5K7SA

Microed structure of proteinase k at 1.6 a resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title Atomic-resolution structures from fragmented protein crystals with the cryoEM method MicroED.
pubmed doi rcsb
total genus 104
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5k7sA00
1PEKE 2TECE 1GCIA 5AVJA 4LVNA 3Q5GA 2Z58A 3LPAA 3I34X 5AVKA 1TO2E 1MEEA 1V6CA 1GA4A 1R64A 2DQKA 3BGOS 1KDYA 1Y4AE 5JXJA 1Y3BE 3SICE 3PRKE 3WIUA 4C3VA 2WV7A 3F49S 3DW3X 3DYBA 2PWAA 4H6XA 2SICE 4J94A 1ZVKA 3DVSX 1SELA 3HJRA 4RYDA 5ARCA 1AQNA 1HT3A 4AKTA 2E1PA 3GT3A 2Z2XA 1EA7A 2W2MA 1AF4A 1SPBS 3VHQA 3WIVA 4CG0A 2XTJA 2DUJA 2HD4A 1PFGA 3CO0S 3VV2A 3EIFA 1SVNA 1SN7A 2G4VA 2W2PA 3DE7X 1MPTA 3OSZA 3EDYA 2WUVA 1Y4DE 1SIUA 5JMOA 2ST1A 1Y9ZA 3QFHA 3QTLA 1Y1KE 4WOCA 3VTAA 1BH6A 5SICE 3T41A 1AU9A 5JXGA 2QTWB 1SBTA 1ZVJA 1BFUA 3DE3X 1TM1E 3BX1A 4KB5A 4DJ5X 1SBCA 2ID4A 1GA6A 2PYZA 4YN3A 1Y3DE 3GCWA 3TECE 2PQ2A 1TO1E 3LPDA 1UBNA 3EE6A 5ARDA 4NE7A 3QMPA 4H6VA 4ZARA 4ZOQI 1S01A 2W2OA 3WQBA 3VYVA 1AH2A 3A3NA 1T1IA 2WWTA 2PWBA 1YJBA 3TI9A 2Z57A 1SBNE 1BE6A 3DDZX 1YJCA 1TM7E 1XF1A 4I0WB 5AMXA 1Y33E 4OV6B 1SBHA 1GNSA 3L1KA 5K7SA 3VV3A 1EGQA 1GA1A 2ZWOA 1PJ8A 3DE6X 1V5IA 2B6NA 1SUEA 4CFZA 1CSEE 1TM3E 3F7MA 1TM4E 3UNXA 5JXIA 4KG7A 2PRKA 2SNIE 4GI3A 3DE4X 1KDZA 3ZXXA 1TK2A 1Y34E 1SIOA 5I9SA 1SUCA 3AFGA 3GCXA 2PMWB 1SUDA 4B5LA 2V8BA 5FBZA 1WMDA 3AJ8A 4BWGA 4LVOA 3I30X 2HPZA 2IXTA 5FFNA 1SCBA 2Z30A 3DE0X 1SUPA 4OMDA 4NMXB 1GTL1 3D9QX 1Y48E 5JXHA 1P8JA 1SUBA 4C3UA 3DVRX 1C9MA 3BPSA 4MZDA 5B1DA 1R6VA 4DWWA 1A2QA 4KPGA 1THMA 1ST3A 2Z2ZA 3SQOA 1TM5E 1KE1A 2GKOA 3A3OA 4Z2AA 1SCDA 1S2NA 1YU6A 1SIBE 1WVMA 2PKCA 1BJRE 1PTKA 1S02A 1NLUA 1C9JA 1VSBA 3LXUX 3I2YX 5CW1A 1WMFA 1IC6A 4HX2A 3LPCA 3TI7A 1TECE 1BE8A 3D43A 2W2QA 1P7WA 1Y3FE 2W2NA 1KE2A 2ZWPA 3ZXYA 1IAVA 1SCJA 3P5BA 4OMCA 1AK9A 1T1GA 1YJAA 3DWEX 4NE9A 2ZRQA 3A3PA 3VSBA 1AVTA 4K8RB 4JP8A 3DE5X 3WHIA 1LW6E 4AKSA 1Y3CE 3DE1X 3H42B 3F7OA 1OYVA 1TMGE 1T1EA 2XRMA 1BFKA 5AQEA 2Z2YA 2X8JB 3CNQS 3DE2X 1JEAA 4FONA 1AV7A 1GTG1 1NDQA 1DUIA 1C9NA 1SCNE 1P7VA 3DW1X 3Q40A 1OT5A 1GTJ1 1SUAA 1SCAA 3GT4A 3I37X 1R0RE 3PTLA 1SH7A 1GNVA 4DZTA 5ARBA 2SBTA 3AJ9A 1DBIA 2Z56A 2SECE 2P4EA 4HVLA 1KDVA 1SBIA 1WSDA 3DVQX 4H6WA 5B1EA 1NDUA 1ST2A 2ID8A 4M1ZA 1CNMA 1WMEA 1OYOA 2IY9A 4CFYA 1Q5PA 1C3LA 4WOBA 2X8JA 5FAXA 2DP4E 1GT91 2WUWE
chains in the Genus database with same CATH superfamily
3WVNA 3HUFA 4O4JA 2Q9CA 3RGWS 2FPPB 3QKTA 4DR2B 4FYIA 2ODAA 2QJOA 3KOWA 3SNKA 2J45A 2RGYA 3COYA 3KWFA 2IF2A 3ASYA 3D64A 1RWBA 4D6YA 1AZLA 5E6RB 2WFLA 1V8PA 5AVKA 2ZBGA 4ZPXA 4F5YA 1ZNZA 2A1TS 1V47A 2VR1A 4HT3B 4F92B 5JCOC 1JHXA 2E85A 2H29A 2NNWB 1T3ZA 1JZTA 4MIYA 1Z83A 3NIGB 1J2TA 1B8NA 3NOOA 3OQHA 1BEZA 4P86A 1CUCA 5H9VA 2NUTA 4C5CA 1FSFA 4PYRA 2XVXA 4QDUA 1FNCA 2HT6A 2NU9A 3NTLA 1FLVA 1VI6A 3IT3A 1UBGA 2C04A 2XMZA 5BSHA 2EX4A 1QZZA 3QFFA 5AOCA 4HQNA 3X2SA 1Z7GA 3DV0A 3LQFA 2JW5A 4JC0A 4R16A 4B74A 1M2VA 5E3IA 4D43A 1UC5B 4MTLA 1VG1A 2B25A 4OXQA 1DOHA 4R05A 3WLJA 4ZTBA 2FGKA 3I9LA 4JVNA 1NNUA 1BHO1 5KTOA 3BICA 5JCXA 1NRWA 2WY2D 4ZYZA 1CX9B 1KEPA 1TC2A 2FSGA 3HR8A 4LHEA 1ZINA 2CJWA 3RHTA 2GXSA 4C01A 4D96A 1AUQA 4EG4A 5JSZB 3T5GA 4KYVA 2V7QA 2X23A 4AM8A 4M1TA 2VP2A 1UAGA 5HRAA 3FWYA 2QGNA 2RBKA 3FSJX 3QMWA 4H1TA 3GX1A 4I1IA 5EAIA 4DAOA 1J4AA 1HC7A 2FP4A 4YK7A 5HOQA 1CKEA 1ICEA 3EARA 4FM9A 3WL6A 4HAYA 4CVNA 4R69A 1VYHA 2VHUA 2P9EA 4PQRA 2FNAA 3CCFA 5P21A 4ZTZB 1W36C 3UOGA 5KTYA 3FCYA 3WNCA 2HJRA 5A9SB 1D2GA 2DR3A 4ZZ0A 2ZUBA 1XRLA 3QI7A 4XX1A 1YQXA 1OZGA 3UO8B 1KBOA 1RKXA 1XRRA 1YQWA 4OBWA 3RSSA 2PL1A 4FZVA 4Y6PA 4BFSA 1V4VA 2X2OA 3LYHA 5E9JA 1T2NA 3WHKA 2YNMC 1A95A 5D5PA 1E7RA 3G79A 4UPDA 1G3MA 1KC3A 1QIFA 3JVDA 1JFSA 1XQWA 1ECPA 3VVBA 4WBNB 4R2JA 3NI2A 2X7HA 3SEAA 1OHHD 1WPXA 4ENUA 3HTXA 4LGYA 3I9MA 3R41A 2JFBA 3FDZA 2D2XA 2AJCA 2B34A 4GW3A 3WJAA 4RADA 1QNFA 3ZKAA 4ALIA 4BNDB 1WS6A 1ANKA 5EZ6B 4KGDA 1WULS 3ST7A 3FTQA 3T9BA 4ID9A 1FC0A 1HE1C 1NAHA 4AS2A 4BQIA 4WLOA 3AI1A 2WSSA 3BRSA 4ZC1A 3CLRD 3NW9A 4LG1A 5ALLA 5I47A 3N74A 1RAHA 3T6KA 2JZNA 3VPCA 4WLVA 2XBLA 3L0OA 5CYPA 1WSWA 2RG1A 1M73E 1NQWA 2ST1A 3QA9A 4QGHA 5IJ0A 2V59A 3P1JA 1QWOA 1VHJA 1CUXA 1RI1A 3QE9Y 4PANA 1BA3A 2ZIUB 3VPDA 3FHOA 1C9KA 5DYNA 4EQZA 2EW8A 3EIUA 4LQCA 4C43A 3LQYA 1U7XA 4EB6A 2J5XA 3AK4A 4QUJA 3WYDA 4FGWA 1OPXA 1YZHA 5SICE 4CM5A 3TNFA 3AOEC 3TPCA 5DGHA 1PZEA 3C8DA 3JCZA 1Z4KA 3JQ8A 3LQRA 2IH4A 1JAHA 1QYXA 1GAWA 4HNRA 4B31A 3DE3X 5TJHA 2OCPA 4LZJA 5I7AA 1YVPA 1JEQA 4LDRA 4L5JA 4OG2A 4M9QA 1SBCA 1TJYA 2UVPB 3A6JA 3ZNPA 1I13A 4Q7EA 2OBNA 5ALGA 3P2OA 4EFDA 1XCGB 3QGMA 5FO1A 1GA6A 4H0NA 4AJNA 2R4UA 1V48A 2JGMA 4PRLA 1UK8A 3M33A 2V7XA 4YDHB 2DWOA 5CFZA 3TW8A 5KBYA 3LPDA 4F4HA 3K6SB 2B1JA 1NJGA 2ZATA 2XJ9A 1A4RA 5EINA 4AZSA 1IQRA 3A70A 1U2DA 2PWZA 3B6KA 1LJUA 4XAQA 1XHFA 4XYMA 2ZUFA 1BMDA 2QXYA 2RHRA 1ZA2A 2WAMA 3QMPA 1N34B 3SSOA 4OOFA 4YGYA 1RYYA 3B70A 5HBGA 2CHQA 1FFHA 4H6VA 1H6BA 1FP7A 5EMNA 2GCGA 4RD3A 5FIUA 2YWDA 4YMIA 1HQKA 3CEPB 3QHPA 3OCYA 5DRYA 3A3NA 3HFSA 