5K9KA

Crystal structure of multidonor hv6-1-class broadly neutralizing influenza a antibody 56.a.09 in complex with hemagglutinin hong kong 1968.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
229
structure length
226
Chain Sequence
QVQLQQSGPGLVKPSQTLSLTCVISGDTVSSNRAAWNWIRQSPSRGLEWLGRTYYRSKWYTDYAVSVKSRITITPDTSKNQFSLQMKSVTPEDTAVYYCARGSAMIFGIVIILESWGQGTLVTVSSASTKGPSVFPLAPSSKSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vaccine-Induced Antibodies that Neutralize Group 1 and Group 2 Influenza A Viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords 56.a.09 Heavy chain
total genus 32
structure length 226
sequence length 229
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5k9kA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5k9kA01
3GUTA 1JGVH 5DI8A 2BC4A 3B2VH 4UB0L 3Q5YA 4LSTH 5CJBA 3DURA 1J0JA 3C08H 1YEGH 4RA3A 3FFCA 1NUNB 4IRZH 5L88H 4MD4B 1AD9A 1YC7A 1QHPA 3D3VB 1A7QH 3SPVA 4HKXA 2WIIA 2L4OA 3SQOH 2DI7A 1YMMA 3RUGB 3JTTB 3HMXL 4OZGF 4G9FA 5BJTB 2BSTB 2B1HH 5F88A 5FHBL 1A7OL 1EV2E 1T83A 5KW9L 2V2WA 1RVFH 5GZOC 4K7FA 3VXTA 3HUJB 1VFBA 2BOCA 4FN0A 3PABB 1K85A 2AKRB 3RA7L 4ZDHB 3BSZH 4R8WL 3WJLC 5ACZB 3SE9L 2IGFH 3UTSE 3RFZC 3GHBL 4JRWA 4FQHA 2X4TA 4OD3H 3LQZA 3MZTA 4XH2B 4NQDE 3AREB 2AJVH 4UILH 4X6EB 4I1NB 3VXUE 5I1DA 2PYEA 1U8KA 2WQRA 3FQTB 1A5FL 3CDGA 4QXUH 4UV4L 4UIKL 1F4HA 4KJPC 1TMCB 4XVTL 4HC1A 1BEYL 3NFSL 1TTUA 3CXDH 1OCWL 1SBSH 5J1AA 1BFOA 3ROOA 4ZSOE 4JN2A 3X17A 1A1MA 3TO2B 2H6PB 1JTPA 4I18A 3DVGA 3JUZA 3HMXA 5GPRA 2GTZA 3ZE0E 3I50H 3MRIB 1NEZA 5E5UB 3WLWD 2NY4C 3D2UA 1I7TA 1UC6A 1OGTB 2V7NB 4BQCA 1KJVB 4Z7NE 5C0AD 2F58H 1N64H 1N5AA 2B1AH 4QXGL 2E9WA 3O9WC 3FMGH 4HKBB 1OSPL 5EBMA 1QPXA 1FIGH 4XPTH 3FO2A 3WD5H 4UV7L 3GIVA 2X10A 2I9LA 3QWRA 1JV5A 3RWHA 4LRIC 1ZGLB 5FGSA 4J8RB 4EN3C 4ONHA 3ZKMC 4E0RB 4OCMC 3EGSA 4GAYA 1CE6B 3S3JA 4XBPB 5T1DH 5DSCA 3LQZB 1MY7A 4WHTA 4CDGC 2JJSA 2ERJC 4XP4L 1OM3H 1B3JA 1HXYA 4TVPD 1GGIL 5AEAA 2G75A 1UEMA 3HUJA 3BW9B 1XIWD 4LGPB 4HWUA 1C12A 2Q86A 1HH9B 2AEQH 4PJBF 1KEGL 3FMGL 3P77B 3HI5H 5BJTA 1JZ2A 2FX8H 3KR3H 4HUXA 2EZ0D 3CU1A 1WZLA 4QOKA 2LFGA 3RBGA 3DXAE 3D3VA 3F65A 4MJIE 5J57B 4KXZI 1VEOA 3BH8B 5GGSA 1DP0A 3HC0B 1H8NA 2D4DA 3G9AB 4LLVA 2R0WH 4P5TD 1PGRB 4NBZB 2X4QB 4OGYH 5MHSD 3GUTB 3ILPB 2VH5L 1BREA 1HIML 1UWXK 3BP6B 1S5HB 4XHJD 3NIFE 3QI9B 3E0GA 4I0PA 3H9SA 1CL7H 4RGNB 5I1JH 3ZE1F 5IGXL 4CMMA 5K9OA 1IQDB 4TULH 4IHOA 3DBXB 4I77L 2C26A 1A7NL 4OLVH 4WWID 4X5WA 1C08A 4UT9L 4D9LH 3RWGA 2AERT 5D2LE 5DRXB 4YWGH 3KJ6H 3I84A 2BRQA 3REWB 4PGCA 1N5YH 3EOBB 3PGCA 4DUXA 1OF2A 1UADC 1U2CA 2OSLB 3MBEC 4L4VD 5JOEA 2BSRA 4GMSL 2DJ4A 5DRZA 2OI9B 1IGMH 1QFWL 1SJEA 4JY6A 3SKMB 1AR2A 4Q2ZB 4ETQA 2R15A 4S11A 1P53A 1YMME 3BE1H 4M3KB 3HG1B 1UB5B 2AJSH 3CDFA 1NJ9A 2GJ6E 4X6CA 4V1DB 1NFKA 4O2EA 4O00A 3G5XB 1I8IA 5DHXB 4K94L 3UJTH 5E9DA 1CI5A 2UVEA 3O4OB 1EFXB 1EEYA 1F6AB 4WUUA 5DRWB 4OKDA 4NNYA 1IILE 3OBAA 4BQ8A 4GBXB 3FB7B 2E6JA 3O8XB 2IQ9L 3C6LD 4XTRD 4FQJH 4MJ6B 3TT3H 1ZGLM 5GGVY 4QT5A 1MFBL 3PWLA 1OB1B 3IJHB 5C09D 3D69A 1MF2L 4GAJL 3BKJH 3FN0H 4I3RL 1RU9L 2AJUH 5EO9B 3TBYB 2UWEE 4XVJL 1CG9A 1SYSB 5ICZA 5CKGA 3GSQA 1DQQA 4YHML 2A9NH 2N1KA 3VRIA 4RBPH 2D0GA 2FX7H 1OSZA 3E6HA 1PVHA 3LD8B 4ZAKA 3K8LA 3N0PB 3ARYA 4DN3H 1IEAB 5LWYL 2D7TH 4KVCH 4C56D 2V5TA 1A7QL 5JPNB 5HGDA 1MCEA 1S7UA 3OR6A 5DK2B 4WWKA 5KSBB 5DA4A 4M6AA 4IMLA 1JN6A 3RWFA 4XNUL 3OF6D 5TGBA 5BZDA 4MS8C 4ZPVB 1AP2A 3C5SB 1XGUA 5TDOB 4AENB 3RX7A 4JM4H 1WFOA 5MEOB 1L7TH 2V9RA 2OX5A 3ZKMD 1RURH 4GMTL 3I75A 3E2HB 5IHBA 4UDTB 2VLKE 5IMOA 1A1NA 4NQDB 3RDTD 5J4MA 4E41E 5EBLB 1N59A 2VABA 2NX5B 2EYTA 3LKQA 2WINB 3JV6B 4XCCL 4X4YB 1RMFL 1ONQA 4X99B 4D0DB 1UZ8B 4PJ7F 2M2DA 1XCQA 3WDJA 3VG9C 5MENE 5DVKA 2EH8L 3CVHA 4U0QB 2DRUA 1N0XL 1XIWA 3P4OA 4FNLH 1RZGB 2Y7QB 1HHGB 5CJXA 3L5XH 3CFKB 4F7EB 5HD8C 3MV9D 4M62L 2IMNA 3FQNA 2VLJA 4Y1AD 1TNNA 1S9YA 1N6QL 3OV6A 3EYUH 2H32A 3OXSA 4YNYB 4OBSA 1FIGL 4JPVL 4LLDB 3MLUH 2YD8A 1VHPA 3DO7A 5D2LB 1AGDB 3MA9H 1U41A 2ADIA 2XNAA 3GEWB 2YD6A 3LS4H 1BQSA 2HJKB 5FGCB 2FX8L 4GRLC 5A16B 3U46B 4PGDB 5ACMA 4EDXB 4LLQA 2BOBB 3ALXA 3F58H 4KRNA 5CKAA 1S7WB 5B22A 4KKBD 4IIQA 5KN5A 5HDBE 2C7UA 4XCNA 3TT1L 4GQ9H 2CUIA 3CVHL 1N0XH 5IMMB 2AP2A 4OGYL 4DKEH 4HQQL 2CXKA 1FG2B 1EHAA 2EXWC 5CZXC 5SX4I 5CMAB 3KPNB 4OD1H 4HX1A 2IAMA 2BP3A 5IQ7H 4Z0XB 5M95B 4UIKH 1F42A 5ID1A 3NFPA 4ZTOL 4L5FH 1FGNL 3PGFH 5SV3A 2RQ8A 5DDHB 4UBDC 1DDHB 3ECBB 3WS6A 3UDWA 4EXKA 3FB5B 1HHGA 4GKNB 1JNJA 4HIHA 1T0PB 2QSCL 2VR4A 1KLUB 4PJ5B 5IVXB 1FYHB 3O6MH 2NTSP 5SWZB 4ZUVB 1MPAH 3UZEA 2JB5H 4XMLL 1KT2A 1WT5A 4OCRL 1FZJA 3TA3B 3J8F7 3SDCC 2FEDC 2H1PH 2ZOKB 3FL7A 1A6PA 3NZ8B 4L9LC 4FP8H 3NCYP 3SHSA 2ICWB 2H26B 4WW2A 5FM4A 3ARGB 5FHAH 4W70A 3WUWB 3KLDA 2P49B 3STZB 4OCSL 4ZS6D 5EPMA 4P2QE 4OLYH 3SKOB 4OD3L 3BGMB 4NQVB 1RAMA 5FM5M 1UFUA 2R23A 3NVQA 4MMZC 1VADA 3Q3GB 4YHIB 2MPAH 5HTSA 4JY4B 4G7VL 4BFBD 4JKMA 3B3IA 3MLRL 1HHJB 2DIBA 4LLYB 3TH3T 2JIXB 1RZKH 1FYTE 2ITDA 3WKMH 3DTXB 1SVCP 4KMQA 5DS8B 3W5NA 3FRUA 3W5MA 4MD0B 1H0DB 1GGBH 5FK9A 1J1OL 1I1FA 1L7TL 3RP1A 4CN1A 3RIFF 