5K9XA

Crystal structure of tryptophan synthase alpha chain from legionella pneumophila subsp. pneumophila
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
272
structure length
262
Chain Sequence
AMNRIDKTLEKLKANRKKMLSPYITAGDPYPELTVSLMHQLVKSGADVLELGIPFSDEGPVIQRAMERALAHSIHCDDVLNMVRQFRKTDTETPVILMGYLNPIEQYGYDLFAQQAVEAGVDGTILVDLPPEEADGVSRVWQKHGLYSIYLCSPTTSAERMNYINQHANGYLYYVSLALKLPELKAQYLQRKAQSKLPLMVGFGIKTPEMAAQVAEFADGVIVGAALINEIIEAYEAKKDPLQASGALLSSMRQAIDNIGSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Crystal structure of Tryptophan synthase alpha chain from Legionella pneumophila subsp. pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila (strain philadelphia 1 / atcc 33152 /
molecule tags Lyase
total genus 82
structure length 262
sequence length 272
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5k9xA00
1OK6A 3CQ0A 1G4PA 4BI7A 1T96A 4OU1A 4JGDA 4GUIA 5DLCA 1FWNA 1VCFA 1SZNA 3PR2A 3MJYA 1VGAA 4OQVA 4JIQA 1GVQA 4OHQA 5E0KA 3H54A 2YGYA 3EWZA 4HT3A 3U2OA 1O95A 5FF0A 1YTKA 1F5ZA 1TMHA 2G97A 2JK2A 5C5YA 4P61A 3BG9A 1VLWA 4PA8A 4UTTA 4ZL1A 4ORMA 3IIOA 3S5ZA 1TPFA 1CX9A 3SR7A 3S0CA 1G7VA 4BI6A 5KMYA 4XQ6A 1LM1A 3RNDA 1EWDA 1A50A 2QCCA 2QEZA 4POCA 4NZFA 2ZTKA 1S5TA 3LXBA 4LC6A 4A21A 3EX1A 4GUGA 4Q33A 2QDHA 3M16A 1TJRA 3GDLA 4GXMA 3P61A 4S2BA 3MO7A 4O8RA 1B57A 4AWTA 2AAMA 1DOSA 5CPLA 1SO4A 5MHBA 4JTLA 4ZQRA 5KZDA 4JTJA 3G1FA 3NPVA 4O12A 2ZRXA 1PVNA 1Q3NA 3UWYA 4UTIA 2ZZ1A 1IIHA 4LRTA 3HBLA 5H2ZA 3SGZA 3EX2A 3LCGA 5LZLA 1NSJA 5G2WA 4A3UA 4M6QA 4MOZA 5K3VA 3GVGA 5BMWA 4MVAA 4EWND 3VNDA 2FPTA 5BMXA 3HQ1A 1TQXA 1WYIA 4ZQPA 3I68A 3BV4A 1XL9A 3A21A 5EY5A 4XKYB 3N14A 4FNSA 4CCCA 4KWVA 2FB2A 5EBUA 