ZGIA 2JH0D 1AHTH 1BTWA 2QE7D 4CREA 4MTBA 2SFAA 1TQ0B 2ZU4A 1O5EH 3EE0B 2A4RA 3F3BA 1BT7A 2NU2E 3NXPA 2J98A 1P2QA 2BX3A 3ZZ4A 4XD7D 2OUAA 5KECA 4RI0A 4B71A 4Q7XA 1C2GA 1WTHD 4A6LA 3M36A 2AYWA 3AK5A 2ZI2H 1D6WA 1H8DH 2XBXA 1NU9A 4CRGA 1HNEE 2WHXA 1MCTA 1T4VH 3SU0A 5GCHG 1VITF 3BTKE 1O0DH 2TPIZ 4X8TH 2R3YA 1AB9C 5BRRE 1HRTH 1G3EA 1T32A 4CBNA 1D3TB 3JZ1B 1ZMLA 4AOQA 1V2UT 2G8TA 1B5GH 1K1OA 2ALVA 5DP8A 4WXVA 4AZ2B 6ESTA 1HAVA 1ESBA 3TH4H 7LPRA 5KGOA 1D3DB 2ZO3H 3HKJB 5E0HA 3RXJA 3MH7A 1HJAB 3QTVH 1P2OA 2ZHWH 3DHKH 4MNVA 2RA0A 1UTNA 1FI8A 2BDBA 3FO8D 1AE8H 1FY5A 1H4WA 4NGAH 2PTNA 3A85A 5CMXH 2VIDA 1TGCA 2V6NA 1GVLA 1BB0B 1KIGH 4FU8A 3VGCB 3H7OA 4DT4A 2QXJA 5F6MA 1HAOH 4U01A 1XXDA 1S6LA 2BD9A 5HIYA 1AVWA 4F49A 4BAQB 5FX6A 2PHBA 2HPPH 1C1SA 4R8TB 1D3PB 5EIYA 1UMAH 4NCYA 4GSOA 4ABHA 1ARCA 1P8VC 2F91A 2BYAX 2BD4A 3ZZ8A 1GGDC 3SO3A 2F9PA 1H1BA 3H5CB 2GCHG 3UOUA 1LQDB 5EQRA 2EI7A 2FYQA 4AC9A 4CRDA 2CK3D 2FX6A 4AORA 4LOYH 1S0QA 3B23B 4MNWA 4YXWD 1OWEA 2GMTC 4H4FA 1JOUB 3A86A 5FPYA 2OBQA 1TQ7B 1DSUA 1BQYA 3M5NA 1SBWA 3PMAB 4Y79A 1O3GA 4LZ1H 4MNXA 1ZJDA 2Q1JA 4WWYA 1NN6A 2XCFA 2QIQA 4X1RU 2FTMA 1CQQA 4J2YB 2BD3A 4Y0YE 2GCTC 3LU9B 1TAWA 1HPGA 3TK5A 1BBRE 1TGNA 4I8LA 3VB6A 5LH8A 1GI3A 3NRLA 4Q4LA 4NIVA 4YZUA 1O3BA 4OGYA 1E38B 1YPHE 1HUTH 1LPZB 5T6GA 3RXOA 1O5AB 1HBTH 2G5VA 1GMCF 3RXPA 1O2HA 5AF9H 1W2KH 3BEIB 1ETRH 1ZHPA 4Y76A 1JMOH 1W0YH 2M2AA 2B7DH 3UREA 4CH2B 2F9UA 4OS6A 3B9FH 1W8BH 3SYJA 4DG4A 1GBCA 3GY3A 1H8HD 3UB0A 1SHHB 1O3LA 3RUOA 1GGDB 3WW7A 1DFPA 2ZPQA 4X6OA 1QL8A 1ELGA 1P04A 2ZDAH 4I33A 2RDEA 4ZKSU 1EAXA 2DUCA 2WYJA 1YLDA 3EA7A 3QN7A 3FZDA 2ZGJA 1SGDE 3SORA 3HGNA 4X6NA 3RM0H 1J15A 1OWHA 2TBSA 1QA0A 1Z6JH 3F9FA 3SJ9A 3E6PH 4ABAA 2CF9H 2GCTB 1TA6A 2Y81A 3BG4C 3UY9A 4GLYA 8GCHF 1Y3UA 2OC7A 1GMHF 5EPNA 2AHME 1YLNA 3T25A 1INCA 3O8BA 1Z71A 1J16A 1WBGB 2AERH 1HAPH 2OC8A 1BTZA 1C9TA 4ZH8A 1DITH 1P02A 4YO9A 1O3KA 2ZFRH 1MD7A 3I29A 3F6UH 1C1NA 4I31A 1BJUA 1O31A 3OE7D 1XUIA 4JMYA 2F9NA 1C4U2 3U69H 1GHXH 5GDSH 5FAHA 1AMHA 3A8CA 3SU2A 4HTCH 3SU6A 1VCQA 4INLA 2CXVA 1THRH 1ELTA 1C2LA 1GJ5H 3TIUA 2RFKC 1DVAH 1T7CA 3MH4A 2AS9A 4A92A 3SNAA 3PYHA 4IMQA 5DP7A 1GI6A 1K1PA 2BM2A 1KYNA 1LO6A 1O2OA 2QF5A 2BZAA 1P11E 2FO9A 1FMGA 1GBTA 2VVCA 3Q3XA 5C1XA 3NPSA 4BTTB 1UVSH 5IDKA 3Q00A 2KZ4A 2EI6A 4DURA 1YF4A 1TGBA 1FV9A 4I7YH 2Y80A 4BOHA 2OBOA 1O3NA 3ZV9A 2W26A 2VIVA 2FOCA 3QDZB 4B2AA 5HYOA 4ABFA 1PPFE 1KTTB 1E34B 4ZMAH 1IOEA 1Q3XA 4XOJA 3WWFA 4IN1A 1GBJA 1KXDA 4OS4A 2XBYA 3MYWA 3BG4B 4TY7A 2LNCA 4ABGA 1HB0B 3ENSB 1LDTT 3LJOA 6CHAB 3OAAD 2PV9B 1TONA 1NRNH 2FOBA 2PLXA 2XWAA 4TYDA 1TYNA 1ZMNA 3MFJA 4CRBA 3DA9B 