4C4KT 1AKJA 4MQSB 1R24B 4X6DE 2IFFH 3BAEL 1LD9A 4EDWH 1MHCA 3VFPA 4ODTH 3F7VB 3UO1H 4RGND 4DQOL 1JRHI 3H6JA 1NANH 5ICZB 4P2QA 3TPUA 3WNPA 1CG9B 2F5AH 3VFUB 4LVNB 4UOW1 1PQZA 2NY4D 2VE6B 4H20L 5C0JB 1FFNA 25C8L 2V2XB 4KQ4H 4DKFL 4GKSB 3CVIL 4JHAH 1JYVA 4ZTPH 4IRSC 4O02L 4ODUB 4HBCH 1FVDB 4KKLC 1MI5B 1T6WA 4U1KA 4WFGD 2FO1A 4N9OB 1U8IB 3ES6A 3RUGF 4HLJA 3O3BA 5KSUA 4MAYA 3PWNB 3EYUL 1F11B 4OGAD 1I8IB 3CSYA 4UTBH 2DTML 4OZHF 3DUUA 3EDDA 3VW3H 5D5MB 5DEGA 1PZ5B 4X6DA 2XY2A 5JQ6L 4GRMB 1ACYH 4X9GA 3KR3L 4KUZL 1NL0L 3VRLF 3GMNB 3OKYA 5DRZB 1RUQL 2DTMH 3ARBC 3TIDB 4OM0H 4L8SB 3QXTA 3SGEH 3K80A 1F45A 4M7LL 4X6CF 1HH6A 5HVHB 4TPRL 1EAPA 2DMCA 2BVUA 5IJVA 1N0LA 4M61A 5FYKE 1AGBB 4WNQB 4HWBA 4QHLB 1XGYH 4X5WB 4XCCH 3WNMA 4JFFD 4EUPH 4R96A 2KKQA 3VXQB 2VLKD 4P2OD 4BFEA 5SWQA 4Z7VE 3NIDF 5ACLA 4DAGL 5BW7A 4CN4A 5C0AB 5E8OA 1I8LA 2OP4H 3IFNH 3RVTD 2FECL 4FXKB 3DIFA 2IPTH 5E2TH 2HTKD 5LCVH 1EX0A 3TFKC 1FPTL 4JRXA 3STLB 3CD4A 3DX7A 1H15A 3FB8A 2B4CL 1C8PA 4I3RH 3BKJL 2W07A 3OXRB 5LAXB 3CFDB 4B7IA 1D6EA 1MELA 2PXYC 3L1OL 1FNLA 3S88H 1Q8MA 5E8EB 5IG7A 4QHUA 1A4KA 5DRNA 3QNYA 1HSAA 4WI4A 4JO1L 3CUPB 5KTEL 1I7UA 1T5WB 3ARED 5DUBA 4AM0B 4HS6B 4LSUL 3BD4A 1K2DB 2GJ6D 5IR1A 1S9WA 3BP5B 3DYMA 1VGKB 1QA9B 1R0AL 4R7DA 1X7QB 4DGIH 4J1UB 1KGCE 2PO6D 1HQ4B 1NC2A 3QUMH 1EUTA 2BK8A 1IGIL 4TSAL 5IMKB 5C3LD 1QBLH 3KYNB 1KPRB 1IAOA 3RNKB 1I9RH 3G6AA 4OQTL 1KEGH 4I2XE 4CU8A 5JNYA 2HN7A 2ZCKL 4Y5YB 3EGSB 4Y5YA 3HR6A 2VQ1A 4HGMA 3CFBB 4YHZH 1CIDA 3QULA 2JJTA 1JFQL 2EDQA 2ZNXA 4RFOL 4D9RD 5MERA 5DFWH 3AXLB 1DL7L 2WUCH 3OGCA 4NZRL 1KXQE 1MIEH 3KPRA 1ZGLA 2JJTC 3GSOB 2VITA 4MVBC 1OAKL 3ILQC 4P23B 3B5HA 1IFHL 4GQPH 3VXRB 4P4RA 3RQ3A 4NKMA 3MRLA 1D5ZB 2R4SH 2ZCKH 5HYQA 5IB2B 3LRHA 2R1WB 4U7MA 2V7NA 2ZPKL 1OT1A 3UYRH 2X1QA 1PKOA 1IGTB 5DRNB 2CKBH 3WFEL 4JFHE 3NCMA 4LVOB 3CLEH 1QQDB 2X1OA 3X11A 5EWIL 4PUBL 1D6EB 3LS5L 3TO2A 3MZGB 4K3JL 2IADA 5I1GH 1A3LH 3L9RA 1O5DT 1BFOB 3OXRA 2CPCA 5D2NE 3VGEA 1S78C 4XMLH 5CIPA 3NZHH 3BGAA 4HKZB 4ZFOA 1C16A 4HKJB 3OX8B 2GFBB 5IB5B 4RIRA 5I8OH 3FQTA 5IBLC 4LSVL 1LE9A 4F7TB 3SDDA 2AXFB 5F1SA 3FQWB 4P2QD 4H25B 3MJ9H 5FYLD 4R0LC 3T2PA 1LE5A 3OKNB 2VQTA 5HHPA 5HSFA 2X9XA 4YQXH 4LSVH 4NWTH 4R4FH 2GY7B 4ZDHA 2QHRL 4MNQD 2DQUL 2MSPA 1SY6L 3PL6C 3ARGC 1B6UA 4XP9H 3AM8C 2DN7A 1JPGA 3W0WE 3F6IA 3GSWB 3MCKB 3CVIH 4CKVX 3LEXB 4J3OC 3N85L 1CCZA 3P4NB 5IOPA 1JYNA 1R3IH 3QIUB 5ERWA 1FORL 4O4YH 4X6DB 5DEGB 1CDCA 3HFMH 1G9NH 1XGPA 5FYKL 2EIEA 1HILA 4G6JL 1I3VA 1ODAA 4GG6E 3U0PA 3VFNB 3ES6B 1U8IA 3B9DA 3L7EB 4DCQB 4PJFF 2DLIA 2HWZH 1KTDB 2F74A 4R97C 3T8XB 3HI1A 1MCWM 4KPHH 2BXZA 2OBGA 2OQJB 4WENB 5I1LA 1XGTA 4MA3B 1JWMB 4YGVB 1E4WH 1R3HA 4LFHG 3RGVD 4NO5A 3R06A 1CXEA 5IQ9B 15C8H 1I9IL 4FQXC 3MRKB 1KCRH 5KZCD 1T1WB 1WBYB 2GAZA 3BGFC 2LU7A 3I9GH 4U1LB 5CEZL 1BAFH 5I75B 5EIVA 1KJ3H 5A1AA 1H9VA 3H9SD 3TBTA 3BISA 5BVPH 2XA3A 3C87A 2JCCF 1H8OA 4X7FC 2VZUA 2VXVH 3IXTA 2XWJA 5I19H 3CH1A 3NFNA 4FTVA 3R1GL 4MAUH 2R56L 4JJHA 5H2BB 4TNWF 1OTUD 1KACB 3A67L 4GW5B 1FFQA 3MLZH 4TSCL 1YEIH 4LBEB 4I3SH 2HKHH 1REIA 3QDGB 5FOBB 2LAGB 2WBJC 3GSNB 3L95B 2P5WA 5DQ9A 4G6KL 5DUPL 4I48A 3VXME 4I48B 5HHOB 2CMRL 2R23B 3VXRE 3MBEA 2GCYA 2R2BA 3IAPA 3B9KA 5F9WB 2W9LA 5EO0A 5K9QI 5F7NC 3EYOB 5IBUG 5T1KD 5IMLA 1BVLA 1NFIA 1O0VA 4I3GA 2GSGA 2R4RL 3MUZ1 4FMKA 4GH7B 5H2BA 4KROB 3T1FA 5F9OL 2DWEB 3M1BA 1DBAL 5B21A 4X80H 4BFGA 4QY8B 3K1KC 5DD0L 1N4XH 2EDOA 2CRYA 3BH9A 2AQ3A 5GZND 5LXGL 3GK8L 1ADQA 5J12C 4Y2OA 4QRPB 4V1DE 2LAAA 4R90H 1A3RL 4LARH 2R39A 4C59B 4MXVF 5KVFH 3ULVE 1KIRA 5ID1B 3V2AR 4NQDD 3RDTB 3VXPA 4W6WB 3OAYH 1QRNE 3VXMA 2BVPA 2OP4L 1A2YB 2F53B 3MFGB 4XB8A 3LRSB 3HE6B 4NQEB 4UV4H 1TXKA 3JTSA 3EIFA 4ZPTB 4S0SD 4CVXB 1UM5L 4PRNB 5F89A 2ZUWA 3BHBB 3UMTA 3WLWC 3HAEH 3TIEB 1V3LA 4X6FB 1TZGL 3KLHD 3CPLB 4YEFA 4DJMA 3VH8B 3LRGA 3MRMB 4ZXBC 5F7FA 3AY4A 3QIUA 1AIFA 5ERWB 4IBLT 1JIBA 1OW0C 2F54E 1ZHNA 3BWAB 4H1LG 2H3NB 4X7CC 3BZ4A 3O3UN 4Y8DC 3G5YB 3AY4C 4CAGA 4GLRH 4NZJA 2FIKA 4WRLA 4ZPTA 3PL6D 5D9SA 4RAHA 1G9ML 5DYOA 3T77A 3DRTA 4UV7H 1TCRA 2DLFH 3QXUA 3T0WA 4N5ED 4I0CC 4KXZH 3ETBF 4JFHD 2ITCA 3QEQD 1T04B 4QNPE 3H7LA 4EKXA 1EUUA 5HHPB 2AW2A 1LO2H 5I74B 1OARL 1R5IA 4MCYB 1NPUA 4LCYA 2AXFA 2DI9A 2R0LL 3RPIB 3ZDZE 2FWOA 4Y88A 1T03H 4QY8A 5DLMH 5JDSB 2GFBA 3KJ4C 3EHBD 2NR6D 1IGYB 2Q8BH 1SEQH 3V5HB 3RZCD 1K8DA 2HMIC 4GRWF 5BS0D 1OGAB 3WUWG 4Y1AA 4HWNA 5I1HL 2K3TA 5CSZB 5JHLL 1NDMB 2R2BB 2VDQH 1M7DA 3QJHA 4Y19E 1CFQB 1BM3L 5MEOA 3IFNL 4JM2A 2DL2A 3MACH 3WDHA 4LU5L 1BBDH 3GSNA 3L95A 5DQ9B 1KGCD 2XXCB 5DK0A 2RGSA 1BD2A 1ND0A 3L5WA 5KSBA 2Y72A 5BXFA 1R3IL 3OKLB 3ARDC 4KQ4L 3OR6B 4L1HA 2QADC 4X6BB 2QSTA 1IAIM 2CSPA 1NAMA 3SGJC 3VMOA 4RAVB 5F70A 2VDMH 5I8OL 2CUMA 3IXTB 1P7QD 1I9IH 4PRDA 1MI5D 1P4IH 4XBGB 2HT4C 1OTUC 4NQXB 3W39A 1I1YA 1Q72H 1CWVA 1NUGA 4QF1A 1F4AA 3EFFB 3T2QA 1CDUA 5DHYB 4QEGA 4K8RH 3QUMB 4TVPL 1FL5A 1VEPA 3KYNA 4PB0L 2QHRH 3ZKXC 2PXYD 4RX4D 2NCMA 1J05B 1EK3A 2D9QB 3ARZA 4BK4A 3UBXA 1OP3K 4KGJA 1DBKH 1RUKL 4G3YH 1CXHA 4JKKA 4X7TA 3T4AB 2P5WD 3UAJD 3D69B 4YGVA 1WEJH 4FZEH 4IS6A 2C1PB 4G8FB 1S9VA 3IDXH 1OB1A 