4I7UA 5BOOA 4OV4A 3NG3A 3DKJA 1YXCA 3PC0A 2V82A 3NAVA 1SO6A 3STFA 1LCOA 2WQPA 3RK8A 1LOQA 1KV5A 2BZNA 3HGOA 3PUOA 3KX6A 3TAOA 2V2DA 3HOJA 3OBKA 4I7VA 4NQ1A 1FUYA 1GWJA 4U28A 5GVJA 5EPDA 5D32A 5FEXA 3IEBA 3M9YA 1EP3A 1YXDA 2NWRA 4UFHA 2Q8LA 4RX0A 3EKZA 2G5WA 3DH7A 1KFJA 4UTWA 3LRLA 4RZ6A 1GYNA 4WOQA 4JTHA 1LRNA 5G2IA 2ZZ4A 4DEFA 3ZFHA 1OFRA 5KINA 1IIGA 4ICNA 3EX3A 5F1UA 3STEA 5LHFA 4JTEA 4E38A 2WSRA 2ISVA 1ICQA 4MZYA 4P2VA 1KM6A 2E6DA 3JRKA 5AC7A 1V5XA 3LCWA 3TJLA 1EEPA 4B5NA 2RKXA 5K4XA 6TIMA 1IXOA 4O57A 1R46A 4YCOA 1W5OA 4GFSA 2C15A 4LUJA 2NZLA 5L9FA 1H7RA 3W1TA 5ABTA 2V2CA 2GUUA 3LHUA 2A6NA 5HWNA 3EX4A 5LNUA 3BO9A 5EMUA 4N4QA 2ZRWA 2EKCA 1FDZA 3W2LA 2W0UA 3GNDA 2TPSA 2ATSA 1H60A 1KFKA 1ME8A 2NLIA 4UFLA 2QUTA 3MI3A 1NEYA 4FIQA 3QMSA 4UR8A 3U6WA 1J2WA 2Y88A 3NQDA 1X6UA 4Y6GA 4EF9A 5LGXA 3W7GA 3IRDA 3HGRA 2E6AA 3QZEA 1XI3A 3NQ8A 2GVLA 1EUNA 4LV9A 4CQ8A 3G3DA 1JULA 3NZRA 3P82A 4LVAA 1WV2A 2CWNA 1SU5A 1EA0A 3W7MA 2QUUA 4DPQA 5HNRA 3PG9A 4R33A 1H50A 3W2MA 2R91A 5IBXC 3TCEA 3CIXA 1HO4A 3TR2A 5TBOA 4FXSA 4ADUA 5K2ZA 5D33A 4UMBA 5KTLA 2YXGA 3L5AA 2CW6A 5DCEA 5KITA 4O54A 1H63A 3BLFA 1TQJA 3TNOA 3PWAA 1JCNA 1GOXA 3C2VA 3BW2A 4AHQA 3R5EA 3DFQA 3C56A 4O50A 3E0IA 4UTMA 2A1YA 1QCWA 3NPXA 1W54A 4WY0B 3L66A 4LW7A 2YW3A 1KM1A 4AWSA 5D2VA 4UFMA 3TQKA 1RD5A 3W74A 3G0UA 3HGSA 4BI5A 2VXNA 7TIMA 3C61A 2V5BA 3EX6A 3NL6A 4GWEA 4R7JA 1WBHA 1UBSA 4NJGA 3TK7A 1F73A 2VEIA 1AW2A 1OYBA 1AMKA 3L68A 3UWZA 1FY6A 4A2RA 1QO5A 2V5LA 1QFEA 5CZSA 3BGGA 3PF3A 4O1AA 4JD4A 1ZAHA 1HTIA 5A5WA 4LVBA 1DHPA 4E2DA 4QITA 2RDUA 2CZFA 2NXGA 3PS7A 1XM3A 5CKSA 2DZUA 3MMTA 3T7VA 1FXQA 2ZZ2A 4TR9A 3G3MA 3EWBX 3O6DA 3WFAA 4ZQCA 2QKFA 4Z1DA 2VFFA 