5K7SA

Microed structure of proteinase k at 1.6 a resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
molecule tags Hydrolase
publication title Atomic-resolution structures from fragmented protein crystals with the cryoEM method MicroED.
pubmed doi rcsb
total genus 104
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5k7sA00
2P4EA 1ST2A 1CNMA 1SCJA 1BFUA 3EDYA 1Y4AE 4BWGA 3WHIA 1EGQA 1SN7A 3AJ8A 5I9SA 2DUJA 4NE7A 3LPAA 5FFNA 1KDZA 1SCNE 3DE6X 3GCXA 3PTLA 4YN3A 1GA6A 4NE9A 2GKOA 5ARBA 5JMOA 1SUDA 2Z56A 1TK2A 3I34X 5AMXA 3L1KA 2SNIE 2DP4E 4WOBA 2ZWOA 1MPTA 3DE5X 3D43A 5JXGA 1DBIA 1WMFA 5B1DA 1PTKA 2PRKA 2IY9A 1ST3A 4RYDA 5SICE 1GT91 3EE6A 1V5IA 1Y3DE 2PQ2A 3WQBA 4H6VA 2PKCA 2IXTA 3DVSX 1MEEA 2ZWPA 1R6VA 4KPGA 1GCIA 3I37X 5AVKA 4C3UA 1SBCA 4CFZA 1SUAA 3ZXXA 1NDQA 5FAXA 1TMGE 1Y9ZA 3Q5GA 1SBNE 1BE6A 1TM1E 4KB5A 1BJRE 2Z2XA 4OMCA 1IC6A 1TM5E 2TECE 1TM4E 2QTWB 3EIFA 1NDUA 1Q5PA 3F7MA 1TO2E 3AFGA 2ZRQA 1YJAA 1Y3CE 3I2YX 1GA1A 4HVLA 5JXHA 5AQEA 3LPDA 1SELA 2PYZA 1SBHA 1KDVA 3QFHA 2WV7A 1SUPA 4AKTA 3OSZA 4KG7A 1R0RE 4DWWA 1AQNA 4HX2A 4ZARA 1OT5A 1GTG1 1WMDA 1SCBA 2E1PA 3DE4X 2XRMA 3D9QX 1AH2A 1SH7A 4H6XA 1AU9A 3CNQS 3H42B 5FBZA 3DWEX 3A3NA 3LPCA 1NLUA 1Y3BE 1SUCA 3VHQA 3VYVA 1SBTA 3GT4A 2ID8A 3DE3X 1GTL1 4ZOQI 1Y48E 1JEAA 2DQKA 4B5LA 3BX1A 1LW6E 1YU6A 4DZTA 1V6CA 5JXIA 2SBTA 1SUBA 1P8JA 3GT3A 4M1ZA 2W2OA 3TI9A 1SVNA 1A2QA 3DYBA 4FONA 1T1GA 1OYVA 3TI7A 1IAVA 1GTJ1 1SIOA 2W2MA 1SIUA 2Z30A 4H6WA 4NMXB 1SUEA 1BFKA 4CFYA 2Z57A 3I30X 1AVTA 5B1EA 3TECE 2PWBA 2ST1A 3F49S 4DJ5X 3WIVA 5K7SA 4WOCA 3UNXA 1UBNA 2X8JA 1GA4A 1YJCA 4LVOA 1TO1E 1THMA 1PJ8A 4C3VA 1C9JA 1C9MA 3VSBA 3DW3X 2SECE 3VTAA 1XF1A 2G4VA 1S01A 2ID4A 2Z2YA 3P5BA 1SPBS 5AVJA 3DDZX 2B6NA 3F7OA 1KE1A 1ZVJA 3HJRA 1Y33E 3Q40A 1KDYA 1GNVA 3DE0X 3DVRX 2V8BA 4JP8A 2Z58A 2HPZA 3A3OA 1WMEA 1Y34E 2PWAA 2X8JB 2WUWE 2PMWB 5CW1A 1C9NA 5ARDA 3SICE 1GNSA 1PFGA 1T1IA 3QTLA 5JXJA 1AK9A 2XTJA 3AJ9A 2HD4A 3GCWA 4CG0A 3DW1X 4Z2AA 3ZXYA 1BE8A 1TM7E 1S02A 3LXUX 2W2PA 1Y1KE 1ZVKA 4J94A 1PEKE 1R64A 1CSEE 4K8RB 1DUIA 1S2NA 3A3PA 4LVNA 4AKSA 3VV2A 3T41A 2WUVA 1AF4A 1Y3FE 1AV7A 2Z2ZA 3DE2X 4OMDA 3QMPA 1SIBE 3SQOA 1TM3E 3PRKE 1SCAA 1BH6A 1C3LA 2W2NA 1SCDA 3VV3A 3DE7X 4MZDA 1P7VA 3BPSA 1VSBA 1YJBA 1KE2A 1TECE 1Y4DE 1T1EA 3BGOS 4GI3A 3WIUA 2W2QA 3CO0S 1WVMA 3DE1X 3DVQX 2SICE 4I0WB 1OYOA 5ARCA 1HT3A 1EA7A 1P7WA 1WSDA 1SBIA 4OV6B 2WWTA
chains in the Genus database with same CATH superfamily
2VR1A 4JUBA 2A1TS 1V6SA 2X9VA 3ZOKA 3WJAA 3BXZA 3MTEA 3OURA 4LSWA 3NGMA 3UJBA 3ZHSA 3HB4X 5AW3A 2PM8A 1TFUA 2NZ2A 4YMLA 1GA6A 3WHLA 5ARBA 1GTSA 3G8BA 1OXXK 2ET6A 5IJ0B 3QELA 2ZJBA 4MRMB 1KI8A 1SUIA 4NCAA 1GFZA 1KEEA 4M1QA 1N6NA 2XB2A 1QOQB 4ZTBA 1KYVA 4GVXA 5DI9A 3HDTA 2WIJA 2I33A 3NHSA 1K7FB 3I0NA 2GN0A 3NGXA 4N1AA 4IDFA 1P29A 5G0VA 5B3JC 3TG8A 2Q27A 4Q7KA 2IWRA 4CIBA 5JQGA 2CT8A 1L4NA 1U7ZA 1E2DA 3ONVA 1G8SA 5JQGF 5LPNA 2R85A 1IWOA 2JAXA 3EISA 2R60A 2I2FA 3CINA 4G8DA 1L5GB 4B8YA 5KTMA 1UUFA 1B8UA 2FA9A 3EDRA 4H17A 2ZJ1A 1X7ZB 2XRZA 4P98A 3MS4A 3PCXA 3T1OA 4LSGA 4LQLA 3VR6A 2NMVA 2DT8A 4UNSA 1UZLA 1MNQA 4HAXA 1AIPA 1QCYA 3LW8A 3RSFA 1AQNA 2YWHA 4OI4A 4HAWA 1SULA 1UH5A 2MINB 1F8XA 3AHCA 4YRMA 4BVLA 1CRQA 3QU2A 5EZQA 1X0XA 4L5BA 5LD2B 1NY6A 4L8WB 4S1NA 4YXWA 5TQJA 2A8YA 2DSTA 2M1XA 2NO4A 1IN6A 2WWWA 3DAFA 4OL0A 5F2KA 3WX0A 4A2QA 4B3CA 1SD5A 3CMCO 4HDSA 5C9ZA 1C14A 2VSYA 2NP6A 1H1LB 5JISA 4A03A 1NQUA 3UH1A 2SBTA 1C5KA 2ZJFA 4J29A 5F3DA 3DC2A 1NR5A 2O48X 3M6LA 3ABOB 4C08A 5KIAA 1PL7A 4J0CA 4RSGA 1UQRA 3PA6A 4YAOA 1Z6YA 2I3AA 4B3IA 2A5GA 3G5MA 1CE8A 3EWAA 3EZ6A 1VJ1A 3GLGE 1PNOA 3A70A 4QUDA 2QHXA 1OAOC 5FH9A 3HDVA 4MWSA 4TLBA 1IY1A 1UPFA 4FFRA 5DN6A 4KXLA 5DLQC 3QNMA 1ULBA 3TB4A 4GOLD 1HNNA 4FNAA 4GX0A 1BXKA 5JAMA 5IJ9A 2ZSEA 3O3OB 3P2MA 1IXSB 1CW2B 2I6GA 1CQJB 5GP1A 4HWOA 4PIVA 1IJEA 3N87A 5F5LA 5B4UA 2B1GA 5THQA 2OGZA 5KPJA 4ZN6A 2E2WA 4R6XA 4GXQA 1W73A 1OF1A 2VAVA 2VH5R 3B3AA 3L2OB 2C7OA 4EY8A 4LEIA 1EZZA 3JY6A 4E5MA 1S2NA 3FYCA 1EUYA 3V1UA 1N2SA 4NZ9A 3C3DA 3UHOA 4L76A 3KD2A 2GK6A 1FDSA 3C97A 1EESA 1YR9A 4L74A 5IZ4A 4Y2YA 5AKKA 1U7XA 4AXBA 1PX0A 3NDPA 3WL8A 1G5PA 4ZKDA 5EJ4A 5EHQA 1BWRA 3CFYA 4JGBA 2JLCA 2ZI6A 2OGWA 1MA3A 1P9WA 2XGSA 3DWIA 3OIUA 5CGZA 1PG2A 3VC2A 2IUTA 2Q0SA 4RDHA 1PSDA 5E9AA 4F60A 1W94A 2G08A 1PEYA 4UKDA 3UV6A 1E0AA 2F64A 1YKSA 3COZA 4B32A 2ZCVA 4IZ6A 3ID6C 4S2UA 4FDLA 1OE0A 2PBZA 2YNMA 4JH0A 4S24A 1MABB 5F9HA 1VL5A 4Q1DA 4R98A 1E4YA 2H0AA 2PXHA 4MV5A 1M1NB 4NG5A 3ULKA 4BLSA 4EVQA 3P26A 3UA4A 3ZD6A 1UDWA 4IMJB 5C1IA 1KZ9A 3O3NB 2R1VB 5J2TF 3EPRA 3G2IA 1YDMA 4G89A 2X7JA 5AJYA 1PVVA 5EL0A 3R7FA 4B81A 4L0DA 2B30A 2VPZA 3FCUB 4TTQA 2FXVA 1NVGA 3TNLA 4DNQA 1PT9A 2AOUA 4XB6B 3QEMA 3RK1A 1QYVA 3L8CA 4KR3A 2FFJA 2JBAB 3QTTA 4M4SA 4PX5A 2PWYA 4BVBA 1K8XB 1J4AA 5JZSA 4B4DA 2ZYUX 1ZJJA 1NVAA 3JWJA 1GKYA 3DFUA 2QRMA 2ZPUA 3ZY4A 2EJVA 2PS3A 3AHDA 3BAFA 5L53A 2QW8A 2JGEA 1OTXA 1XEXB 1JJVA 2QI9C 3QE3A 4UM5A 1JXOA 1K8ZB 3EEOA 2QUBA 1GNRA 1UT8A 1N8NA 3FZNA 4EMUA 3ZDXB 3GRRA 5BWMA 2ECPA 3HJTA 4EAQA 