5I1LB 1UB6B 3WHXA 4L3EA 3FFCD 2CK2A 4YUEL 1PG7X 2F74B 3BEVA 4LLUA 4NOBA 1K4CB 1WWBX 4DCQA 1U6AH 5E8EA 1KJMB 1T80A 4PGJA 5I8KH 1I7RB 5GS0H 3VXUB 1Q9LA 5GZNC 5E9DB 4KUCD 1WBZB 4DN4H 4MNGA 4JANA 1DBBL 2Q1EA 3V4VL 2DQEL 3V7AE 1JWSA 1FZOB 3U9PH 3NBNA 3FB8B 4X6CB 2X4UB 1K6QH 2FJFA 3CSBA 4UTAH 3UTZA 3CMOL 1J12A 4NM4L 1E6OL 5E7FA 3TZVD 5D71H 3HKFA 4TTDD 2X2YA 4LAJH 3O9WB 2VTFA 1MFEL 1TZIA 2QL1A 4KDTC 4ZUSA 2VLLA 3D87B 2ZKHH 1A1OA 4XX1G 5HBBA 3ULVC 2B4CH 1JF1B 1QOKA 5GS2H 2DOCA 3VXMD 3WN5A 1YYLL 5EFIA 2NZ9C 3BE1L 3EOAB 5FYJE 1JI2A 5AD0B 3JWDH 1HYSD 3WN5B 1DVFB 4XPAH 5D7LE 2MCPH 4PJCF 4P2RA 4CDHA 1L6ZA 3OKNA 3N1QC 3FT3B 4UZGA 1MAJA 3LS5H 4LIQE 1INEH 1S78D 1DLHB 5JOPE 1VCAA 2HRPH 4HEME 3SDAD 5FECA 3QUYC 4UTAL 5TDNA 1ZT4A 3UTZB 1MHPL 3DUUB 3U7WH 1MLBB 4J4PC 1CDJA 1F11A 2NY3C 4EN3A 4YLQT 1AHWC 5E2UL 2MKWA 1EJ6A 5JIIA 1K4CA 4U6XA 2JJSC 3S36L 4QRRD 4IRSA 5AAMA 1Q9WA 4R7NA 1YPZA 4B41A 3X3GH 1TTGA 1U3HB 3DV4A 3GMQA 2C1PA 2X4OB 3QO0A 4WY7L 1MWAA 1X5AA 5JA8B 3BW9A 3HS0B 1H5BA 4HK0B 4OSUL 5B39G 3UBXB 2I25N 2QQKH 3KPRB 2B1AL 5FYJH 5KVMC 4YBHA 3QNZB 5E2UH 2Y25A 1E4XL 5MERB 4OLWL 2YUWA 4LSTL 5K9JL 5DHYA 4J3XA 1MAMH 2YR3A 3TN0C 3QWQB 4YZFF 1JUFB 5LGHL 1G6VK 1AQDB 3C6LB 1FNHA 1XT5A 1KPVB 3INUL 4X4MA 2PXYB 3C8DA 4NUGH 5T1LB 4PJ9C 5F6IC 4NIKB 3V8CA 2XQYK 2NLJA 5JXAL 1JV5B 1RULL 1TQCC 3RWHB 2Z31B 4AEHH 4XVUD 2Q76A 5A43C 1QLRA 1NGYB 5DS8A 2FSEA 4GLRI 1RJYB 1RZ8B 2OTUA 5HYEA 3RVVD 4DN3L 5LWYH 3OKDB 2NY5H 5T33H 1B90A 1BD2B 5IVXE 1F58L 3VDBA 4TQEL 3G6JF 4JREC 4XI5C 3QG7L 1NEZB 1A4KB 2NY1C 3GO1H 4KK5D 1FNSH 1NH6A 1M7DB 4PJFB 4KRPD 3S5LB 4MNHA 5CSZA 2Q87A 5GGQH 1F2QA 2BHZA 2H6PA 4Q58C 4EI5D 2P5EE 4YUEH 4Z8FH 4PJHA 3WUWA 5GGRY 43C9B 5DURB 5D5ME 4Z0BL 4PGBB 1S5IL 3T0EE 5I1EH 1EA9C 2YUVA 5JDSA 4LSRL 1M05B 1C5CL 5FUZL 3WUZA 5IUSA 4X4ME 4RMQA 2PYEB 1NMCC 5ELIA 5BV7H 2CH8A 2UWEA 3RVXD 2YPKA 5J6GB 2AABL 4LCYB 1RZIB 1YECL 4L5FL 3AREA 3ZHKA 1R5IB 1FFOA 1DQDL 1L7IL 3ZKNC 1KCUL 4NDMB 1IBGL 1I3GL 5DZOA 4R96B 4BFIA 3N1MC 3TGXA 1S7RA 1FYTB 4C56B 5SX5K 2GTWA 1VFBB 1BZ7B 1ZLSH 3BQUB 4JFPA 2IH3A 1EAPB 4OCRH 3WJJA 4Z0XA 2MTPA 4KK8C 3OL2A 5T3ZD 4ODVH 1WITA 3KPNA 3RL2B 3MREA 4HLZG 3GK8H 4FZEL 3N9GH 4OLEA 3PQYE 4U1JA 2DLTA 4UI2A 3OKEB 5KS9F 3RY5A 1FH5L 4Y5YC 1XGRA 4FQIH 5GIRB 3ARBB 1OP3H 1AIFB 4D9LL 4IIQB 1EFQA 1A7PH 3MRCB 5D5MA 3TCXA 1S9XA 1F90H 3QAZC 4NYLB 4AQOA 3MRMA 4CN6A 5JHLH 4RMWA 5C0BA 5E1AB 2OK0L 5FGBC 3V6FB 3F12A 5GISH 1H3XA 4Z7VF 4MGXA 3DPBA 3ISWA 1PKQA 5C9JB 5J06A 5TF1L 5K93A 1X4XA 1Z9LA 4YBQC 5HGBB 1JZ8A 2VYRE 1EHLH 4LPCA 4LSPH 1AGDA 4PRNA 3ZDXE 3EDJA 1LEIA 1FVDA 4NKIH 4F2MB 4M6NH 3MXWL 4CJ1A 4M7LT 4GW1B 4POYA 1X5ZA 1BVZA 1MNUL 2ZUYA 1RQ5A 3G5VA 5I1AA 1KXTB 4P57B 4I2XA 3N9GL 4E9LA 1SMAA 2DQUH 3GMOA 4OFKA 4LCWA 1W0VA 2F54D 3V52H 1XIWB 3TC9A 5LBSH 3O8XC 3EZJB 4NPYB 3MV9E 1R5VA 1SM3H 1MCQA 4BUGA 5C07A 3FN3A 3BIKA 5DWUL 3BKMH 2H8PA 3VA2C 3GBNL 5DJAA 4NP4L 3EUUA 1AQKL 3FO0L 4F58L 3MLWL 1BVLB 2F53E 2V5RA 3QQ4A 4JQIH 1LO2L 1BQHA 1WCBB 4P2YA 1J11A 1EJOL 1TLKA 1LP9F 4Z7WE 1KXVC 5C6PB 1PX4A 4MHHI 4FQCL 2EDXA 2O26U 4R90L 4N5EC 4YXLL 5T3XH 2DM2A 5FOBA 1CFVH 3P3YA 4ZPVA 5C9KA 1DEDA 2X41A 4LBEA 1Y6MR 5FM5O 1HOCA 5ICXA 3G08A 4J12A 4LLWB 1U8LB 1U95A 3I3DA 2NY6B 4DK6A 1A8JH 1YDPB 1ZHBA 2UZXB 5DJDA 5HPOA 5E2VL 2Z8RA 1ITBB 2E7CA 2XWJB 3MV9A 4OGZA 2X05A 5IFAL 1JHTB 1MCNA 1IGFH 3GIZH 2BSSA 1CFNB 4KY1L 3RVVC 2A73B 2VNCA 4GMTH 3QIBB 5HPMA 5IVXA 4M43L 1OSZB 3OAUH 4XP1H 1CN4A 4H88L 4RQQA 1UKTA 4PJ5A 1P5UA 3MLWH 3QP3A 5J3HD 2E9JA 4RAUA 4JZOB 2EH7H 5IP4A 4YHNB 3INUH 1HKLH 4F9PC 5IQ9A 1U8QA 4MZ2A 3OAUL 3WD5L 1XGTB 1BZ9A 2EH8H 3QSKB 2DM4A 3M17B 3MRNA 1DE4B 3BP7B 4F9PA 4ZG1A 4N8VB 3AS2A 1G0YR 3DMMD 2VDPL 3HI1B 3QDGE 4XPGL 1KYOJ 4LSSL 5E6ZA 2NXYB 5FA3A 4OCLC 2CK0L 2BMKB 2DJSA 4KFZC 3DVNB 3O4LB 2IANA 1KB5H 4Z76A 3JWOC 4PRAA 4LLQB 2G9HA 5C0EA 4O2EB 2YA1A 2YZ1A 5A16A 2H9GB 1NBYB 1UB5A 2P47B 2HJKA 2NY0B 1MRDL 1OTTD 4M7ZB 4XP1L 4U3HA 1RK1A 2Z4QB 2AJYH 4YJZL 3GGWA 2BHYA 4UBDD 4S1SH 5CUSH 1QFPA 4XNYH 4DUVA 5C0CA 1IAKB 3BPCA 4GT7A 3PQYA 3RIAK 1OOAA 4KK6C 3UC0L 4PG2A 4ZNEE 4FRWA 1FL6A 3SCMB 1NCBH 1RZGA 3B9EA 1HEZA 1HIMH 1CICD 2AJ3A 5INDA 1BJMA 2CKNA 1BJ1J 2F58L 1CDIA 1ZA6A 4JN1L 4O2CB 1S3KH 2ZSWA 3T0ED 4WI6A 4YBQD 2AV1A 5BRZA 1S5HA 1T7VA 4KQ3L 3MRJA 3ILPA 4JB9H 4L8CA 1U93A 5HVGB 12E8H 1FLRL 4HKZA 5E8DH 1BBJB 3HC4L 3ALPA 3BDXA 4JKLA 1N59B 3EJYC 2DBLL 1A1NB 4NQDA 3IRZA 5D7LD 2GT9B 5J11B 2Z8SA 3B2UD 3I6LD 5BV7C 3GM0A 1LILA 2W91A 3LD8C 5CP3A 1QSED 4QO1A 1CLOL 1F4YH 5TDOA 3WFZA 5HI3D 1V7NL 4PR5A 3VI3F 2RR3A 2HFFB 2LTQC 3CFJA 3TBWA 2VC2L 1IM9A 4Y4KD 5B3JE 4OCSH 3LKSA 4XCEA 4A6YB 3QQ3B 1RZJC 2JELL 5INCA 1AXTH 2FJHA 5ENWB 4U1GB 5JPNA 3KPOA 2LVEA 4QTHA 1UCBL 1JPFB 1ZK9A 4XP6L 3OJVC 4WU7B 2BVEA 5I17B 3ARGD 3CFBA 4FOMA 3ARSA 1A02N 5ITBL 4LAQH 5HGAA 1WFUA 4POZC 2J8HA 3KNBB 3QEGH 4AT6B 1CD8A 4HGWA 5FB8B 1AD0B 5C6WH 4J1UA 2X4RB 1QYGH 4MAYD 3N85H 5ESAB 4PBVC 3C8KB 3KPLA 2XKNB 4HH8A 1BQLH 5IQ7L 4X7SH 5FUOH 1U42A 3LKOB 3NH7L 5HYSB 1MHEA 5EC1B 2BDNH 1ZLUH 1MIEL 1KCLA 3IDMA 4NRXB 3TESA 3ARDB 3CFIC 5MEQB 2EEBA 3P0GB 3D2UB 5EU3B 1J8HA 3RAJL 2XZQL 4Z7WF 