1IQKA 4KTUA 3VG8A 1Z8GA 3PLKA 3T29A 3IWMA 2HPQH 5DG6A 2HGTH 1MTNB 1OSSA 3VB4A 1WSSH 1XM1A 4FUGA 1C4Y2 1GCTB 2PFEA 3PV2A 2C8XB 3FFGA 3KQBA 4O97A 3V13A 1JWTA 3EDXB 3B8JA 1LTOA 4Y8XA 1W7GH 4O03A 1VCWA 1C5WB 2ZQ2A 4YLUA 3ZZ5A 4ACBA 3A81A 4RT0A 1MTSA 2O8LA 1G3BA 5C17A 4ZKRU 4UFDH 5T6DA 3BTEE 1IQFA 1C5XB 1O30A 1W7XH 1Y5AT 2QF3A 1CHOF 1UVPA 1DUEA 2R0KA 1NZQH 2PP6A 2QF0A 2FI4E 2P16A 5EW1H 5C94A 1FIWA 1O2NA 3BTTE 3RXRA 4GUXA 1V2QT 3D23A 3LPRA 4IW4E 2ZWLH 3OY5U 1IHTH 1RXPA 4DIIH 1GJAB 2ZU5A 1KMHB 3TVJB 1EPTB 1GL0E 3MI4A 3A8DA 3ZVFA 1XUHA 2ALPA 3F9EA 4SGAE 3F2HA 2P93A 2R2MB 4WMFA 3SNDA 1P2KA 2PUXB 4J1YA 3T26A 1SGFA 5C3NA 1VGCC 5IYTA 3E1XB 2GT7A 1PPEE 2P8OC 2JJ1D 3GY7A 3FP7E 1SQTA 1L4DA 1GG6C 2OP9A 3KNXA 3LONA 2UUYA 2H5DA 1O2YA 2OC0A 1XMNB 1O3AA 3QZRA 3S7KB 4AFQA 2FOHA 1GDUA 4B6EA 2ESTE 1OS8A 4X6PA 4OS7A 1WOFA 4ISOA 2ZHFH 2BDIA 2C8WB 3P95A 1IQLA 2QN5T 5A8XA 1WXRA 1V2MT 4X8SH 2G81E 2EC9H 2A4GA 1GVZA 2V0BA 5C67A 2BY5X 1UO6A 3W94A 1SGEE 2GCHF 4CBOA 1UTKA 1EQ9A 3U1IB 4GHQA 1PPBH 3UWIA 5T1VA 1O2GH 2G55A 5A0BA 1H9LB 4K2YA 2I6QA 2I6SA 1LKBA 3P8FA 2PKAB 5TJXA 1C1WH 1UHBA 2J92A 2BOKA 1K21H 1A7SA 2SNVA 4O3TA 3UIRA 2FI3E 1D4PB 5AVDA 3CP7A 1JIRA 3OFND 2KR7A 4MPXA 2ZFTA 3KCGH 1UW7A 4FUJA 1O3MA 2ZP0H 3H7TA 4ASHA 3OTPA 1K2I1 4K3JA 4GCHG 2FWWA 2HALA 3CNRA 2C90B 1GBFA 1MKWH 3A7XA 3DCLA 3SV8A 4MNYA 4X1NU 1MKXK 3AVZA 2IJOB 2R2WU 1O3PB 1QCPA 2GDEH 1TALA 3P17H 1QTFA 2CF8H 2Y6TA 4NIYA 1DSTA 3S7HB 3RC4A 1GWAA 4MVNA 3RC5A 1GDQA 1HIAB 5FHTA 5C0UA 1O3OA 5A8YA 3LGUA 3LT3A 1IQIA 3SOSA 2ZTZA 3PROA 4JYUH 2TRMA 1E35B 1G3DA 2ODQA 3STIA 2WPMS 5LPFA 4FETA 1C2KA 3BIUH 4KTCA 3ZZBA 2BMGB 2VGCB 3GYMA 2PUQH 4O3UA 2GKVE 2PGBB 1MBMA 3S69A 1JIMA 1FAKH 1DY8A 1WV7H 2QC2A 3LH3A 3A83A 2VH6A 3RXCA 3SJIA 1K0HA 1ZHRA 4GHTA 1FN6A 1BMFD 5T3HA 4Y8YA 3UAIC 1QL7A 3HK3B 8ESTE 4WH6A 2SNWA 4BAKB 5EXMA 1TBQH 2XWBI 1UK3A 1BJVA 5JDUB 1TMBH 2OK5A 2GMTB 2XW9A 1BITA 3SU5A 3RP2A 1KXFA 1IAUA 2J95A 3AAVA 2GD4B 3VB5A 4CR9A 1V2PT 3RMMH 1AB9B 3WY8A 1V6DA 3MU4A 2Q6DA 3FANA 4K1SA 2J94A 1HAXB 4XRNA 2A7JA 2RCEA 1NU7B 4BAHB 1NBMD 2P94A 1O2JA 1QQ4A 1F7ZA 1MH0A 2FEQH 1DLKB 1FY4A 5AFZH 1O2PA 1QJ1B 1UK2A 2ZTYA 2QAAA 1Y59T 1ANBA 2FPZA 3GCTF 3TK6A 1XKBC 1MMJN 3TJUA 3VFEA 4AGKA 4X6MA 1OWIA 5L2YH 1EJNA 2DE9A 2C8YB 3JZ2B 1AGJA 2ZKSA 4P02A 4YLQH 1T8MA 1ZTJA 1P9UA 5I46H 1C2EA 2THFB 1KDQB 1M9UA 4OS2A 1HAIH 3P8OA 4GCHF 2CHAC 2QF4A 2ODPA 2V35A 1NTPA 4TPYA 4ZAEA 3EGKH 3RXBA 3RLYH 2K8IA 1SLXB 1MKWK 3LDXH 1DX5M 1ELAA 3KQDA 1YPEH 2A5AA 3A7YA 2AMQA 4ZCNA 3SUFA 4DY7B 1FZZA 1YPKH 2WPKS 2SGDE 3KHVA 3KL6A 1GDNA 5LPRA 3L3TA 1ZPZA 2WUCA 4A7IB 1YGCH 1QBNA 3Q76A 2IN2A 3PO1C 4MPUA 1PQ5A 1BMLA 