3UY7A 1SO5A 4YXGA 1OX4B 4C1KA 4QSHA 3HO8A 1QAPA 1XUZA 5DELA 4IPIA 1K7EA 2Q8ZA 4AHPA 4O0KA 2YR1A 4TIMA 3S1UA 1G69A 5CPNA 2DJXA 3W1UA 3C2FA 3H55A 2ZRUA 1YDNA 1X7FA 1DBTA 1JQXA 2NUXA 4FNPA 2BLEA 1RPXA 1SZEA 3I7QA 3TC7A 4XUGA 3LBMA 1VCVA 1SSDA 4QQ3A 3G1SA 1LORA 1UUOA 3GAYA 4MFDA 4PFMA 3ATYA 3FOKA 4BFAA 2J9ZA 3QPZA 1WQ5A 2ZYFA 3G24A 1FBAA 3T55A 1M7OA 5AHMA 1PE1A 3IGUA 2Z6JA 4JDYA 2EHHA 4KFNA 2YYTA 3QQ1A 4N2YA 3PBYA 1JRBA 3TSBA 3O06A 4HNUA 3UQNA 5LNSA 2JKPA 1PS9A 3UWWA 1ZAIA 1KLZA 4OBTA 5DXYA 1WOAA 1EPXA 4XTIA 1QMLA 1YADA 1LROA 4JS3A 2YW4A 4Q32A 2HSAA 4NXSA 1ZNNA 4TX9A 3CB8A 1D9EA 3QRHA 1MO0A 3S1VA 4JTSA 4JX4A 4JNMA 1KM4A 2B0MA 1K03A 2VEKA 1U5JA 1QOPA 3F03K 3LOTA 4ZQNA 4LVGA 4PL2A 2CFFA 2E5BA 1B9BA 2C3ZA 1DVJA 2CZ5A 3B03A 5AYXA 3S42A 3PSVA 2IQTA 3N3MA 3EXSA 4UTKA 3W2KA 3NQFA 4O17A 4DQWA 3UNDA 1FWWA 1Z41A 2X16A 1H62A 3NQMA 4M6PA 1VYSX 8TIMA 3LGEA 1P4CA 4IMEA 5E1QA 1E51A 1RQEA 4WXZA 4AB4A 1QO2A 1ICSA 2HS8A 2Z2UA 5CZJA 3W22A 1N8FA 3G1HA 1P0NA 2OZ0A 1H51A 3DHDA 3MW7A 3G0XA 1C8VA 1DQXA 3PVFA 3FKKA 1RQBA 1W5QA 4LS2A 3TXVA 4QNEA 1G6CA 1X1ZA 3EXRA 1W0MA 4AAJA 4E0CA 4R53A 3TW6A 5DCBA 4MY9A 2DZTA 3HB9A 3NQ2A 4OT7A 4MYAA 1MEWA 3FEMA 3B06A 3BLIA 2GQAA 3V1PA 2BXVA 2W6RA 5D30A 1K7FA 3NQAA 4JTTA 2XN0A 3GYEA 3LCLA 1ALDA 4XWUA 4DBDA 4JTUA 2BTMA 2FB3A 4GUFA 4JX6A 3O05A 1I8JA 5G1YA 1OX6A 5CPOA 3PB2A 3GB6A 4Y8FA 5I3GA 4AHOA 1KM2A 3N19B 1JCXA 2DZWA 5U7SA 3ZR4A 1JCLA 3NL2A 1TREA 1QOQA 4HNTA 2ISSA 4MPQA 3QSRA 1KA9F 3F1QA 1O60A 2HTMA 1JR1A 5SWUA 5LNRA 3QC3A 1OVDA 1VH7A 1XC4A 2DZXA 1BWKA 3W76A 3W7QA 2ZDRA 5LKYA 3KRZA 3LRMA 2ZQ0A 3G0SA 2EPHA 1TYGA 2WNQA 4N9EA 3NGJA 3HG2A 1SFJA 3LCHA 2PCQA 4N4PA 4O1CA 3WJYA 2R14A 2R8WA 4NJKA 3O6YX 