1SEBA 2GTZB 1W72B 1ZHLA 5DWUH 1FAIL 1ZE3C 4JFZH 2XRAL 2ADGA 1YJDL 2N4IA 3CFDA 1CK0H 4Q6IC 1DVFD 1T7XA 2CDFB 2JE8A 1NGQH 4BYHA 3H9YA 4WCYL 1S7TB 2Z91B 5F7KC 1BQHG 3HZMA 4MQ7B 2FNBA 2NXYD 3SKMA 1I8LC 3QUZB 4PJ5D 3FZUD 4DTGH 2OSLA 4L1DA 2HVKB 4U1IB 2CR3A 3VXQA 4NHUA 3SDXE 3GJFA 5D4QA 2ED8A 3QXDB 4NZTH 5MI0B 3HZKB 1P1ZB 5DMKB 2RCSL 3PABA 5JW5A 1DBML 5GGTH 3UX9B 4P2OB 2QEJA 4TVSa 2YSSA 4KK5C 1QLEL 3BKYH 2OR9H 1U8HB 1UH3A 2ATKA 3EOYG 3QIBD 3EYQC 4H8WC 1DR9A 4EI5C 3IU4L 4NWUH 4G9FB 3TIDA 4OZHE 3B2VL 4I0PB 4OT1H 4OCWL 2V9TA 3AU1B 1GGTA 4XP5H 3MR9A 2NY2C 4H0IA 3B8SA 1Z5LB 4BQ9A 4ISVA 2QQNH 4IOFD 1QR4A 4QXTB 3QFJE 2B1HL 1DQMH 4MAYB 5M7QA 2PO6A 2QADB 4N0YH 4UIMB 4LDOB 2HFEA 2P7TA 4KDWA 1GOGA 1PG7W 5AYUH 4M8QA 1MVUA 3SDXA 5D71L 2PO6C 3T65A 4ZTPL 5F7EL 1ORSB 4HS8H 3WV0A 1CGWA 4G9DA 4X4ZA 4L4TD 1Q1JH 3K3QA 3LKRA 4JCLA 3BKCH 3JVGC 3O4OC 1IGCH 1WUNT 4XPBH 3X3FL 5BRZE 3AAZB 1HXYB 1QNZL 2ZNWA 3LVEA 4ZFZB 3FHQA 2ICWI 1BQUA 3CZFA 4LEXL 2NY4B 1NMBL 5EU4A 2ZCLH 1U92A 3CZJA 4MVBD 1YEEL 2YRPA 3KHOA 3U79A 1A7PL 2C1OB 4FHBD 2MCG1 5ADOL 3I3BA 2XYCA 4X83A 4GBXD 1QFUL 4RMTA 5KJRH 5IKCB 5FK9B 5CD3B 4LP4A 1MWAL 5H35B 5E08H 3BFOA 5H37G 3OPZH 1VFMA 1IKFL 5E4IA 1IM9D 2ENSA 3MRQA 1YQVL 1OGTA 3PWPB 5BMFL 1GSMA 4XNZB 2BNRA 1Y18A 3RWCA 3OKKB 3MRIA 2BNQD 1IAII 4NRXA 4HFUL 3EDKA 4HEPG 3T0BA 4P46A 2PKDA 1A1MB 4G6ML 2M26A 2F19L 3OAZH 2YPLE 3BZDA 5EPMB 5GS3A 4HIEB 5J1AB 1QSEB 1NCCH 4PJ9B 4EBQH 3N1PC 4R26L 2ADJA 1QACA 2H26A 3QIWC 3WO3B 2O5ZH 1RJLB 1MQKL 2JF1A 3T04D 1NDGB 5DJYA 4ODBD 3SEPA 3VFVA 5F7WC 4HK3J 1WTGT 4HUVB 4LVOC 4OLZL 4LKCA 3MLRH 3MRBA 5LGJB 1PD6A 5I17A 2XTLA 3DNKA 5C09B 3VRJA 4NSKB 3LPFA 4GXVL 3VGBA 5I1CH 1SYVA 1DBKL 3BXNB 5F6HI 4JO3H 2EDWA 4XP4H 4LEOA 3DUHA 2O5ZL 3ZYOA 4HPYH 1T6VN 1YN7A 1JYWA 4FQCH 4L3CB 5ESVB 1JF5A 5INCB 4P5MA 5I2IB 4M7KL 1SQ2N 1OP5K 2P43B 4K8RD 1QSFA 1SEQL 3VJ6B 4PRPA 2VC2H 1G7PB 2Q6WA 3WNLA 1ORQA 5A3ID 2FX9H 1LMKA 1G7MB 1DSFH 5IROC 3KYAA 2VLJD 5EDXA 2NY3B 4HFWA 4I4WA 3MOAL 2V9QA 5DD3H 3MLXL 4PS4L 4P4KA 3VWJB 1WAAA 3BJ91 3H3PL 2F9BT 2BOBA 3BDBA 1I9JH 1MH5A 2VN4A 3T0EB 4QCIB 3BIAX 2KUTA 4N8CH 2N56A 4Q9QH 2NY0D 2QADD 1D5MB 1FFPB 4YIQA 4LPTA 2VOTA 3BD3A 1BM3H 4MMXC 3PWUA 5JHDB 5F9WC 1IC4L 4D8PA 1CYGA 3O11A 4FP8L 4W68A 2H32B 3OXSB 4YNYA 3ET9F 5CBEA 4LPVA 1FSKB 4HXBH 5FKPA 5A2IH 1AQKH 2YD2A 3CDCA 3RU8L 3SGKC 1S9KC 1FL6B 2X40A 1CXLA 5DJ6A 3CFKA 3MGAA 2KH2B 1EGJL 2EDHA 3S96A 1CZ8L 3SGKA 2FYYA 1BFSA 1K4DA 2DM3A 4X8JA 1TETH 1X6NA 1OAXH 4JFEA 3FQRA 4QRSA 2AQ2A 4P48A 1BECA 3BKCL 1CF8L 3QFJA 5A40E 3BO8B 5DT1H 3FQXA 4BA8A 1CLOH 1F4YL 3V6OC 5HY9A 3MOQA 3FO9B 3KLSA 4X4XA 2FLRT 1ZSDA 1KB5A 4XAWL 1KJ3L 1F5WA 2FEDD 2WQ8A 3MBED 5MEPA 1E6JL 5EIIA 1MFAL 3JV4A 3LEVH 1JK8B 2H9GA 3P2TA 1HNGA 1T0NB 4QCIA 5L0QB 1Z3GH 2IFFL 3BAEH 1LEKA 5I9QB 3P0YL 4G9FD 4MQTB 3KXFA 4NC1C 3OKMA 4ODXA 2IANB 5F9DC 4KK6D 1Q38A 1ORQB 5FF6B 1JN6B 5HXMA 3FHAA 3CH8A 1I85C 2EYRB 3MXWH 5CEZE 1MFEH 2XKSA 1HHIA 5HI4D 3AC0A 5ESVA 1X5XA 5IHZB 4JFEE 3GJFK 2VXUH 3CC5B 2Z8WC 1XR9B 2CRIA 2NW2A 3T0EC 4HS3A 3T2NH 4KWUA 2Y07L 5GGVL 2H2PD 4RQQB 1ZVHA 4WO4A 1SJXA 2VZVA 2FLBT 5HGHA 4U1SA 3QXAB 3HE7B 3QXAA 4G5ZL 1OL0A 5EUKB 3V5KB 1KBGL 1S7QB 4OD2A 3QRGL 5KG9A 4OBRA 4U6TA 4WO4C 4HF5H 5JMRA 2JJWA 1EO5A 2B8OT 3LS4L 1R3JB 2D7NA 1INQA 3PP4H 4OFYD 1IL1B 2WANA 1YEFL 1HHIB 1NGQL 3EOTL 1TTFA 3F58L 2NXZB 3P4LA 2VDRH 1QBLL 1MCSA 1MLCB 4P46B 2D7QA 5C3TA 3FB6B 3GMRB 5JLZA 4ZXBD 5GS1A 1AI1H 3QIWD 3O8XA 3O2VL 5GSVA 4M1DL 4KKLD 2F8OA 2X7LB 3WMSA 3BPOC 3FT2A 3MRQB 4K3GA 4YGAB 3SO3C 4Y19D 3VGFA 1GJIA 5E4EC 4MA7H 1K9TA 1ZS8A 2ZUQC 4PRHA 3C9NB 4XNXL 4KMTH 2HRLA 4OGAC 2X09A 4GRWE 4Z77A 1I4FA 3GSRB 1T0NA 1MJUH 3UPRB 1RZJL 5EBGA 3HG1A 4PLJD 1I1AA 5GGRA 5CEYB 1A6ZB 2F15A 4GUPB 3MMEA 4POZD 3KS0J 1SJEB 3QO1A 4M1DH 5HY9B 4G80B 2ZPKH 1FNGB 5KVGH 1I1AC 4JN1H 1PSKH 3O41A 2WW8A 1QD0A 1GL4B 2E8ZA 43CAB 4PJXB 3HZVA 1MI5E 4PGCB 1NEUA 5E70A 4KROC 2FYYB 2OCFD 4OV5B 3G04A 1QSFD 3S96B 4PY8I 3SE9H 4R6UA 4JPVH 5EC2A 1JNHA 4S0TD 3QDME 5ECJE 3HNTL 5FA4B 5GRVK 3TCLA 4DK3A 1N6UA 5AUMA 1YEEH 4WI8A 3QUKA 4KI5F 3RNQB 4G8EB 1T21A 2GUOA 2XRAH 4G6AC 4M7KH 2NY0C 2R2EB 4PJBE 5ANME 3PWUB 1LEIB 2N7AA 1MVUB 4TNWK 2NX5E 3DHJA 3VFTB 3BP6A 1ZHKB 1D5MA 3THMH 4QXTA 3KPTA 2OK0H 2APBA 1KENL 5GGUB 3FZUC 1MH5B 4NYLA 1S7SB 4OLZH 3TBSA 35C8L 4JR9H 3HC0A 3HA0A 2CXGA 1NBVH 1YQVH 2MQ3A 3KAAA 5KVFL 5EA0L 1L9NA 4GKOA 4HFWB 2A0LC 4ZO9A 4QHKI 4N8CL 4UT7L 4MDIB 2P8LB 3BT2H 5I76B 5DVMA 5EG6C 1A6UH 1FDLL 3KGRA 4AY0A 3HZYB 5I1EL 2VJXA 5IIEA 1IC5H 2P5ED 3NAAL 5E8PB 5ADOH 4C4KO 2NTFB 1W8NA 1KENH 2HT4D 3V4UH 3BD5A 1RHFA 2YSSB 3U2SA 5F7MC 4YDLB 3OAYK 4PPTA 2VDNL 3MRPA 4QKXB 2G75B 4U0RC 1FYTA 5FYKD 4ONOA 2D3VA 1KG0A 5L0QC 3PP3K 3V6OE 2KZ1B 4RNRB 2EE2A 2GJ6A 1EEUA 3WS6C 3HMWH 3QCUH 3VI4E 4KZDL 4LKCB 2J8UE 3O3DA 4NFCA 5CWSB 1NC2D 3VFSA 3VWKB 3U0TB 5HVWA 1TIUA 3T2NL 1PLGL 8FABB 3IU3B 3RWDA 3KWWB 1VGEL 4UT6H 1P2CB 2CD0A 4PJHB 1HI6A 4L9LA 3ULSB 2UVFA 5HYJB 4XWGH 2D03H 1GGIH 2G2RB 4OZHB 1MVFA 4F3FA 4MNHB 4G8IB 1UXSB 2I07B 3S9DB 3LQMA 2DYPD 4ZS6C 4PJ8A 4HDIB 1V3KA 1I7TB 1Q9KA 5DGRA 3S5LG 3U9UB 1Q0YH 1IRAY 1CE1H 1LK3L 