3ZYDA 1V2LT 2H1UA 1UVUH 1H8ED 1V2ST 5ETXA 1UJ1A 2XYAA 3RXMA 4YT7H 1BTYA 5DP6A 1O3CA 4HG6A 4XE4A 1C2JA 4MPVA 3UTUH 1A1RA 3ZVDA 2D26C 2PWXA 4FVBA 5L2ZH 3LGIA 4K1TA 2JETC 2VVUA 5DP3A 1ANCA 4YM9A 2WPJS 2WPIS 3ATMA 4IN2A 4U32A 3STJA 3MO9A 2VH0A 1HGTH 3OSYA 2ZC9H 1CA8B 2BTCE 2KX4A 3A7ZA 1H9HE 4D7GA 1TPPA 3ATLA 2ZIQH 4B1TA 1NRRH 3KF2A 3OEHD 1BTHH 1TMUH 3RXKA 3NCLA 1GMDF 3TJVA 3U8RH 2ILNA 3TLOA 4JZFH 2RG3A 1EAIA 1ZMJA 3FN8A 1XXFA 3URDA 3BTFE 5A0AE 1OHHD 5FPTA 2GX4A 3MNCA 3TK9A 1MKXH 9LPRA 2A0QB 1Z6EA 3TH2H 2Z9KA 1MTUA 2R9PA 4HGCA 4ABBA 3BTME 3T27A 3RC6A 4NFFA 2BLOA 5DP5A 2ZCLP 5A09A 4LXBH 1HJ9A 2A7HA 3GY6A 3HGPA 4IS5A 2PSXA 4BTIB 4DIHH 3ODFA 1LKAA 2BDGA 3SBKA 1XUGA 2HLDD 5G4BA 1DWBH 3ATKA 1H9IE 1KXBA 4Z0KA 1MU8B 1CE5A 1NESE 1GBHA 2J2UA 3G01A 3T28A 4ZXYH 1ZLRA 1W0ZU 5L6NH 4ZUHA 1ZGVA 1BRBE 1LHGH 1SOTA 1GMDG 1LPKB 2AH4X 2BXUH 2SGPE 4IC6A 4UONA 3TGJE 3F2GA 2ZTXA 5JB8S 2VB0A 2ZNKH 4DGJA 1ZRBA 3P8NA 1ARBA 3GCHC 1SMFE 2VBCA 1E1QD 3M7UA 4YT6H 2KCPA 4YOJA 4GAWA 2ZQ1A 1GI0A 2FI5E 3AAUA 5EQSA 3RXFA 3IG6B 2AIPA 4KKDA 1C5NH 1CT4E 1ELDE 2ULLA 2A45B 3K9XB 1CGHA 3A84A 4D9RA 1HAYB 4CRFA 1DICA 4F4OC 1SR5C 3ZZDA 1UCYE 2BHGA 4H6TA 3CS0A 4OS5A 3A88A 4I86A 1QIXB 1SB1H 1L0ZA 2M5TA 4E7RG 4B2CA 2STAE 1G2MA 5EPYA 2Z3DA 1TNIA 4D7FA 1F5KU 3OTJE 2SGEE 1K9OE 1G2LA 3RXVA 1LMWB 3V3MA 1OYQA 1DOJA 2VINA 1KXEA 4RN6A 2RA3A 2Z6BD 1GJ9B 4JZ1A 2W7SA 3EA8A 3TNSA 1VGCB 1SPJA 4UD9H 1OKXA 2BDAA 2A32A 4F48B 1KLTA 4LK4A 1SLVB 4RKOB 2OXSA 3SZNA 2ZGBH 4D9QA 4XFQA 3UQVA 1NFYA 2KAIA 2BD5A 1G3CA 5C0TA 1OWKA 1AO5A 3S9BA 1RGQA 3M3TA 2C4FH 4UEHH 1EZSC 4WY3A 1FQ3A 4HI3A 1N8OB 3A7VA 3DSOA 3M3VA 2EI8A 3RMOH 3U8TH 1EOJA 2HRVA 2PKSC 2WV5A 2V7QD 3S9AA 3ZIAD 1TRYA 3MU5A 1IQHA 1YCPH 4MG3A 2V3MA 5TCAA 3O8RA 2W6JD 5F53A 4K69A 1C5QA 1F0UA 1YY3A 1GJCB 1O2WA 2C3SA 1EFRD 5CHBA 3SI3H 3NKKA 3M5LA 3E91A 1UVTH 4NIXA 3VGCC 2VWLA 3UWJH 3M5MA 3A8AA 5KEDA 4THNH 1F92A 1MUEB 5EOKA 1NM6A 1ESAA 3ZZ7A 1O5DH 1L1NA 1V2TT 1WCZA 1A5GH 5JBAS 1LHDH 2QXHA 2D1JA 2C93B 1A46H 1KY9A 1W13U 2KM0A 3KQEA 4KELA 1Y3XA 1S85A 1Z8IB 4INHA 2F9BH 3BTHE 1V2RT 3S9CA 3D49H 3ZVAA 3R0FA 4Q63A 1HJAC 2BY9X 3RXGA 5JPMH 1GJ8B 1TPOA 1O2SA 3V7TA 1BRAA 2W3KA 3MTYA 3DD2H 1K1NA 3GISB 3OY6U 4ISIH 4ABEA 4LZ4B 3HKIB 3M7TA 4BAOB 2RDLA 2FS9A 2XC5A 1W0JD 1A3BH 5HM9A 2XC0A 2Y82A 2OLGA 3FAOA 1QNJA 2PGQB 3ZYEA 3ODDA 2BZ6H 1K1MA 4DVAU 1A0HB 3T2NA 3ZZ3A 2PTCE 3PRBA 3RXLA 3GDVA 4I8JA 3QWCH 1O3JA 3ZVCA 1TMTH 3F0PA 1O33A 2XBVA 3MH5A 1V2JT 1Y3WA 1WDIA 2FYRA 8LPRA 1G32B 1CA0C 1W3CA 1P2JA 1UCYH 1Z8RA 5C5OA 1GI9B 3TITA 1NRPH 2Z9IA 1UVOA 1AFQC 4K8YA 1C5PA 1C2MA 4X8UH 1IQMA 5EODA 5GNDA 3ATWA 1TPAE 3RXDA 1E0FD 1TIOA 