3CIWA 3NO5A 1TV8A 1Y0EA 2YCEA 3M47A 1T8XA 3OVRA 4LVFA 4DO6A 1ME9A 3DFOA 1UUMA 3W7JA 3BGJA 4HNVA 4NZJA 4MIMA 4O15A 4M6VA 2CLFA 3PSWA 3P60A 3QF0A 3W7CA 1G4EA 3NPWA 4M19A 3P67A 4NX0A 1LRQA 1KFCA 2XN2A 5J5DA 1MEHA 4XZ9A 3SGUA 3A22A 1FX6A 3THQA 3LTYA 2QCDB 3LHYA 4LS1A 3K30A 1XDMA 2V2HA 3G1YA 1B4EA 3M5ZA 3B0VC 4UTUA 3G1VA 3SY5A 5FF2A 3C8FA 4FHAA 2OX1A 1DKWA 3W2JA 4O16A 2BX7A 4CNOA 3A24A 4Z1AA 5K9XA 4N02A 2ZCGA 2C13A 1TPUA 1GG1A 3L0NA 3O16A 2QAFA 4Q4KA 1TCDA 3IV3A 1KM0A 4IXXA 4MZ1A 3RMJA 2VKZG 3NM1A 1KM3A 1VZWA 4PL1A 4MKNA 3W23A 3HMJG 1I2NA 3P74A 1MSSA 1ZAJA 3G1DA 2GJLA 4XKYA 4JTIA 3KRUA 4LU0A 3WK0A 1M5WA 4KFOA 1Z48A 3PBWA 1AL7A 3CWNA 2FIQA 4JR5A 4NX5A 4M7TA 3NA8A 3MBFA 2Y6ZA 5AYYA 2WOQA 3C4UA 3BVJA 1KM5A 3GXNA 3E49A 1XDLA 3EWXA 2CZDA 1I2RA 2E68A 1H61A 4KFPA 2YX0A 3TDFA 1GT8A 3BG3A 2BSLA 1W5PA 3G8EA 3P81A 4D2JA 3NL5A 1ADOA 3UZ5A 1IF2A 3B05A 2QCNA 1G7UA 3F4WA 1YPFA 4ALDA 3M5XA 3MI2A 1AW5A 1DJQA 2ABBA 2GVGA 2QJIA 3TQ0A 3STGA 1A5CA 3FS2A 3C52A 3O1NA 4AEOA 3KAOA 2JGYA 1TRIA 1CI1A 4UMAA 1LDCA 2A0NA 3GAKA 2GQ8A 4AVFA 4K38A 3KVLA 5EA9A 2XFWA 4OE7A 1EUAA 2J88A 4IX0A 1A5BA 4FXRA 5CGQA 1J5TA 2C14A 1SUXA 2TMDA 4IQLA 3S5YA 3LI1A 2X2GA 1KTNA 1LOSA 3AO0A 4EF8A 2YYUA 5E93A 4LC8A 1OFQA 1YDVA 2NXHA 4HN4A 4BWLA 2VEPA 2YPIA 4A22A 4ADTA 5D03A 3P5YA 1YXYA 3MHFA 4CLMA 1TB3A 4CCDA 1KTBA 1YLVA 1SZFA 3N9RA 2OMAA 2QCHA 2QUVA 3DU0A 2RDTA 3BG5A 2O7QA 5FI8A 1YPIA 5F2IA 4RJEA 2Q3OA 1GPWA 3R13A 1OFBA 5HUPA 1VQTA 1A5AA 1XBZA 3UWQA 5D2TA 1H7WA 3KOFA 3PUDA 3TH6A 1LBMA 3W7DA 3QPYA 1OHLA 3L5MA 3WK3A 1Q6QA 2ALDA 3CM4A 4L4MA 3GR7A 2NXIA 3GK0A 3UPWA 3NVTA 5HWMA 2FPYA 3LCXA 3I7SA 2AQWA 3DFPA 4UC5A 5AHIA 3EWYA 5CPMA 5HMSA 4A2SA 4S2CA 1LYXA 5CZ0A 