3DTYA 4MROA 1II9A 2JHPA 5IDWA 2EV9A 1XQ1A 5AW9A 1SC9A 4K6OA 3VOTA 1Y5NA 1FTGA 4YRQA 1VRWA 1GDDA 2W11A 2YWXA 3DLIA 3GNLA 5JH7F 1IL0A 4D98A 1SBTA 1VYVA 3OJXA 3DGFC 2QX6A 4CLEA 4Z49A 3G0HA 3RTBA 3TOCA 2H3EA 1L4KA 5SZKB 4N8EA 4OX9B 3D2CA 3IMEA 4IIUA 1EU1A 3WK9A 4AIIA 5SYMA 5FBRB 1I7QB 1G8GA 2QP3A 4ARAA 4IF4A 3PNSA 4XOUA 1U02A 4BVJA 2QN8A 2ZWIA 2HJ9A 3SOZA 2C2YA 3IQHX 3KFLA 5HRAA 1WUJS 2RJ3A 4LDJA 4Z4GA 1KDPA 2QL9A 3QE9Y 1YVPA 3VO8A 5J59A 3OY2A 2CCGA 1MEOA 3NHBA 2VWGA 5IYZB 3MVEA 1SFRA 2QPTA 3OZVA 4QOJA 5CG1A 1G55A 4UU7A 3W9BA 1B3BA 4DGQA 2DZDA 1YBVA 4ND6A 3C1UA 3VQTA 2GXAA 5T57A 3WB0A 1UBUS 2II6A 2QTLA 2C5GA 2Y05A 1IZZA 1QQ5A 3DBOB 3NJ4A 2GAJA 1XTIA 2FZVA 4HR7A 1T9ZA 2PZMA 4JLDA 2AQKA 2QORA 4GMXA 3K1AB 2ODBA 5INTA 4CU2A 4N3BA 1DC4A 3WGMA 2XB9A 4QT4A 4BRUA 3TFQA 2NPFA 5L95A 2EBFX 4R2KA 4REOA 3VZQA 5A4DA 4WJLA 4DNOA 2X0RA 1M10A 1Z4LA 2RBGA 2BEWB 5LSAA 2B0JA 3OLXA 5HYVA 5BSRA 1EBUA 3QUBA 1D1PA 1TDJA 4F2DA 2AEEA 3HGTA 5DYNA 2A59A 1QHGA 1THZA 3EXIB 4MQ4A 3G7UA 3NUQA 1EP2B 3R20A 4K5QA 4KLCA 3K9QO 1UBCA 2CXUA 3OKCA 3C7TA 4AC9A 1XQWA 4TXNA 5ARCA 5F76A 4Z3OA 1KOGA 3FCSB 1E58A 2BRUA 2H1WA 3I23A 3IE0A 3IV6A 4OXRA 2OO7A 4CG1A 4X65B 1GD1O 1K75A 3IHTA 1W2GA 3PRYA 2R6HA 5LIPA 1BQEA 3JAMA 1M0WA 4L4RA 3FVTA 4QPZA 3UMSA 1W87A 4K1LA 4F12A 4C0AC 5BSVA 4JBIA 1SUDA 3VPSA 2RGRA 2IU0A 4LC1A 1OXTA 5DWVA 1NLMA 3PNKA 4CLXA 2IOYA 5AW7A 3K1TA 1D4OA 5B2EA 2OVFA 1PLLA 4L08A 3UFBA 3USZA 2NACA 2I91A 2GSDA 2EVWX 2FR0A 2BHTA 4RULA 1ZWKA 4QQRA 4MICA 3PDJA 1HYHA 1Q11A 3HJHA 1T6ZA 3U0BA 1LPNA 4ERNA 3T94A 3S29A 4D0RA 1ZNQO 1DINA 3WA7A 2CUTA 1SZDA 3FTCA 3KDPA 1TAQA 2CFIA 2TECE 4TZTA 2D6FA 3G8CA 2RAPA 3UKOA 3ETCA 3CW9A 1U5BB 1Q74A 3WTCA 5KHOC 3PR3A 4QDOA 5TY0A 3AKCA 1LLDA 1SBHA 1FX0B 1PJTA 3G8DA 2CNWA 4Z54A 1V8ZA 4URHA 4QPNA 4TLEA 3ZBUA 5HZKA 3EA4A 3QKIA 1LV7A 1SO8A 3FVVA 5J4VA 2A14A 2WWYA 2NXCA 1VHWA 3NRCA 1XRSB 1XR3A 3QYPA 4FS8A 4MJXA 2OL4A 3IUMA 1YB1A 3WVNA 1XZKA 1RI4A 2XCLA 3PR1A 2ZIZA 4U2BA 2HO5A 2X19A 1ZUNB 5T6BA 4JNCA 3G13A 3C6MA 3U31A 5HF8A 4GE3A 4IFTA 2D1YA 4HRXA 3LXXA 5FHQA 3U3XA 2O05A 1EM8A 4ZRMA 3I2HA 4UTZA 2FOLA 3AMVA 1MBZA 4JROA 2XYQA 2AMLA 5ENZA 5BV1A 4OTZA 4RO0A 1KNQA 5D86A 1X8LA 3HZRA 3Q0EA 4ZT3A 3VM6A 4DG8A 4HAUA 2JJMA 4IIDA 4PSAA 4RH0A 4QJ3A 4U7GA 4N6OA 4Y2TA 5IULC 3HB9A 3K9CA 4N0MA 5K3OA 2PLAA 1R4NB 2I6SA 1TQHA 2NO0A 2Q5QA 2J08A 3EEIA 3RNLA 3HU5A 1XROA 3ORFA 1Y6QA 4BGVA 3ZHTA 4KQFA 4QSHA 2WUGA 3DT6A 4I1YA 3L7YA 3CU5A 3H18A 5FXMA 2G83A 2PWAA 2PMWB 3ILYA 1R8JA 3ER9A 1Y4SA 3PNLA 4LDNA 3UHJA 1XVVA 4PGHA 2NT4A 1JIJA 3MA0A 2BKUA 3JWHA 5JAOA 5FA6A 1QM5A 4GZ5A 5A4AA 3L4JA 1XELA 1E9CA 1IHDA 2BKAA 1FNMA 2NTJA 3T41A 1H8ED 2REQA 4G0ZA 1GG2A 5JMWA 1AV7A 3F6EX 4NECA 4RCYA 2AGVA 5H59A 1I6MA 1ZUHA 2FN3A 3EBLA 4YRLA 1LTKA 1SCKA 4JGGA 1D1TA 3I4CA 4PIMA 5K3DA 3HO8A 1C9EA 4CM7A 2WSBA 2YJ4A 2WSMA 1S8OA 5CB4A 1SC1A 1EZ1A 5BN5B 2GWRA 1V45E 2I1QA 2WWRA 2OAP1 3BDIA 4MVJI 2WOJA 4ZVSA 1ZN2A 4DLYA 3GMTA 3V48A 2BI8A 3KPWA 3ZVMA 4IO1A 4LJAA 4OFBA 2H1RA 5GM1A 3I09A 3FSGD 4IILA 2XVXA 3FWKA 1MABA 2JKVA 8OHMA 1Z68A 4IW3B 1ZNYA 1PGQA 4BYGA 1FTWA 4OOEA 5GZ6A 1GPMA 4JB8A 2YIVX 1KJJA 1MX9A 1XL0A 1A7UA 4DCVA 2QQ0A 3L7DA 1PCXA 4YRDA 5IM4F 1W96A 4IJMA 4QYXA 2Q5JA 4BJHB 2PKCA 2RJOA 5DIZA 3ZLJA 4L9AA 3EWSA 3VR6D 2HF9A 1VL8A 3LUFA 5IW8A 4CCSA 4TKUB 1UDRA 4UNRA 2IWHA 4AL4A 1DC5A 2JJ1D 3F4KA 1YONA 2BFNA 1SBQA 2ZRKA 5GGXA 1KKMA 4K2HA 1A9SA 1CZHA 1JE1A 2VLIA 4J2TA 2DBVO 4R7TA 3DDNA 2AR0A 3LDHA 4QYTA 3UFXB 1U65A 721PA 4RV9A 1RHJA 5LYJF 3VR2D 3M9WA 3GFRA 5FA5A 1O4WA 1QOZA 4FFBA 5EQJB 1JP7A 4YTEA 3R3UA 3FXAA 1RKVA 1OIWA 3IP3A 3GFFA 4X93A 2B4AA 4L57A 2WYOA 2A9FA 4D8YA 4TQ9A 1CYEA 1FLDA 2R9VA 3A9RA 3GJSA 1YO6A 3FKSD 3MMZA 4OQEA 3TL3A 2JBWA 1YR7A 3EZ2A 1PV2A 3UXMA 3M6FA 2PFSA 4C04A 3ZX4A 2O7RA 4L5AA 4MVXA 3BREA 3SHWA 3FWHA 4YT8A 4YV1A 4TRMA 1PFUA 3DKPA 2IYVA 4M60A 1K5HA 1IOVA 3KQQA 1CKEA 4UQPA 3GLFE 4CM4A 1GNQA 1ZOIA 3OPQA 5A3JA 4GQAA 2HTEA 3H0EA 1P7YA 3FUTA 4CM8B 1T5DX 2YYYA 1GV0A 3QM1A 4PSVA 1W5TA 3I64A 3RTAA 3H2ZA 3SZ3A 3MOSA 2AYZA 2X7HA 5JD6A 2R8ZA 2JAHA 4LCEA 4PXAA 4C3VA 2PUBA 4X41A 5HIMA 3BG5A 4TKUA 1RRCA 4J7UA 3MWEB 1QORA 5JE8A 1M72A 1UOQA 5AO9A 4ASUA 3A0RB 1ZSVA 1ESEA 1SVUA 4B3RB 5HKLA 1C3EA 4LMAA 1G8HA 3F5MA 5FBHA 5EHXA 4WFJA 3GRPA 1WMEA 3C6KA 3EVNA 3DZHA 2XLCA 4L4UA 2JA2A 3RTCA 3OJ0A 4UHCA 2G4CA 3MQ2A 1SZJG 2ZE7A 4NBUA 2QTNA 3DZGA 2NQ8A 4PLTA 3BRWA 4ER6A 4M9RA 5IJWA 3MUFA 3ZBQA 1N8KA 3G82C 2XTZA 3QVLA 5CP8A 7REQA 4DBZA 1THGA 5IVIA 1FYWA 1NQTA 3QENA 3NHZA 3BMOA 4JEMA 3G5LA 2GZRA 4QKQA 1HBJA 2HZBA 5IEBA 3NXSA 1N5MA 2VPTA 2HGZA 2A0UA 4JR0A 2JL1A 4IGAA 1YUNA 1BD4A 4WACA 1Q0HA 2CMDA 3FVWA 3SK0A 2WJAA 4MRVA 2N42A 2X2FA 5LZ8A 2I3GA 4XOIA 3SHVA 3TN7A 4ETIA 4A36A 3KEGA 1VFNA 3O92A 4BLRA 4I1IA 4G5OA 4X0EA 4B2PA 3THSA 5L7YA 1Z8DA 3CN7A 4WASA 1HE8B 4EFKA 5K03A 2QI9F 3LW7A 3ES9A 2Q62A 4G81A 3VA7A 2IZ5A 3N8GA 1MR3F 1T0IA 3F3SA 4RJJA 4BMYA 1KEEB 2ERCA 2FSSA 4GBED 2NQTA 4A9AA 3CV3A 2D7JA 4DMFA 1M83A 4XSHA 2XMDA 1UXIA 2WD9A 1QK5A 4L3OA 5D01A 4UVEA 1EFLA 1XGKA 4X20A 4US1R 4ZYLA 5A04A 2FSPA 