1NFDE 3QUZC 2VLRD 4CU7A 4JN2B 4X98A 5HYSA 1EIBA 1JPTH 1U3YA 2K7PA 4XMPH 1JNNL 3KDMA 2ZUTA 1VA9A 3P30H 3T1WA 5TE6L 5IV2A 4JG0H 5IM7B 4LRNL 1RUAL 1KPVA 2W9DH 1WICA 2A6DA 5BZWA 4U2ZA 5EOCJ 3HE6D 4FQQB 4NQED 4ZD3L 1U92B 3VGAB 1NGWB 4H88H 2E9BA 2PW1B 3C8HA 5LJYH 4HT1H 2GJ6B 2Y6SD 4H1LB 2X89A 4ZFZA 4JY5L 4Z9KB 5IEKA 3H9HB 2EDYA 5I74C 4QTHB 3KPOB 5LCVL 4OQTA 5KSBF 1MWAB 1BIIB 5JMOC 4R97B 3C5ZC 4EN3D 3GMQB 5FO9A 5D7IE 3UP1A 2V2WB 1UA6L 4MNQA 4TSBL 4P99A 1Z9OA 2HLFC 1H3PL 5E2WL 4MXQD 4Z7UB 3IAQA 4PLJC 1OLLA 2NY3D 3C5ZA 2EDEA 4MWFA 5B4MD 4HHAB 5CAYB 2VLME 3PE9A 4PTUB 2PO6B 3LMJH 1DLFL 4HS8L 3FQUA 4MB3A 2CIIA 3ARFD 4I8DA 2JB6A 5E94B 4XBEH 3IFOA 3MLTA 2PCPB 4Y5VB 3CIQA 1BAFL 3L6FB 4NM8L 1RPQA 4Q0XH 3RVUD 4PRIA 4MJ5A 4D0CA 4NWTL 4XVTH 1B0RA 5EO1A 5BQ7B 2P8PB 3IDXL 1CL7I 1KIQA 1T1ZB 4FQ2H 2CLVA 3MLPA 1YEJL 1ZLWH 2X1PA 4C57C 3UJIL 2DL9A 5FYLE 4RFEA 4BH8A 5K59E 3QPQD 4KY1H 1KSRA 4PJBA 1DVFA 2VAAB 3OTTA 4RGMC 4ALAL 5JW5B 3WFDH 1FO0B 4AZ8A 4Q6IA 3ARQA 5FYJU 3ESUF 3DVFA 1KN4L 3B4NA 1ZLVH 4U1IA 5GRYA 4XVUC 1QLEH 3BKYL 4PS4H 4S2SA 1D3CA 2XG4A 1I9EA 1RZKC 2CIKB 1JMZA 1NCAH 1C5BH 1ZXQA 2VZ1A 3QO1B 4Y4HA 5CINH 2A0LD 4J7RA 4FFWD 1LO3H 4Y8AA 5CSBA 5GGRB 2Z91A 1D5BA 4MCZB 1SJHB 4NZUH 4AQ1B 5F72S 2XN9D 2E7HA 4HMDA 3SO3B 3I6KA 1AFVL 1CT8B 4YBLB 2NY1B 1WBZA 3MYJB 4HAFA 1WTLA 2HTKC 4Z76B 4K94C 1IAMA 1KF9B 4M9OA 1QFHA 2ORBL 2BMKA 3FT2B 3OZ9H 1T22B 4BQ6A 1M1SA 3BPNB 1PY9A 1RZFH 5GSVB 1F4XL 5JW3L 1BFVL 4LP5A 4YXHL 3BEVB 5EORH 4FTVE 1FP5A 4XPTL 3TT1H 4N0RA 2PN5A 4XAKD 3BP7A 5GSRA 4PJCB 4MB5A 2X70B 1UB6A 3JV0A 4OB5H 4P5KA 5CJOH 2D4FA 3J7HA 4AG4H 2VWEE 2OZ4A 4X9HA 5CILH 5ESAA 3D0LA 5KANI 2Z35B 1AJ7L 5FB8A 2P44B 4ZFGH 4LOUC 1I3RB 5I8CA 5J13C 4JDVB 4NN5C 1KCSH 4ZUTB 5ALBH 4D9RE 1ZT1B 1ZLWK 1B2WH 1YEDB 3D85B 4Y89A 5CS7A 4XMPL 1WK0A 5F9JB 1I1YB 3D6GA 3CSPA 1X5KA 3MJ7B 2HJLB 4JPIB 4ONFL 4RWHA 5TDPB 3S35X 3MODL 4RRPA 4ODSL 4F7CB 4JG1L 3FFDA 4CGTA 2EECA 5L6YH 1P69B 3QBTB 4UU9B 4KC3B 2VZSA 5ICXB 1WVZA 2FX7L 3NCYS 4NQCE 3WJLA 3CX5K 4WUKH 4A6YL 2IPTL 5E6IA 5GJSH 3VDAA 2DMKA 2HTLD 3V6ZB 1X9QA 1Z9SA 3FN0L 3IDJB 4NN6C 5DTFA 1MCOL 4QHNA 3UJJL 1QO3A 4J3WA 4M6ML 1BQHB 1C7SA 1WCBA 5HI3C 1YN6B 5I30L 3S35L 1JVKA 4F57L 2VO5A 1TETL 3WFHA 5AG9A 1MEXH 3MV8E 4OIAA 2AK4D 4JRYB 1EZVY 3HNSL 4MXWL 4ZFFB 2YA0A 3EO0B 3PV6A 1F2XK 3LDBB 3BIKB 3MRGA 5CD5C 4GOSA 3QEQB 2HAZA 2JCCE 2R0LH 4HC1L 4OTXL 1RZ7L 5E5RB 3V4UL 3TBVA 4MA1B 4KKNA 4JFEB 4MA7L 3NABH 2YUXA 2P24B 4X8JB 1XEDA 4ZS7H 3UTSA 3PL6A 4U1HA 3PGDB 4R0LA 1LK2A 3WDIA 4NQCA 2NX5D 2EIBA 5L9DL 5DJ0A 3BPCB 1QRND 5D2NC 3O11B 3MACL 2OR8A 1VFAA 2EDRA 1P84J 2APFA 1QSEE 1U9KA 1HHHB 4YIQB 3EBAA 1CD1B 3I6GA 3RVWD 1A7NH 3EHBC 1WV7T 1QLFB 5L7XH 1CDBA 2J5LB 3HRZA 6CGTA 4Z18A 1KULA 5JIKA 5L8LB 4NKDB 1XFPA 4LASL 3MLVL 1OLZA 3O6FA 2XZQH 1YMHA 4O2FB 2Y07H 5GGVH 3QZWG 4G42A 3BHBA 3D25A 5DMJB 2ZCHH 1YY8A 5IBTH 4LPXA 1Z0NA 1RSFA 4JO4H 5F96L 4XGZB 1IC4H 3GSVA 2LE9A 3VXMB 1INEL 3L5JA 1UJ3B 4DW2H 4KRMB 3BQUA 1URLA 1LEGB 3ARDD 2OR7A 4Z5RA 4DGYL 4JE4B 4RSVA 4YHNA 5EA0H 1SYVB 5F3BA 2FL5B 3SDAB 3ARRA 3WKNA 1SY6A 2HJLA 2VDRL 1ZTXL 4HUKB 2D31A 5IESH 3F7PC 3DI3B 3MRBB 1BMGA 3HPLB 3W11C 4X8XA 2BFVH 3X3GL 3SKJH 2BCKA 3F7YB 4OF6A 3A67H 1JHTA 1N4XL 4UDUB 1I3RA 3PHOB 3M1BB 4M6NL 3VWJD 4YX2H 2XZAH 3CMOH 4PY7B 1OAYH 2H45A 2NY2D 3FONA 4XNQB 1RJZB 2OL3A 3T0XA 2VXSH 5BS0E 2R9HC 3GFUA 3GIZL 2Z92B 5I73C 3WSQH 1J1XH 5C7XL 2GCYB 4DOHB 3S5LA 4JZJC 3LB6D 5E95B 2IEPA 5EU5B 1DQJB 2MQCA 2YD9A 5DQDH 2VWEC 5F71A 5FUCE 1F3JA 1MIMH 2YRZA 3V6OA 1JZ4A 1NC4A 1RIHH 1KN4H 3DX9A 1FRGH 1JGUL 5HYFA 2CO6B 4NQEE 2UZIL 4LK4A 1NGYA 4ETYA 2DWDA 1UWEH 5K9QG 4FFYL 4JFXA 5DQDL 1VESA 1J18A 5CD3A 4TTGA 2Z31A 5FCSH 4JKWA 3B83A 2NLJB 4ODWB 3K0WA 2OJZL 1AC0A 4JFOB 3FTGB 5ESQB 1CGVA 4V1DD 5C07B 1RZFL 3VXSD 4C83B 2C1OA 2HVJB 5BO1H 3IU4H 4NWUL 4S2SB 3RHWF 3I02B 1M6OB 3FO1B 3CZFB 5GJTH 3QNXA 1W0VB 3VD5A 2DLEA 4YPJA 4J2XA 2DQCL 4I2XB 1VACA 5F9OH 4HQQH 1FO0A 4HK0A 4G43A 5F3HB 3G5VB 4HWEL 3AS3A 1PY4A 4K94H 5E6ID 4ZUUB 1RHHB 3VDCA 3I6LE 3NCCB 4XMKL 2X4OA 4EJ1C 1G9EA 3DUSB 2OQJA 4Y4FA 2AV7A 3WL9B 2WK2A 4R4BB 1YEKH 5DA0B 1MCWW 3LIZH 4C56E 4NKOA 3ZDYF 4QRTB 4QYOA 1R3LA 5KAQG 1IGFL 1F8TL 1G0DA 2UZIH 5EIQA 4DGIL 2W0FA 4WUKL 2P7TB 1C1EH 3DMMB 5CHNB 1UT9A 3MLTB 2Q3ZA 3BDYL 3V6FA 2LV4A 3MNVB 2ARWA 5E94A 1I9RL 5C2BH 5BV7B 1A14H 1MUJA 4HIXL 4K2UH 5SWZE 5TDNB 1Z5LA 3C5JA 1A3QA 1XGRB 2EDTA 4ZXBA 1SMOA 2ZUXA 4HHAA 1BGXL 4Q9BA 3LCYA 2J3SA 4WWKC 5CSGA 3A6CH 3P9WB 1TDQA 1OAUH 4JY5H 1N6VA 4NN5B 3ZE0F 5J9PB 5HYIA 4FXGA 4Y19A 4BZ1L 1WZ1H 4MNQB 4NQCD 4F33A 2RAMA 1A22B 1H3GA 3TYGL 1WAAF 1FC1A 3QEQE 3GMMB 4G8GD 2ZCHL 2HLFD 2P1YA 2DQIH 2ZSVA 2AXHA 1T0MB 4XWOC 3GSNH 4MXWH 2AK1H 4PGEA 3LSOA 2PYFA 3BVNB 1UH4A 5K59F 2HVKA 3F5WB 3PNWB 4B7LA 5F7UA 2YOCA 3PUCA 3W81A 1BFVH 4DGYH 1J8HD 4N5UA 3OB0K 5JOPD 2Y36H 3QG6A 4WTZG 1UQSB 1OAKH 4NM8H 5KS9E 4TRPL 3BOVA 1JWSB 1F4WL 1T7ZA 4X98B 4PBXA 4PLOB 4HC1H 5F6HJ 5HI5D 2GY5A 3X11B 5GRJH 4PJ5E 5FO7A 2HMID 3MO1A 4K9EC 1P6FA 5FKAA 5D7JB 4O51B 4QNPF 5EU3A 2QLVB 5DLML 3RGVA 4OSUH 4D94A 4JHZA 3GNMH 1CXFA 3ZE1E 3ARDA 1GZQA 3EYSL 5GRJL 2GKIA 