2GVFA 1C1QA 1N1LA 1FNIA 1O2MA 2EY4C 4F55A 4FOUC 2YMSC 3LKWA 1QJ7B 5B6LA 1TX8A 2ZU3A 1EJAA 1GI5A 4CRAA 1K22H 1EZUC 5JYIA 2BY7X 4BNRA 3MU8A 1BHXB 1K1LA 4FU7A 2YMSD 3IITA 1O2ZA 5EW2H 4CH8B 1FX0B 1SQOA 1C1PA 1W12U 3SV6A 6LPRA 1A3EH 4YESB 3GCOA 1QB1A 3LH1A 4D8NA 1QURH 1COWD 1EPTA 1HIAA 1BRCE 3F2FA 2BX4A 1O32A 1TRNA 1GVKB 2FM2A 2KCOA 3AASA 4BXWA 1J8AA 3AW1A 1RTLA 1VITG 2H9EH 1GBLA 1QL9A 3RU4E 3SN8A 1MQ6A 1E1RD 4A1VA 2SGAA 3SHAH 2ZA5A 4TSFD 1SVPA 1DT2A 2F9OA 1FPCH 2ZCKP 3RXQA 1C1TA 1XUFA 2Z9JA 5F03A 1P57B 2IPHA 3E0PB 1HYLA 3MNSA 1GHBG 4Y0ZE 5E2PA 2K0QA 4AB8A 4H6SB 1DS2E 3QX5H 5T6FA 1DY9A 1AU8A 3GY4A 1LVBA 1TOCB 4DCDA 4AB9A 3MH6A 1PYTC 3PV4A 4KGAA 2W5EA 1SQRA 3PO1B 4YOIA 1YPMH 2YMSB 1TPSA 1HAGE 5DSFA 1MTWA 2JH5D 1GHAG 2NWNA 1QQUA 2R3UA 1GJ4H 1O37A 2GV6A 1GJDB 1HFDA 1ABJH 3A82A 3SU4A 5FCRA 2ZZUH 2BVSH 2TGDA 4Y7BA 7ESTE 1ELBA 2FOFA 5EG4A 3RM2H 1VITH 1DM4B 1QGFA 1THPB 3SV2H 4DJZB 3FOAA 1FY3A 1X7AC 2BLWA 2AMPA 2BVRH 1AD8H 1SSXA 1WYKA 5E2OA 2Z94A 5JBBS 1CHOG 1ACBE 2B9LA 1OP8A 1C2DA 5SGAE 1YCPK 1Y3VA 3GICB 1F5RA 3E0NB 3LC5A 2K1QA 5DGJA 1GJ7B 1AQ7A 4NSYA 1O3IA 1Z1JA 2P3TB 2QYIA 2R0LA 1P01A 2H9HA 1IQNA 1YCPM 5E8EH 1CT2E 3RU4D 4A1XA 1T8OA 3N7DA 5LGOA 1ORFA 5DP4A 4Q2KA 3KGPA 2BDCA 1E37B 1N6YA 1Z1IA 5HM2A 2ZDVH 5CHAB 5FCKA 4CRCA 5B6OA 2VNTA 1A0LA 1THSH 3GS9A 5A8ZA 1VCPA 1SGYE 1SQAA 4AYYB 3MNBA 1ZRKA 2P3FH 3MQKC 3KYGA 5IK2D 1TLDA 1TBZH 1ZSLA 1QRWA 1AWFH 2ZGXH 3VPKA 1H8IH 3MOCA 3I78A 4DW2U 4UFGH 1C5SA 3MO3A 2F9VA 1C1UH 1SGTA 2ZFPH 5CE1A 1O2LA 2BB4A 4E7NA 1SGIB 2ZHEH 3F1SB 3P6ZB 3UR9A 1F0RA 4ZHMU 1TNHA 1V3XA 5C1UA 4NA9H 4FUEA 1O2RA 1CT0E 4KTSA 3QO6A 2ZCHP 2OINA 1G36A 3PTNA 3PM3A 4RSPA 5C5NA 4IMZA 1XKAC 4NG9H 1XVOA 1GJ6A 5TCCA 4XBBA 1IQJA 4VGCB 2BVXH 3RXEA 2VWOA 1EASA 2AIQA 2YNBA 3PWCA 1SGFG 1MZAA 1DDJA 3SUDA 2HOBA 1K1JA 3SJOA 1TGSZ 1O3DA 4WXIA 5ESTE 4BXSA 4UDWH 3RU4T 1F2SE 4OGXA 4AG1A 1GBAA 1NC6A 4JZEH 1A5IA 3KN2A 4R0IA 4TWWA 1SOZA 3L33A 2HLCA 4JYTA 4JZDH 1O5BB 2BY6X 4IC5A 2TGPZ 1RTKA 3N99A 1RD3B 4B75A 4K1EA 1ZJKA 1TFXA 2ASUB 1C5VA 3UNQA 1C5RA 2HNTC 2AFQB 1GMHG 2A31A 2WV9A 1DE7H 1Y5BT 2ZFSA 4I8HA 1AUJA 1S82A 3P92A 1VJAU 5L30H 1L1JA 1HV7A 1C5TA 1HAZB 1DANH 2Z9GA 1ELCA 4FUBA 3DFJA 1WQSA 2OC1A 3SHCH 2UWLA 2VIPA 2HNTF 4WMEA 1V2WT 4ISLA 2FLRH 1EUFA 1QR3E 6CHAC 1RIWB 2PR3A 3ZVBA 1UTLM 1F5LA 5E0GA 2CHAB 1TBRH 3SU3A 5DO4H 1RFNA 1XUJA 2GTBA 4NFEA 3MWIU 2A4OA 3NWUA 4K60A 4MQAA 4JCNA 3T62A 2D8WA 1WTGH 1YM0A 3SNBA 1FY1A 3A87A 1FJSA 3LJJA 1CBWC 1EKBB 4FUDA 3W1EA 1AWHB 4ASUD 1OXGA 3FP8E 3QGJA 4Z1MD 1PPZA 1TE0A 1NROH 1S84A 1CA0B 2EEKA 2Z9LA 4ISHH 1Y3YA 2B8OH 2Y5FA 4B76A 4Y8ZA 1BMAA 1PJPA 1S6FA 1Z8JB 4ZXXH 1LPGB 