4HVCA 1T2NA 5TQ2A 1Q0UA 2WHPB 3W78A 3I3SR 4OIMA 2WT9A 2Q3MA 4G23A 1VDMA 3FFXA 3UTCA 4CM3A 1L5FA 3W4IA 2H4XA 4URXR 5L7TA 1FXUA 2GYUA 2VT7A 2I67A 5KQRA 4IUBS 2WZDA 4YALA 2WPDA 2CXTA 1KBQA 2D5LA 2RGAA 2Q6KA 2RGWA 3CSDA 5BQXA 3V9PA 5FF9A 4BUCA 3PIIA 4K87A 4UULA 5L3ZA 3URMA 2CZGA 2ERXA 1M2FA 2WMDA 3L6EA 4H7PA 2JGRA 4UTPA 3GFQA 2GA8A 3C85A 5JSKA 4BB6A 2RH5A 5EKXA 3DCNA 2WUEA 3OF3A 4DG5A 3WADA 4HF7A 3I45A 1GKIA 3ND9A 2OG1A 4DIUA 3OQMA 4NMMA 4OP3A 4GX2A 2CYAA 4XQGA 5AK5A 4WD3A 4R05A 1Y48E 1TZ2A 3D1JA 4CLRA 4KEAA 5LKRA 3RC9A 1S2LA 1D8AA 1ZK3A 2BFFB 1DWOA 5BSEA 4WVFA 2R3SA 3CTPA 1IHOA 4FFDA 3FTPA 3GGJA 3WLOA 3O93A 4GLBA 3TLMA 4EHBA 5BVHB 3MCUA 5EMLA 3WIDA 3ZGOA 3KAJA 2BHSA 4MUXA 2OHHA 3BXGA 3H4VA 3QU7A 2IODA 4UBLA 4TKLA 3PU6A 2LCQA 4MUBA 5MFZA 5J4KA 4HX9A 3H04A 2VXCA 2GLTA 1KIAA 2Q6VA 2WKSA 4HLUA 1JH8A 1XAGA 2WHPA 4MGKR 5IKPA 2RI0A 2OHOA 1SHTX 1LRLA 4HH1A 4DNPA 2VSFA 3A4TA 2WBLC 1O6FA 4YAGA 5C1OA 2ZQYA 1QQBA 5TMBA 1CQIB 4RK1A 2VDVE 3ESDA 1YDWA 4QJIA 3T54A 5JTUA 4Z99A 4LF6B 2P0AA 2UYHA 3PWZA 4LHEA 1PFQA 3OIFA 3ANNA 6ADHA 1UFRA 4LOAA 1Y81A 2B61A 3QV2A 1FRZA 3TLBA 1GRNA 1WPXA 3WYDA 3PC8A 1UPTA 4HEQA 3VV2A 3VR3A 1E64A 4RKEA 4LWOA 4GKJB 2J85A 3EF0A 4YAJA 5JS7A 3JZAA 1WHSB 4RPIA 4I55F 1XPRA 4O63O 2VNHA 3HYTA 1C1HA 1ADBA 2GPSA 1N2EA 4U9IS 4KVZA 5IAKA 3NWOA 2Y1CA 4YFVA 1ZIYA 3KQSA 1B8PA 3QNUA 3PNVA 4OQDA 4IJQA 4B8ZA 4KQ9A 4R54A 4RF2A 1W88A 1IIRA 1N5LA 3RLFA 4MRNA 5LQNA 4RKFA 1WKVA 4ISCA 1ACLA 1YBHA 4RQAA 3KYCA 4QYIA 1NLYA 4XJXA 5AM5A 3S2UA 3UV7A 1FTQA 3ELWA 4GI7A 4Y2RA 1N7JA 3BCRA 1AKVA 2BVNA 4M9XA 2W98A 1U80A 3ZWPA 2AR7A 1UAGA 4NYIQ 4PPNA 2CNBA 2FMXA 4FUTA 2LNDA 2XKAA 3IHKA 4HH3C 4NJOA 4URYR 1X7XB 5AVYA 1I94B 1QZTA 3AVTA 1OPXA 2IYUA 3S8EA 4IFEA 2GF9A 2ZRNA 2Q6IA 3SOPA 4FYKA 2AZDA 1XJCA 3VZSA 3ZDYB 3U4QA 5JHGB 3SBOA 1JI3A 1EDBA 1VDZA 2ZBQA 4IDOA 4AO6A 2WT8A 1UBTS 4EPRA 2GPTA 2PX6A 1VCOA 2XOKD 3UAYA 4D8UA 1OXVA 4HVAA 1PEDA 4XIIA 1X8KA 2DU8A 2VDUE 4R9RA 3E4CA 3UWSA 1Z15A 5CVCA 2VJKA 4FLEA 2GM5A 1IONA 5FB3A 5GVRA 5KCZA 1B43A 4MV9A 4OBBA 3UMRA 2QRJA 2YV1A 1DC3A 1XLWA 2V9ZA 4JT9A 4ZAZA 2AEJA 2AMJA 5ICSA 2AFRA 2YVQA 4GX5A 4WA8A 4BLOA 5AVSA 4PYRA 3GEDA 2VHXA 3C3YA 2E49A 3ZCPA 1BMFA 1PWEA 3LC2O 2YW9A 1AH2A 4IVRA 1QG4A 3L6UA 2J9RA 4BY9E 4DWVA 3EH1A 4XUGB 2HGSA 2PH3A 4Q9DA 1EXWA 2XF2A 3K9LA 3PUWA 4QXMA 4YQYA 4WZZA 3L7JA 3OP4A 3VDRA 4OXNA 3BX1A 7YASA 3CVUA 1CP2A 4RTSA 5JD3A 2XNKA 10MHA 1VKHA 3GU3A 3P97A 4NR0A 4CODB 4ABTA 2H48A 4FONA 1R88A 1J0DA 3PC3A 4R1MA 4KX5A 3R0ZA 1JHOA 1ONOA 2EG5A 4TROA 2WJGA 1WPRA 1Z73A 1XVTA 1SIUA 4MRRA 4WADA 3TTVA 3ADBA 3Q12A 3ZZNA 3L6CA 3UHAA 3VNSA 2PDAA 1EUCB 3U5ZB 2JFWA 5HA5A 3ZE8A 2OC4A 2XXBA 5JANA 4N39A 4RK5A 1DRVA 2PT7A 3ZZ0A 1PJ8A 2PZJA 5A1JA 2EKQA 1PKXA 1DPGA 2F90A 4Q4LA 1EK6A 4J9VA 1YC2A 1KVQA 1ADCA 1T6BY 3AHGA 2CLMB 4ND2A 4YK7A 4AJKA 2H2IA 4INJA 4OH7A 2XY4A 3P45A 3R7LA 821PA 2XE6A 1VSVA 2KWIA 3AH8A 4KV9A 3OU2A 2VT6A 3ZTTA 2E0IA 2GJ8A 2PSEA 4DIDA 3OEEA 4X20B 2EJTA 1GSIA 4X8HA 2AEFA 2FEOA 4AQ7A 1R0CA 4IQGA 5E3IA 2OKGA 4RCVA 4K9LA 4RHEA 3CSUA 4Y1EA 4JODA 1H1TA 3U7FB 4PGAA 1FFWA 1WZNA 2VYVD 3H6KA 4MOWA 1PJAA 2D0PB 4D9BA 1KORA 2B4TO 2P35A 1UZAA 2VK1A 3HU3A 3IVGA 2O8DB 3EXIA 4YO7A 3E7WA 3NKFA 2QNRA 1N9ZA 3I05A 3Q9UA 1JHVA 3DWFA 4RUKA 2B36A 4GL4A 2BI7A 3UJDA 1O94A 1Y6ZA 3DL0A 2HI0A 3AHEA 3L9XA 2R47A 4MXDA 1PUXA 4CVNA 1E9RA 3N53A 4MEBA 3RIEA 1WMSA 5IX8A 3WL7A 2BUAA 1OZ0A 2RGBA 1HL3A 1SCUB 3KE8A 3KDAA 3LQFA 3RS5A 2YW2A 1KEKA 1E1CB 4TTAA 4XSGA 5BQPA 5K01A 1K6EA 1RM0A 2F1HA 1BMTA 2W2TA 1FQOA 4RKRA 1JV2B 4RCZA 4H3KB 2DPGA 3OJEA 4YNBA 2QLTA 3DOJA 1W85B 3GZ4A 4X8LA 5G4LA 5AXAA 2F67A 2RKWA 5IP5A 3ERCA 2Z3WA 1C7QA 2BF7A 3H5RA 3C8ZA 4N5LA 1HFJA 4J1QA 3IP5A 1N6IA 3N2KA 1KY2A 5J2TA 2DR0A 3FROA 2W6ID 1SZPA 4LHSA 3NV7A 5KDLA 4JDUA 4EBFA 3LT0A 4EPYA 3HBJA 1WCXA 2NO7A 4M1KA 4UHFA 4UUBA 3CUSA 1ND6A 2HBRA 1Z25A 3VBCA 4BNKA 5KYYA 4EI9A 4QVIA 3Q8KA 2ZZNA 1M6EX 4KRFA 3LHDA 3KAQA 1UAAA 4DZZA 4LJSA 3AFIA 1KXJA 4KE8A 3UJ9A 2FJPA 3GJZA 1T8RA 5ISMA 1E0JA 2ZI4A 3G89A 2F17A 3TM5A 3D8UA 2VTEA 2PWZA 4UUAA 5L51A 4ZA2A 2V5AA 4MINA 3DNMA 4DJTA 2R00A 5TGDA 1KYIA 2P1ZA 3Q87B 2IITA 4GYWA 5D7BA 5JDIC 2R1ZA 4RWZA 4X7BA 5E6SB 1OAKA 5I7RA 1P1RA 3BB4A 3DEJA 1QGUA 3VHQA 2XWPA 1V8DA 3TLJA 4F9TA 2YJNA 4Q47A 4O59O 2DQKA 2G1PA 2X4IA 5BN5A 1E8NA 3C0KA 2ZAYA 4JYCA 4DMHA 3NHFA 1JFTA 3RBZA 1YGPA 3E5HA 1GPBA 3BZWA 2P2CA 1PAUA 4HD8A 4JI8B 2OOSA 2PZAA 3LC7O 1T5HX 2GK3A 1IULA 3R3YA 3A3YA 3EQ7A 2P4HX 3LQYA 5EKSA 1DGQA 2FKAA 5DCUA 3T5DA 1I6KA 2Y1EA 2P2SA 4Q5IA 4FMBB 4F72A 5LP6B 2GEBA 3TGPA 2PAFA 1CZKA 3PGLA 1CUCA 1MGPA 3TPCA 4TYPA 5F23A 3DTVB 2H4ZA 5DNDA 4HDAA 4NU0A 4E21A 4EG0A 5JQGB 1M1XB 1MGOA 1XCJA 2PEZA 2VAPA 1C9JA 3EWNA 3F2VA 3RJ5A 3WWZA 2O8BB 5IJZA 3EOAI 5BR7A 2VSXA 2QIPA 2HO4A 3IP8A 5FO1A 4FYMA 3EXEA 5H3LA 3TSWA 2QUIA 5KQGA 1E4OA 5KREA 2CWWA 1JWAB 4PTZA 3MPOA 3O8DA 3NALA 2EX4A 1RYDA 2MR5A 2GTIA 5DCLA 3H65A 1C9NA 2KHZA 2XD4A 3K6RA 1SVWA 3SWWA 1J9GA 2X5KO 2Q1YA 4RACA 3IMCA 3ZWYA 2X2EA 4BVEA 4CTKA 4QGFA 2FSVA 1DUIA 2VHYA 3ZWXA 2ZEJA 4TUYB 3NDJA 2WAXA 3AP2A 