4WQ6A 1B4KA 4LS0A 3HF3A 1ME7A 3LB0A 3QQ0A 5D05A 2VELA 2NX9A 3HPZA 1HFBA 1TV7A 1EB3A 5AFDA 3W9ZA 4QIUA 2GOUA 4BR1A 3A5VA 3A9IA 5DBUA 3I6RA 1LRTA 1Q6LA 2HMCA 3W1MA 1W56A 5TQLA 4IMFA 4JEQA 3NDOA 3S5OA 3W7RA 5AN7A 2EF9A 3STCA 1Q45A 1J4EA 3SJ3A 1PHQA 2LLEA 5DXXA 2Y89A 3QM3A 5I3HA 4FIRA 4IUOA 4WY0A 3IGXA 1K8ZA 4PEKA 5F2LA 2X1TA 1EWEA 2B7QA 1R2TA 4JTKA 4FX7A 1S5VA 3D0CA 4GUHA 4JX5A 4O0ZA 4M7SA 3CTLA 3HJZA 3LHTA 4ZQOA 1FCQA 3IVUA 2Y7GA 2C1HA 4BF9A 5DY2A 1A5SA 4IX2A 3NNTA 2VFEA 3HG5A 3SSJA 6ALDA 2G95A 5K7JA 2QF7A 5I3KA 3SFKA 4WJEA 1F74A 3YPIA 1S3HA 4HNNA 2FLIA 4DF1A 3T44A 1PCKA 2F7FA 5K9DA 1VJIA 2WV8A 1I4NA 4AXKA 3LLFA 2H8XA 4UTTC 3LHVA 1GG0A 3TMQA 4PODA 3O8AA 1BWLA 3UY8A 1W1ZA 3DBPA 4AH7A 2QCGA 3HG3A 4LT9A 2QCLA 1H1ZA 4LUIA 2NX1A 5F4WA 3F4NA 1GQNA 5CG7A 1TO3A 5T26A 3MYPA 2TRSA 1AK5A 3LI0A 3TIMA 1G4SA 2EAWA 2A21A 1ZY9A 3E96A 3LXCA 3ANYA 3W1LA 2KZHA 1TPEA 3BLEA 2CLOA 1P5BA 2C6QA 1GVOA 1HO1A 4HPXA 1OF8A 2Q3RA 3OVQA 5F4XA 2GPTA 3M0ZA 1TPDA 1W3TA 5HULA 3BW4A 4UMCA 3W7NA 3S1XA 1PL9A 2E6YA 3TJXA 4QISA 5CSSA 5K9CA 5AHEA 5DBTA 1QPOA 2WSQA 1JUEA 4JICA 2RDWA 3NR0A 4S1FA 2BWGA 3TV8A 3W87A 1JUBA 1DL3A 5D02A 4H6KA 4ZQMA 1XUUA 3W71A 1DV7A 3B8DA 4UTLA 1TRDA 2TYSA 1LP6A 4O4WA 1C9DA 5G4WA 2CLLA 1I2OA 4IWWA 4HHPA 1R30A 4O13A 2FFCA 1YDOA 3CWOX 1JCYA 3QH2A 3W75A 4DELA 3C2EA 2B7OA 3LTSA 2UV8G 1TPB1 2PRHA 4GC4A 3L2IA 3ZWTA 3OA3A 2Y7FA 3EB2A 3L0GA 1XBYA 2V30A 4RV8A 2VEMA 5LHEA 4ZZ9A 1W8SA 4NNAA 2JBMA 4X22A 4UFJA 1I2PA 1FDJA 1IXPA 3W88A 3CLMA 4DF2A 1X1OA 2WJZA 3QFEA 5G4EA 5AB3A 3C3NA 3EKLA 4XBSA 1D3GA 2CLKA 2QR6A 2C0AA 4UTWC 4PC8A 3UPBA 5KZEA 1OJXA 1ONRA 3FKRA 2Z1BA 4N6FA 3C6CA 2RH9A 2ZZ5A 3N73A 4JN6A 1VYRA 5AHLA 1LBFA 4RZ5A 5F2MA 