3ZZ6A 1DWDH 1DXWA 3BG8A 4ABIA 1YPJH 3E3TA 2A1DB 1EP6A 2BLQA 3VEQB 1QHRB 3A7WA 1TNJA 2LP6A 1SFQB 1O36A 3P70B 3LGTA 3KEEA 2ZEBA 1TX7A 3URCA 4ESTE 4PROA 1LHEH 3M7QA 3TGIE 1QZ8A 1OP0A 2XXLA 2A4QA 1OP2A 1S6HA 1YPHC 2JDID 2AGGX 4X2WA 4B73A 4X1SU 1O3EA 1UCYK 7GCHG 3E16B 3W95A 2L6OA 4OS1A 2G5NA 3D62A 2GGVB 1BTXA 1LQEA 1P2NA 4BANB 1FIZA 1PPGE 1Z7KA 3PMJA 4CHAB 3SNEA 5A2MH 3LOXA 1ZOMA 1TNGA 2Z3CA 5F8TA 2HNTE 3QGNB 4X1PU 1AY6H 1GBBA 4SGBE 4XBDA 4TT3D 1GBEA 1PQ7A 1LVYA 3PLPA 3FVFB 4AGJA 2YOLA 5EJLA 2ZU2A 3RLWH 1KXCA 1BHXF 4Q80A 4TY6A 2GP9B 1BTUA 2ZHDA 3UUZA 1SGPE 3HATH 3GDSA 1ZHMA 1IHSH 2UUJB 1L4ZA 3ATIA 3UPEA 2W7UA 2J97A 1O35A 3Q77A 5GIBA 1JBUH 1J14A 1YPLH 3A89A 4X2VA 3LC3A 4JZIA 1SFIA 3SZEA 3MNXA 1GBKA 1GG6B 2Y5GA 1O2XA 4GVUA 4P00A 3U1JB 3QLPH 1YC0A 1ZPBA 1MU6B 1MABB 1Q31A 2G00A 3U28C 1N6XA 1J17T 4YOGA 1GHWH 2XBWA 1SLUB 2H5CA 1IQEA 1ETSH 3SU1A 7KMEH 2B0FA 3UOPA 4DOQA 1EZXC 4WH8A 1GI4A 4NA8A 1HXFH 3DSPA 1V2VT 1GBIA 3BIVH 3KQ5A 2J34A 4TPIZ 1MZDA 1ZPCA 2LPRA 2WSSD 4JK5A 1SC8U 2O9QA 2V3HH 3BTDE 2G52A 3O8DA 2SGQE 2EQNA 4KP0A 2A2XH 3GYLB 2JIZD 4AX9H 1UHBB 5C1YA 3RMNH 3EE7A 1AZZA 1BRUP 1IQGA 3EAJA 3BEFB 4NZQA 3RXAA 3TGKE 1FDPA 2BXTH 5AHGH 1NFWA 3SI4H 1UTOA 2BQ7B 3Q3YA 1KLJH 1RTFB 1W0KD 1ZR0A 2J4IA 4D76A 2FIRH 3CS7A 1BBRK 1TRMA 3NUMA 3RXHA 8GCHG 2WZQA 4Y11E 3GCTG 2A7CA 3UFAA 1LHCH 3PWBA 1TB6H 3F0OA 1ZTKA 5LPEA 4AFZA 1BOQA 5HMAA 1AN1E 2G51A 1YYY1 4M9FA 2SGFE 2GDDA 1BIOA 1OOKB 3VXEH 5DKMA 1AVGH 3LIWA 2H6MA 1PQ8A 2FTLE 2FOEA 4Y71A 1ABIH 1C4V2 1NO9H 4AFUA 2VWNA 2KFWA 3PMBB 2BQ6B 1BUIA 1O2VA 3RXTA 3M3SA 3LGVA 5JBTA 2WYGA 3Q3KA 1RIWC 2XNIA 1T4UH 2PKSB 2KCAA 5I25A 3SUEA 1O38A 1P06A 3ESTA 3ITIA 4INKA 2PSYA 1GMCG 2AGIX 2GV7A 1A61H 1WUNH 1XX9A 2B5TB 1AZ8A 5FBEA 1OYTH 3SV7A 3ELAH 2Q6GA 3K6YA 2W6ID 2J98B 5HKKD 4X2XA 2A5KA 5GXPA 1C2FA 3U8OH 2Z7FE 5EJ1A 3OX7U 5FL7D 3E8LA 2AGEX 1EAWA 4A5TS 1O3FA 1FUJA 1WAYB 1JXPA 1TNLA 1O2QA 2ANYA 3BTGE 1BDAA 1P10A 4AG2A 4E05H 3EYDA 1CU1A 2HVYB 1EB1H 1U6QA 1VZQH 1Y8TA 4I8KA 4NWLA 1UTJA 1S81A 5ABWA 3MO6A 3TH3H 1J9CH 1LHFH 4X8VH 1B0EA 1VJ9U 2Y7ZA 3SNCA 1NBME 1SHYA 1UTPA 4MPWA 1AKSB 4OM9A 2F83A 1G9IE 4Q7YA 3HK6B 3SGQE 1P0SH 3N7EA 2TGTA 1NFUA 2VIWA 2VGCC 4A1TA 3F9HA 5F8XA 5EGMA 3P8GA 1XUKA 1C5UA 2OCVB 4ZHAA 4AN7A 4H42U 4QT8C 2QCYA 1P9SA 1NS3A 1DPOA 2BLVA 1BCUH 2UWOA 2BDHA 1B7XB 3QTOH 2CGAA 1DWEH 1ZYOA 2ZFQH 2O8TA 2DE8A 1MTVA 1QA7A 1YKTA 4NWKA 3U98H 1G37A 1TOMH 5J4SA 1CGIE 4NIWA 1SI5H 3M35A 4U30A 5FBIA 1SGRE 5AFYH 5HIZA 1ESTA 1GBDA 1AI8H 2ZDMA 1AFEH 5FXLA 1NRSH 2FOMB 3T5FH 1GL1A 2VJ1A 2AMDA 1O2IA 3K6ZA 5FX5A 1KLIH 3A7TA 5BPEA 4X2YA 5J4QA 1BZXE 1TWXB 1O5FH 1MBQA 3N7OA 3TPIZ 4TWYA 2QGRA