1DT3A 1RAAA 2GO7A 2HZ7A 1P3DA 3JQDA 5J63A 4EFLA 1N9GB 2ZYRA 1M9NA 3JW8A 1OB2A 2CXRA 1JAZA 2X13A 3ILXA 2QZSA 3OCCA 1Q1ZA 5CK4A 3PUHA 2OMEA 1CLUA 4NF2A 2OZLA 4M99A 1LDNA 3LHFA 1DOAA 3W8NA 3T7RA 2D2VA 3LRXA 1Z6TA 3I2FA 3NH6A 1GSAA 4RLSA 2BEWA 2QQ5A 3ROQA 3ZC3A 4I1UA 2V6FA 1DDOA 1W44A 2F1OA 3GFBA 1V8PA 4NFYA 2ZZMA 1OB5A 4GLFA 3V6LA 4XPZA 4DT1A 2FQ1A 3ZE1B 2IXAA 3ZHZA 2DUJA 2QNIA 4MKHA 1AB6A 3F8SA 2H2HA 1P0CA 1D2RA 2V7VA 5FTKA 2NVOA 3EMBA 4MMYB 1B0ZA 1ECBA 1UPUA 2IEGA 3ICQB 2XDQA 1KYXA 4MR9B 1L5MA 1OBVA 3A4NA 1PN3A 5GQSA 5JSQA 5EPEA 4XIYA 5JI3E 4HG2A 4OY3A 4CMIA 4IEEA 1DX9A 5ILQA 4C3UA 1R6VA 4RPJA 1Y1LA 4N9QA 1K6MA 3KXKA 4GKVA 4DANA 2IZ7A 2FW6A 2JEZA 1UKEA 1WP4A 1MLDA 4QE3A 5ALNA 1SRRA 4JQYA 3SIWA 5MN6A 1IQRA 3NR2A 4LE1A 2IVFA 2X0EA 4E5KA 1ZWLA 3CCFA 3KBOA 5EPUA 1JDBC 2B1JA 2VP2A 4JX8A 3RHTA 3DZJA 3OPYB 1R6AA 3GJ3A 4FUQA 4DPMA 1QU2A 4H3VA 1G2IA 2VDKB 2JFQA 1BD3A 4F85A 5A4FS 2X9LA 2NX2A 1WSAA 5JYCA 1ICIA 4ZXFA 1Z63A 2Y0PA 2YJ6A 3TR0A 1GLNA 3EXAA 3U4AA 4CQLB 2VJDA 3AHJA 3JAKB 3VVBA 4BZZA 4K1XA 2OEPA 3CT6A 1LBTA 2JJ8A 2ZQZA 5J58A 1FDIA 1FX0A 2FG5A 1CQXA 2OV6A 2NSHA 4I2NA 1KO8A 1V3UA 3CVOA 3IQGX 3WGVA 1R18A 2P9HA 1DQSA 1H9BA 4JFRA 4O1IA 1XA3A 1QCCA 1Z75A 1NXVA 3OIDA 4QHYA 5FPQA 1UINA 3BTSA 1WBBA 3L1HA 5M2QA 4OX9Y 1W46A 4JXJA 2QWXA 3O4IA 3Q3CA 4WKBA 4NS1A 3SZOA 4JYPA 4NBTA 4KITB 3I12A 4P0TA 1W4AA 4Q7LA 1P1HA 2H31A 2CLDX 2ZB3A 3JVUA 4QUHA 4S12A 3WLJA 4DYDA 3STUA 5KNDH 3L4KA 5E6UA 4C6HA 1DIHA 3I3OA 3IRVA 3BCSA 1JPUA 1ZD1A 1WOYA 2OGSA 4TX1A 4UBOA 4CT4B 3H9JA 2DH5A 3KV3O 5C37A 4E51A 3PKIA 4JMLA 4YB8A 4D02A 2WA2A 3I5UA 3AHFA 1Z18A 1RYZA 4B4UA 2QRVA 1UPCA 3KOYA 4KO3S 2HFJA 3W8DA 4NK5A 1J0AA 1OILA 1S3FA 3ZWBA 4BU0A 4S0XA 2RGCA 2A3RA 4RQTA 3FVRA 3SHQA 5C5EA 2C9DA 4RVFA 4ZVRA 1GYPA 5IH3A 2C4TA 4N65A 1QCZA 2R8OA 4CMEC 5IKXA 2B78A 2QMHA 4HGOA 2EFCB 1PIWA 4ZJYA 4CKEA 2FU5C 4UCXA 2ZSFA 3E05A 4QODA 3ZI0A 1CJUC 1CRWG 2XE4A 3BPSA 4RPKA 3DAOA 3TEJA 4ZJUA 1TL7C 4O08A 5H9VA 2XB8A 4Z0TA 3D4OA 1U0HC 3ZXUB 3QH4A 1JLRA 5HCUA 4KMSA 5C7OO 4IPTA 4ADSG 3FUWA 2Q5OA 3QUAA 4IXMA 2HHLA 1NW9B 4ZDWA 4MPRA 1AMOA 3MINB 3NCTA 1W2HA 1NM5A 3CW8X 3LWNA 3Q98A 4HZUA 3OQ6A 5FQNA 5FOQA 3O8OA 1LPOA 5DTQA 4TQAA 5FBLB 3SP1A 4EGFA 3KALA 3CWCA 5SY4A 3M4JA 4EDFA 2IH5A 2JIRA 2N1MA 1QNLA 3MFQA 4GWKA 2VP0A 1GITA 4DQUA 4K6MA 3BOSA 2QN9A 2V0NA 4DDTA 1N5DA 1DG9A 4RMNA 5E7JA 2HJRA 4RX1A 3E53A 4CMHA 3DXZA 5KJCA 2D4AA 4ATNA 5F3WB 4YH1A 1ZJ4A 4F7WA 3A14A 1L5SA 3PWSA 1PJRA 4D96A 2I2CA 2ZPTX 3KRTA 4I6EA 3UK1A 4YLEA 5DNVA 3SC3A 1KEWA 3ENWA 3PGKA 3TDMA 4ZU3A 1N3IA 1ECLA 3RAEC 3COVA 5KDDA 4KPUA 1XYYA 5GADl 3INGA 1MOQA 4EM6A 1L4EA 3HBMA 4JMPA 4H1WA 4UTXA 4CU5A 3SN6A 1XBTA 4HEHA 4P8RA 4KAAA 1V37A 5K4AA 4JLPA 3M49A 1KK0A 4YHBA 2ZSAA 4ND8B 2DUNA 7ADHA 1G5HA 2AKAB 5TE9A 1D0SA 3SC2B 2E89A 3NHMA 2BGNA 5CA1B 4EKNB 3V5NA 2QVYX 1R0BA 4NDNE 3O8OB 2PTGA 1WSBA 1C9KA 1KK2A 1AQUA 1T24A 2BR5A 2I03A 3LOPA 4KO4S 4TTTS 1G8YA 1U1DA 2IEIA 3AIIA 4HEJA 3UO8B 3QX7A 3N39C 1ARZA 4CETA 1RKUA 4NDAA 1H23A 4WNAB 2HPHA 1JMVA 4H1UA 2X8BA 5ENVA 3DDOA 5F33A 1XP8A 4PSUA 3R6TA 4JK3A 4TMWA 3L7NA 3EQ8A 2MMGA 2A9VA 1VCMA 4C0WA 3ET4A 2AE1A 3OCUA 4ZXPA 1DDGA 3REQB 4YUWA 3R3XA 1V43A 2XHEA 3TQRA 1O9GA 5FPHA 3ZU6A 2KW5A 1B7GO 4GO1A 4BQPA 1JPVA 4URUR 4X1YA 2ZWVA 4C6TB 3FOFC 1FZTA 2ZJ4A 1FUIA 5C8VA 5I4IA 4FU0A 1M66A 4BC1A 4F5ZA 3KEOA 4JHXA 4QICA 3O9MA 2JHCA 3M33A 1NNUA 5TS3A 4R0MA 2PX3A 2WV9A 3CPHA 3OECA 1U9IA 1HNWB 1LC3A 4ZEWA 3G2HA 4LAFA 4BNHA 1XLTC 4RD2A 3AUKA 3WFZA 4LDQA 3NJRA 1AHPA 4U7PB 4AN0A 2WG0A 4OB7A 4L2IA 1FUUA 2YHIA 1EX9A 1UBLS 4NSNA 3BE4A 2X0DA 5BQOA 2IF2A 2Q8QA 2W2XA 3RVQA 1J56A 3LX8A 3H1GA 4BEVA 3ONFA 4D0LB 1Y9DA 5JXWA 1I14A 2WM8A 2CE2X 1MQ9A 3CX6A 3T9AA 2HA5A 1RXCA 2QM7A 4DR3B 2R6JA 3RTEA 2FEMA 4V0QA 1MHTA 1GFWA 1EFKA 1P1KA 2C99A 1WB5A 3WHIA 5HKKA 5KNCH 4N40A 4OU5A 1GTRA 1RU3A 3S7ZA 3A6DA 5JMOA 1U8CB 1ZK4A 3T1NA 3GQVA 3I2KA 4GHWA 4TRJA 3AERA 1G98A 4OF4A 3PC7A 3K71B 2HN9A 3H9QA 5BT9A 2I7VA 4I1PA 4N9WA 4Z0PA 4WBNF 1AZSC 3RU7A 2CWDA 5C4MA 3PQ7A 4IGFA 5EJGA 5BNWA 3K2IA 3RIXA 2EGUA 3DMTC 3NYQA 1KSHA 5EJ2A 2PE5A 2PQ0A 3K31A 1L7VC 2WU4A 2XTMA 3GEGA 4LG1A 2GTHA 3GLHE 5FBKA 4BAUA 3SBDA 2P9YA 4GEGA 4E03A 1DCFA 1BJRE 2Y27A 4H77A 3RAFC 4XVUA 4N0QA 2NU7B 1P91A 1PZFA 2OMKA 3NC4A 1HTTA 1ND5A 2N46A 3DXXA 3NIFB 4JY7A 4NX2A 4JUDX 3ZHRA 2BLLA 3EX7C 1LVHA 1MAUA 2G9UA 2HCRA 1H2YA 4Y2GA 4TT8A 1TKRA 2Y9MB 3D3NA 3CRQA 4M46A 3AL0C 3HJFA 1Y6FA 3H8VA 2BOVA 1HE3A 4Q7QA 4PYQA 1B73A 1JIXA 1KNXA 4L0QA 4RORA 2DKFA 1HSOA 4DG9A 3DCJA 3RRJA 1X80A 3UHFA 4DMLA 4GP6A 3FLEA 3SFZA 3MTIA 4K81B 1E1YA 1KH3A 1ECCA 1E3WB 2XJ4A 1F8GA 4I5FA 1ZIXA 3P0RA 5DJ5A 1EFPA 3UJ8A 4R8KA 5HMLA 2EBUA 2W2OA 3IOYA 2OBNA 1WDTA 2QEQA 4M55A 4G63A 4J03A 4AJ4A 5LUAA 1OC2A 1O6ZA 5EVJA 3S7TA 4R51A 1GTJ1 1AB5A 5DZSA 2OPHA 3U61B 3ZDDA 1RP1A 2VEDA 1MIHA 4D9NA 4ZREA 3GRYA 2V7EA 3LDUA 4BLWA 2GLUA 1ZOOA 1CR4A 3EQ9A 4G4JA 1UT6A 5D5QA 5CA0B 1PZHA 1QGOA 5EZ5A 3KC2A 2VBCA 2G5GX 3S0JA 2GJ9A 5IDVA 3ETJA 3UUEA 5KOJB 1SWVA 1BSVA 2QYOA 1XLTA 1UZUA 1SWWA 1RXYA 3HA2A 4IAOA 1NA5A 5DCYA 3W4KA 