1VLIA 5G5IA 5KSWA 2B4GA 2CLEA 5LGZA 3W7OA 2P1FA 3MBDA 3LHWA 5HQEA 4GUJA 4LWWA 1WX0A 3LDVA 5F1VA 3EWWA 2FJKA 1Q6RA 2A7NA 4O18A 3NXFA 1KW1A 2J6XA 5U4NA 5D37A 3W6YA 3TAKA 5LSMA 4RCXA 1OFPA 3W83A 1PCWA 3SW6A 2QCMA 2QAPA 4GNJA 3H53A 1L9WA 3M41A 2VFGA 3W85A 2DU2A 1F6PA 3GIYA 3GX9A 2ISWA 3N2XA 4H3DA 1G4TA 3GDMA 3W1XA 3L5LA 1Z44A 4JY9A 3EWUA 2A7PA 4QAIA 3W86A 1R2SA 3THAA 1JRCA 4U4MA 3WJZA 1OK4A 3S1WA 5HJLA 1YTEA 4UIOA 3FJ6A 2C19A 2QJGA 2YFOA 3OHIA 4K6AA 2VOMA 1BEUA 3RF9A 1ZENA 2Y85A 3LCIA 3W1NA 1ZCOA 3AJXA 3DI1A 1OFAA 4FEZA 1FWSA 3LV5A 4GE8A 1H5YA 4UXDA 1W3IA 2WO5A 4JY8A 4I7WA 4Y90A 1OX5A 1I2QA 1TTPA 3W84A 2H6RA 3HPSA 3WJSA 3LXAA 5C6MA 1LTDA 1VHCA 3NOEA 1M7PA 3SZ8A 3CHVA 3CEPA 5AC6A 3W1RA 2D73A 3UXDA 3RFAA 2H3DA 1QR7A 3UWVA 4N9DA 1H7XA 3JS3A 3OG3A 3NEVA 1WAUA 3P7YA 1TJPA 4C1LA 5G1TA 1TPC1 3G18A 2VFIA 1P1XA 1JUKA 3W72A 3L9CA 1K8XA 2P10A 3SECA 5FF3A 3ABRA 1IXNA 1R2RA 1KFEA 1UCWA 3IIPA 3UWUA 1OFEA 2P0OA 3GNNA 4NNBA 1WOBA 1MXSA 2JKAA 3DKLA 1FCVA 2FPVA 4OGZA 3BPWA 1H7NA 5FF7A 3LX9A 1U83A 2JGQA 1SW7A 1SW3A 4DO5A 4CNPA 4FX8A 1FQ0A 1QNVA 3P5ZA 1CW2A 2Z0IA 3TSMA 4IOTA 2YSWA 3QW4B 2ZZ6A 1OYAA 1M6JA 4PTNA 3TFCA 1GZGA 3RU6A 4MFEA 4RR4A 2DJLA 1UJPA 5EKYA 3TKFA 4AF0B 1F7BA 2ZA1A 4BK9A 1L6SA 3E02A 2VC6A 1AW1A 2Y7EA 3B4UA 1L6WA 1TIMA 3NPUA 1W37A 4NNCA 2ZZ3A 4TU1A 1DJNA 4UNKA 2XN1A 2DORA 1DQWA 2H90A 2CLIA 1EX5A 1ML1A 4K7YA 4AWUA 4J9JA 4KWWA 3OVPA 3W1PA 4LVDA 2FTPA 2AGKA 2B7NA 5I3JA 4K8HA 1KV8A 2ZA2A 3W7EA 3GXTA 1ICPA 1XBXA 4MJZA 2PURA 4Z0JA 1HL2A 4Y9AA 2VFHA 5FEPA 5BRBA 1O4UA 4GRSA 1GVRA 3E12A 3PG8A 4WD0A 3LM7A 1VCGA 3UYCA 5FEWA 3PM6A 2CLHA 1ZJIA 3IIXA 4YMZA 1HG3A 3MHGA 4MUZA 3O15A 1KFBA 3UZJA 1XFBA 4QM1A 3W70A 3MP5A 1SSGA 