3SGJA 4TRPH 2R2CA 1D5ZA 4BZ2H 5GQBA 5JXEA 1RJYA 3RY6C 3OSKA 2VR9A 1FFRA 3K2UH 1L0YA 3T4AA 1VENA 2X4RA 8FABA 4OUOA 4YAQB 5L8KB 1F6FB 3H42L 5D2LF 4XZUA 4QXGH 1J05A 4EI5A 4XPAL 2IANE 4R2GB 4U1MB 2YPVH 2YEZB 5A2KH 1UYWL 3K7UA 3VFSB 2VN7A 4HSQA 4MSWA 2VQ1B 1TJIL 4DFIA 5I1JL 2HA1A 1CFVL 3EYVB 5FHBH 4N8VG 5KS9B 4OB5L 4PRDB 2IC2A 1NGPL 4NO2A 2VLJE 1F3RB 4XZUB 2R1XA 5IVZA 4OLXL 3IF1A 4WJ5A 2ZOLA 2A77H 3HS0A 3QXWA 5T3ZH 3UTOA 4YPGA 1FE8H 1MCKA 4NC0B 1BLNB 4OZFG 5JW4Q 4HLZH 1NCWL 3DV4B 4M6OH 4PP2B 4PTTB 5FUCC 5BOZG 5ITFB 1ACYL 1CF8H 1NC4D 2VZ3A 4XHQA 3WIIL 5IFAH 4EZMA 3RTQB 1YYMH 4CRPA 2WBKA 5D7JA 1QUNA 3L3GB 1S5IH 3JVGA 3ZE2F 2PTTA 2A74B 5I8KL 1S7SA 5LAXA 4L4TA 3DHMA 1KCSL 4JRYE 1MIML 5KOMC 4K07A 4WW2C 4JRXB 1YZZA 4Z7UE 1A4JB 4LU5H 4L8CB 1UQSA 5E2TL 1LQSR 4OM0L 2FD6H 4O02H 1J1OH 4FXKA 3U4EA 4NM4H 3ZTNH 5KZCB 3BEWA 4YDKH 2DQDL 2EYSA 2VDLH 1VEMA 1YEGL 1I3UA 3FT3A 2ICES 3BVNA 3ZTJH 1D9KD 3DVIA 1T04A 1G7LB 1IGJB 1U8NB 1CL7L 3C08L 2ITCB 1RUPL 3SN6N 3QWOB 1EXUB 3KHQA 3MV8D 4I18C 3G04B 1NCDL 2AK4E 3WN5C 3D9AH 4X0KB 1M7XA 5D7IB 3SJVA 1JMXA 4J3UA 4XRCB 1JZ3A 2XKUA 4YK4C 3T77B 4PJIE 3O9WA 5D72H 5EBWA 2F54A 1KN2L 1RUKH 7FABH 5ETUA 4PRPE 5C08B 4AG4L 4U2YA 3OG6B 3ZE2E 5DZLA 5FGRA 2BERA 3MV01 3QIUD 4LCWE 1T66D 3UPRA 3QA3B 3O3EA 4NC2B 2P8MA 2E7LC 4Z8FL 5HHXH 1T89C 3V5DB 4HIIB 3SKNA 2PR4L 1GPOL 4PRHB 3EOTH 4K7PX 1MOEA 2ED7A 1A9EB 1KJMA 5CHNA 3MRFB 4J4PA 4JLRB 1FO0H 2XWBB 5L88L 1G6RB 1FVCB 1T3FB 2APWA 3HI6L 2YMXH 3GMRA 3MRNB 1DE4A 4L3EB 3V6BR 4BSVA 1MLCA 5JLZB 1G1CA 4Y4FB 4GKSA 3NTCL 5F1KC 1P7KA 4AEIL 9CGTA 2NNAA 1RHHA 4IRJA 3GM8A 4KMTL 1U8QB 4XP9L 4YX2L 5ISZB 3KPSE 3BUYA 1FNEB 3RL1B 2N7BA 4YEEA 5B39A 2GJJA 4UNUA 4WI2A 3BRFA 1MPAL 1HNFA 4OI9A 3U1SL 1N3NB 1PDKA 2R2HA 3V5KA 2KBGA 4L4VB 3ZMRA 4P2CG 2A73A 4U1SB 4JAMA 1JGEB 5ID0A 5HHQA 2VKXA 2HFGH 2O5YL 4YR6A 1G6RL 2KPNA 1CDYA 3LV3A 2Y23A 1U8MA 2C4FT 5B3JF 4JFFA 3OKLA 1X3DA 3DTXA 3GBLA 5I16B 4QHKJ 3G08B 5HYJE 1DUZB 1AFVH 1BEYH 3NFSH 4XXDA 1HHJA 2X9YA 3QR2A 3ULVH 1FLTX 4NO3B 4OCNC 4J3TA 1X4YA 4JGJA 1U2HA 2F5BL 3IDUA 4P59H 2UY7A 2VDOH 1T1XB 1DCLA 4L8BB 3WS3A 2V5MA 3JWDC 5JO5B 5TQ0H 2BRRH 2WLYA 4LAQL 2FH8A 1OARH 5DD6B 4U6VL 2IAND 4OAWB 3W11D 1ZT7A 4K3EL 1SY6H 4KU1A 3W0WB 4KRPB 3CH1B 2GJZA 2YD1A 4L8DB 1PZUB 4DGVH 2ZOKA 5ID0B 1RIUL 4JFED 4FMFA 4RX4A 4NJ9L 3OPZL 1KT2B 4ORZC 4WFED 4L4VA 3OKOA 4U49A 1TFHA 4BKLA 3F7QA 4RZCA 3RVXC 1G7HA 1NANI 2GAZB 1D7FA 4U1LA 5F1IA 1QRNB 3BUYB 3RL1A 3QPXL 4FFVD 4FA8A 5C6TH 5MHSE 1DUYB 1LEGA 4NO5B 4IRJB 4X80L 3IFLL 3VMNA 4K9EH 3PQYD 1JWMA 4ZTOH 4LF3B 1P7KB 1CLZH 4S1QL 4H0HB 4NQUA 4JR9L 4HV8B 4HPOH 3ESVF 3BJLA 1BWWA 4Y5XB 1J87A 1OAUL 5D9SB 3O3AA 5CEZH 5DJ8A 3D25B 4LVHC 1KNOA 1IARB 3UYRL 3BESR 3U0PB 3OR7A 3F12B 4UNVA 4UTBL 4PRBA 3S97C 3O4LE 5CJ8A 4FQLL 1QBAA 3QUZD 3S35H 1S9XB 3PWJB 1TJIH 3U46A 4X6FA 5DF0A 1G7JB 1X5YA 2XA8H 2DDQL 3HCVB 2HLAA 4I4WB 4E41A 1XMWA 4QRRB 4U05A 4GG8A 3IETB 2FZ3B 4PJDB 3IKCB 3D39A 4LLDA 1FNFA 1G7MA 2HH0H 3GBML 35C8H 2JB5L 1JFQH 4KGLA 4NNXA 4ONGH 4OFDA 5FEBA 3OJMB 2GITA 4X0KA 5IW6A 5MENA 4FQLH 4KKAD 4NGHL 3FQNB 1JTOA 5DJ0B 2GEEA 5IK3B 2XFXA 3K2MC 3BT2L 1KIRB 5CBAB 4NQCB 4V2CB 5J11C 5GISL 4C56A 4F7EA 4HIXH 4WW1B 1ERNA 2H2SD 5D6DA 5F1IB 3BXNA 3VGDA 2B5IC 4BFIB 2EEDA 5B38A 2VDKH 2DQFB 4GRWB 4JRYD 3B5TA 3QDMA 3CVHB 1CFBA 4HUVA 2DQJL 4JQXA 4XVJH 1JHKL 4F7TA 4KPHL 2R56H 2Z9TA 4XCYB 3PV6B 4U6HB 2XZCL 1UH2A 4HIJB 4PJAE 4D0DA 4WHYH 3S37L 2EDJA 5SX4H 2J6EA 2B4CC 1RD6A 2NX5A 2HKHL 1FRGL 2GSGB 3BPOB 1I8KB 3K4AA 5IGXH 2W1NA 3SBWA 3S3SA 3EYOA 5EUOF 4PJFA 1UKQA 5DMIL 3IDJA 3U82B 4WDIB 3SBWC 1JI1A 3RVUC 4UINH 4OLVL 3UTQB 1XGUB 1YY9C 3QDGA 5TGBB 2LU3A 2FGWL 2D0FA 2IH1B 1CICB 2FSEB 5B3NA 5H35A 1QLRB 1BIHA 5HGDB 1U8MB 1BX2A 2P48B 4IEFB 5CFHA 3DXAA 1YC8A 4F7CA 5ALCL 3MCLL 1EVUA 1IEAA 2DKMA 2J6EH 3UTPE 1KELH 3BWUC 3GI8L 2NY2B 2UYLA 1MY5A 2IF7A 5F9JA 1IKFH 3S8WA 3NH7H 3LN5B 1EEZB 4KH2A 4E5XB 1RUQH 5CJ5A 5D7KD 2QTEA 5C0CE 1SYSA 5KOVC 4YAQA 1X7QA 4N0YL 4OZFA 3QO0B 3P9LA 3PHQA 3MROB 2DQHH 1NGZA 4QT5B 4PJHE 1U3HA 1MFBH 4YH6A 3MGOB 1FVCA 1XF2B 4Q0XL 4JDZB 3F62A 2R29H 3QNYB 1P7QB 1RI8A 2V17H 3L7EA 3DX6A 1CDHA 3PF2A 4XVSL 2IALA 4L4VE 1HCVA 4HIIA 3SY0B 1LVEA 5F44A 3UAJC 5TJWK 3B6SB 3V0WH 2CDGA 3P4NA 4KJWD 5ETUB 3RWJA 3BP4A 4UAOC 1DLHA 4NC1E 1QFUH 1WZMA 3T09A 4YHYC 4XRCA 2WSKA 3EAKA 1OF2B 3PNWA 4XC1H 5C0NC 1XF5A 5KVEH 3CXDL 3LSOB 4JVPA 3QFDB 2ESVE 1NFDF 4KI5C 5JPMB 1OGAD 4TOYL 2A83A 4PREA 2A83B 4MA1C 1P1ZA 4PREB 4YDIH 2C4FU 3X13B 1JZ5A 4L8SC 3GMMA 2OM5A 1CIUA 3VG9B 2MKLC 5T1KB 3Q48A 4XMKH 5TE4L 4GXUN 2B7DT 3QUML 4FXLA 1HDMB 2FBJL 2DYPA 1KIPA 3TJEH 1CVSC 1GVIA 3QUZA 1CGXA 3ULVD 5EUOA 3E6FB 1DL7H 2D9CA 3L6FA 2VH5H 3QRFM 1CBVH 3JZ7A 1B9ZA 1HYSC 2PTVA 4L4TB 2P5WE 3MLVH 2E7BA 1WIPA 2VDLL 4HUWB 2NZIA 2PYEE 5GGSB 4ZO6A 2APTA 1W72A 1KJ2L 2W0FB 3HE7C 4QOKB 1IGTA 4MWFB 5AZ2H 4KV5E 5GGSY 4W6YB 3SDAC 3G9VA 4EQ2A 3EYFA 4XAWH 3QZWB 4XC3L 3WHXB 3WL9A 4ZOAA 4YHZL 3AFLA 5KVDH 2Q86B 4JFDA 3WE6B 3HE6C 4BSWB 4K3EH 2OTWA 4ENED 4G43B 5F3HA 3VFUA 1S7XA 3OJDB 2R1XB 4N0FA 1ZMYA 3KNBA 3QAZB 5DEFB 1AY1L 2JKXA 4E5XA 3QUMA 4AYFA 4S1RH 5BVPL 2FECI 