1YU9A 2QR5A 1U2ZA 4A2WA 4B33A 2CJWB 5FUXA 2CVZA 4YRNA 3EARA 3H2HA 3AOEA 2VAWA 1L7QA 1TIPA 2YHIB 3C70A 4HB3A 5LMUB 4X90A 1AK9A 5A03A 4CUKA 3WGYA 3UCFA 4Q4DA 1BE8A 3GOQA 1K89A 2PD6A 3QWAA 1Z0DA 4MUGA 1PYOA 1KMIY 1OKKD 4HGZA 1RACA 3AVXA 1CQIA 1DEAA 2BI4A 1I24A 4QUBA 2ZAMA 3CTMA 1C8KA 5FR1A 5KYNA 3RE1A 1VIYA 2O2IA 2DPLA 4PLHA 4PSCA 4WY8A 1L9KA 4QO7A 3TBHA 4MV6A 4W1QA 3TAXA 4E46A 3RCBA 4OHVA 1KQFA 3E1KA 4W5WA 5CLIA 2XGGA 3ETEA 5LQCA 2GZAA 3C3PA 5HE8A 4O29A 3L77A 2HT6A 2QYSA 2IYEA 4Y0AA 1QRSA 3SEQA 1QLHA 2QN6A 4DY6A 1ULUA 1Y80A 4ZVVA 3CRVA 3PUVA 1A9TA 3L92A 4RETA 4B6GA 3SYNA 3KETA 2GYWA 1JR2A 3ROXA 3IT0A 2WINI 4JAVC 1JHUA 2P4QA 4TS4A 5EZSA 3U3DA 1ZPDA 3UM9A 4BYMA 1SXJE 3DOFA 2JB9A 4ZI3A 1T9HA 2DHQA 2H2AA 3DE6X 4IM7A 4J1NA 2ZJZA 1JHAA 1E3TA 4NARA 1TK9A 3BJZA 4DQLA 3EQZA 1QTQA 1B0UA 1DKLA 1ZDMA 2GJ4A 3L1JA 4KDCA 5FL7D 2YN4A 4IJVA 4F6CA 2QSUA 5KQLA 3QLEA 2NPOA 3D59A 3MT7A 4HKTA 3ZUPA 3IKVA 1F6DA 3D8TA 4EUEA 3EB9A 4RELA 2BGLA 5K2OA 4GU5A 2PKWA 1D0IA 4GICA 2ETXA 4KTVE 3CZPA 3DVSX 3GLRA 4KDEA 4DWWA 5IXJA 1HQDA 1BXGA 3ZWNA 2ZE8A 1SUAA 1USUA 3K1YA 3PNOA 2QBYA 1Q91A 4S0ZA 5BWBA 4Y6QA 3NAGA 4ENWA 3MF4A 5CT9A 4QU9A 3FGOA 1V11B 3S8MA 5H80A 3WLNA 1CUXA 1BDJA 4MULA 4A3SA 4CGYA 3NBAA 4UCFA 3X44A 1DB3A 2WV7A 3SX0A 3ZU2A 1E3WA 3FHLA 1PV1A 2J4DA 3REFA 2HHJA 3HU1A 5IAGA 1H5UA 1O96A 5FUQA 4RIGA 4BNUA 1NASA 1M3SA 3D54D 1L7PA 1Z0SA 3DWEX 5EJ5A 4PXYA 3PIRA 3O95A 1VL2A 2ATEA 3X0DA 5BSUA 2ZIAA 4KRYA 2QSYA 1KO7A 4HFMA 3RQSA 2WJ3A 2W2KB 2M6RA 4K9KA 1E1DA 2ZSKA 3KQVA 1EG7A 2R6FA 1D5WA 1K97A 3C3XA 1G21B 3L0DA 3Q1KA 1PKEA 5DCWA 3LGSA 4D5EA 4J0HA 2XOXA 4MYSA 2X86A 3MWDA 2IU3A 5EKDA 2YWFA 4CDRA 2RSLA 4LKOA 4NU5A 4TZ0A 4G97A 4EMSA 3QVVA 4RD1A 1AKUA 1OR8A 4DJ5X 3BQMB 2X76A 5DT2A 1IK6A 3VSDA 1LDYA 2A35A 2UYQA 5DEOA 4RZXA 5DF1A 3SR4A 4P84A 2UKDA 4YJ3B 1Z17A 5EJFA 3F46A 1BG6A 2VDWA 3OM0A 5FOXA 3F47A 2JEYA 3EDOA 2Y0CA 4QDJA 3F7OA 2D62A 1AKNA 1PVDA 1KDYA 3G23A 3SC6A 3IAXA 4RADA 3V00A 3DVRX 1YCFA 4BFZA 1LQTA 5M5BA 2VYCA 1OGJA 2VUSA 4CCAA 5TLSA 2GARA 2WJWA 4LY6A 5FBQB 5A71A 3NX4A 4QUAA 4OOFA 3ANXA 2M6KA 1R8XA 3C41J 1DBVO 1M34A 1RAFA 3IMKA 4X1IA 1GRQA 1AN0A 5TPWB 3GNQA 2VFAA 3UJHA 3IUPA 4G3XA 1KIFA 2AG6A 2X7XA 3KZNA 2NXJA 4KN6A 3SJZA 5L8VA 3ZE6A 5FEUA 2D1SA 3DOIA 4HNAB 2BR4A 3E3MA 4V3CA 5IXYA 2WKRA 4EFDA 1ZLYA 3FIUA 1CVRA 5J23A 1F06A 2B8WA 3IKJA 4JJ6A 4WK4B 4ZRNA 5KTRA 4XR9A 2R751 4JEUA 3WBKA 4IH1A 2QMYA 5J3JA 2OBBA 4JZKA 2X77A 3SX4A 1ZR2A 3FD8A 4QPCA 1CUYA 2EZTA 4I0WB 4MYDA 4KU4A 1XDDA 3AVYA 3GF4A 5AXCA 1R0SA 1EA7A 3OICA 1DFGA 4IXDA 5DOVA 2FGJA 4JWTA 1LC0A 2FLWA 2BFBA 4PHGA 1FU4A 4G5YA 1SCJA 2IK8A 1D6MA 3VKUA 1YH3A 3CLRC 4F96A 4N7RA 4GR5A 4K9NA 3KKNA 5FR2A 1E8MA 4NE7A 1SXIA 1Z0IA 4QFMA 4MYRA 4FE7A 2RHLA 3T9CA 2VP6A 2CW5A 3BDVA 4BPRA 1ISMA 4P22A 3DR3A 1ZSNA 4XZ3A 3KVVA 3V8QA 3OPXA 2AXNA 2EF1A 2YFKA 4Q1AA 4EGSA 2V7PA 1Q16A 4FHEA 1Z2CA 4BQQA 3I9JA 3U56A 4CEJB 2VSQA 4PYMA 1VE9A 1LPAB 2GBLA 4Y98A 1ZI9A 3TE6A 1V41E 1J5PA 4UAUA 2P9FA 2Y93A 4P93A 5D3QA 5AM4A 3MYRA 2V7TA 3W9UA 2AFVA 1X7GA 3MBIA 3FN4A 4G1VA 4DV5B 4WNYA 2WJZB 1KJ8A 3FR8A 3M8KA 1LWOA 4GPTA 4YEDA 3WYAA 2XCSB 5BVGA 4EJSB 2JFVA 3K5PA 3O47A 1QIFA 3OZRA 3UYLA 3N6XA 4QC2A 5HMMA 4UPDA 3EGCA 3GFGA 3IPYA 4KVFA 2GEVA 4P38A 4QDXA 1DMSA 4HB4A 1JJFA 2EFEB 3HWSA 1EUZA 3EEQA 2XKKA 2AJDA 3SI7A 3UENA 1KTIA 2NN3C 2AN9A 2Q45A 4FMDF 4BE4A 1XAHA 1OH6A 1MRZA 1AU9A 1OXBB 1K0FA 4HDMB 2WA1A 1YMUA 2W90A 4TSKA 1TQ4A 5DB4A 3EQ2A 4C7XA 1V8OA 4D6XA 2E87A 5TVKA 3ZU4A 1GZ3A 1PBNA 2XZDA 2C61A 2PKRA 3VISA 3D8RA 3LZCA 4TTPA 3SC4A 1RHKA 4ND3A 2BZ0A 1AXEA 1CB0A 1UC4B 3EW9A 2CYBA 2C96A 4P3XA 2WMYA 1XG5A 1NJ1A 1VFPA 1X1BA 3UCEA 3VZCA 3VO9A 3L6RA 1FQJA 3HY4A 4M9SA 4M38A 1GSHA 4P80A 2IGBA 2JVKA 3ZGVA 2HJSA 2HMTA 4J3JA 3O4FA 5K0SA 1I4OA 4A8TA 2Z1NA 5TQ0B 1F5SA 2G9QA 4GXNA 4CKCA 4DLLA 4EFNA 4R2IA 1UBHS 1N1EA 5C8YA 2GPNA 3F49S 3G79A 2CEAA 4J4BA 4BNIA 1SBZA 3QXCA 5FEMA 1K8RA 4OU4A 5JR3A 3QVGB 2OOKA 2UZ4A 2B20A 4IS3A 3FWNA 3N2ZB 1IJFA 2X41A 4Y8VA 1KI9A 2YDXA 2GXSA 5DIFA 2OCLA 2QPOA 2Z3ZA 5C5DA 5JATA 1U7DA 2RGGA 1HI9A 1R2QA 4Q02A 4F6RA 4F86A 5B3LA 2IDJA 4LDAA 1URPA 1PK7A 1YR2A 3U19A 4ZCRA 4TKZA 5B2ZA 4IG4A 3A58B 3P9XA 4N18A 4Q3NA 2PS1A 2GXUA 4DXHA 2GZDA 3AB7A 4MV8A 3RS8A 3STVA 4YCMA 5JXJA 3INNA 2X9QA 3EOZA 3HN6A 5I51A 4MUFA 4JI7B 4LY9A 1L7EA 4K7JA 5EE9A 3BSSA 2F3PA 2R8YA 1QAOA 3OI7A 5B5SA 4HJRA 2DCMA 5B12A 3G8YA 2NTEA 1IJBA 3WK7A 2HRDA 5ITSA 4HRYA 4P53A 3S5UA 2JH8A 4E94A 3F7TA 1F7UA 2PKXA 1CUDA 4BGDA 1Z45A 2H07A 3UYKA 3JV7A 5DWQA 3RRMA 4FKMA 1WDMA 4EI2A 5A5FA 1PQUA 1RIIA 1U2GA 1VE5A 2NUPA 3MOIA 2EWWA 1SM4A 1Z3CA 3EGEA 7AT1A 2WAOA 4ZYVA 3GCDA 4LXGA 2FW0A 4FT4A 1OX5A 3NG1A 1KA9H 2P2GA 2CV1A 4ARIA 4IXTA 3C5WP 2G06A 4PAMA 1ZAKA 3QFFA 2PUVA 2VSOA 4C5AA 2EFDB 2X2OA 4C7KA 4J4HA 3WE7A 2BFCB 4NFLA 2IA5A 2DTXA 3K5IA 3SHOA 1RR6A 1F38A 2XGMA 2Q07A 4WDQA 1CWUA 4Q3DA 2V4MA 5TMDA 1DELA 3A9VA 5TSDA 4QREA 3I76A 4YI5A 3H1PA 4YRFA 2IJGX 1H5QA 2RH4A 1ILEA 2A4MA 1PGJA 4M9UA 4FD2A 3LUDA 3RVJA 3N8DA 3IBTA 3GLIA 2BH9A 3D4LA 3FRJA 1SC4A 3P8ZA 2IPXA 1M54A 5EP1A 3RRFA 