4OH1A 4X00A 3BTUA 2FQXA 3E3OA 1KXZA 2AB0A 1ZWKA 1P9LA 2VNSA 3NHFA 3GD7A 3CWZA 2DSNA 3FD8A 3KXIA 1E7YA 1T36A 1SBNE 1KKMA 3D2BA 5KNLA 3BGWA 1I3NA 4LC9A 3S44A 3T4EA 5LL6P 1QQAA 4J6FA 5AK3A 1PK8A 1GLNA 3A37A 3W3AD 1RHKA 5ICMA 2PUDA 3OPYI 4HH1A 3CA8A 4OPMA 1S2MA 1OIVA 1YACA 4X1IA 3EVCA 4QOIA 1CQXA 1JQEA 4G56A 3W79A 4QKQA 1XNRB 2X58A 3CR7A 1RM0A 2B30A 4FGKA 3ZCVA 2PVCA 2RHBA 4WCDA 1QP8A 3B7GA 4JJAA 4L15A 3LDFA 2ZR9A 4N6NA 4XEUA 1GZ4A 4QFCA 1MDBA 1DDGA 2GRUA 4AF7A 1PGPA 1HRDA 2XQJA 2O8DB 2CT8A 1B3BA 2F3QA 2ZXEA 1AB5A 1A27A 3EUAA 5IHXA 1MB0A 1KY2A 4MW7A 2PT7A 1O95A 1MTZA 2E4YA 2Q2QA 1E3QA 1ZEJA 2DHEA 1P0CA 4CR8A 4JEMA 2IXAA 3HCWA 3HCOA 1EK2A 4HDMA 4U3JB 2ZAMA 2PVSA 4ZEOA 4ECEA 4LRXA 4YUXA 1TUGA 2B35A 2XCIA 2XUFA 3OCJA 3I2IA 4HLCA 4JQSA 3MCVA 4KHZA 4QGFA 5E4FA 1UPXA 1FLNA 5AI6A 5JDCA 3N6VA 1KOJA 2MMCA 3M4JA 3THRA 2GAFA 1TW2A 2EG5A 3QEKA 1EBBA 4U8GA 4E5DA 1Y1QA 3M6XA 2VRCA 1ZVVA 1M6HA 5ALJA 1RKVA 5BR7A 1E2IA 1T6BY 4JJIA 3OE7A 3TR5A 4IGIA 1SQ5A 4WLFA 3WGQA 5BV1A 1P61B 2NP6A 3H7AA 3RV4A 2ODPA 1LUAA 1WW3A 3R40A 4IXDA 4HTAA 4EA6A 4PICA 4ZZ1A 3AO0B 3JQPA 4MIEA 1SRQA 3HM2A 2VJAA 3JV7A 1Q0PA 2O2HA 2PMDA 4FC7A 3JSAA 1IL0A 1KJWA 1LNQA 2R11A 3Q0IA 1Z07A 4PLZA 1W4BA 1XFDA 4UMEA 2P6OA 1KR2A 3L5KA 2XOXA 3QXXA 4JQZA 3E9NA 4ZQEA 5FUXA 1QHSA 3BERA 3W6PA 3OQOA 1MNAA 1Z9BA 1GD1O 2G83A 2PXCA 3O8LA 1JKFA 3JYPA 3I4LA 4RBNA 3OKFA 5EMHA 5D2CA 4XUDA 5IAOA 4MICA 2BCEA 1PU2A 4KXYA 1RJWA 2NSDA 5C32A 4IDNA 2GJ8A 1UKZA 3P96A 4TZKA 4YT2A 4WGGA 2VZ9A 2QTVA 3K9NA 4PY2A 4RFVA 4U2CA 3B6EA 1CC1S 4E5MA 2G06A 2JNWA 1FUUA 3PQEA 3PQ3A 1BC5A 1DKMA 5E2AA 2SKEA 2PDAA 3RFUA 5JZVA 3K70B 1LWNA 1WG8A 2WYIA 1Z36A 1AMUA 2R47A 2GDJA 3O4JA 4LFBB 2IXTA 4XWWA 3L79A 2Q1UA 1XLTC 3R0VA 1XPUA 1PFWA 2YWRA 2P41A 1F4VA 3CT6A 3HN2A 3AESA 4RK5A 4BKRA 4G01B 1HO3A 2JH8A 4DM7A 3IE1A 4CGZA 3ND6A 5JYBA 2CJYA 2JD1A 2AR7A 3JD3A 4I4NA 2BFOA 5DTQA 5IJWA 4XYLA 4ZVVA 4XGIA 2D5IA 4PO8A 4NLLA 3OZIA 4JT8A 5FBQB 3AU9A 2VDWA 2H1VA 3VR5A 2J5RA 3ZDBA 3I8SA 3V8NA 4LJSA 2H1CA 1UBRS 2Z4RA 3HJBA 3D5QA 2Q3MA 3BDVA 2DKOA 4EHIA 1I0ZA 4PPNA 2IHZA 1YAHA 5T4BA 5C8ZA 5K51A 4CUJA 1T25A 3I1YA 2A8YA 3MOIA 4GL4A 3NTOA 1T8WA 2BFNA 1VLJA 4GSYA 2I8AA 1NJ5A 5AW7A 2WOOA 2B1RA 1KL7A 4JLVA 2OBXA 3UUGA 3VKWA 4GX0A 1U6IA 5H83A 4DG8A 5KOJB 3TKLA 3KTOA 1AE1A 3NHUA 1NI5A 1XDSA 4LJ9A 2AFRA 3Q2OA 4S0ZA 2WM2A 4F9GA 4URYR 3KSUA 2VSYA 1Z5ZA 1EGAA 3N7UA 3PFFA 4JLUA 3HK2A 1HTWA 1PLKA 3KEQA 1NW8A 3EGVA 4CKBA 4N0EA 5JG7A 1ZM2A 4ERNA 4KPEC 3Q8LA 5ALEA 5CDHA 3I62A 5I4IA 1P80A 1ZXLA 2C84A 3D6NB 3U0BA 3CTMA 2VYND 3PICA 4P81A 1RM4A 1WB4A 2PUTA 1T0PA 4N0QA 4TMKA 4M1WA 3VXKA 4DWOA 1EHCA 4YPOA 4UVIA 5KIAA 3NWEA 1NLUA 3DEKA 2BFWA 4NCIA 1GRCA 2F2TA 5C5CA 3RC8A 4CLRA 2F1KA 1R4NA 3ZWPA 3GLIE 1USUA 3RVQA 4D0LB 1SXJB 1KEZA 3PE3A 1V4BA 2G8LA 3LXXA 3V7YA 2JLUA 2VDNB 1YS7A 4H3HB 3NBUA 4EKGA 5JADA 4BGVA 4LOLA 4Q4CA 4L95C 2OAP1 3AUXA 4FE3A 3TAXA 4HGOA 1D5WA 2GM4A 4IMJB 1KDTA 2JVIA 1K1EA 1YULA 2RBEA 4GPEA 3QW2A 4OQDA 2GBLC 5EOVA 1MPXA 3U39A 4Z4CA 3T34A 2FW6A 3W78A 4HAUA 1XZMA 3GVXA 2UUAB 1GL9B 1RHMA 3HB5X 4PYKA 5DIZA 5GV8A 3MHPA 3H9QA 2ZE7A 3ZWMA 1V41E 4U8HA 1CE8B 1K6IA 1U81A 3FPAA 4OCZA 1L6IA 2EOAA 3NAMA 4B1FA 3AT1A 3T5AA 5JZOA 2RB5A 4QOSA 2GXQA 4Y30A 2K2WA 3KR1A 1IWOA 1I1OA 2ZRJA 2XHEA 4M1MA 4N1AA 4O4LF 1WZCA 2F3RA 3FPLA 3H65A 2NYUA 3QX9A 1S9DA 2HMAA 4FMDB 1GNLA 1RC1A 2AVDA 1ESZA 2BMEA 2N46A 2ZYIA 3BD6A 2A9QA 1MC5A 4C0BA 4P3YA 4B45A 1NR5A 3ZQ6A 2WJVA 1KNQA 1PWEA 3AF3A 5DEIA 2VDOB 1ULBA 1T43A 3ETHA 3LUKA 1HXHA 2ZROA 4LHVA 1E69A 6LDHA 4N0MA 3ZN2A 2W37A 5HF9A 4CF5A 3DR5A 2DY1A 1KVRA 4ESHA 1UP7A 3K0AB 4CW7A 2Y27A 3VZQA 2QEQA 3ADOA 3C4JA 4MJLA 3L7JA 5HJ5A 1UBOS 1XA4A 1NP3A 4ETWA 1RXSA 5C2JB 1JU9A 1RYDA 2R8BA 3LBNA 3V32A 4RUKA 1SQSA 1BVRA 3WGTA 2VJMA 4RMJA 1TMOA 4I14A 2VHVA 3DG9A 1C0KA 3MMZA 4H7JA 4NYIR 1H69A 1ZCZA 5CXXA 2HK8A 1HDZA 3R3SA 4WZ6A 1KQPA 1WDLA 3M4YA 1UR5A 4DCOA 4YRGA 5KKNB 2W4IA 3GDWA 1RJDA 2HQBA 3UYLA 1S8NA 2R7MA 3DMFA 3KOYA 4YUZA 2FB9A 1F5SA 2C9DA 2B69A 5EKUA 4AN4A 1XVVA 5CTAA 1U0BB 1NLYA 4H4CA 1TT5B 5KYXA 3D4BA 1D6JA 2W4MA 2YHSA 3FAZA 3PPYA 4O4JB 5DM1A 1EFPA 4CQMB 3PX7A 1M5TA 2RDMA 4YS6A 1NBMD 1WPQA 2Q4OA 2C0CA 2XH8A 3BZUA 5GMOA 3ZD9A 3R8CA 4RAQA 1CR6A 3RTBA 1Z29A 4D26A 2Q1TA 3VR6A 1RYMA 1H1DA 1S96A 2C3YA 4FOLA 1B43A 2WFLB 2ATIA 3IVXA 3C70A 1MMFB 2O9JA 3QRWA 1JGTA 4LGVA 3TSYA 1HKHA 1KP9A 3DXFA 4E08A 5DGTA 4G2TA 3QF7A 5B58T 5CLQA 4U7FA 1ABBA 2NUTB 5LDDC 4QSMA 4RHXA 4YP6A 5CFQA 2W2LD 1NN1A 1ORVA 2NU9B 1EZ1A 1T24A 3KU4A 3LBAA 3ML1A 4F06A 3HN6A 5BUZA 4D3YA 4ZYWA 4KZKA 3LOQA 3UHOA 3DV0B 3ZW9A 8GPBA 1W29A 3KLBA 3HYLA 4CIBA 1M2VB 1A9RA 2Q2VA 4BQNA 4KODA 1RABA 1VKJA 1QP0A 4CMGA 1VLLA 4OHCA 3R77A 4HAZA 1T9DA 1POXA 2E89A 3S1AA 2F3PA 3R44A 1Q91A 1Z5WA 4L0QA 1PQYA 5FNVB 4IY1A 1IDOA 4ZO7A 1C3OA 3AP3A 4WA7A 2XE7A 4ON9A 4MS4A 4MUNA 4YP5A 1AIPA 1YRHA 2Z9BA 4REOA 1O2DA 1TLLA 4JBNA 4DQUA 4EHAA 5KSZA 3DZHA 3NOQA 4G1MB 2WP8J 4YO8A 1D0SA 2IYPA 3BGSA 3RLIA 1DZIA 3JZMA 2VTEA 1EFDN 2I5PO 2J3EA 2PANA 3AWIA 4DJFC 1P2VA 4IEFB 3S2FA 1IOVA 2CNBA 3MGGA 1BG6A 