3NL3A 3CT7A 4K39A 2X1UA 5AOUA 1ZALA 1KBJA 3KRSA 5IBXA 2WKJA 1F76A 3T40A 4DXVA 2V0TA 2ATMA 5FESA 3L65A 5H91A 3N9SA 4O11A 2JKEA 1XCFA 3RLUA 1QDSA 3PBUA 4N9BA 5IM51 5L6UA 1LBLA 1NAL1 2QCFA 3MP4A 4GBUA 4M5PA 1H7PA 1A53A 3VKJA 4DBEA 2NV2A 1RV8A 3G1XA 4YWIA 3B0PA 3W7PA 2X1RA 4MYXA 1FCUA 1XBVA 1OFDA 1JCJA 4Z0SA 5A8GA 3M7WA 3HGJA 1JJKA 3O07A 4ZMGA 4K37A 1G67A 5C54A 3M6YA 2YDAA 1TPVA 4JTGA 1EP2A 1H7OA 2V9DA 4UFKA 5AC8A 1PHWA 1F05A 4IJBA 4NJHA 1N7KA 4O53A 1SZGA 2NX3A 4MLRA 3P62A 3DFTA 1OG0A 3NQ6A 1L2UA 4FF7A 2PRLA 1LLWA 4N9CA 3ABQA 4OV9A 1OABA 2OT1A 3WJXA 3MWAA 1OFOA 1WBJA 3W7KA 1QPRA 5HWJA 2GVJA 3S8HA 3CPRA 5KZMA 2QJHA 3RLVA 1W5MA 3C2RA 3W2UA 2E5DA 3P84A 5F2GA 4DPPA 3O6CA 3DI0A 3VFLA 4TO8A 1THFD 2A6LA 2H3BA 2V81A 3LLDA 1B3OA 1SW0A 4UTHA 3M44A 5I3IA 3IIZA 1H1YA 2ZRVA 4NVTA 5CSRA 1D3HA 1RQHA 5EL1A 1UB3A 4JTFA 4JYFA 1SFLA 3W2NA 2PC4A 5I3FA 1TTQA 2FDSA 3HG4A 3S5NA 5K4ZA 4NU7A 3TQVA 3V75A 4UTJA 1QWGA 5BNKA 3NM3A 5D09A 1T99A 4RKAA 4LTSA 3NQ7A 3Q37A 1P0KA 1LLZA 5DCDA 3PAJA 2ZTJA 3Q58A 1X8FA 3GKAA 1FWTA 1UASA 2C18A 3CC1A 3QMRA 4FB7A 3ZS4A 3NZ1A 3IIVA 3TE9A 1BTMA 1YTDA 2ABAA 5HUOA 3TSDA 1PIIA 1WA3A 4MJMA 3W3OA 4QJ1A 4JIPA 3P8IA 3KVJA 4MLJA 3UXAA 1FWRA 1GYLA 3PULA 4O52A 4UR7A 3C2OA 3LRKA 1GTHA 3I7RA 4LOCA 4NUWA 4IMGA 2GQ9A 2Y7DA 4Z1CA 5FEZA 2WSYA 1RR2A 5D2YA 2QCEA 3GDRA 3Q94A 3HPXA 3GDKA 4NT0A 2VENA 2H8ZA 4E2BA 2WNNA 4UUIA 3R8RA 3LERA 4TMBA 1KBIA 2E1DA 3M1ZA 4WOZA 1SPQA 3GXPA 2HS6A 2PE4A 4K8EA 1WDWA 5F4SA 5D04C 2I1OA 1JQVA 1O5KA 4HIBA 3S9YA 1O5XA 1IXQA 2DZSA 1L6YA 3O63A 3C0JA 4GJ1A 4I9AA 3TU9A 1OYCA 4CCEA 1NF7A 3L0KA 1GTEA 3DFSA 2I14A 2Y63A 1VPXA 2NUYA 2WPBA 4HSOA 4XBKA 2V8ZA 3CEUA 5C55A 4IXHA 3QYQA 1ZHAA 4Y96A 1T0OA 