chains in the Genus database with same CATH topology
1W11U 8KME2 2FP7B 2Y7XA 2ZDNA 1BMMH 3KQCA 2QXIA 5C2ZA 1KSNA 1QRZA 4X0WU 3PLBA 2Y5HA 3BV9B 5HGGA 1HAHH 1F0SA 3DUXH 1JRSA 1K1IA 5C20A 2XC4A 1D9IA 2CMYA 1MCVA 3SJKA 3ZVEA 2IOTA 5ESBA 2CJIA 2FS8A 2H9TH 2W3IA 3MMGA 1HCGA 3ZZAA 1OPHB 4XBCA 2GZ8A 2J9NA 2JH6D 2ZHQH 1O34A 1P2MA 3BN9A 1CGJE 3RXSA 2STBE 2O8UA 4E06H 1GJBB 3BF6H 3V0XA 2H2ZA 4FU9A 1HJ8A 4GPGA 2XTTB 2P3UB 4IBLH 9ESTA 1MD8A 3M61U 1PPHE 2ZGCA 1O2UA 5DK1A 2FODA 2XRCA 1EPTC 3C1KA 1P2IA 1CSOE 4U2WA 2NU0E 1FPHH 2G4TA 2ZFFH 5EQQA 4NA7A 1L1GA 1W14U 3TU7H 1KXAA 1ELVA 1QFKH 4I32A 1TGTA 3UQOA 2ANMH 5DP9A 1HLTH 1QBOA 3K2UA 3OU0A 1NRQH 1W10U 2WPHS 2OQ5A 4B2BA 2JETB 2ZDLA 2ZU1A 2FLBH 2ZGHA 3DT0H 1QBVH 3GCNA 2BOHB 3E90B 1QJ6B 1BMNH 1PPCE 1GPZA 1L2EA 1P12E 1E36B 1C5YB 1ELEE 3RDZA 4JYVH 2GT8A 1C1VH 4WJG2 1G30B 1ZSKA 3U9AH 3K65B 4UE7H 3I77A 3SW2B 4AYVB 3ZV8A 1C5MD 1RRKA 3QZQA 4ISNA 7GCHF 2CV3A 3OYPA 1WQVH 1BTPA 2UWPA 3FZZA 1OWDA 5EU8A 1EJMA 2OQUA 2P95A 1XVMA 1C2HA 4K8BA 1P09A 2HWLB 3SUGA 4WMDA 6GCHF 3M5OA 3D65E 3SGAE 1T31A 2WPLS 4CHAC 4CR5A 2FXRA 4Y7AA 1DWCH 4ZHLU 3S0NA 2ZG0H 5A0CA 3BTQE 2O8MA 1AFQB 4DT7B 1Q2WA 3MHWU 3F9GA 2O8WA 1LVOA 2FMJA 1GCDA 4HFPB 1A4WH 3ZZCA 1TX6A 3ZVGA 4Y6DA 5F8ZA 4Q7ZA 1V2KT 4UFFH 1P03A 1UTQA 2VIOA 3A80A 1AIXH 2FZZA 1GHVH 1EOLA 2TGAA 3GDUA 2V3OH 1ELFA 2NU1E 2VWMA 3GY2A 1PYTD 1P3CA 1VR1H 1NT1A 3RMLH 1NFXA 1C5OH 2QA9E 1TA2A 3ZZ9A 2OTVA 1MTNC 1ANEA 2YNAA 2TIOA 3R3GB 3M37A 4RKJB 3SV9A 1P3EA 1O2KA 2G4UA 1PQAA 1AE5A 1UK4A 1F0TA 1V2OT 2A5IA 3VB7A 1EAUA 4FUIA 4BAMB 1EP5A 2A2QH 2XCNA 3LGWA 1B0FA 2NU3E 1OWJA 2OD3B 4BTUB 2KAIB 3NK8A 4K5ZA 1T8NA 1YLCA 3C27B 1C5LH 1RS0A 4MDSA 5PTPA 3SGBE 1CHGA 2FX4A 1O2TA 2AEIH 1FAXA 1A2CH 2VU8E 3PTBA 3DFLA 1MAXA 1CBWB 3KIDU 3BTWE 1SGCA 5GWZA 1OX1A 1DXPA 3V12A 5GPIB 2PW8H 4ABDA 1QB9A 2FDAA 1SL3A 4I8GA 2P59A 2CN0H 3SQHE 1QRXA 1QB6A 4B74A 4NSVA 3NZIA 1TNKA 4YTAA 2EA3A 3SQEE 1WU1A 2VVVA 3RXIA 3EA9A 1RJXB 1T8LA 4UFEH 1ZTLA 1FLEE 1O3HA 3UNSA 1C9PA 1DUAA 4WVPE 2C8ZB 2FOAA 1GHAF 3PB1E 4VGCC 3A8BA 1HDTH 3LGYA 1SG8B 5E0JA 1GI7B 1HXEH 2FESH 5FPSA 4FUHA 3TJOA 5GJ4B 2NU4E 2BD2A 4FXGH 1FXYA 3HPTB 1PFXC 5DJ7A 3VXFH 1K28D 1KDQA 3BEUA 2QXGA 1GI8B 5DPAA 2JKHA 1ETTH 1O39A 2ODYB 1UTMA 2QY0B 1GHBF 2HVXA 3TNTA 1EATA 1SGNE 2ZPRA 2F3CE 1BA8B 1YPGH 1EZQA 1FY8E 1CVWH 2UUFB 2UUKB 1EB2A 4IGDA 1LCYA 2WUBA 3AW0A 1A5HA 4Z6AH 1HAVB 1GI2A 1GBMA 3EQ0H 5EXLA 1KTSB 4XSKU 1NPMA 6GCHG 5K7RA 2PKAA 1D3QB 2ANKH 2QV1A 2ZDKA 2Z3EA 3GCHB 1ZZZA 2BD8A 5JBCS 3MU0A 3SJ8A 1AVXA 1C1MA 3GY5A 1FONA 1C2IA 3GOVB 4AFSA 1S83A 1TABE 1YBWA 2WV4A 1MAYA 3QK1A 3QUMP 4Y10E 1GHZA 2BY8X 5JB9S 3F68H 1C5ZB 