2AG1A 1EEXB 3AOGA 4M9XA 1RKBA 2B99A 5ABPA 4E51A 1OLSA 3BL5A 2JIMA 3KQOA 3KV1A 4QNRA 2E3JA 4KWEA 2B5VA 3PPVA 4V0ME 4JXZA 3CB4A 4DEVA 3T52A 1W52X 2YYZA 4PZDA 1KTVA 1UQUA 3LV8A 3NT4A 2R1UA 1F06A 2CHGA 3RT1A 4FWTA 1BH2A 1YHYA 3QENA 4OY3A 3TKYA 1V8FA 5JARA 3X1XA 4UEJA 1PQPA 4DWJA 3I12A 4WK0B 3JWHA 2Z43A 3OT1A 3TXYA 3DMTA 3FE2A 3FDZB 3IOMA 5FB3A 5FWDA 2Q6IA 2X4IA 4RFSB 5IT4A 4Q5IA 5K03A 5JW6A 4B4OA 2AMLA 2Z5VA 3IC5A 4DADA 2SKCA 4DIEA 4MV0A 1E9FA 3JWGA 2FG6C 3O93A 2YWCA 2J3JA 2OY0A 1JLHA 2EZ8A 3E1KA 4Y9SA 5CK5A 4J1TC 4IV8A 4ALNA 5LNK6 2VCYA 3R5SA 2YASA 3QIVA 2W0SA 1H2BA 4ZOLB 3GU3A 4E94A 3KO8A 4CLOA 5EXTA 4WNAB 4UZEA 3JPWA 5B64A 1PJSA 1ZVKA 1C14A 5IXJA 1VIAA 1PF7E 3CUSA 4NMWA 3TOCA 5FOTA 2QD4A 4QTUB 2B61A 5CLJA 2NTYC 4K9NA 1LBIA 4KIWA 2GAAA 2O7RA 2PH5A 2HHJA 4EB6B 1JL3A 5DW3A 2V4ZA 1E79A 1SZJG 5DXJA 4K6CA 2DPYA 1Y8QA 4AKTA 4GX1A 1CUZA 4YDRA 2E1PA 3JQ8B 3D59A 4Y7DA 4C76A 3WFZA 1HX7A 3P9CA 2NACA 3LVBA 4ZODA 5EPEA 3X2FA 2DETA 3GBSA 5KNDD 2XB2A 2J9YB 3FZNA 2I6UA 4CG0A 2W2TA 1PJCA 4RZHA 4KV7A 5LP1A 3PUIA 4J03A 3U7FB 2Z0MA 4NK5A 3KJFA 1X2BA 5C0OE 1J33A 3WKDA 1DXHA 2JG3A 5CPFA 1UOPA 4LI0A 3S2YA 4UHHA 1DEKA 3DWIA 5JFGA 5T4EA 3ZWWA 4BNKA 1JXOA 3I8OA 2DBYA 3N5CA 4XLZA 3TW8B 4GF5A 1N8TA 1PT6A 3IPLA 1FFAA 2CUKA 3L49A 4GR9A 1NUSA 3WMFA 3B6JA 5BVHA 4RTOA 3KKPA 1Z62A 2C4WA 3BCHA 3ZGOA 1KEEA 4FMCB 1MZPA 3RWOA 4FEYA 6YASA 4MMYB 2J46A 3H1PA 4C5BA 2JIBA 1P7PA 3CYFA 5GM1A 1UZUA 2WZDA 5I9IA 1MAHA 1AXEA 5JAQA 2W9XA 2JJ8A 5A4IS 4H7KA 3TTYA 3F5SA 4NMMA 4MJXA 5EZYA 2HMSA 5B7NA 4JEIA 4RS4A 2GA8A 1VYTA 2B4KA 1KIFA 1OVGA 1QXSA 3WK9A 4CNBA 4N76A 2QS9A 1Y1KE 1PNRA 1JR2A 4WOCA 1SXPA 2VZ8A 1EWKA 4KYTA 3ADDA 4QVKA 3VTAA 3ETEA 1OUMA 1UM9A 1ILWA 2RGEA 4DPKA 4QJ3A 2WTXA 5SV2A 3RS8A 3TSCA 3C2QA 5IAGA 3AVQA 4X1IB 1BHSA 3T41A 3V4LA 2GZ2A 1NUTA 4O08A 2PN1A 2XEXA 3PGVA 4GMHA 2L82A 2I4MA 3OFSA 1BFUA 3PX2A 1N5RA 4JENA 4UM8B 2YW9A 4ZCIA 5A4AA 4Z3DA 2D6FA 1J0CA 5HNKA 3ESRA 3WMWA 4GKAA 4PPFA 1LF0A 2J3QA 2BHLA 2PSSA 3BZBA 1QUEA 1NJ2A 2Z09A 1EDEA 3P27A 1U1FA 1Y3DE 5K8CA 4HDMB 3S7ZA 3LC0A 1YVEI 4A0SA 3GRVA 3NFYA 2RHTA 3LUDA 4KIJA 1SQGA 2O2EA 1JEEA 3KALA 4MHOA 5JBIA 4NE7A 1UWVA 5C1IA 1R10A 1O57A 4IG9A 1X1BA 2A5YB 2EFYA 1FMJA 1KYQA 3WICA 4B6JA 4DLUA 3ESYA 3A6LA 2XRFA 3FJOA 5EFZA 1REQA 1VJDA 5C4GB 3H86A 2DMRA 3NAGA 1GHTA 1I01A 5CM9C 4FFOA 5CFRA 1QHYA 1DUVG 4QIHA 3KDPA 2QAGA 4ZZ2A 4BVLA 1TYCA 2MSCB 3EH2A 4G9BA 3ZE6A 1WTAA 1E1LA 5TVKA 3RFCA 5FPSA 2GYYA 3JD0A 1DADA 5HCUA 3TPZA 1MC1A 1NSFA 2R6DA 1CIJA 1E1KA 1YJCA 2OV3A 2X22A 1MV5A 1VL1A 2WAYA 4Z9BA 4IWYA 3ZD6A 4HQ6A 1BMQA 2VYQA 4R01A 5REQA 1A96A 4PCLA 5I48A 4URZR 4MKRA 4G84A 4QEKA 5M3BA 3H4VA 4BP1A 5ICFA 4DA7A 1IHPA 3N0WA 1UAAA 2GYVA 3MPUA 1GZ6A 1T9GR 3EVAA 2CJPA 4GPIB 4MVJH 2EIHA 5BQOA 3I9OA 4CEHA 4J4HA 5CXQA 2BFAA 4GZMA 1DAPA 5B3JA 2QTVB 4Y2JA 4BFZA 3HCCA 4LRTB 4O5OA 3HXMA 4CV3A 2XUHA 4R2KA 2JPDA 4LHZA 1JLRA 4R1SA 3GH1A 7ADHA 4QAJA 4WKOA 5AVWA 1QTQA 2XUQA 2BFEA 4YAFA 5LA6B 1GKKA 3KOOA 3L7DA 4GLLA 3RUAA 3MMNA 3ECAA 5BQ5A 3BB4A 2Q7DA 3NEAA 2VQFB 1JSLA 4IUBS 3DZDA 1ZN9A 4G1CA 4NMHA 1AN0A 4FB5A 1W4CA 3GRFA 2RE8A 5KWIA 3GROA 3MCTA 1TVMA 3WLOA 4R0MA 3ZDDA 1GN8A 2X13A 3IPXA 3AFMA 3K3PA 2YINC 3PA8A 2ZBQA 5KVAA 4TQUS 1Y82A 3LZ6A 5IEBA 3QELA 4MAAA 2PM8A 3FPEA 3RUEA 2BUCA 3INNA 2P3SA 2CV0A 4ZKDA 1CLEA 1IDN1 3QUTA 4IG4A 4X65B 1AKTA 2PT5A 2EDCA 1R6UA 4Q02A 1EWYA 1L1RA 2YN0A 3D3KA 3HLTA 2CZQA 3HBNA 5F9HA 4OKIA 3SVLA 2PGLA 3M82A 2RGNC 3REOA 1GFWA 4RDIA 3U17A 3UW3A 1ZR4A 3H2YA 1PJ2A 4Q3NA 5JNVA 2O2SA 3GCXA 1MKYA 1LDBA 4OQNA 4EPTA 1V9CA 4ZOAA 1DKNA 1T9KA 4C4RA 1SCUA 5FULA 3B6ZA 3NIDB 4J0JA 4R9SA 2AOVA 3B1ZA 4BNXA 4F8JA 3UGKA 4F3TA 4IKPA 3LH5A 3GV0A 4ILKA 4IICA 4O2AF 3VDQA 4CKBB 2B3TA 3DYIA 5BOSB 1YDFA 1K4YA 2XA1A 4NFYA 1LPSA 3FPKA 4JR2A 5THXA 5CD9A 4J0HA 2QMYA 3II6X 2GHIA 1H8ED 3AHGA 4PLHA 4YR7A 3SQMA 3UK0A 4EWLA 4CMEA 2NIPA 3C5WP 1AKEA 3ZTYA 1CRWG 3U1TA 3LQKA 4CLRB 1R4NB 1Z6TA 3E8MA 1R3UA 2IUSA 1RVDA 3RAJA 3LTNC 4GVLA 4A8JC 4PYIA 1BQ4A 5FLXA 1YA6A 4D4LA 2FFAA 2DR0A 2A3NA 3WNZA 1SVSA 2REQA 3AEXA 1R16A 3WGMA 2P8SA 3FJYA 2VWPA 1YZ3A 3AH8A 3BE4A 2GNOA 1M1YA 2NV6A 1E2FA 2AC7A 2CHUA 1DT3A 3IDSA 3MAAC 1M6YA 3ODPA 4Q01A 1C1XB 1IBKB 1YL7A 1OX5A 1QGAA 2MJLA 2XLCA 3DVRX 1YNSA 2BLNA 2PX5A 1NPDA 2DFNA 1R6VA 3EAQA 4PVDA 1KQNA 2M1XA 4IPTA 3TM4A 1Q1BA 4NJMA 4BN5A 2BFDA 4IH1A 5ENVA 2R6HA 4JLPA 1JWBB 1A2QA 2GFHA 4ARIA 3ETCA 3H97A 4DIKA 2PUFA 2XGOA 2X0NA 3DO6A 5IKPA 3QBVA 4D25A 4V0QA 3M1IA 4CHTA 3D7NA 2X15A 1U7TA 4GQAA 3GAMA 4LE2A 1JU4A 1W35A 2IEZA 4OVKA 2XY4A 1QPBA 2J48A 3NNDA 1XDWA 3C6BA 3GLTA 4ZCQA 5HFJA 1WUIS 3SNHA 4AW9A 5U4QA 2GDZA 2OLEA 4HQ0A 5E8JA 4DDWA 3FNBA 1IMOA 2GZ3A 2YWXA 1I0IA 3ER6A 1DP4A 1RADA 5EKXA 3WBKA 1OJ7A 4CKCA 2A1UB 4BPRA 5KTSA 2AW5A 3LIIA 4JODA 4HNUA 1TZJA 4DLKA 4P58A 3EY4A 2Q07A 4YQZA 1IEWA 3GJ7A 4RZSA 1P77A 3CXUA 5KWJA 1FVHA 2G5PA 3G2KA 2OZPA 2VJMB 3H5LA 3K2EA 4MYCA 1MQ9A 5EJAA 3PGKA 2C2KA 2Q8NA 1O77A 2CL6X 1A5BB 3DHVA 4N40A 2UZ0A 3KM0A 4HDOB 1GQYA 4E6EA 2I22A 4N0DA 3RAPR 4OQ4A 1T15A 1N7IA 2H65A 2J3IA 3RFVA 2ZXUA 2QG6A 3BK7A 