3EFFA 4GAYB 4ZS7L 2HH0L 1CQKA 2VISB 3EFDL 3HI6H 2R69L 3H3PH 3HR5B 3OAZK 3WFBH 4C83A 2F5BH 4E42A 4LNRA 3ORJA 4U1MA 1XR8A 4FG6C 4WV1C 2XA8L 3WNKA 3JSSA 4ZO7A 1NC2B 4GQ9L 4JG0L 5DMGC 2OTWB 2DWDB 3BKML 5B4MC 4RISL 3UO1L 3SCMC 5D1ZC 3LKSB 4XCEB 4A6YA 4YQXL 4AM0A 5HHVH 3NPSB 2IMMA 2XN9E 3CFJB 3ARBD 4GW4A 4JFZL 5F21B 3EYFB 1N5AB 4K3DH 3MV7E 3ARFC 1F3JB 1ZEAL 3KYOA 4KQ3H 3TLRA 1HSAB 1H3WM 3JWDL 4O51A 1IC7L 2WP3O 3OWEA 5KSVA 4R4ND 4G8IA 2G2RA 4OZHA 4F3FB 4NQVA 4BK5A 4LMQE 3UZQA 4ELMA 1I8KA 1NUDA 4JO4L 4KTEL 4XNQA 1MAML 3QPXH 3D3VD 5DXWA 4Q9RH 3IU3A 1RVFL 3V5HA 4PY7A 3RKDC 5J12B 5JW4R 1XCTB 4HIJA 4JPKH 3L1OH 4U6HA 3DIFB 3QDHA 4NKIL 5EUOB 5HHOD 2FWOB 4JHAL 5F7LB 1V3MA 1KIPB 4OCXL 2BHUA 3VWKA 2ZSWB 3HPLA 4YHPB 3O3DB 3VW3L 2X6MA 4MCYA 4KRPC 4N9GB 4NGHH 3E1F1 5AZEL 4F58H 2FGWH 5L2JB 2AJ3B 2PR4H 1WC7A 3QEUB 3IDIA 4O5LL 4OZIE 5TFSL 4XP6H 1NL0H 1T0MA 5ACZA 2AKRA 2ZSVB 1NLDH 1DDHA 4WCYH 4WW1A 5DMIH 1P6AB 2DS4A 4GAGH 5HHXL 4P5TB 1G9NL 3QUXC 1J0ZA 4FFWC 1IAKA 3UEZA 2I26N 1XF5B 5GS0D 3MC0A 5C0CB 4NCDA 4Y19B 5IIEB 3D85D 3TT3L 3O4LD 25C8H 3WKML 3N50A 3RWEA 1XGYL 3R0NA 2P8LA 4OLUL 3S37H 3QIBC 3RWJB 4KJWC 4ELME 1E4XI 1ZAGA 1OT2A 2UY6A 3HCVA 5ILTH 4M7LH 4NKDA 5E0QA 2EICA 3C2AH 4N1EA 2FO4B 4LHUD 4W4OA 2FBJH 5GGUA 5I18L 4PRBB 3LN4A 3MNVA 4KI5D 1QBML 4GSDH 3OR7B 4G6FB 4L3ED 4KK8D 3QEHA 3DROB 5FYJL 2J8UF 5ILTL 4DVRL 3DX6B 1A6TA 3REVB 5KSBE 1VFAB 4LKXA 4TUKL 3TO4C 1W2KT 4Y5XA 4OZIA 4NRZB 1A2YA 2AV7B 1KPUB 2YK1L 3QCVH 4ORGA 3MROA 5F7EH 5AUMB 3L3DA 4DUWA 3RA7H 2CUHA 3BPLC 5C0RH 3S3PA 3NZHL 3R1GH 1VACB 1W0WB 3M8OH 5DVOA 3VGAC 2DDQH 2X5PA 4JZOA 3MLUL 2ZJSH 3SKUD 3TZVA 1CGTA 4F9LA 3UC0H 2ZZUT 1GXEA 1AXSB 3P4OB 5E6IC 4EBQL 3O2DL 1QVOA 3T4YA 2IPKA 2BRRL 2P4AB 5AWNL 1ZANL 1SBBA 4MQXD 1OPGH 2CMRH 4NRYA 4HWEH 1ZA3A 3L3HA 4P3WA 3R8BB 4WO4D 1CR9H 4NBYB 2NY7L 3TH4T 2NPLX 2G60H 1DFBL 1KTLA 3G5ZB 1AXIB 4MD0A 3CVHH 1YDPA 1IBGH 1D5XB 1HOCB 4UDTA 1ZLUK 12E8L 5E8DL 2HT2D 2IBGA 2WUCL 2EC9U 4OFYA 1T1XA 4L8BA 4GG6B 4RFOH 3B9AA 4NJAH 1IAIL 1LDPH 4JFDD 4TOYH 3LKPB 4WWKD 2B0SH 3S88L 3C5SA 1BGXH 3ZYJA 4ZOCA 1UXWB 4XXDB 3PJSA 4IMLB 4RMUA 1JBJA 2G5BB 3C60C 3VI3E 5IWLA 4QOKE 1NAMH 3LDBC 5LBSL 4QRPD 3ARGA 4P46C 5KVDL 3TNMB 4MJ2A 4QRRE 3ZSTA 1JNLH 1KYOK 4NOFA 1MCCA 4GO6B 4TQEH 1KCUH 4F15C 1AC6A 4HUMB 1E4KC 1S7QA 5AZ2L 4XNYL 4YFLF 1VPOL 3TYGH 4LRIA 3BN9D 4HMEA 1AHWA 1HE7A 3BGFB 2IPKB 1I1AD 1U3JA 4NPYA 4BZ1H 1QVOB 4YE4H 2DQFA 3PG2A 4PJEE 3SE4C 1E4KA 1KLUA 4JPKL 4IRJD 4LCWB 3GSQB 4Z7WA 5C1MB 1XR9A 4ZSOA 1VPOH 5DHVA 4P57A 1FNEA 3D0LB 2EE9A 3BMVA 3V9FA 5I1CL 5FCUH 1U0QA 3L3DB 3NFPB 1W0YT 1T4KB 3N1GC 5C2BL 4MA3A 4PJDE 2WBWB 2F8XC 4HX1B 4BSVB 1J0YA 5GSRB 5GRZA 3RZWA 1K3ZA 3FRPA 3QH3A 5FF6A 4F2MA 3W9DB 1QEWA 1RIVL 3FB7A 2VXQH 4PJAB 3IETA 4JB9L 1FGNH 3PGFL 1T22A 4YBLC 2K1MA 1MCIA 1AH1A 3VFNA 1GZPA 3KXFB 1S7WA 3LN4B 3K4DA 4O58L 3ZLQC 4LHJB 3VWKD 2FO4A 1NQBA 4X7DC 4P4KC 1SJHA 3TVMD 3I6GB 1QHOA 4BM7A 1FJ1A 1KB5B 32C2A 2NW3A 2PTUA 1T2XA 3BRDA 3LEXA 5EBWB 3O2WH 3O3AB 3GKWH 1C5DA 3SJVB 3FQRB 5L8JB 1DLFH 4I0PC 1A6AB 1OAXL 3T2OA 2AEPL 5JUEH 2D7TL 1BBDL 1GRWA 2DD8H 1QSFE 4M48H 4UUJA 1ULVA 4OZGE 2OZ4H 1KB9K 1S7RB 2Y7QA 4ZMAT 1JHLL 1OTTC 3S36X 3WO4C 1CU4L 1NMAH 4P0DA 1DANT 1FFOB 4N9GA 4PUBH 4P3DB 4AH2B 1U8JA 3RRQA 4ODVL 4I9WD 2R9HD 4N90E 4L8DA 2FGZA 3LEYL 1DQLH 4KHXH 1ONQB 4X99A 2ESVD 3LB6C 4TN9A 4ZFOB 4H1LH 2WINA 4G9FE 2ZP0T 3NCFB 3GHEL 3NABL 1BFTA 3RJDA 4ELMB 1ZVSB 4P9ML 4KHTH 1F90L 3I75B 2PTTB 3UJTL 2AVGA 3H9SE 3VXSE 2DIJA 2FR4B 1QYGL 2NY7H 4YDJB 5BV7L 3TJEL 1I85A 1KELL 4LSDA 1ZOXA 3KYOB 1DQLL 3BUTA 4KHXL 5JORA 3W9EB 5BZDB 1JCKA 1G7PA 1V7ML 2L0DA 1FHGA 2MOVA 4HJ0C 1FLRH 3OKDA 1ZWIA 4C58B 1S7VA 2HT3C 1YN7B 4WJ5B 4Y4FC 3NIGE 4PRHE 3B2UC 5TDPA 5EZJB 3LZFL 4E42B 1P4BL 3HG1E 3HR5A 4AEEA 4F37K 4CMHB 2DKSA 2RB8A 3G6AB 1J88A 1YNLL 1N3NA 3VFVB 4YZFE 5MEND 1MJJA 2J8OA 4Y4KC 5DJYB 5FV2A 1QFWI 3QNZA 2COQA 2Z35A 4HAGA 1S7XB 3HE7D 4L4JA 4HCRH 1C7TA 5DVLA 4L29B 2ADJB 3KPMA 3BRGC 4WTWA 4ERSH 3WE6A 5A2LH 2NNAB 4YE4L 4TVPH 4JQVA 1D9KB 2BNQA 3PWLB 2CLZB 4OFPA 3ROLB 3B43A 4IDJL 1B88A 5ALBL 3GMPA 1G6RA 1GZQB 5CCKH 4JFDE 1DN0B 4IRSB 4J3SA 4Y1AE 1FZKA 5ADPH 4DKEL 3EO1B 3BMWA 4U6XB 1WJ3A 1Q9KB 3S7GA 2O5XL 3PP3H 2AJZA 4QHUB 1UXSA 5KSAD 3MCG1 5GS1C 2QSQA 3H9ZA 3MYJA 1S3KL 5IVXF 5CZKA 3ROOB 3RWIA 3V5DA 5IW1B 3ZYIA 4FFZL 4H0GA 3MFFA 2VXQL 1NJ9B 4FZ8H 4GAGL 5IKCA 1D5BB 4RCAA 4Q74A 1G7IB 2UV3A 1WSST 4JZNA 4FG6D 2O5XH 4IM8A 5E6YA 1AGEA 5HDQH 2FBOJ 5E8OB 1X5HA 4GAFB 4MJIB 4FQPA 3V79C 3PGCB 4U6YA 2CO7B 1MCPL 1R3KB 3ZT5A 1F02I 3W2DH 2LABA 2XXMB 4P2RB 1FV1B 4NO0A 4Z7QE 1KG0B 1A0QH 3CJJA 3WHE0 1EXUA 3AAZA 5EN2A 1AR1C 1G7QB 4QHLA 5DJZB 3UTTE 1MCJA 3D3VE 1X6LA 3W2DL 3QFDA 5CJXC 4QOKD 4ESKA 1OD9A 2W9EH 5K9OB 4JM2C 2RJMA 4M5ZH 4JDTL 2IPUK 1KOAA 4XC3H 1TZIB 1GGUA 1IJ9A 1CD0A 3QI9A 2IGFL 4WW2F 3JTTA 3MBXL 1UCBH 4MDIA 2VLKA 2XPGB 4FZ8L 4UIMA 3DWTA 3NPZB 4ZUWA 3IFOB 3I2CL 5HYJD 3NTCH 2XTJC 4IDLA 2JB6B 5DUML 4JANB 3SO5A 1L0QA 4YHOL 3O6LH 1YEJH 2NMSA 4U1GC 1UACH 4OZ4B 4LSPL 3ULVL 2VLKB 1PW3A 1P7QA 1R3LB 4LLUB 4ZQKA 4Z7UA 1FGVH 4G8EA 1OPGL 1HH9A 2C9AA 4K23H 4AK1A 1BIIA 2C4XA 