1S5SA 1LVMA 4ZKNU 3TJNA 1P05A 5K0HA 1AUTC 4M7GA 2ANWA 2BD7A 1EX3A 3MU1A 1GI1A 1Y5UT 1DLEA 4X1QU 5CHAC 5H4IB 1BBRH 4WF8A 4ABJA 1D6RA 1C1OA 1ANDA 1CO7E 1O5CB 2ZF0H 5HXFA 1O5GH 1ZSJA 3BSQA 2WINI 4FVDA 1A0JA 2GZ7A 3O8CA 3VB3A 3UR6A 1S0RA 2J38A 3GY8A 2ZECA 1YP9A 3L6PA 3PMHB 1GCTC 2BDYA 2Q6FA 4FUFA 1MQ5A 1QY6A 3UNRA 2D2DA 4O9VA 4MLFB 5GCHF 2VIQA 1SGQE 1SLWB 1AKSA 2P8OB 4NZLA 2GZ9A 4ZROA 4ZKOU 1ID5H 2BQWB 5EXNA 1NY22 4FUCA 1FN8A 1JRTA 4HZHA 1N8OC 1GHYH 3CENA 4JK6A 3RXUA 1C1RA 4XDEA 1V2NT 2FOGA 2ZPSA 3FP6E 1EXFA 1ZGIA 2JH0D 1AHTH 1BTWA 4CREA 4MTBA 2SFAA 1TQ0B 2ZU4A 1O5EH 3EE0B 2A4RA 1BT7A 2NU2E 3NXPA 1P2QA 2BX3A 3ZZ4A 2OUAA 4B71A 4Q7XA 1C2GA 1WTHD 4A6LA 3M36A 2AYWA 2ZI2H 1D6WA 1H8DH 2XBXA 1NU9A 4CRGA 1HNEE 1MCTA 1T4VH 3SU0A 5GCHG 1VITF 3BTKE 1O0DH 2TPIZ 4X8TH 2R3YA 1AB9C 5BRRE 1HRTH 1G3EA 1T32A 4CBNA 1D3TB 3JZ1B 1ZMLA 4AOQA 1V2UT 2G8TA 1B5GH 1K1OA 2ALVA 5DP8A 4WXVA 4AZ2B 6ESTA 1HAVA 1ESBA 3TH4H 7LPRA 1D3DB 2ZO3H 3HKJB 5E0HA 3RXJA 3MH7A 1HJAB 3QTVH 1P2OA 2ZHWH 3DHKH 4MNVA 2RA0A 1UTNA 1FI8A 2BDBA 1AE8H 1FY5A 1H4WA 4NGAH 2PTNA 3A85A 5CMXH 2VIDA 1TGCA 2V6NA 1GVLA 1BB0B 1KIGH 4FU8A 3VGCB 3H7OA 2QXJA 5F6MA 1HAOH 4U01A 1XXDA 2BD9A 1AVWA 4F49A 4BAQB 5FX6A 2PHBA 2HPPH 1C1SA 4R8TB 1D3PB 1UMAH 4NCYA 4GSOA 4ABHA 1ARCA 1P8VC 2F91A 2BYAX 2BD4A 3ZZ8A 1GGDC 3SO3A 2F9PA 1H1BA 3H5CB 2GCHG 3UOUA 1LQDB 5EQRA 2EI7A 2FYQA 4CRDA 2FX6A 4AORA 4LOYH 1S0QA 3B23B 4MNWA 1OWEA 2GMTC 4H4FA 1JOUB 3A86A 5FPYA 2OBQA 1TQ7B 1DSUA 1BQYA 3M5NA 1SBWA 3PMAB 4Y79A 1O3GA 4LZ1H 4MNXA 1ZJDA 2Q1JA 4WWYA 1NN6A 2XCFA 2QIQA 4X1RU 2FTMA 1CQQA 4J2YB 2BD3A 4Y0YE 2GCTC 3LU9B 1TAWA 1HPGA 3TK5A 1BBRE 1TGNA 4I8LA 3VB6A 5LH8A 1GI3A 4NIVA 4YZUA 1O3BA 4OGYA 1E38B 1YPHE 1HUTH 1LPZB 5T6GA 3RXOA 1O5AB 1HBTH 2G5VA 1GMCF 3RXPA 1O2HA 5AF9H 1W2KH 3BEIB 1ETRH 1ZHPA 4Y76A 1JMOH 1W0YH 3UREA 2B7DH 4CH2B 2F9UA 4OS6A 3B9FH 1W8BH 4DG4A 1GBCA 3GY3A 1SHHB 1O3LA 3RUOA 1GGDB 1DFPA 2ZPQA 4X6OA 1QL8A 1ELGA 1P04A 2ZDAH 4I33A 4ZKSU 1EAXA 2DUCA 2WYJA 1YLDA 3EA7A 3QN7A 3FZDA 2ZGJA 1SGDE 3SORA 3HGNA 4X6NA 3RM0H 1J15A 1OWHA 2TBSA 1QA0A 1Z6JH 3F9FA 3SJ9A 3E6PH 4ABAA 2CF9H 2GCTB 1TA6A 2Y81A 3BG4C 3UY9A 4GLYA 8GCHF 1Y3UA 2OC7A 1GMHF 5EPNA 3T25A 1INCA 3O8BA 1Z71A 1J16A 1WBGB 2AERH 1HAPH 2OC8A 1BTZA 1C9TA 4ZH8A 1DITH 1P02A 4YO9A 1O3KA 2ZFRH 1MD7A 3I29A 3F6UH 1C1NA 4I31A 1BJUA 1O31A 1XUIA 4JMYA 2F9NA 1C4U2 3U69H 1GHXH 5GDSH 5FAHA 1AMHA 3A8CA 3SU2A 4HTCH 3SU6A 1VCQA 4INLA 2CXVA 1THRH 1ELTA 1C2LA 1GJ5H 3TIUA 1DVAH 1T7CA 3MH4A 2AS9A 4A92A 3SNAA 3PYHA 4IMQA 5DP7A 1GI6A 1K1PA 2BM2A 1KYNA 1LO6A 1O2OA 2BZAA 1P11E 2FO9A 1FMGA 1GBTA 2VVCA 3Q3XA 5C1XA 3NPSA 4BTTB 1UVSH 5IDKA 3Q00A 