2IWHA 3LPCA 2XHZA 2DOKA 2JKVA 3DOUA 1IZ9A 3E9MA 4PS0A 3ZOKA 5J43A 2XVMA 5JS1A 2ISSD 1JJFA 1CY6A 4DIUA 4LDJA 3RWMB 1Y8AA 3GO4A 1EFPB 4JHXA 1L1FA 1OYYA 1G6HA 2OG1A 3C1UA 3AM5A 3DP9A 4KNVA 5IVDA 1KE2A 4D79A 2C77A 2IU4A 1G2IA 2AZDA 5FPPA 3QU2A 1SCIA 1S5PA 1R5OA 2F4NA 2FRVA 1K6MA 3RRNA 2ISCA 3FTFA 2NTNA 1IAVA 3ZG6A 4CG2A 4FYXA 2DYKA 5T57A 1P72A 1YZKA 2P7IA 1PX0A 3KB6A 1T8RA 1TZ2A 5DYWA 1QO9A 4CKEA 4CIYA 2IY7A 4L4UA 4WE3A 5EXSA 2EJTA 2Q6VA 2JCXA 1IVYA 1ZK1A 2VUUA 2WM3A 4ZO9A 1U8XX 3SC6A 1JF8A 5CJJA 3JAKA 4IXMA 4OATA 1N3YA 4DN6A 2COUA 3T0GA 5FWXB 1PFVA 2AGVA 2QL5A 3QNWA 4HO1X 5JUWA 1YR2A 1YFJA 2IHKA 1Q16A 2PYDA 3FVRA 3RK1A 1UOOA 5IFLA 1XP8A 1NI4A 1UP4A 2WINI 3DWEX 4M0EA 4WCFB 1UT5A 3SFTA 5JSHA 3DGEC 4M0UA 4ZU6X 4BLPA 4ZQIA 2BBWA 2AMVA 4OFBA 3R0IA 1D2HA 4IQ4A 2IXFA 3W77A 2R00A 2EJUA 1I5OA 5HIIA 2JRLA 3QOYA 1IZZA 1IN4A 1HMYA 4OFZA 4TL7A 3S1AB 4IVQA 3PU6A 4TYNA 4V2UA 2EW2A 3RF6A 3COJA 1C3OB 4B6GA 3G9ZA 1H8HD 2XCOA 2J9GA 10MHA 2XCRB 1KO1A 3T7CA 4MS4B 4QVIA 1BFKA 3ONNA 3AR4A 4RZUA 4CM3A 4OGLA 1VYUA 2ILTA 3CT4A 1NW6A 4MV4A 5EVJA 4F84A 1X7WA 2P9QA 1I2DA 2RK4A 2VPZA 3CLVA 3R7LA 1XCLA 2JIDA 2XMSA 1UOEA 4P83A 3ZCUA 1PBNA 3H1AA 3ICCA 3BTVA 2Q6KA 3ZV3A 2VS1A 1KYYA 2CKDA 3JRXA 5JNWA 1QH1A 5I7EA 1E3MA 4EY4A 2Q5HA 1C9NA 4W9RA 3HXLA 4BOYA 1P1HA 3VTKA 1OLSB 5IDQA 2QL7A 3GAFA 3R8XA 3K05A 3LT2A 4KYUA 4K7JA 2HDNB 3QVVA 1OLUA 1PJRA 4S35A 2G07A 2XMRA 3T1VA 3C7TA 4AG3A 4UNNA 2FPSA 4HG2A 3RIGA 2POQX 3GT4A 4WNCA 3PLNA 1H2YA 1UXJA 2QZ9A 2WVGA 2XTMA 3GLUA 5ILGA 2AKAB 5DW0A 4Q7KA 1D0IA 1A9XB 1EXVA 1EAMA 1R9JA 4IUCS 4B47A 3WLSA 5HWSA 1RPNA 2QY6A 2X4DA 4IO0A 1T6ZA 3HYTA 2BMWA 3AJ9A 3STUA 3PGXA 4XWOA 3T15A 2FPGA 4EMBA 1D4OA 3OT1B 5G53C 5I9MA 3F6SA 3UB3A 2PKQP 5A1TA 1B74A 2IYYA 2JK0A 1C0IA 1SU4A 3E7FA 4QBTA 4TS4A 2BKVA 1O1YA 4EPRA 1FNBA 2G7ZA 3PTZA 1QM5A 4TLEA 5A4KA 4TKVA 2PAFA 2PMCA 4CF4A 4CDMA 3U7QA 1E5LA 3NH9A 3BF8A 1DLIA 1M2KA 1AGXA 1Z6QA 1HPLA 1IY1A 2PQMA 2XB8A 3JQBA 3KQHA 4LWZA 1NVKA 1CJCA 5IK2A 3O8RA 4FS8A 3K70D 2B6HA 4YVFA 2KBFA 1HFKA 4JB3A 2AOXA 4P31A 3N0VA 1YKFA 5HZKA 1S1CA 4HV4A 3ICWA 1Z2EA 4OXIA 2HJWA 3TLMA 3C8UA 3B5JA 4U02A 2I6QA 4MR7B 2P9ZA 5DLEA 1GT91 5TDHA 3T0IA 2R5FA 4RWEA 4YB8A 3L0DA 4B34A 1WVGA 2P68A 1M72A 2XZOA 2PXAA 1G42A 3C14C 3FROA 1W4ZA 2CD7A 1R15A 1NSTA 4DYDA 3C5CA 4CMJA 2PKYX 3PUYA 4CCAA 2GO7A 5JAUA 1VCIA 1OE0A 2XE6A 1IWPB 3GRZA 3PUWA 1PVDA 1V8BA 2WK1A 3EIOA 3I34X 4QC2A 3KD2A 5ALNA 1VE7A 4BQPA 4WJKB 1P7CA 4KI7A 4LKRA 3GGDA 2IU6A 1RWPA 2Q4BA 5TV2A 3GIDA 5F7ZA 1A8PA 3NBMA 4FQ5A 1EB8A 1WIWA 1ZGZA 4IOLA 4M1ZA 3B1WA 5K0ZA 4GO1A 2ZJZA 2FX2A 3C3DA 3BGOS 1JNYA 1AA6A 2HIGA 3TGWA 3N3BC 1F9EA 2R66A 3NVDA 5F1YA 3H99A 3R0ZA 3MTEA 1QBGA 2F1JA 4NARA 3LJKA 1T3LA 1ZZGA 1IIBA 1RRKA 2P2GA 4U0KA 4AF6A 4AZ3B 1KEEB 2G6TA 3MJSA 5FBVB 5ALTA 1E1QD 4G1VA 5BV0A 4EQ6B 3T4UA 4G5OA 2NVOA 1TA4A 2YYYA 3PGMA 5C3UA 3RVKA 4IJMA 3PFNA 4J90A 4ZQFA 2O8BA 1E6EA 2UXCB 1WX1A 4JXKA 2BIFA 3SQLA 1UJCA 2VSXA 2DX7A 1QKJA 1E89A 3OP1A 2W98A 1MV8A 5ECGC 1DBPA 1RXWA 4EFNA 4B3RB 2HSJA 3V8QA 3QEMA 2QU7A 2F59A 5K2OA 4EI9A 3G3EA 1IXKA 1TRKA 1M74A 1COWA 2BFMA 1Z08A 2QXUA 1N2EA 1UM9B 3IKVA 1BWQA 2CJFA 3JQ6A 3N8HA 3TRIA 4E4YA 1COZA 1QCZA 2GPWA 1OROA 2ZYDA 2FW1A 2OFPA 1GPKA 3IPAA 2VNKA 4CG3A 4A2QA 4CM8A 1QGOA 4L6AA 4C08A 2QN2A 1KKLA 4YDSA 2E6UX 1PR2A 1YVDA 4L5CA 4OI1A 3THOA 4YP7A 5K45A 4H35A 3I52A 3O7MA 1TKBA 4LHXA 1KIMA 2I2FA 2WD7A 4DNOA 1IEVA 1YONA 2QT9A 3UFXB 5LLDA 5FAKA 1XKLA 2C82A 1Q44A 3I6MA 1YK0A 3KB1A 4L7VA 2MSEB 2NYRA 821PA 1J0XO 5KUTA 5DMHA 5KYWA 1V7QA 1BGWA 4KQIA 521PA 1CNEA 3CLUD 2OR3A 5CX4A 2OORA 3A06A 5KYGA 3DF7A 1LLQA 1FDRA 3GNLA 2WAOA 2HFJA 4B3XA 3CH7A 5D1NA 2ANBA 1OFHA 3NHRA 3CX8A 1ZESA 1U3WA 2GD2A 1DQYA 2NZ2A 5JTUA 3RTEA 1YZTA 3CN7A 4LF6B 2JJYA 2PU5A 4YYZA 4MDFA 9LDTA 2WE8A 3CVUA 3IELA 4X8MA 4BN0A 1REQB 1UKAA 4TTQA 3F3YA 4ZV9A 2WTUA 4K2HA 1PQWA 1R18A 3W1VA 3I72A 1L4UA 1PQUA 2ZTUA 5IYZF 2QAGB 4QOJA 2NT3A 4YRBA 2BTQA 2H4WA 2JFPA 4HS4A 1W2WB 1ZAYA 4HFJA 2YWBA 1M34B 1UM8A 2RGWA 1U5CA 3G7SA 1Z2NX 2EVWX 4MGHA 4DNPA 4OHRA 3GLKA 3VPXA 4BTVA 2PH1A 5REQB 3ZWDA 3N0XA 3N87A 2QMQA 4JJ4A 4MPDA 2JKYA 4CE6A 1BWRA 2IY8A 5JCOA 1N2HA 1HGXA 1JPNA 1T5TA 3FHJA 3KD3A 1PD0A 1TE2A 3ZBUA 3FB1A 1DBSA 3WYCA 2VQ6A 4D41A 3Q3VA 5KSWB 1JIVA 1DU4A 1MO2A 1B8UA 1OZFA 2GEVA 4G0QA 4OP3A 5JXGA 4G0UA 2VSQA 2MR6A 5JR3A 4Q9HA 4CEHB 1W59A 2J5KA 1QO0D 5GJBA 2P27A 2NXEA 3GJ0A 4H59A 4CQMD 2R4QA 2ID4A 2GILA 1OSNA 4UTXA 5EIWA 2ILVA 2GAOA 4FHGA 1KDRA 1LTQA 3TVDA 4C4SA 3LG2A 4NEHB 4UAUA 5F51A 4LN1A 1GAXA 1GPNA 3KHSA 1GTVA 4JH0A 2C61A 3OKCA 2BYTA 3HSSA 2BFEB 3MJHA 3AY7A 2FEXA 2QYTA 5AJYA 3PX3A 1J0DA 1JH9A 1MGOA 1O4VA 1JQDA 4ZT7A 4Y9DA 1UBNA 2WF8A 4R6WA 3OAAD 3IJEB 3OJLA 3LTEA 3DLAA 3MGCA 1YJ5A 3F6YA 4RHTA 1OAKA 1CUUA 1K7EB 1KSHA 3VZCA 2XWPA 2QVYX 2CLCX 2JJ1D 4HPWA 4ZMSA 2WLTA 2ONYA 2VL7A 2BGRA 3BDIA 4R1PA 1RPAA 3PNMA 4LRWA 1RPTA 3HDGA 1ABFA 3EPLA 2XRYA 1JYFA 3U81A 2KQUA 1FCJA 3GFPA 4MEAA 3FWNA 4UCXA 5E4JA 1GPH1 3UKOA 4A0HA 4BO6A 3L8CA 2X5OA 5CBKA 2E4XA 4UXIA 3ND8A 3P9QA 2NMVA 2DPXA 5EUQB 4GYWA 4M55A 