2BGGA 1NMQA 2REXB 1GCIA 2IZZA 4MTLA 1QMGA 2BZGA 1DZIA 1JDSA 3LQ1A 2PGOA 3L7CA 3ILSA 3R41A 2XRYA 4GFDA 3RQIA 4K3VA 3FDFA 4OYHA 4G5RA 4RGBA 2FKNA 3DEIA 3VC3A 4UEJA 3ZVLA 4MVYA 3S1AB 1KPHA 1G7TA 4Q3KA 3SDZA 2RB4A 4CL0A 2PUEA 3QVMA 4OQQA 1TIBA 3DZKA 1U9IC 2X5NA 2YV5A 1QFXA 3FDZA 3PC4A 2WG2A 3BGWA 1J8FA 2Q6TA 3TCKA 1MU0A 3GBSA 2UUAB 5EWJA 4DCOA 1OH8A 4PINA 2IHNA 3FJ1A 2VYQA 4IYRA 4DIFA 4JL6A 2BISA 2HLDD 1YB7A 1XTJA 3QOYA 4IIJF 1TF7A 1L2TA 4H7DA 1DFHA 4OLFA 1WO8A 2Q8PA 3OG9A 1M67A 2Y68A 3HV2A 4WN3A 1RKBA 3ICCA 2EWMA 5K0JA 3AR6A 3OETA 2YV2A 1QK4A 2IPMA 3L1IA 3U9TA 4M1ZA 3AY0A 1U99A 4PVCA 5IVKA 2KX7A 3U1VA 2G1KA 1B8OA 4KUGA 4WLUA 2LDBA 1OREA 1QIEA 1RJGA 1CFZA 2HMAA 2Y4NA 1XAJA 2NNWB 4Z2YA 4L4SA 2Y0DA 2E85A 4MW5A 4RAOA 4F2GA 4FIDA 5K7SA 2J30A 1E2JA 5DLEA 1NV8A 3AKEA 3ASZA 4ZVQA 2PZ8A 1EINA 3TCXB 3DZBA 4QAJA 1RYEA 2Z2KA 1RRVA 2KS6A 4BO8A 2GZSA 3TRJA 2WSYB 1U6JA 1Z56C 1WQ4A 3L07A 1W34A 5G2OA 5JASA 1T0BA 3WQRA 1H9AA 4N03A 3FPHA 1XXLA 2YBDA 1JX6A 4CLHA 5K20A 4K6FA 2O20A 3I01M 1CJMA 5LYJB 2WSSD 1ZR4A 1Q0TA 3AEYA 1NXSA 3GWGA 3F3KA 4MUJA 3GGOA 3UBTA 2V97A 2HT1A 5DMXA 3NASA 2CYCA 4NULA 3HXOA 1QGUB 3U3RA 3X1YA 3N8IA 1XEWX 3A3PA 3TRIA 3UFXA 3V1TC 4M7PA 4O4HF 4DV3B 4L2IB 3T7DA 1YFKA 4DA8A 2E7ZA 1DAEA 3GEMA 4RS4A 4U6QA 4LVUA 3H0KA 3MRSA 3V2UA 3N5KA 2V58A 2Q7OE 3HB5X 3CY6A 5H81A 3ESRA 1Q1QA 2BHRA 2Z04A 2QXTA 4EYQA 5DTRA 2PG3A 1D3AA 4UHKA 1W19A 3E9NA 2R7LA 1A1SA 2ZUBA 3B1XA 1D6NA 4IXWA 3GEBA 3HU2A 3M3DA 2FW1A 5DP1A 4WMLA 1VZ2A 1SKYB 3FLMA 1ST2A 1YZQA 1J0XO 4UMDA 1UFQA 2ZVQX 2EQAA 3WGIA 1YQ9A 2RK3A 2OFPA 2RHRA 1P0FA 1P0QA 2WW8A 4HZGA 5TRTA 5FWYA 1XU7A 4PG7A 3DBLB 1Y7PA 1ZYUA 2C5LA 3NHLA 1V48A 3H1FA 3D6FA 2BT4A 3IAHA 2FW7A 3GGSA 2OHVA 3CT4A 4IKOA 3TQOA 1X1QA 3EMKA 5HQ3A 3A4IA 1MPTA 3GEHA 4IJ6A 3HJUA 4A6XA 2DY0A 4EITA 3DFFA 3QVJA 4K26A 5JS1A 1AO3A 3WQBA 1T15A 4CG2A 5JT1A 3ZCQA 2QX9A 2OV1A 3ZQUA 5TS2A 3AVPA 2XWBF 3F9CA 5DNUA 1ZK1A 2CLLB 2WYWA 4NABA 4CIXA 3BTVA 5GGYA 2AOVA 5KC8A 4LUCA 1X8XA 4PZEA 3K2QA 3NDIA 1SOVA 2P8JA 4M8NE 2B35A 4RESA 4I3FA 2Q1WA 4W99A 1E8DA 3TSCA 5JYEA 3ADDA 3FUXA 4O0LA 2AUMA 1KKUA 4QIHA 4ZHQF 2BP7B 2MT9A 1DADA 3FMIA 4GPIB 3THRA 5DHSA 1LK5A 2NUTA 4FDVA 5DYGA 3OZGA 3R0JA 3FAKA 4YCSA 5FBZA 4ZV4A 2PK3A 1U81A 3DMFA 1Z0ZA 1U0LA 1GU7A 1L5OA 5E38A 1IOZA 4BEWA 3LDAA 4KACA 3FMPB 3MWGA 2GN8A 3GQBB 3K2EA 3ONWA 3PXCX 3PS9A 3WJ1A 1OBOA 1RBZA 2WJYA 1AXGA 3GN1A 5JJCA 2FFQA 3OQJA 2QRNA 4ETNA 2GJAA 3H97A 1YR3A 1ZC4A 4MVWA 4AZ0A 4I9FA 1P7ZA 4M9QA 2QL5A 4XE5A 1Q92A 2IOQA 3KB2A 3LT2A 4RXMA 1Q1EA 3DNFA 5I5GA 2NU9B 4TXLA 3E03A 2W5UA 4KBYA 1I6LA 2WVJA 3B36A 3DO8A 4KL8S 4Z1MA 2RKBA 3WYEA 1JIIA 2QY6A 2E37A 3O8BA 1VLMA 4PAOA 4JBNA 5CT6A 3BK1A 1NBOA 2ZDGA 3NZEA 1THMA 1A2BA 1W9MA 2RFLA 3DFZA 4ZQEA 2C2HA 5FNVA 2WD7B 3P2JA 2C5BA 3F6PA 4I3GA 5IG2A 1QRUA 2P5TB 3WP1B 2QLBA 4DBLE 1WKBA 2ORWA 5KNCD 5T4EA 3ROFA 1C41A 4Q21A 4RS3A 1NUHA 4TLCA 2POCA 1XP5A 5G1NA 4C5BA 1RXWA 1KOJA 5CW1A 2H0RA 1W76A 2IYNA 2W43A 4WCFB 1PFGA 4C4PA 3OOSA 4D9CA 1ZU4A 1HC7A 5CHYA 4KSBA 3IMFA 3R6GA 2WC1A 4IFBA 1X94A 5EIWA 1EFVB 5F52A 1JEOA 1VMIA 1YUMA 2QB5A 4NCKA 5KNBD 1COZA 3ZDAA 5JJLA 1MD9A 1XKXA 1ZY2A 3BJMA 3IBFA 4J1SA 1WY7A 4L16A 2ZU6A 2BH2A 4FBGA 3KTAA 2WY2D 2E55A 1C3LA 1XZMA 4OMUA 1VJGA 4Y2PA 1GL3A 3MLBA 2FG6C 4O2BF 5B58T 1AQIA 1CY4A 3WGLA 4RDCA 3F1LA 5FWYB 2ZXFA 3DBHA 2Y76A 1E6UA 1G7RA 1K2WA 3EVZA 4LXQA 3OA0A 4FB4A 1IRIA 2H1OA 4EKDA 5KWIA 1NP3A 1OVGA 1FXWF 3BBLA 4ZEMA 3L7KA 4EZIA 5FBVB 2H4WA 1LI5A 4YCNA 1JHXA 3DMRA 1SRQA 1XJWA 4O2AF 5E6UB 4NOMA 1RLTA 3H9GA 4I4NA 4LYAA 5C3UA 1S3SA 1TT7A 2ECQA 3D7NA 1OA1A 4IHJB 2ZZKA 4OQYA 5DHTA 3VUEA 3OX1A 5JI2E 2OR3A 1WXIA 5HUJA 4S1TA 4R3WA 1M74A 1WMFA 3H19A 3DLCA 5AXDA 4XWKA 3G85A 1G291 4ZRDA 3RSOA 3PXDA 3TW6A 2B7BA 1SVMA 2QBYB 3ZHXA 3KSZO 3UGJA 1IZ7A 3OWXA 1SU7A 4PC3A 1F0NA 3KSUA 4H35A 4N4AA 1JEQA 5JYBA 1XTBA 4OMCA 4BBPA 4TLAA 3F67A 3GZNA 2HSDA 1II0A 3KAPA 4FHFA 2FP4A 1KI1A 3R76A 3H3XA 2ZCJA 3TIGA 1OXSC 1Q14A 1CJSA 5EPOA 5KU7A 2DF8A 2SHKA 4S1VA 2VCHA 3LT4A 2PX5A 5H3HA 2A92A 2VUUA 2VHEA 4ZQCB 1LRKA 1VG1A 3H2JA 4J0KA 4WXEA 1T25A 2IKQA 4IXNA 1UJNA 3M5DA 4TOIA 4KWIA 1T5TA 3A1CA 2XPCA 1T0HB 5DBHX 1AKQA 4O4JB 4KUHA 1RXSA 1U0OC 4IIJA 3PSHA 3G9TA 3A4VA 1FSSA 4C1NA 5AW6A 4J7AA 4PG8A 1DT5A 3ZDRA 3SXPA 3JRNA 1Z5ZA 2WWVD 3QVKA 4N76A 2HK9A 4W4TA 3OKFA 3EVBA 3P2EA 3CEHA 1V1JA 2VNJA 3PR2B 4Q1EA 5G1OA 3RTDA 3U9SA 3OMXA 4YT4A 5FA8A 1OYWA 2GWHA 4RK0A 1EVZA 4MP6A 4V3BA 1T91A 3AJAA 5ALZA 1G5TA 3AJEA 3EC1A 5C4GB 3QEBZ 3OT1B 1CS4C 1H93A 1A4RA 1R6TA 2AHOA 3PQ5A 4HRAA 4RSHA 9GPBA 1Z2EA 4U00A 1NE2A 4IHAA 2V6JA 4E14A 2A0FA 5EZYB 4DRZA 3W7AA 4GLJA 1QTNA 2HPZA 2JPDA 3UOGA 4C4ZA 5I3CA 4XUDA 2H4FA 3OLQA 1P19A 1T10A 5KOJA 4OP1A 4AJ9A 3T7KA 1MZVA 2B2XA 2R00C 2Y3IA 4TS3A 3RV3A 3T4UA 4L85A 1L0BA 4UNPA 3CIOA 4OLAA 4W7SA 1PYDA 2BMWA 5HJ5A 4DRXA 4JLKA 3NRBA 2H17A 3JD3A 2GRAA 4EY3A 5M29A 1ADFA 3W05A 1PQWA 2CHVA 1ZM2A 3UT5B 1KFJB 1RPTA 2V54A 4MARA 4A8JC 4GPAA 4KQEA 2I4RA 3JR7A 5EWMB 3RRZA 4B9AA 3UPUA 4H27A 4JUFA 3U80A 3L8ZA 1OLOA 3W2IA 3ONDA 4YR9A 2RHTA 3KTFA 2HRBA 2NUAA 