4O9HL 4J6RH 1DBBH 3TCLB 1PQZB 3V4VH 4YXKH 5ICYB 2GK0B 5FIEA 5I8EB 3V52L 4GS7C 3MJ6A 1TPXB 3MBXH 4LOUD 2VB5A 3NN8A 4WHTB 1CGSL 2YBRA 1ES0B 1CE6A 2EC8A 5H94B 1MHCB 1P4LA 3WYRA 3DGGB 2OI9C 1XGQA 1R24A 4WHDA 5IVOA 5ESQA 3HB3C 2O93L 4JZNB 2GI7A 3HN3A 4ODWA 2JELH 5E9DD 1OAQL 2EIDA 3SGDH 2ORBH 1S7TA 1BX2B 4WUUD 3UPAA 4LGSB 1IGCL 3RIAF 3X3FH 1I4FB 1X44A 3GSRA 4Z77B 4HT1L 3ZHDA 1TVHA 1KC5H 3CLFH 3IDYB 2HFGL 2O5YH 4TTDC 1ND0B 1WF5A 4JZJB 4MX7A 5LG1A 1AO7B 3RGVB 4WGWB 1P4IL 4JM2B 5EU5A 1EBAA 3C6SA 1FZKB 1NEZG 3QJHB 1DZBA 5GS1B 1HXMB 5TE6H 2D7PA 3DVGB 1VDGA 1D6VH 4LCCC 3FB6A 4U31A 5IB4A 4AJ0A 5EC1A 1D9KA 3V0VB 2HYMA 2NYYC 4N0UA 3O2DH 4I0KA 4X7SL 4LCCA 2DAVA 3DV6A 4PJXE 1AD0A 5DJ2A 4WEBH 2R1YA 2FEEL 5EU6B 3DRQB 2A1WL 1J86A 3U0WL 1FIEA 3KPSD 1U8KB 5DZNA 1DJSA 3OB0H 3RPIA 1FZJB 3TA3A 3GDBA 4I3SL 1GC1C 4OI7A 5HGHB 5SWZA 2OJEA 5F7HA 2PYFB 3OG4B 5C2UB 3U48A 5IHLB 1JPFA 3MNZA 2DBJA 1B0GA 3U30B 2Y5TA 2EKSA 3CGTA 3QQ3A 1J0HA 3K8KA 2GITB 1K8IA 3ZTNL 5MENB 1IM9B 3RHWK 4M4RA 1N2RA 3KPPB 2XQYG 2VUYA 3DSFH 4JFFE 5GRWA 3MV7B 1FG2A 3G6DH 3IJSB 5DYOB 3S4SB 1YY8B 4MA8H 3GSUB 5IMMA 4HKXB 2V6HA 4MHHG 5EU6D 4QRRA 5D1XB 1M4KA 2ICEB 2VL5A 4MXQC 1JNLL 1VFOA 1G7JA 1MUJB 3S98A 6FABH 4CW1A 3PWJA 5DK3A 1X5GA 1HN1A 3CPLA 2JIXD 4PGDA 1YJDH 3JV4B 2PF6A 3PHSA 4PJEA 5T33L 2WUBH 5D2NB 1JP5A 1HHHA 1Q0YL 2D2OA 2NY6C 3PXJA 5D1ZA 5I0DA 5DJ8B 4NO0D 4OT1L 4QWWC 4CVXA 1NCWH 4NKOB 4JQIL 1EAJA 3NGBB 4TPRH 1MHPH 3VXPB 4LF3A 1MJ7H 4DOHE 2J8UB 4LRNH 3S36H 1MJ8H 5J0BA 4AL8H 1EMTL 2XOTA 1IM3B 3PL6B 4U1HB 4OV5A 5CJOL 3TYFA 4KV5F 3FO1A 4Z7OE 5GHWH 1Q0XH 3O41B 1I1RA 2MCPL 3MOBH 2F5AL 3VWKC 2QJDA 3MRGB 3FTGA 5D6CB 3CK0L 1HQRB 4LDLB 3WFDL 2DD8L 1ZT7B 2GW5A 3VWJC 4XPFL 5HHNA 2MMXA 2FIRT 2BY3A 3CFCL 1NFIB 4M93B 3KPRE 4NNPL 5IT2L 1U36A 2QV2A 1MAKA 3CMGA 3GKWL 4HUNB 5EO0B 4P4KB 2J4WH 4G7YL 3B9KB 4LEXH 3VWJA 4CNIB 4FTVD 4JG1H 4PYHA 3O4LA 3D18A 5KBNC 3GRWL 2X7LA 2IQAB 3UTTB 1A47A 4WVRA 1LWRA 2SEBB 3HLAB 1XZ0A 2CLRA 3EKCA 3ULUH 4LHUA 5I15H 5I16A 3ARFB 5C92A 3TH2T 1B2WL 3FONB 4KUZH 5D7KE 5JW4N 1EGJA 5DHVB 1GHFL 4LQFH 1M71A 3SE8L 2OMBA 1JGEA 1YEKL 1CXKA 3NMEA 2AI0H 3OMZA 4EI6A 1BZQK 1PG7H 2BXYA 5F7YC 2XIDA 1V7MH 2DQGL 1UM4L 4PIRF 1NGXB 3VRIB 1GH7A 1DBJL 3CFCH 4A2MA 5I8CB 3VXSA 5HGGS 4DGVL 1E28B 5E8NA 5T1MB 3SGDI 2I27N 4A6YH 1T1YB 1T2QH 3MYZA 5IHUL 1L7IH 4K71B 4LVHB 4M5ZL 4OZFH 2H2PC 5C0FA 2AABH 3V0WL 3MV11 1X5LA 1PG7L 3IAGC 4XGZA 2RFXA 1CFSB 1C5CH 5FUZH 3T8XA 2E8YA 5GRVL 2AJXL 1Y18B 3RWCB 4GBXA 3V0AC 4G42B 3L7FA 1ITCA 2FH6A 3MRFA 3W0WD 1YMHB 4WI9A 2UUDH 4PLKC 1EFXA 2DQIL 4NN7C 2A9MH 4QLRA 5D6DC 1XGPB 2VIRB 4GJTB 3CDYA 2P8MB 5HHNB 4APQD 1J0KA 4Z78B 1ZVYA 2MHAB 2OZ4L 5MEPB 2EXYC 4F80A 5D6CA 4UQ3B 4TUJB 3O2VH 2LU4A 2H2SC 2YPLD 1V7NH 5D7IA 1KEML 1AXSA 1A6WH 1ZKAA 2QHLA 1I3GH 3E2HC 5IWLC 1LO4L 5T3XD 3DARA 4D3CL 2P24A 2BVYA 2R0WL 3ARWA 4RFEB 3SCMD 3UCRA 2GHWB 3ARVA 3KVQA 3FQWA 5D7LB 5L7XL 3QEQA 1LE9B 4MZ3A 4M8QB 1OAQH 3H0TB 2ZUUA 4Z0BH 1PKQB 2FATH 3QEGL 3DROA 5D2NA 1A4JA 2PCPA 4Y5VA 3SE4A 4N8PA 2R4SL 5CIPB 3NCEB 1WZKA 3MRRB 2B5IB 4OZIF 5HDQL 2IADB 2JCCB 4Y4KB 3HFML 5F96H 4KJYB 4ISVB 4X5XB 3V7AG 5GIRA 1QO3B 1X5FA 3PP4L 3MJ8A 5BS0A 3C5ZB 3FAWA 4DEPC 3RWEB 2WUBL 4ZOBA 3MV8B 2K7QA 5J3HC 5JR1L 2Q6WB 4OCYL 2K9UA 3AB0B 4FQXA 1QSFB 1U8HA 4NKMB 4UB0H 1FE8L 1BLNA 3VA6A 4FQ2L 2P45B 4JM2D 4OUUB 4P5MB 4UU9A 4P5TA 5LXGH 4P23A 3RAJH 1UCTA 4P2OA 1WQVT 2GTWB 4OF0A 5IB3B 1PBYA 3FFDB 2ZOLB 4Q9RL 1G9NC 5HHOE 5CCKL 2LTQB 1MJ7L 4TUOB 1OGAE 1WC7B 3QEUA 4NSKA 1A5FH 1JTTA 4G7VH 5C0DB 1NAKH 1FZMA 3QUXD 1WWWX 5HDOA 2OJEB 3B5GA 5DSCB 1NGWA 5AWNH 2M8XA 2Q20A 3I2CH 4MSWB 4JRXD 2YMXL 1HCFX 3BN3B 1J1PL 3HUJE 1FO0L 2GSIB 4EI5B 1YEFH 1OAZH 1RJLA 1HKFA 1NBVL 4LQ1A 3VE0A 2I9LB 43C9A 4ONGL 5ITBH 4N0UB 2QQLH 3Q1SH 5I1IH 4WFFD 5DUBB 4HKBA 5EBMB 5IBUB 1A7OH 1SEBB 2Q7NA 3MXVL 3C6SB 2BVOA 3NIFF 4HMCA 1J8HB 5JW4M 4OIIL 3AROA 2W0LA 5DD5H 5IG7B 4JZJA 4I18B 5FO7B 4P9HH 2DQJH 1QBMH 1RK0A 2VL4A 4UAOB 3ZL4L 1TVHB 2P42B 1RFDL 5JA9A 4D2NA 5DD5L 4LSQH 2WWKT 1IZKA 4MCZA 4AEHL 2EEAA 4AIZA 5DGQA 2RIKA 2GSIA 5B8CA 4NFBA 1MCBA 3NCBB 5EU7C 4EVNA 3DGGA 3P73B 3C6LA 5I1DB 5CWSA 1N64L 1ES0A 1PYWB 5I71C 4XPHH 2NXZD 2X4TB 4PGEB 2AI0L 2IPUG 4TUOA 5HVHC 4XP5L 3OJDA 1J10A 3D39E 5I1KH 4JFYB 4NN7B 4NUJA 3W82A 3U2SB 1UM6H 4JFDB 5KVEL 1PAMA 4F33B 2MQ0A 2AS5M 2E6PA 3QZWA 1QNZH 3MV8A 3C09B 4FXGB 1P7HL 4ZQKB 3GMNA 1YMMB 3RUGA 5J9PA 4NZUL 2Y6SC 1AD9B 3MV7D 2EDFA 3IJYA 3C5JB 4JKPH 3KXFE 3QIUC 2YD5A 5J1TC 1U8PB 4WGVB 2JCCA 4Y4KA 1OP5H 1NCAL 1W8OA 3C60D 3UJJH 1T2QL 1PEWA 4KRLB 4CVUA 5JTWA 1U8PA 3LKNB 4PTUA 1F4XH 2XPGA 4JQVC 5BRZB 3IGAA 3AU1A 3H0TA 3LHPL 2EH7L 4QRTA 4QYOB 1F97A 4AMKL 1OW0A 5JIHA 4R4BA 4O2CA 1PSKL 4RBPK 2IFGA 5C8JA 1KIUA 1M7IB 5FA4A 3SCMA 1S8DB 3X13A 1Q9OB 5IFJB 4K8RL 4WFGE 3MUHL 4NQTA 5EN2B 5HHMD 5EFIB 3RDTC 4U7SA 1FV1A 2I9TB 1KLFA 2YD4A 5DR5H 2APXA 3MQIA 4IMKC 2DJUA 2E6QA 4FQIL 3WIHH 1WZ1L 2HVJA 3I3EA 1LD9B 4Y2DC 3EDEA 4EVNB 4TUJA 4IMKA 5F7DA 1ZGLP 1A9BB 5TE7L 5B8CB 3VRLE 2M1KA 5CEYA 5FYKU 5IV2B 4QXUL 4NZTL 4Z78A 1RIVH 1MFDL 3KDMB 1ZANH 3SY0A 1RY7B 3U9PL 3C9NA 3WLBB 2NXYC 2VZOA 2EKJA 1F4WH