2OUIA 3M6MD 4RJLA 2V7QD 3H87A 3DOJA 5F7OA 5DP2A 4K9PA 4ARAA 2J33A 2QMZA 3D6VA 4DLYA 3H5NA 3TD2A 3V1KA 3WDSA 3WWZA 4NSNA 2QTHA 1G20B 4LWQA 4LWOA 1SCUB 4A73A 1CV2A 5BV7A 1YI1A 1G5IA 3C8MA 2DWCA 2V96A 5DWDA 5K4AA 3VDRA 3P9PA 1GITA 5JJLA 4A16A 3FSGA 2JIPA 1GAEO 2FG7C 3PDUA 4B3SB 3M8KA 4BKUA 3O4IA 2HY7A 3SKYA 3ETDA 1GCAA 3NCHA 3T0FA 2HBZA 5DHQA 4M60A 4MRMA 4C03A 1IRIA 2OCDA 3GB9A 2XMBA 4FSXA 2DERA 4BNIA 1IN6A 1IE3A 3VUEA 2I7VA 3F4LA 1LA2A 4Z8XA 2X0IA 4KQ2A 3IBTA 2B6NA 4BTLA 2OD2A 3NORA 1V1MB 3SHFA 3UG6A 4J2TA 2AUTA 4CM7A 1YZYA 1BIFA 2ZAIA 2REQB 3DOFA 1TM4E 2WJZB 3ABZA 4DREA 5B57C 3WR5A 5GINE 2PG3A 1NJSA 1XTJA 1B8VA 2I6XA 1M1YB 2IIVA 3NHMA 1EUCA 3F1KA 1JAZA 4PZLA 5AW0A 4RW0A 3KRTA 3RUDA 1B41A 1FP4A 1L4MA 3DEAA 3AOEA 3DNPA 2O3UA 3DXYA 4QECA 1K63A 2OESA 1LK5A 1PRYA 3CS3A 4P33A 4PO1A 4COKA 4QM7A 2Q9AA 3I6QA 5HXAA 3VR3A 1FDIA 3CUEF 3V2HA 4P98A 2H9YA 1YCFA 4G89A 3S81A 2OG2A 5E7JA 4RL6A 1GUBA 2Q0QA 3R3VA 4GI7A 1YA8A 1XJWA 4KQEA 4Y6QA 3BE6A 1Z6YA 3E18A 3OJ0A 5I3ZA 2ZLBA 3DGFC 4S04A 1K68A 1D7AA 2P62A 4GX2A 3B6IA 1HI9A 3WV4A 2H4HA 4P4GA 4TVBA 5LOVF 1I33A 2EKZA 4B0PA 3VSDA 8ADHA 3RRZA 5TQ2A 1EK5A 3KXPA 1G21B 5KYTA 2GEDA 4X44A 3SC2A 2B7LA 3O8DA 5TNXA 1SKMA 1WB6A 4IP0A 2P9CA 4MIKA 3ZCPA 4RY9A 4CKCB 1WQ3A 1P45A 3GUZA 3M7IA 3W5CA 2HAEA 4WFQA 2H1SA 4IDBA 4BVAA 4ENRA 5KTNA 3P8ZA 4Q66C 4UU8A 2J5QA 3DL0A 3GFSA 4QUEA 3CONA 2GHRA 2Z30A 4OJQA 4R9UC 5BOVA 3ZDAA 3UYKA 5IKMA 3RIHA 2R6AA 2A0YA 2GZAA 2Y71A 1K66A 1O94D 5BUSA 3PNBA 3NVMB 2ZB8A 1Y48E 4KK3A 5KAMA 2R8OA 1GKIA 2XZPA 3ERCA 1D04A 3EMDA 2X1LA 3IEXA 4RLHA 2I54A 5JSKA 4MZDA 2DWUA 4OP2A 5B1DA 3WSWA 2YXLA 1N7HA 4S2UA 4N6OA 1FX1A 2VKQA 2O23A 3Q0TA 4LHWA 4DRXA 3PIRA 2O1SA 4IWNA 4P7KA 1V9LA 2CFTA 1Y6RA 1BWPA 1E2PA 1QV6A 3TSOA 5F5NA 2YRWA 1Z6XA 1N0WA 4MYHA 4CLEA 2QG4A 5FBRB 4CKEB 1A88A 1ZSNA 1UJBA 4Y0NA 4CCSA 1D09A 2M9MA 4XSGA 3IAM6 3VO9A 2GNPA 3HH8A 3H7IA 1A82A 1VMIA 4I4TF 3JAKB 3ZY5A 3CSUA 1NW9B 1AY0A 3WG9A 2QX9A 4JLOA 4XJSA 4DY4A 2I8CA 5DXFA 5G3ZA 3UPTA 1NVDA 4I1OA 4Z4GA 2XUJA 1B4DA 2IHNA 4IV0A 3KWLA 1O89A 3OICA 2WNIA 2ZUVA 2VJCA 3GRRA 5HKLA 3DEHA 3U26A 1JJAA 1TIBA 3GRCA 2A9KA 3MUNA 4ZALA 2IV7A 1ML4A 1G18A 1VL2A 3LO5A 3PKJA 4L16A 4PC2A 1XX6A 8OHMA 4LJLA 2WJIA 4BVKA 2XMQA 1YDEA 4QTXA 5DT2A 4D8UA 1U28C 3F6CA 2HWWA 3LXUX 4TLDA 3RANA 3SG0A 2IVZA 5KX5B 4Y6OA 2ZRNA 3E9CA 2HRZA 3I2GA 4R2MA 1XDUA 5CBPA 1UXIA 3IHLA 2BONA 4UUQA 5DLQC 1N0UA 4EYOA 4BNVA 5BVGB 3QXSA 1WTCA 1X13A 2CNLA 1YRQA 1X7WB 5K8TA 2ZT5A 1M2FA 2YXPX 4YTEA 3DL7A 1P2GA 3BCSA 4J0IA 1W88B 3GJYA 1KDOA 5IWCA 4O4LA 3MJDA 2UXDB 2Y6VA 3D2AA 4TYMA 1IY9A 3EVGA 3BAZA 1QH1B 4TV8F 3K5WA 5EZSA 4C6HA 2XAAA 3ASVA 1GTSA 3V48A 3DL4A 2OP0A 3IYLW 3W2EA 4AZWA 3AKCA 1ADJA 1QG4A 2DH6A 2Q9BA 5IU6A 1A5SB 1L4NA 1PL8A 4KXNA 3ZZNA 4COOA 3EJ6A 1OLUB 3Q3HA 4WINA 5TIIA 2G0NA 1NLZA 2VDKB 2TMGA 2YUIA 3QU7A 1PR1A 3UMVA 3KWJA 2R25B 2E1RA 4UBIA 3G88A 2ZSIA 4IOKA 2AEFA 1NOJA 2OGWA 3AIOA 4CV0A 5EHXA 1N5KA 3KJIA 4G81A 1BGVA 5K5EA 4B6OA 4CF6A 1S3FA 2R6R1 3JU3A 5LMUB 1J22A 1UF9A 3UN1A 5DRTA 4MO2A 4UOZA 3FMGA 3OQJA 2G63A 1KQGA 1XLTA 4QTZA 4Q3LA 2Y76A 4ZQBA 4DGSA 3TZKA 1Q50A 3IOCA 5DHSA 4KRXA 1GP2A 3IULA 3U3OA 2WJ4A 2CXPA 2OFWA 2Q29A 2YDXA 2WVAA 5TSDA 4TMYA 1R0YA 3PYXA 3L4BC 4MKHA 5FOUA 3U7QB 2ZJYA 4L08A 5E0OA 4JI6B 3ISVA 4G9EA 2R2GA 4LSMA 4Q4AA 2R6GA 3PCXA 4J0DA 2PZBA 3DE1X 1XPOA 1C30A 3JR3A 3ORFA 4JJEA 4PG8A 3ZQJA 1ZM9A 3RJTA 2P5SA 4ATNA 4GP7A 2F1HA 3ZGNA 2G6BA 1KOGA 1V11A 2FAXA 5CGQB 4YP1A 1L4HA 2FWJA 3C3MA 3NEPX 4LGMA 1YTLA 3AI7A 3CNQS 3JTEA 4LI3X 4D9EA 1M0EA 2V0GA 3K92A 2XECA 3VYTB 1HL7A 4UUMA 1ZNXA 2VA9A 1P2UA 3DULA 4IDOA 1VFNA 2I03A 4JASB 3LY7A 4B6FA 2WYWA 3CEJA 5BMVF 5B53A 2IZ6A 4FLMA 4TZ0A 1C1HA 2Q9UA 3WOVA 3CRZA 3VU9A 1ZRNA 1FK8A 1V5FA 1GQ2A 2NZ8A 2J59A 4POOA 4D8XA 2D7JA 3IO5A 1GUAA 7ABPA 4OI2A 1L5HA 4BYMA 4NU0A 1SVIA 4KZPA 4GI2A 4DC0A 3W5IA 4ZT3A 3ULKA 4DNQA 3ZH9B 1QQBA 2R7LA 4WXEA 3MTIA 2C9YA 1A8HA 2VQ3A 4X7PA 3WAGA 1WBBA 3NEYA 1XTBA 4YRMA 2VF5X 4MVCA 3DBOB 2V3WA 5H1YA 3ZLTA 4MUEA 3QVTA 1KDVA 3OHMA 5IVKA 3I45A 3JQAA 4J07A 4C4ZA 5B1EA 1DCFA 4N5LA 1YOVA 1GYRA 4HXGA 5K3CA 1JKMA 4U7HA 5FA5A 3KEFA 1XTUA 4GXNA 3KTAB 3BE8A 3ORQA 4MYTA 4R8KA 3NYIA 5FBLB 4AMBA 2OFXA 2QZPA 3N8DA 4K9MA 1P9RA 1VJRA 5TGTA 4EHBA 4AICA 4Q7JB 4QT4A 2GBLA 1VOTA 4B73A 3HZHA 3NHWA 4US2R 1A8SA 4D02A 5JYDA 1VKZA 2LIPA 4JI4B 3MSCA 2MCFA 3BVPA 1Y9DA 4PLCA 2NZYA 1HDXA 2ZJOA 1NM5C 3QEMB 3R2JA 3HZOA 5I51A 5BURA 2C97A 4F46A 4F9EA 4OK6A 2IHUA 4WPGA 2R7KA 1U2EA 2W0MA 2OB2A 3ND7A 1SB9A 4I9NA 1GCIA 4NNOA 3UXHA 3WYEA 1F48A 3RWBA 4LY3A 1ENZA 2HK6A 3D4PA 4NULA 4EENA 1GPWB 2DU8A 5HS4A 3MMPA 2I0FA 4RIFA 5DB4A 3PR2B 2R5WA 2IYAA 4R2LA 3HG7A 1S3GA 2WD7B 4ESEA 1E64A 4C6SA 3PE6A 3BJEA 2JGIA 3TCXB 1Z56C 5KYWB 2QP9X 4K88A 1ZZEA 1PJ3A 3MC1A 1Y4AE 2YJZA 3VAYA 4NS4A 3ZCXA 1KFEB 4JC5A 3UTDA 2HXSA 3GCZA 7REQA 3AXTA 1H2HA 3L8ZA 2CV1A 1XJQA 3U3XA 1K5DA 1VIDA 1KIAA 4I9UA 1M67A 1ATIA 3FFWA 5AK0A 3RE1A 5FFMA 2CL5A 2HR1A 1XZAA 3EZGA 3QP9A 1RP1A 2PLFA 16PKA 4HYYA 4IXTA 3WIUA 5K0JA 1LI4A 2WV7A 5LWQA 3NZEA 2CE7A 2NXWA 1N9ZA 