2Q3DA 1NSTA 3HWX1 4MVJE 3UCXA 4KSCA 4P1ZA 4RD0A 4U2GA 4PC6A 1TD9A 1Q17A 1LSUA 1IVNA 1F2VA 1DLJA 3Q6MA 5E3JA 1OZHA 2N1BA 5F7ZA 4DLTA 3Q0IA 4E30A 5DW0A 3WGZA 3ELBA 1EMDA 2C3YA 3RSCA 2AHRA 1HDZA 4HNSA 5CA1F 1KPGA 5CLHA 3DFIA 5GOZA 3NTQA 1LBEA 2W8BB 3I5AA 4HL6A 5CU7A 3PEYA 3P4UA 3OIWA 3P9IA 1EP9A 3H4MA 4XIFA 5DH9A 1TEVA 3GNTA 1N2OA 1WXEA 5I4KA 2DXIA 4XVQA 5E0KB 2LR0A 4B3XA 4UREA 2OXEA 5J5CA 1W4RA 4P5EA 1HUQA 2F6RA 2B92A 3BB3A 4Y6OA 3R7WB 4G1BA 3SSMA 5B4VA 2O6LA 2Q46A 4QTZA 3JQ9C 3SYTA 3U16A 4EJSA 2LVBA 4IFIA 3PUJA 1ESDA 5DN9A 1P1CA 2VJMA 2D06A 2YQZA 4HNHA 5LDDC 2XB4A 1C50A 2VT3A 3IAM1 2FPWA 3P9SA 1Q12A 3CZCA 4Q9KA 2QTWB 1TYEB 1NW5A 1C2YA 4MKFA 5KZMB 4RMHA 2JKYA 2PWPA 1M7GA 4V2UA 4I66A 2RGYA 1JE0A 2EQBA 5DKFA 3DDSA 1HGXA 3UJ6A 4LRTB 4Q9JA 4M87A 4KAXA 2VHZA 5FUMA 1VXRA 5IF3A 1ETHA 1RJ9B 2P9JA 3DF7A 1M2HA 4KXVA 3FPSA 2CV2A 1XL1A 3MRTA 1MX3A 1NNLA 2FJUA 3IUQA 2LP4Y 1XD8A 2WU8A 4EHLA 2IS2A 2ZVPX 5K0GA 2C9CA 2QR2A 1CRLA 1DJLA 3NM6B 5LZ5A 5CAEB 3R5HA 1NF3A 4Q34A 3GEEA 2EL7A 2PMKA 3G9ZA 2GHRA 1J33A 1PS9A 1QDEA 1YU6A 2M32A 3DZFA 3M5WA 4BP9A 4LXTA 6Q21A 5AFSA 5JXIA 1OFGA 4PLYA 4FWTA 3VTZA 3TI9A 1DXOA 2WI8A 3V1YA 4IX9A 1RWMA 4DTIA 2PLNA 4YGXB 1X70A 2Z4TA 3TQIA 1CDZA 3DULA 2V1UA 4KQHA 2Z95A 1OOEA 2H3HA 2VF2A 3FMGA 4DA6A 5CB6A 4ZFNA 4HDRB 1BHQ1 2O2SA 4KAFA 1WB9A 3N2KB 4NBRA 4TQUS 4Z8XA 3R74A 3L7LA 3B1YA 4HYEA 1YBFA 5KX5B 5ICGA 4AP9A 4BNGA 3AGQA 1I3CA 1RDFA 2A7QA 3JQ6A 4WE3A 1VMKA 4XUCA 4EJ2A 1UXJA 5UKDA 1WV0A 4EW2A 5HZHA 1DMRA 3C8UA 4XGQA 1NIJA 2W2VA 2Z43A 1Y98A 3C6BA 4NH0A 3SICE 3A4LA 5CG2A 4FMCB 4IDEA 1VPLA 4JI6B 2RIRA 3QKRA 1SAYA 4GRIA 3FTDA 3G5AA 1WF3A 1KHHA 2W2PA 3ABRB 4NVRA 5BSWA 1AUXA 1YQXA 4WKNA 3Q2KA 1N92A 4QLOA 4JOQA 1O4VA 1HYEA 5AVTA 1FFEA 2CXNA 1VSUA 3RI3A 3KHKA 4E2WA 1CR2A 4DRYA 3HCNA 2J0QA 5KYKA 4ZT5A 2JF0A 5IBQA 1T4BA 4F9EA 2OK7A 1RJDA 2YHBA 2B8NA 3FFBA 3HR8A 3LCCA 2C2XA 3FFWA 4OK3A 4EHHA 5IT5A 5LQKA 1F1BA 2X4LA 2WAYA 3HV0A 1TXGA 3LRTA 1DI0A 5GONF 2C4MA 1EYZA 1ZUD1 1LTHR 2C82A 1Y82A 1DBWA 2I4IA 4FCCA 3TWOA 2ISQA 2ORED 1RQLA 1F6WA 3DBHB 3HS3A 4HN2A 1F20A 1WB4A 4OV6B 2QZ4A 2HMWA 2P4EA 3IE1A 2WE7A 3GUUA 3HL0A 5FLKA 5IMBA 3GMIA 4DUPA 4QYWA 5CYGA 1ZJYA 3AEUA 4GUAA 3TW8B 2O8EB 2HJGA 1COWA 3OFVA 4MQEA 4H9GA 4LE0A 3HJCA 1ZKDA 4QGHA 3BIJA 8MHTA 1E92A 1WXDA 4OA8A 4HOYA 3AG6A 1M8GA 4WNAA 4Q6BA 5ADUS 3RASA 2G70A 1BDIA 2Z2IA 1XMQB 3W9YA 3TLAA 2DPHA 1MB2A 2H63A 3F98A 1RPNA 4PY2A 1U8FO 4QFCA 5JZBA 5KEIA 2H1FA 4MV1A 4Y3UA 1YJQA 5ITZB 3OX3A 5IZCA 4RKYA 2Q3JA 3K96A 2HNAA 1UBMS 4GOKA 3VKWA 4URVR 3P4XA 2VPWA 4TRRA 1KMHB 3IB3A 2O1EA 3AFGA 3QJYA 5EUCA 2VUIB 2CJXA 5CAEA 3I1IA 1JR6A 4DR5B 2PLWA 1IBCA 3WIOA 4I5EA 2EKZA 1T2AA 1SUPA 2JH9A 5KJFA 1JTEA 1HZZA 4II2A 3IKTA 4GP9A 1FYEA 2FEXA 3D8SA 4Z4EA 3WLAA 1EWRA 3PKJA 4QXOA 1T36A 3NFYA 4UEOA 1GQOA 1TCBA 2A94A 3CEJA 1NJGA 3MGAA 3ODPA 4QWMA 3H86A 2PD4A 4LWPA 1BVHA 1R0LA 3RJZA 2XMQA 1N1GA 3BMQA 4TLLB 2QRHA 3IJ5A 1YRHA 2ZM6B 1EWQA 3B8EA 3LYAA 5JDCC 3ZBPA 4OGLA 4M86A 5FCDA 1GZ7A 1TVEA 4KO2S 3HCOA 4DZRA 1A4IA 1C0EA 4AFNA 5EVCA 3JX9A 4Y1FA 1ZIPA 1Q19A 4DSAA 3V4RA 2UUPA 5BSTA 1XYGA 2NYUA 3RABA 5E7IA 1CLEA 1T8UA 4HNTA 3N0RA 5K3FA 2TSYB 2NUAB 3WMXA 3D7KA 5BWCA 2HYIC 2P6RA 2X40A 3AR3A 3VVCA 3PXBA 1MDFA 1F2UB 4DPLA 1Y5RA 2OCBA 1IFXA 5BT8A 4RZQA 2PS9A 2ZWMA 3Q7RA 4X7RA 1RE1A 4B3BA 2YFYA 1TZMA 1HWYA 3GARA 4ZO7A 1J9ZA 2E1RA 2GCNA 4IVNA 1FFHA 4U5XA 2Q49A 2WE8A 4BNYA 1X9GA 2AQHA 4ZANA 3T5BA 2XRFA 4MAAA 1V11A 5AJHA 4NBKA 1VYTA 4CV3A 4N0EA 4WXHA 5I7HA 1TTTA 1PJCA 5AT1A 3SKVA 3HLKA 5KTSA 5AWFC 4OHFA 5FL3A 1EHCA 1RXEA 1XZIA 4KQ1A 5IANA 2ZRIA 1BWSA 3O3CA 4CG0A 3AJ9A 1P0MA 1T2EA 2RCYA 4CWAA 4UJ3A 4X1OA 3HRHA 3AJRA 3H99A 4N7BA 1O0SA 5CLQA 4BRZA 2O5RA 3AM1A 2NTNA 4LXIA 4BE7B 2CF6A 1SIBE 4JJ8A 4DDVA 1ZCBA 3NXKA 4FGUA 4JXXA 3DTNA 2C9YA 5I8ZA 2PGJA 3GG9A 2HK7A 2R66A 2GD1O 3AT1A 2WIBA 2JCXA 2QAGA 3Q7IA 3VSEA 4CQMB 3NM4A 4B40A 1WUKS 4CI0B 4CEHB 3DM9B 4MCAA 3IP7A 4WJZA 3QA3E 4B6FA 5NLLA 4MV4A 4BDSA 2E5WA 1N7GA 2WWTA 1WDLA 5BSMA 5B6PA 2XYVA 1ANKA 1BFUA 1RT9A 1V9SA 4JLJA 3ZI7A 5CM8B 3FCEA 2IXEA 1QIKA 4BEJA 3D4PA 4AURA 3LPAA 1YDHA 4F92B 3HDHA 3ORRA 3RB8A 5ITZA 4FMPA 1UDXA 4CN8A 2ZREA 4C7MA 3PHBE 1JDVA 3S2SA 2A33A 2BD0A 3T7IA 5JS2A 2VYFA 2AL7A 1T5BA 3OEWA 2H8GA 1VGRA 4TXMA 4GR9A 3SLRA 2G9VA 5KSPA 2PRKA 4ER3A 4D57A 3DZCA 3W2FA 2HJVA 3G0BA 1EWVA 3CPJB 2I55A 3OTWA 1QMPA 3UPTA 2PVSA 1TMKA 3ZK8A 4CKBA 5I5EA 1VJTA 4DLPA 3EPPA 4DXAA 3RSLA 1UMDB 1HA3A 4IJUA 4M6WB 2OCKA 2ZBUA 4QGBA 5AKJA 3VPCA 8ADHA 4IDGA 1RWPA 1L5HB 4LV5B 3BXFA 3NAQA 1VCIA 1M76A 2CEKA 2IIBA 4Q3BA 1R9JA 4PSDA 5CVJA 5E1DA 3ZIAD 3BRSA 4D4HA 4G5SA 5B1YA 4V1CI 5CD1A 2XYHA 2CJWA 3WMRA 3RODA 1QQTA 2O4CA 3X1MA 1ZI8A 1W25A 5CDSA 1VRVA 3ETDA 3LLMA 2RAUA 2XNHA 4LZAA 1F17A 3WLKX 5TX7A 3L40A 1QX4A 3K9NA 3NHUA 4GM0A 4X8OA 2DJIA 3O90A 2A5DA 4RLHA 4EOGA 2C2KA 2O2EA 4FLMA 1IDN1 3R7BA 4B75A 2J5QA 2DPMA 3NP9A 5KVAA 3CZ4A 2AD1A 2PN1A 2VF5X 4YDRA 4M36A 2HA3A 4DZTA 3A27A 4QOEA 3AF5A 5BRNA 4BV3A 1BYIA 1EP1B 1DUSA 1S8AA 1UODA 3LUHA 1J8YF 1SA0A 2A30A 3GGPA 2VXBA 3B89A 1QH9A 3CA8A 5LZ9A 