2EI6A 4DURA 1YF4A 1TGBA 1FV9A 4I7YH 2Y80A 4BOHA 2OBOA 1O3NA 3ZV9A 2W26A 2VIVA 2FOCA 3QDZB 4B2AA 5HYOA 4ABFA 1PPFE 1KTTB 1E34B 4ZMAH 1IOEA 1Q3XA 4XOJA 4IN1A 1GBJA 1KXDA 4OS4A 2XBYA 3MYWA 3BG4B 4TY7A 2LNCA 4ABGA 1HB0B 3ENSB 1LDTT 3LJOA 6CHAB 2PV9B 1TONA 1NRNH 2FOBA 2PLXA 2XWAA 4TYDA 1TYNA 1ZMNA 3MFJA 4CRBA 3DA9B 1IQKA 4KTUA 1Z8GA 3PLKA 3T29A 3IWMA 2HPQH 5DG6A 2HGTH 1MTNB 1OSSA 3VB4A 1WSSH 1XM1A 4FUGA 1C4Y2 1GCTB 2PFEA 2C8XB 3FFGA 3KQBA 4O97A 3V13A 1JWTA 3EDXB 3B8JA 1LTOA 4Y8XA 1W7GH 4O03A 1VCWA 1C5WB 2ZQ2A 4YLUA 3ZZ5A 3A81A 1MTSA 2O8LA 1G3BA 4ZKRU 4UFDH 5T6DA 3BTEE 1IQFA 1C5XB 1O30A 1W7XH 1Y5AT 2QF3A 1CHOF 1UVPA 1DUEA 2R0KA 1NZQH 2QF0A 2FI4E 2P16A 5EW1H 1FIWA 1O2NA 3BTTE 3RXRA 4GUXA 1V2QT 3D23A 3LPRA 4IW4E 2ZWLH 3OY5U 1IHTH 1RXPA 4DIIH 1GJAB 2ZU5A 3TVJB 1EPTB 1GL0E 3MI4A 3A8DA 3ZVFA 1XUHA 2ALPA 3F9EA 4SGAE 2P93A 2R2MB 4WMFA 3SNDA 1P2KA 2PUXB 4J1YA 3T26A 1SGFA 5C3NA 1VGCC 5IYTA 3E1XB 2GT7A 1PPEE 2P8OC 3GY7A 3FP7E 1SQTA 1L4DA 1GG6C 2OP9A 3KNXA 3LONA 2UUYA 2H5DA 1O2YA 2OC0A 1XMNB 1O3AA 3QZRA 3S7KB 4AFQA 2FOHA 1GDUA 2ESTE 1OS8A 4X6PA 4OS7A 1WOFA 4ISOA 2ZHFH 2BDIA 2C8WB 3P95A 1IQLA 2QN5T 5A8XA 1V2MT 4X8SH 2G81E 2EC9H 2A4GA 1GVZA 2V0BA 5C67A 2BY5X 1UO6A 3W94A 1SGEE 2GCHF 4CBOA 1UTKA 1EQ9A 3U1IB 4GHQA 1PPBH 3UWIA 1O2GH 2G55A 5A0BA 1H9LB 4K2YA 2I6QA 2I6SA 1LKBA 3P8FA 2PKAB 5TJXA 1C1WH 1UHBA 2J92A 2BOKA 1K21H 1A7SA 2SNVA 4O3TA 3UIRA 2FI3E 1D4PB 5AVDA 3CP7A 1JIRA 4MPXA 2ZFTA 3KCGH 4FUJA 1O3MA 2ZP0H 3H7TA 4ASHA 1K2I1 4K3JA 4GCHG 2FWWA 2HALA 2C90B 1GBFA 1MKWH 3A7XA 3SV8A 4MNYA 4X1NU 1MKXK 3AVZA 2IJOB 2R2WU 1O3PB 1QCPA 2GDEH 1TALA 3P17H 1QTFA 2CF8H 2Y6TA 4NIYA 1DSTA 3S7HB 3RC4A 1GWAA 4MVNA 3RC5A 1GDQA 1HIAB 5FHTA 1O3OA 5A8YA 3LGUA 3LT3A 1IQIA 3SOSA 2ZTZA 3PROA 4JYUH 2TRMA 1E35B 1G3DA 2ODQA 3STIA 2WPMS 5LPFA 1C2KA 3BIUH 4KTCA 3ZZBA 2BMGB 2VGCB 3GYMA 2PUQH 4O3UA 2GKVE 2PGBB 1MBMA 3S69A 1JIMA 1FAKH 1DY8A 1WV7H 2QC2A 3LH3A 3A83A 2VH6A 3RXCA 3SJIA 1ZHRA 4GHTA 1FN6A 5T3HA 4Y8YA 1QL7A 3HK3B 8ESTE 4WH6A 2SNWA 4BAKB 5EXMA 1TBQH 2XWBI 1UK3A 1BJVA 5JDUB 1TMBH 2GMTB 2XW9A 1BITA 3SU5A 3RP2A 1KXFA 1IAUA 2J95A 3AAVA 2GD4B 3VB5A 4CR9A 1V2PT 3RMMH 1AB9B 3WY8A 1V6DA 3MU4A 2Q6DA 3FANA 4K1SA 2J94A 1HAXB 2A7JA 2RCEA 1NU7B 4BAHB 2P94A 1O2JA 1QQ4A 1F7ZA 1MH0A 2FEQH 1DLKB 1FY4A 5AFZH 1O2PA 1QJ1B 1UK2A 2ZTYA 2QAAA 1Y59T 1ANBA 2FPZA 3GCTF 3TK6A 1XKBC 1MMJN 3TJUA 3VFEA 4AGKA 4X6MA 1OWIA 5L2YH 1EJNA 2DE9A 2C8YB 3JZ2B 1AGJA 2ZKSA 4YLQH 1T8MA 1ZTJA 1P9UA 5I46H 1C2EA 2THFB 1KDQB 1M9UA 4OS2A 1HAIH 3P8OA 4GCHF 2CHAC 4TPYA 2ODPA 2V35A 1NTPA 4ZAEA 3EGKH 3RXBA 3RLYH 1SLXB 1MKWK 3LDXH 1DX5M 1ELAA 3KQDA 1YPEH 2A5AA 3A7YA 2AMQA 3SUF