2R96A 5KS2A 3V6LA 2O2ZA 1PV1A 1VLVA 5IDYA 4IDEA 3NVKI 2EFGA 2XBMA 2M6LA 1G8JA 5F35A 4Y8VA 4CEIA 3JATA 3W8FA 1Z6GA 2BTQB 4KBYA 4JZYA 4UW9A 1O5TA 3LW8A 4UAJA 3BN3A 4O3MA 1EE2A 1D2AA 1L1EA 1N9KA 2WC1A 2WIJA 3HJRA 1SKUA 3OZWA 5DLYA 4F2GA 1T9GS 5HKKD 1VDZA 4RKRA 2FWPA 3UJ3X 2QUZA 2VN8A 4I4LA 4P92A 4XGQA 4BMVA 2OXIA 5B12A 2UZ1A 4YJKA 4IDFA 4DCJA 4XUCA 5BV8A 4X62B 3Q3IA 4CMCA 4J0FA 4RVUA 4FKBA 4DQDA 2AWNA 4RVOA 1L4EA 4R0NA 5ADWA 4XDZA 1UBHS 3LKDA 4Q9NA 5TE9A 3SIRA 3LKBA 1QAMA 4P82A 3U16A 1K9SA 2B7BA 2W2MA 4IFBA 3RFFA 5GTDA 4CF7A 3IMGA 3JD2A 1KEWA 1GU7A 5JY6A 3ASZA 4JNKA 3DS8A 4L5IA 4EOGA 3S3TA 4AURA 2ORVA 2IW3A 2OHXA 1AHHA 1XNGA 3M6FA 3PFHA 3E9EA 2GESA 1ZH0A 1HDEA 2XDQA 3JQGB 3K1AA 3M5WA 3N76A 1CR4A 3J7AC 1VP3A 3A1EA 1WB5A 2DT5A 1NFFA 2Z04A 4AKEA 5EWLA 3GIWA 5LB2A 3O3OB 2YQ4A 3FPJA 1N6PA 1SN7A 3B9RA 1TFRA 1SHZA 1MBZA 5IN5A 1K08A 4IFTA 2BUBA 1BHQ1 3KX2A 5C53B 5CU7A 1SIUA 2ZCUA 3GFTA 3K8ZA 4E70A 2VCHA 1W36B 1IMJA 1QK3A 2OVFA 5T6MA 3GLVA 2HA0A 4RIGA 1DDOA 3ZXSA 4IILA 1X7DA 3GRAA 3ZWAA 4FFDA 1ODKA 3GFQA 3DVAA 4LYJA 3D0RA 4M0FA 4RKFA 4DARA 2GAIA 2BHNA 4EDHA 1T4CA 1SC1A 1YBFA 3PP8A 3RC7A 4AP5A 2G4CA 2PX2A 3WL7A 3MMXA 3PKIA 1E58A 4KVAA 5FQOA 4BATA 3URMA 3JQDA 3DHYA 1HMPA 4E1AA 4BQEA 4JI7B 4K46A 1CUJA 1WXDA 1T5LA 1ZICA 4QNNA 3L4SO 3O38A 5IBQA 3UGQA 1IHXA 2OCAA 4KOEC 4B3HA 2GEKA 5IZ4A 3P52A 1US8A 4KMRA 1NAIA 1A7UA 2ZYAA 1C9DB 4PBRA 1XLUA 3A9SA 4QATA 1ZJJA 1JE0A 2O2XA 1K2WA 1W6RA 4GVXA 4MRMB 1L4FA 2G40A 3TCKA 4EVIA 5AWFC 5IKXA 4YN3A 3FLAA 1ECJA 2JIZA 2V6BA 6ADHA 4MKFA 5JCJD 4J1TA 1HT0A 4H7EA 1V37A 3L6RA 4CUZA 5F64A 4F11A 5TARA 2IYXA 3OQ1A 4JROA 1ZN7A 3KT3A 1RRGA 1Z0ZA 2A9OA 2EWVA 3NU1A 2O2GA 1TEZA 2YIJA 1KY3A 3OFKA 1U9YA 4F7DA 4PCVA 3REQA 2OWEA 1RLTA 4MQUA 1SBQA 3I6BA 5EP2A 1GGMA 1FRNA 1VE1A 1Q6YA 1MRSA 1ISMA 2HLNA 2VQSA 1EUCB 2FHSA 1DO0A 3HXTA 1XZBA 3U4QA 1SY7A 4OU5A 4BO8A 1E2DA 1FP4B 4BV9A 1GL7A 3AXSA 3WRYC 3UCFA 4L07A 2XCSB 5DI3A 1UH5A 1EUDA 3RIYA 1B76A 3QVOA 4WKBA 4BUCA 2HL6A 2VEOA 1FP2A 2NUBA 1J0AA 4YCDA 2COEA 3GJ3A 4NAHA 3BDAA 3EZ6A 3WGZA 2PMEA 1MOPA 1JKXA 2Y0EA 3K4HA 4P84A 1KMQA 2D2IA 1OH7A 4C0HA 4QGAA 3CIOA 5IJZA 1XYGA 4HAIA 5J4LA 1G3UA 4UPEA 3NC1C 1V96A 1YRLA 3DCIA 3FRHA 3KCQA 5E1DA 2O5VA 4L9RA 3OI7A 3G49A 1VPEA 3R5FA 3EFOA 2V7VA 3MELA 1PT5A 2P2CA 1V95A 5GGXA 5TQ2B 4U7GA 4V3CA 1E79D 3CEMA 4Y1EA 1U90A 5EKDA 5JWOA 3SC2B 1KMNA 2CB9A 2IPXA 2YHIA 3CSSA 2H5LA 1RBZA 3DE6X 3ZY6A 1JWLA 3QMVA 5KSPA 2ZJ4A 3GFRA 2FH5B 5ALMA 2A14A 4LJYA 4YIKA 4I9FA 4TMWA 3TDNA 2IZ5A 2QTNA 2GN0A 3BH7A 3E22A 3GC6A 5ECYA 1JAYA 1TF2A 3RRMA 3WLMA 4X24A 4D5EA 4DLPA 3WZ2A 4L74A 2IVFA 2Y4OA 3E7PA 3AJAA 3LNCA 2N1BA 3K7EA 5BSUA 1NLMA 3BQ9A 3O31A 4RJIA 3AR9A 3E81A 3KOMA 4GXTA 4R31A 2WIBA 1PW5A 1RE0A 1CRLA 4HNHA 4OHVA 5FTMA 1JILA 2EAUA 4KIFA 3X1ZA 4DDVA 1Z35A 4TLMB 1I3KA 3A05A 4G36A 2AN1A 4KXFB 1J07A 1KI8A 5CH8A 2ASEA 2XMGA 3GGPA 3GOHA 5KMGA 1J2UA 2H4XA 1XEWY 5DP1A 2JGRA 2Y1FA 3E7WA 2FI1A 2XWBF 4O2AA 1AG9A 3QUBA 2ZBEA 4DSZA 4GMGA 1WNTA 1GTMA 1OX4B 1IY0A 1SIOA 2IEDA 3HJCA 1K5HA 1X6VA 4QEZA 4EKNB 3EGIA 3L01A 1X9HA 4JBHA 2MMGA 2QQEA 4MLZA 4GPD1 4HGYA 4NCAA 2XUAA 2JGKA 4LJ8A 2B4TO 4ITVA 4ZVOA 5JPIA 4FEAA 1ZXBA 2F43A 3CZ4A 4IS2A 1N3BA 2DQSA 4I5GA 1U7OA 4QYSA 4X6XA 4YR9A 1GAQA 5CAEB 1CERA 4ARBA 4PSKA 3IUMA 5C1OA 1HA3A 2BFBA 4B2PA 4UVHA 2R8YA 2LR0A 4FYKA 1E3IA 3DP7A 4HUJA 3MWGA 4FTWA 4BV8A 4EPYA 4YAIA 5AW2A 2VPQA 1P7YA 1ZI8A 1XQYA 4K5QA 4NZMA 2NGRA 2O54A 1LI7A 4LVOA 4BO1A 4E12A 5F2OA 1D8TA 1WJGA 3VA7A 2ORIA 4F0JA 5BXQC 2ZIXA 1MO6A 1U04A 2HPZA 3K6JA 1F0NA 5F3RA 5JZ9A 1OB2A 1KVQA 4OHMA 1GFSA 5EUBA 2G72A 2X9NA 2JHPA 4FDMA 3ZUGA 5HSGA 3ACCA 3Q8MA 2XDWA 4E03A 5CBPB 2DLCX 3T1NA 1RAEA 1ZLXA 1EB9A 2CLDX 4ZC8A 5DTMA 2H2AA 4OMDA 1AX9A 2H1RA 3IQEA 1M5UA 1KJNA 2G1JA 5EJIA 2IZ1A 1QFJA 4X66B 4GSKA 2BEUA 1OCEA 2OLKA 4O4LB 3MA0A 1FLDA 3T3EA 1P8AA 2ZYSA 3NV7A 2ZU0C 3RW9A 1SC6A 4JAVC 2CXRA 3EVTA 1QE5A 2VNHA 3EZXA 2XTNA 3GA5A 5IVPA 2B3DA 3CZCA 1DPGA 3R3YA 4ZVPA 3AY0A 3O82A 3PQ6A 1O9HA 4L8GA 1KYWA 2O2CA 3QU4A 2UZ4A 1GV1A 5CT5A 1DCKA 3GLIA 3N53A 3RC9A 3D02A 3I76A 2KJQA 2LRHA 3AKDA 3H6HA 4BNYA 1ONBA 1CY0A 5DN6A 5IC5A 1K8XB 1OXKB 4HN9A 2IU0A 1EP3B 3PFBA 4MI6A 3RVMA 3EXG2 4YCNA 2OECA 2B36A 4KN5A 4REMA 2C00A 4OAPA 1EESA 3BB3A 1H6DA 4CTJA 3DLHA 3KQTA 3LMKA 1YI0A 3UJBA 1FFWA 2GERA 1FRFS 1VE6A 1PSZA 2DZDA 2PO7A 2VUSA 3DNFA 2I1WA 2YC4C 1HT1E 4MCHA 4D6PA 4ZDIA 4OX9Y 2HQOA 5LQKA 1BJRE 1ZIDA 4FGZA 4R7ZA 3QG5A 4BMCA 2D54A 2QMHA 3GP5A 4KQGA 3DCNA 4Q4AB 3FZYA 3G8DA 4H7HA 3U9TA 1FA9A 2AYXA 1SO8A 2B92A 1C30B 3O8NA 2HMVA 3QBEA 3OH8A 3QZUA 3TEFA 4BFYA 1RW4A 3TBKA 4ZJZA 1M66A 2C3OA 4BEWA 1TTQB 2Y68A 2X0FA 4RNDB 1G1AA 2OCKA 3BE5A 3OZAA 3K0HA 3R23A 4L5BA 4YEDA 5CW1A 1V11B 2GTHA 4I9GA 2VH1A 3B3JA 4KMSA 5CT4A 2ZIZA 3N7AA 4GP6A 4MYSA 4ZO8A 3UAXA 2QRVA 5L95A 2KBEA 4B81A 1HOXA 4K40A 1X0VA 2RGNA 3O8BA 1P1FA 1EJ0A 3CF6R 4F3CA 3PJRA 4W82A 4D3FA 1MVOA 4B3DA 2W2NA 4YGXB 3IJPA 4HGZA 4EYQA 5K0SA 4M7PA 3VU9B 3D54D 3VZDA 4YECA 3WB1A 3VJLA 3AP2A 4BO0A 1Q20A 3S68A 3X1YA 1EVLA 2O8VA 3GF4A 3LY8A 1L5HB 1E2BA 1AXRA 