2DFKB 1YRLA 2D8MA 4INPA 2L2QA 5FJIA 3VR5A 4AUNA 5FD8A 4D3FA 1PJQA 4E2FA 3DVAA 4RNDB 4MKXA 1CUFA 3MHPA 1CG6A 5EE3A 4D42A 1H3FA 1QOPB 4AY6A 4TV8F 3QVSA 1FJXA 1DZ3A 1MFPA 4AO8A 4RENA 1YS9A 1DO8A 2XZTA 4R83A 5DBOA 1E77A 1RMQA 4LNAA 2PNJA 1O03A 1C9MA 4CMKA 1CR0A 2Q3CA 4PZLA 2G4VA 3EY9A 4JLOA 5DT9A 2PSSA 4CN9A 1WZIA 3RM3A 2PR7A 1Y3IA 4HYTA 2Z58A 3FCYA 4PX9A 1RI3A 1FNNA 1L7BA 5H02A 3U3KA 4FMDB 3UJ3X 4B2LA 3WB1A 5F77A 4E6EA 1Y8RA 1P7PA 2XGOA 4ZI2A 4YJGB 5JBIA 1F8YA 1QV9A 1R3DA 1U2EA 4BC0A 1KZ6A 3PFGA 4TSFD 4XA8A 1CVIA 1ZNWA 1T5OA 4OAOA 4TKVB 1PSWA 3IQFA 5K6AA 1L3BA 1RRKA 4GDMA 1C7RA 2J9FA 4KN8A 3B9BA 4WT7A 5TJ9A 3THWB 1IVSA 2EG9A 2QSZA 3DLAA 2QVZX 4FILA 3U6BA 2X4GA 2HF2A 1QGAA 3VJKA 3IPAA 2UYCA 3HYCA 3I9NA 4Y6SA 3C1TA 1PWHA 3MD0A 4IMRA 1OTHA 3H4IA 4KYTA 1V9LA 2P78A 1KJZA 5K5EA 1FQKA 2J9XB 1KRHA 4UARA 4BRWA 2YUTA 4TV9F 3LVBA 1AXRA 3PFBA 1UDAA 2R6GA 3EUFA 5DM70 2IS4A 2BM8A 1Q15A 2QVCA 1E96A 2P4UA 3JQFA 4R1QA 1ID8A 4LS3A 2GDJA 2P27A 2YJ5A 3IAUA 4NCIA 2VOJA 3ZV7A 3EZNA 3U81A 1I2CA 1NN5A 1W0CA 3RBAA 3LMKA 4IJKA 1NXTA 1QZUA 3U4DA 4R2MA 1GT6A 1TIKA 1ZC3A 2XMCA 2IW1A 3HY3A 3RUHA 4G0YA 2HWXA 2ZETA 3BHIA 2QDKA 1G2OA 1UMKA 4JIGA 1ENPA 4X6LA 3JPYA 4EYOA 3O7WA 4G0WA 1ORDA 3LQ4A 2WF9A 1L6IA 4LRSB 4QJ5A 1FLNA 2B6HA 1TA4A 4IGIA 3HSKA 1CZNA 3ND8A 4Y6PA 3LBNA 4YP1A 2NIPA 3WGNA 2J7PA 4GQIA 3UXYA 2CGEA 3F7MA 3VR4H 3WRXA 3R7AA 4CDNA 5GV8A 4F5YA 4X3OA 2Q5IA 3FH0A 1UR5A 5EQTA 2WYIA 3V1MA 4CKZA 3A6FA 1QHHA 2C5FA 4J1TA 1M8JA 1V25A 4ZAGA 5KOIA 3BGDA 2UZ1B 3K4PA 3C43A 4I81A 1HYGA 1MOPA 3V8MA 4J6EA 3GJRA 3CS3A 2QS9A 4LRUA 3R2JA 5FLEX 3HSYA 4RTQA 3I9LA 1G20E 1H5NA 1G5FA 2MINA 4ZO4A 3TEFA 4Y0VA 2DH6A 3KOUA 1NFQA 1OFTA 5AK0A 2VZ9A 1DNPA 1U8XX 2BGUA 4HDQB 2PUDA 2NSYA 3EG9B 1WCV1 1B00A 3FWZA 4JA2A 3TX2A 4P0PB 2VJNA 1KJNA 2OLKA 3B2EA 2I78A 3NIWA 1RBQA 3EXFA 1DXYA 2H52A 5EHZA 1J23A 2E82A 2O8VA 4JVSB 4YMTA 3DXYA 1IAVA 3GIWA 3OZFA 1SUFA 2HDWA 2HSGA 3PYLA 1FP6A 2FWNA 2NAPA 4HTAA 5AD1A 1YA4A 3CKMA 3H9CA 1GNPA 3DHEA 3H11B 1SVLA 3AETA 1W5FA 4AP5A 2PH1A 2LRHA 2HSJA 2V7XA 5LC1A 1GZUA 3CW2A 3MJRA 3M5PA 4MR7A 5EMMA 4L6AA 1J97A 2IQIA 3CLVA 3OEYA 3LVFO 3K6JA 4GZ3A 4BX2A 1ULTA 5GZ1A 3FOCA 2JLVA 1VHLA 3AEKB 4OJKA 3SFVA 1QQAA 1GCGA 2YTZA 3B7GA 4X1KA 1A9XA 4J7CA 4ALNA 4FMCF 1N2XA 3FDZB 5JWHA 1I4TD 1FP4A 3QTLA 3C45A 4A6EA 2IEAA 3KB6A 2G28A 1Q3KA 4P7FA 4IRXA 2B4RO 4FP9A 4ER5A 3GVPA 5LDHA 2OZVA 3HEAA 4HLDA 1CU1A 4GSLA 4HT3B 2OUKA 1RABA 2HAEA 1PU2A 4FNMA 3QBDA 3R9XA 1E1RA 2UYOA 5JALA 4YYEA 1Z28A 5TEWA 3EPHA 1Z6QA 3DAPA 3CEAA 1JHQA 1GAQA 4V0MA 2OT3B 3ZXSA 4BQEA 5DW3A 3PQ4A 5GONB 4A23A 3OH8A 5EGSA 1TD1A 4IO0A 4EVRA 2QD5A 2J0UA 2YZ2A 2G36A 2EW8A 4K8OA 5JFTA 2DBYA 2J7KA 1ONSA 5TIIA 1H2BA 3SVLA 3SR0A 2LKCA 1OT3A 2B5VA 4D9GA 1ZN7A 4H31A 4I14A 4L95C 1Q6YA 1RXVA 1XXHA 1ZICA 4F3YA 1E1QA 4QQKA 3UKJA 1BE0A 4PC2A 2B7LA 1ISFA 4Z7JA 2OCXA 3IULA 1UKCA 2G5CA 2AOXA 1SURA 3E3NA 4H0CA 5ELLA 4LJ6A 3V34A 4DY4A 4A10A 4EIWA 4QBFA 4GZ6A 1O95A 4JI4B 1QH8A 5IYZF 1E3JA 1YL5A 5FUVA 2HQOA 1PNQA 2CVHA 2JHGA 2BRUC 2L18A 4MW0A 1XDUA 4G5XA 5CEEA 3VHXB 2P11A 1II8A 2Q2WA 4KPUB 1H8HA 5ECYA 3FCAA 4C0XA 1HQKA 4CT0A 3KLMX 3QWFA 5JMPA 4XIGS 4LXUA 4ABYA 2XZOA 1AQLA 1AGYA 1F4VA 3FR7A 3N75A 1UKZA 3T1VA 1ZX1A 1E1QD 1XHEA 1XUOA 4LRXA 3UT0A 2FR1A 2HC9A 2XDYA 2AWOA 3H4TA 5F7XA 2I2XB 1NC1A 1RSZA 3MTQA 5DTIA 5KTOA 5L4NA 5DEIA 2Q3EA 3GEIA 5A05A 3EBOA 2BHLA 2PX0A 4HLNA 4IBOA 5F3RA 2F7SA 2ZB2A 3JS5A 4NYJQ 5JZMA 3H7IA 1HG1A 5DX0A 3HP1A 2PHZA 1UKAA 2HOQA 1C29B 2ECFA 2P65A 2YJTD 4HBZA 5DM60 5I9NA 2G80A 3PPVA 2FWJA 3DUFB 1Q57A 1YJXA 4IDPA 3I6ZA 4URFA 2AF3C 3QVXA 3GT4A 4MUEA 2WHQA 5KAPA 1N9KA 2OHXA 2PFGA 3DB1A 4J0EA 5I9BA 5E2BA 3OFJA 2VKTA 5JVDA 3JQBC 1JFLA 5AUQA 2WTUA 4PQGA 1QV6A 4IUDS 4FE4A 5L3RA 4OO3A 1SUBA 3M1LA 3I4LA 4YXFA 4CKWA 5FAKA 2H2DA 1NX9A 1SC6A 1PJZA 3CGGA 3FNFA 3M6AA 3PDUA 4NOLA 3ESZA 3IEKA 1WIWA 2XXJA 2JAQA 4YRGA 3CC8A 3GFOA 5TR9A 3S6JA 4EVSA 2AA3A 3G1UA 5IDQA 5E4TA 3K1JA 2OSBA 2X3FA 2J3HA 2PIAA 2CLSA 1KZ1A 2VUTA 2ZITA 1OWPA 4J76A 4YP9A 3FYDA 3EGXB 1SD1A 4IV5A 3CCCA 2IPAB 1XZBA 2VO1A 1UWKA 2I7DA 3LK7A 1REQA 3G49A 3H17A 4QUKA 4X6YA 5AVJA 3ZHVA 1QTIA 1X3LA 2C94A 3QFSA 4NI5A 2H5EA 4NONA 1H05A 3PF8A 3IMGA 2IP2A 1AD2A 2O7QA 3BWVA 1KJWA 1QVVA 5DK6A 2K5UA 2R5FA 2IF0A 2PA3A 3K35A 4ZOLF 3FNQA 5DFAA 4BO7A 1XCBA 3HACA 4YECA 4BV8A 1WUHS 1Y1KE 3AFOA 4Y2UA 4H60A 3ANLA 4RPLA 2V0GA 1U6IA 2F8SA 1DWUA 1I7SB 3ECSA 2VCYA 4CM9A 5F5XA 2LCIA 3IQEA 4ES6A 4MGYR 1WG8A 4K9QA 1OFVA 4QULA 4PZYA 4C07A 4K05A 5K45A 4IYJA 1EK1A 3DL4A 1PL6A 3KE9A 5F9MA 3UOAB 4BVKA 3IDQA 2JFOA 3K16A 5D1NA 5LL6P 3T3PB 4LYGA 4AF6A 4RVHA 3B6EA 1C2TA 2O1SA 4M8SA 3IAAA 3KQHA 1MW8X 2OLJA 1YDGA 1E9EA 4NBVA 3KJFA 5BMVA 3RVNA 4V1CB 5KWSA 3MSCA 1QWSA 4BCCA 4BP1A 1GPUA 5JCJA 1IXKA 2C3MA 4FGKA 3LBHA 1U9ZA 4NJEA 2XNDD 3CJRA 4N47A 5A9RA 3Q8XB 3I8SA 1WHTA 1JQ3A 1EAYA 1PG5A 1UM9B 1VA4A 3ENVA 1L4GA 2JBAA 3U4IA 3SE0A 2PQ6A 1A7JA 2INGX 5C5IA 4POAA 2O8CA 3E9DA 4JI0B 3MC1A 4DJJA 2QUHA 1D6SA 4NBWA 4ZV7A 3HFRA 5IXSA 2O54A 1IBRA 4PRZA 4WNIA 3D8BA 4CMGA 5CBPA 5AW0A 3TJRA 3AIMA 3STHA