1O0CA 3VU1A 1Y6FA 3FNFA 2G1AA 4EW3A 2XE8A 3TQQA 3L41A 2FSPA 2HN9A 1SHKA 1T1GA 2Y1KA 3R5HA 3KQLA 1N75A 5CH5A 1DNPA 2QPAA 2R65A 3JQ9C 3OIGA 3NUGA 1QH0A 2ZULA 4V0LA 3ES9A 3TAHA 3TRJA 3ZCQA 4A8JA 5EJEA 4LF7B 4JV5B 3RSGA 3JQAB 3D4LA 3H9UA 2ATVA 3PR3A 5CP8A 5JVDB 1USIA 2HIAA 3JVUA 1VL5A 3JW8A 3VO8A 4D74A 1YOVB 1R8QA 2BM8A 2QB5A 3ILSA 3W06A 4IUDS 4NOMA 3ROFA 3EGOA 2EGHA 3SN6A 3M2TA 3QE4A 4J6EA 2RONA 5ITSA 1WDWB 3FIUA 1KH2A 2WZBA 2GUWA 1G59A 1D4ZA 3UUFA 5LZ9A 1W8IA 1SKBA 3CUYA 3E1SA 3E8XA 4JSRA 5EE9A 2CUNA 4BFWA 4P7FA 1SKQA 3AF5A 3P20A 4D0RA 4M7WA 4PSDA 4D8VA 3L93A 2I67A 1IZYA 1A72A 2VNJA 4YRCA 1UPFA 5BWOA 2HYIC 3JYLA 3M0EA 1T2VA 4E21A 2ADOA 4PGGA 3UWDA 1MH1A 1FRZA 2CDRA 3A9TA 3CGWA 1HYHA 2VWQA 5ECDA 3ZYZA 3DDUA 1VIVA 1J09A 1Q0ZA 2JBAB 1XZLA 4HB4A 9ATCA 2DQYA 3Q40A 3HV0A 3OE5A 1GFZA 2J1LA 5AW1A 4LYEA 1LPOA 1PFKA 3I37X 1NYQA 3I1IA 1X7ZB 4CNQA 1OLXA 4IDGA 1R27A 5C81A 4G4IA 2AYZA 3WOHA 5AVRA 3HB9A 2NZXA 3WLFA 2PGXA 2FJUA 3MGAA 5ARBA 1ECFA 1IBSA 3PYLA 3BFKA 3UJ6A 1L1QA 4QZVA 3VSAA 5FOQA 4WCVA 3LE8A 4XWKA 2ZUSA 2Z2IA 2AR9A 2MYUA 3BK2A 7REQB 3OOWA 4TXJA 4GGOA 4EK9A 3DVQX 1BMFA 3K2QA 1AQLA 2BKEA 1VCOA 4H6WA 3IESA 3ZD8A 4JUCA 4QJIA 4HSEA 4ZDWA 3P4UA 3HZZA 2D1RA 4TN1A 4V0MA 3F71A 4AI6A 3GN1A 3LX5A 2IYNA 3EW9A 3GXBA 1CNMA 2X2EA 3BWMA 3KVNA 4JLKA 3GI1A 4C7VA 4DG5A 4H1HA 2FJ0A 1A77A 3DEFA 2PSEA 4E30A 2X3UA 4AJ2A 5H82A 3H6KA 2XA2A 1GPYA 4WBXC 2O05A 4RPCA 4Z7JA 1K4MA 2VP9A 4CEIB 1E1YA 3JATB 1U6KA 4MJ7A 1A8UA 4J0EA 4HFRA 3DLBA 5JRJA 3QXGA 5DNVA 1KJJA 4ZT2A 5ALIA 5BV2P 5C51B 2XWJI 5AW3A 1FFCA 1OVMA 2XNSA 3NM5A 2QVBA 4Z0PA 4KJZA 2ANCA 3G1UA 1G8PA 1KK0A 4FNOA 3G1TA 5D3QA 2ZIAA 4EMTA 2AE1A 3E9YA 2UZ1B 4V0SA 4F21A 3O6VA 3WWPA 5B1YA 4GEGA 2D7CA 5HJEA 1JA9A 5CA1F 2W70A 1NTRA 1Z63A 5H3LA 3AW8A 3BTOA 3TQIA 4OUDA 3WLTA 2O50A 4LCEA 2VLBA 1P74A 3MS7A 1QOQB 3MD9A 4LPKA 4WV3A 5THKA 2QD5A 9MHTA 3M3DA 3TEJA 2P75A 3HN7A 5GONF 2AMFA 3Q6IA 4QBHA 5ETJA 2K5UA 4A2CA 1SC9A 2I4IA 2O0JA 3G0OA 3G82C 2ZWIA 2EJCA 4ZVLA 4DIFA 5AT1A 3EVNA 2XDQB 4HATA 3K1AB 1RAGA 4WXPA 4OXXA 2AQ8A 2M1ZA 1L8AA 5JXJA 2XJ4A 2E5LB 2OT3B 3O5AA 5EWLB 4DV1B 1KHTA 4O4IB 1M6VB 5COQA 3ZOZA 2Q2NA 1YL5A 4G09A 4EMSA 5J5AA 2POCA 2J4DA 3K9QO 4A8HA 3MGBA 3K16A 3RO7A 4XQCA 3HR4A 4LUCA 1A4XA 4DS3A 1VHQA 3ADPA 3KE8A 2VAVA 2WMNB 3N2YA 2Z2JA 3HMQA 3JQCA 1V6SA 2SICE 3Q72A 3NASA 1GSOA 4PWZA 5KJEA 1K75A 2G5TA 4XOUA 1WD7A 2C2XA 4DANA 4K9RA 2GSDA 4D0SA 3PT9A 5K9ZA 5K8LA 5F9FA 2VDPB 3FYDA 3FAKA 1L7OA 3BMNA 1ONSA 2H0AA 3F3SA 2C9ZA 3M6AA 2ZYVX 2JJMA 2Q1YA 3Q8XB 3RV3A 5BN3B 4QUKA 3L4JA 1EVYA 5A2QA 5AR1A 3GK3A 3I83A 5K05A 4PCUA 4B3TB 4PO3X 3L8FA 4KO4S 2XKJE 1GOTA 1KRXA 1FDSA 2ZKLA 3GARA 2R7NA 3PQ5A 3Q3JB 3K70C 5FI1B 3Q41A 1BHJA 2Q28A 5ELLA 2PGJA 4HEJA 5MN6A 4J4BA 4CEJA 2OK7A 5LB4A 1SPBS 1WKCA 3W2FA 5L45A 1US8B 1RHUA 2P5UA 2YX1A 1KAQA 2BSAA 3TH5A 1KK3A 3E35A 4UAGA 3HB4X 2NTJA 3DCYA 3GYBA 4LJRA 5FH9A 3R5XA 4CN9A 2GBIA 3AONB 1PJ4A 5K3FB 1BXGA 2F8LA 3BH0A 1WR8A 5BSRA 5IYZA 1N5IA 4MA4A 2A9FA 4GPAA 3Q15C 4XB2A 4S1VA 1FYDA 4LX0A 4B48A 1N8KA 4WFIA 1URPA 3KXDA 4DCGA 5IABA 1DKLA 2TYSB 4YJ3B 4KRFA 1UWCA 4PYLA 4WRRA 1V8DA 2FZLA 1JG6A 2C88A 2VDRB 2JFWA 3T94A 3WJ7A 5HZHA 5JS8A 1MPTA 2OEPA 5EIBD 3REQB 3LWDA 3ZWBA 5SY9A 2ODBA 4DCTA 3EDYA 4E46A 2V1XA 4QUIA 2EFDB 4CTOA 3O75A 1QHIA 3FUWA 1FTYA 4TKLA 3LRTA 1TUEA 3MJRA 1XAGA 4PPQA 5HZMA 3VGPA 1FZTA 4GKJB 1EUDB 3R6LA 1MFZA 2AEJA 3QTLA 4QXPA 4TL6A 1R0WA 4AC9A 5JYCA 4XGNA 2QZJA 2QMUA 2G5GX 4BTEA 1PL7A 5IK2D 1Z12A 2PD3A 4Q1CA 1D1TA 3GAAA 3VDMA 2B8TA 1E92A 4H15A 3C5VA 5A7HA 3WB0A 4YRIA 3T3MB 1AZSC 3LUAA 1USVA 1Z4MA 5IDVA 5DSZA 3VNVA 1N6RA 3I01A 1FDVA 1WPGA 4L8LA 4AJIA 2EATA 3T8YA 3STWA 1R5JA 1P1RA 2ID9A 5AYVA 1JLMA 4MW9A 2I8LA 3KKKA 5TMDA 3S8MA 3TN7A 5KNCH 1IJBA 1H6CA 1TM1E 1E2HA 3MWJA 1VPLA 3I39X 4TUYF 1ZY2A 2BV3A 2WQ7A 1E3SA 4C3UA 3QOWA 2RJOA 4CMHA 3DZKA 1NJ1A 3O3CA 3LYAA 1Q1GA 1D5CA 2YHIB 2PYZA 3H1FA 4L9SA 4OB7A 1NURA 2BI7A 4QYIB 4RE6A 4J1SA 2FHPA 4R4JA 4UCQA 4XM0A 5JPDA 2NNLD 3R4CA 3DBLA 2E4WA 4ZVSA 2WM9B 4NP6A 4EDFA 3EFEA 3QFRA 3E22B 4GM1A 3OJXA 2GCOB 1R5NA 2JGNA 1P0IA 4FZJA 4IWXA 4OD0A 4IRXA 2O2IA 2P35A 3PXDA 3RR2A 3WLNA 2BSXA 4G85A 5ARDA 2G36A 4BZXA 3CZMA 5ICEA 3VTFA 2MDTA 3Q9NA 4CDNA 2CLHB 2GPSA 3IP3A 3I61A 2FDCA 1RLIA 4PHHA 1XDZA 4XPIB 5DMXA 1V1JA 3STXA 1MO3A 2H7YA 4EY5A 4D9BA 1UFKA 1WUYA 2WJYA 1XVIA 5I7HA 3VYVA 3CLUC 1SHJA 3URKA 3IEVA 1RT9A 1RHJA 4CN8A 1I4WA 1W1UA 3ZHSA 1YJBA 3R09A 4ZEVA 4O2AB 3G2HA 2PZEA 3DDZX 2ZVDA 1DKRA 3VRHA 5K09A 4E3WA 2IPNA 3F73A 3HY6A 3FPSA 4C05A 5K3BA 5HBRA 1IJKA 2Q4TA 3D31A 3USZA 1VJ5A 4OV6B 3GPBA 5HIAA 2XF2A 2VRNA 2F43B 4Q3DA 1KPHA 1LDEA 3LLCA 3ZHUA 1SBHA 3T3GA 3TLEA 1COWD 5AUQA 3B48A 1DS6A 2WR8A 1H0SA 3IAEA 2GYWA 3OSUA 4INJA 1QGUA 1S2IA 2BFBB 3LP5A 4LMPA 3KLMX 4QASA 4UBMA 3SJZA 5JFTA 1E4EA 3KVVA 2BJVA 3LW7A 4KQJA 2RKOA 4Y2PA 2RGGA 4BX0A 2BM1A 3FUTA 3RU2A 2X8AA 3EAFA 4CTKA 2RJNA 4MW6A 5JZMA 2MT9A 5KOHB 4ABTA 2YJTD 1K5PA 2P9YA 4R7GA 1E3TA 1JMVA 2P9TA 2PLNA 4ITUA 3VPFA 5JLAA 3T1YB 3HVHA 1JR3D 1ZJ5A 4K87A 1ZK3A 3VH1A 1JI0A 1DEXA 4G4SP 1ZMBA 4ZAFA 3TIGA 3ZHBA 3RVDA 4JR0A 4RHUA 3PNOA 1GQQA 3OOHA 4FW8A 2VK8A 1CSEE 1N57A 4PBSA 4DB2A 2FU5C 2PBZA 2HA3A 3TLZA 3J80A 5ALXA 3AL2A 4ZTUB 3VOBA 2BEUB 2Z5FA 4EPWA 2A84A 2QV7A 3UQZA 4QBIA 3A25A 5JD6A 3E9RA 3F97A 5DHPA 4W6QA 1RBYA 1P1KA 1M2GA 1XTSA 2WKRA 3B9QA 3G8YA 3IT1A 3TIIA 1JB9A 2PKWA 3UMBA 4CRWB 3EAGA 6REQB 1OASA 5LOVA 3V3KA 5CK4A 3COSA 1PS9A 1PR0A 2B82A 1O58A 1SG0A 2D4HA 4JGIA 2X42A 4BWYA 4ZZIA 3GLIB 2HU7A 1IOWA 3GT0A 4IJ6A 1H9AA 2Z4SA 4MVJD 5H81A 4D8TA 1J49A 1ZIPA 1NVBA 2LE0A 3SZRA 4NXMB 1Q7BA 4J9VA 3AV0B 3VJKA 3ZD7A 4PHTA 2IPLA 1GNQA 3WBBA 4X8LA 2IBMA 2V8BA 1BRTA 1GL3A 5FBZA 4H6PA 4L4YA 3RAEC 5AKZA 5FLKA 4Z7QB 2N75A 3LIPA 4Y3UA 1QR2A 3IE0A 1R9MA 1Y6GA 3H2BA 4CPDA 5TPWA 1YZUA 1F8UA 4UQOA 4O5AA 4DM4A 1R6AA 1NMYA 2WWRA 1VI2A 2IEYA 2PR7A 3Q8KA 4Y6RA 4ZCLA 4JP5A 5FLEX 5HRUA 5AKJA 2V45A 4XIYA 1E7WA 2UYYA 3LVQE 4BMNA 1O6GA 4EJ2A 1U1CA 2ZE6A 1O5IA 5TQVA 2OYCA 4Q1FA 1RJEA 1NQTA 2BGJA 3ZI0A 5LQMA 5DZSA 3S6JA 3FB4A 2V74B 4F8EA 5A9RA 2QRVB 1T10A 2QBYA 4PG5A 5EJ5A 4AS3A 1D03A 3OFND 4I4TA 4ZVUA 1CHDA 1C9MA 2QLMA 5TVGA 2FN8A 2WWHA 3JWIA 2FPRA 1P5JA 5BQXA 4R5MA 4PNPA 2QXTA 2KWIA 1GKUB 3ZC3A 3I0MA 4UOQA 1CUYA 2NAFA 3BL8A 1MJGA 3F9RA 4FMDF 4QREA 5F77A 1THMA 1Z8HA 4UFNA 1JDNA 3K96A 5AOAA 1UIMA 3RUFA 1O97D 2JLCA 1AKQA 2R8EA 1AS2A 1LBTA 2C5EA 4G5SA 4H7IA 4NU8X 3JZAA 2ZJ6A 1M2EA 2ZVQX 4G1FA 4E5KA 3H5RA 4OJYA 5KYYA 1E99A 1XQ6A 2BRUC 3A4NA 5T3YA 4OHOA 4MCJA 1ZI6A 3O95A 2DB3A 4D82A 3C8ZA 3G1WA 1ID1A 1NJ6A 2J9FB 3C6XA 4FKZA 3R8FA 2LDXA 4A8JB 3M83A 4DKXA 2FVXA 3L07A 1Z37A 4I8IA 3CX3A 1SWVA 1UMDA 4FT2A 4U6SA 2ZRIA 4MV7A 4RTMA 2C20A 3CB2A 2YRFA 1G55A 4YHBA 3M3HA 1BXRA 3G85A 3HDYA 1F14A 4HX5A 1XYYA 1Z3IX 4TV8A 4DLRA 1VJCA 1I2BA 3DFIA 3IAUA 1JEJA 2GZ1A 5AM4A 3HVIA 3LLMA 3PR1A 2A4MA 1I7NA 1FDUA 2WB4A 5SY4A 2ZJBA 3SYTA 4RZQA 3S4YA 5K8UA 3RYFA 1WXGA 5BNFA 3PQ4A 2OSVA 4MH0R 4PR0A 3C4QA 4V03A 4WJZA 5DGCA 3CN9A 4BNTA 2E2WA 2AJBA 3O8OA 1RTKA 4XFKA 1L8LA 3WIDA 2GPYA 4FYWA 3VTZA 4M99A 3X1MA 1EHIA 2H63A 2OCBA 4UHDA 4XWAA 2J3HA 4YCLA 2PKQO 1GNPA 5DU2A 1CLUA 1PR3A 1AUPA 1WSAA 2HV8A 3OBBA 4EG5A 3HY4A 1RWWA 1A8IA 3CLSD 4ARUA 3ESZA 4G5XA 3RASA 3MQFA 4D9IA 4OB8A 4AY2A 2V5AA 2FZ5A 1ZL2A 3NAZA 2E5WA 1I6MA 1MT0A 1JIKA 4GMDA 5D6OA 4B3IA 1XMQB 3CTPA 2X0RA 4TYQA 1FVXA 4PYQA 4B6QA 3OF5A 2F67A 4I5FA 3DOOA 1EQAA 2I78A 1O94C 1I7LA 2PKRA 4M46A 4YAJA 2J3KA 4XX0A 3A6KA 2EBFX 2VHZA 5FJJA 5KU1A 3VJRA 4OA8A 2YBDA 1ZNWA 1OLXB 2J07A 1U2GC 3QEOA 1FU4A 3KZCA 1BEUB 4JBWA 3IH5A 4R2HA 4RPKA 2PHZA 1NW7A 4FFNA 5FI3A 4Z0TA 1XZJA 3G8CA 3KSAC 1YT5A 1RP7A 2ECPA 3OHSX 4JXJA 1H85A 2O0MA 2PXHA 2YIMA 3QVMA 4YH1A 3WLHA 3A2LA 5NLLA 3UJPA 3Q10A 5EJ6A 2WEKA 1CR1A 3WMGA 1LDMA 1RBQA 4N5DA 3UHJA 5AVOA 3V42A 4C3ZA 3DBHA 3BJZA 2CLIB 4C07A 1XDBA 4IIVA 1W8DA 2GF0A 4B8ZA 5LQJA 1BO6A 4X1OA 5FNVF 1H5QA 2DY0A 1YKSA 1HRKA 3HL0A 3LVRE 4FC6A 1Q11A 4FXPA 4I1PA 1CK4A 1B00A 4Q9IA 4YONB 5C35A 2JBHA 3I01M 1S8AA 3LNTA 5BMVA 2YXNA 4M76B 9LDBA 5T7BA 4KO8A 4A7PA 1FIUA 1GADO 4QPDA 5HHTA 3JYHA 3OU6A 3OZRA 2NVUA 5CXUA 3ENNA 2P2LA 4TTSA 4E11A 1XTTA 1RRFA 3FFBA 3PFWO 1U9CA 1TQDA 2G0AA 4OHBA 1X9GA 1WBDA 1G64A 2CXNA 1KZ9A 4KR2A 2OKGA 1BA2A 3EIQA 4QUDA 3ONFA 1K06A 3KWMA 3TXXA 3FZQA 3EPPA 1NDQA 3OFJA 2GO1A 3P94A 3H05A 4PFJA 4XJTA 3DDWA 3IAM1 4MRRA 1DFIA 4PQGA 2DLNA 5A4DA 3W5BA 2GPNA 1ZUHA 4HLNA 1UEIA 2CLFB 1CZOA 2CXSA 3DHNA 1DWUA 3BTSA 3G59A 4EA7A 1SUAA 4EUEA 5BVHB 2NVWA 3LUBA 2IQIA 3A28A 3PL1A 4MS1A 3HKBA 5DX0A 5CVJA 4B2IA 5B5SA 3OHPA 1QH8A 2ZAYA 4RVHA 2ODNA 4YRRA 3T1OA 5BW8A 3RI3A 4LFAB 3W04A 4UE2A 9ABPA 3MWYW 1C0EA 4H0FA 2P91A 2XUGA 3A1VA 4DKJA 4NFSA 5C8XA 4B71A 4CU5A 4YALA 1ZJ6A 2SECE 3DHWC 1N0HA 1U28A 5H80A 1RZRD 5KDOA 3H9JA 1D9XA 1LLUA 3CC8A 4MWSA 4PW0A 3OZUA 5IMBA 3ZPXA 3O7WA 1TB4A 4YP0A 5EP4A 1QVRA 1NYRA 4ZVRA 2F4VB 3RUPA 3GWGA 2CK3D 4MSUA 3FMVA 4ZOLF 3TQFA 5LCXA 4PFSA 4LPSA 4CYMA 1AKUA 2NTVA 5DNWA 5FF9A 3G0IA 2BEWA 2C4TA 2VJDA 1E62A 1GVNB 2QDXA 3GVIA 4WWHA 1WHSA 3PV0A 2CYAA 5EMKA 3PDWA 3USES 3JTMA 1ZD1A 3SXUA 2HRRA 1DQSA 4QQKA 4KPUA 4A8TA 5AW6A 5DTEA 3T9FA 3OWXA 1DV2A 2VPIA 5EN4A 2DP4E 4OSOA 4W5HA 2KLHA 3M3PA 5H59A 2OO7A 2JFVA 4EI7A 2VJOA 2BTOA 2EKDA 1VZ2A 5EG5A 2J0VA 2QF7A 2OBLA 3EISA 1G8SA 4PFKA 2WD8A 2DFLA 3KELA 4IIFA 3W2IA 3ZCSA 1Z13A 2P2SA 3HNPA 4NS1A 2WT9A 4D1YA 5K4HA 2J85A 3LPAA 4IQ0A 1KARA 3F5FA 1DG1G 3JVIA 2VBFA 2PZFA 2GJ9A 3AUFA 4I1SA 3EC2A 4M1YA 4RKWA 3MNFA 5BPHA 5LUBA 1EEHA 4PSUA 3ZH2A 4UNRA 4CEJB 3EUFA 1ZJ4A 2JHAA 4GDMA 4KVGA 1AKWA 2E4AA 4M9UA 1DIGA 3DOCA 4IBOA 1J2EA 1T3HA 4JVSB 4YMHA 2YVAA 2X4LA 3DWGA 3L4BA 2GHTA 2A0WA 5D3ZA 5DM2A 3WIOA 1V43A 2O52A 2PX0A 3QY0A 1XPJA 2YRXA 1BXGB 3VM6A 3W4KA 4PGMA 1U2TA 1N3LA 3PVSA 4GMXA 2NO5A 5IYZB 4KE7A 1AURA 3RODA 3ZWQA 1G5PA 3CJRA 5CVEA 1HURA 1PVOA 4GBGA 3ZJVA 2V5VA 2UAGA 5I7VA 2MSLA 1KJZA 1ZIYA 3A6ZA 4IKOA 4JOQA 4BU0A 4BVJA 1A9QA 2VYNA 3F49S 5BT8A 1HSZA 5K3SA 2V9PA 4AJ4A 1WZEA 4GRAA 5I4CA 2ZJ0A 4P0PB 4X8HA 2IFTA 5ALQA 4QO8A 3IMCA 2GN9A 2W6JA 3DMNA 3GUVA 4XARA 2L69A 1Q1QA 2HA2A 3HCAA 1EWTA 2XQGA 4RY0A 1Y7LA 2CDCA 1PKXA 2B1QA 1OBHA 2UV8A 3ELYA 5JI2E 2D1TA