3KHJA 2Y70A 2PRMA 1F6KA 2ZFAA 3R89A 5DN1A 3BK0A 2A7RA 1FDYA 4JDBA 3GKFA 1QPNA 3VCRA 5FF4A 3P8JA 1LZOA 4CNNA 3PUEA 1FCBA 1RVGA 1OF6A 3FYPA 4UFIA 1JVNA 3I65A 1TTIA 3IVTA 2J24A 3FLUA 3N34A 4ML9A 3KFTA 4L4LA 3NQEA 2NV1A 3GLCA 1GVSA 1OX4A 2E77A 4O1DA 3UD6A 4WX2A 2DZPA 1HUVA 2VFDA 1ZFJA 3QW3A 1VHNA 1C29A 3R12A 3GZ3A 3LHZA 2YZRA 3M43A 4JXCA 3NQVA 4EIVA 4RLIA 4YCPA 4NXKA 4CQ9A 4EOUA 3JR2A 2G96A 3WJWA 1SO3A 4FNUA 3TUUA 1S5WA 1SQ7A 3LV6A 4IPJA 3W7IA 4DF0A 1VC4A 4LY8A 1EP1A 3DXIA 3PB0A 1KLYA 1FXPA 1NFBA 5C2XA 4IGHA 3QSTA 3N2MA 4TMCA 4FNTA 5D38A 1YYAA 1Z42A 5G2HA 5HR7A 3Q2DA 2O7SA 1SR9A 2ZRZA 2GJNA 3NQGA 3M5YA 3VE7A 5LNVA 4IMCA 1EIXA 3S6DA 4ORIA 3WK1A 4WY0F 4YL2A 3G22A 4A29A 4X2RA 2CZEA 4BWLC 5AYZA 1AG1O 2WNZA 2B7PA 5LNWA 2CU0A 3FA5A 4MY1A 1W31A 3NQCA 3B04A 3IVSA 2OCZA 3ABOA 2ZA3A 3SI9A 3R2GA 4JYEA 3PY2A 5DY3A 3ABSA 4WUIA 1BKSA 3DGRA 1TPWA 4DO4A 2YFNA 5BW6A 3EXTA 1F2JA 4RXFA 3T4CA 4CQAA 4G1KA 1GJPA 4LNYA 1XKYA 5AHFA 1LOLA 1TTJA 3MI6A 3U8GA 4O19A 4QNWA 4UCGA 1KFLA 3KVMA 3CU2A 3KXQA 2A5HA 3DAQA 3LCFA 2RHGA 4LRSA 4IMDA 1AL8A 2A85A 4K7VA 3NYZA 4FO4A 4WZHA 4XTDA 2W79A 3OEXA 4X3ZA 2NUWA 4H4IA 3LTPA 3TROA 1Q6OA 3MYOA 4ZVJA 4WXYA 1IGSA 3VI2A 3QJAA 3P80A 4NJJA 3FYOA 1NVMA 4NJIA 4MY8A 3QMTA 2ZZ7A 4N6EA 1VR6A 2E5CA 3BW3A 3TFXA 2Y62A 1QPQA 2NWSA 4MZ8A 3HIJA 1MEIA 4HPJA 3E9AA 3B0UX 4FNQA 1K3UA 1R47A 1XXXA 4FX6M 4R34A 4O1BA 4PH6A 1O94A 4Z1BA 2OT0A 2EGZA 3VE9A 1K8YA 3L21A 4RZ4A 4O28A 2ZRYA 3G1AA 3IGSA 3TW7A 1GEQA 2X30A 3W73A 2Z6IA 1MZHA 4ONVA 4AMAA 3INPA 5D2WA 1WXJA 3BARA 3W07A 1N55A 4JYDA 2Y61A 3MP3A 4EVZA 2R94A 2E09A 2FQIA 4RXGA 3MUXA 4O4VA 5D2XA 4AF0A 2A4AA 3L67A 1VS1A 4Z08A 3A23A 4YLWA 3M5VA 3FIGA 1RZMA 3QEZA 3ELFA 1VRDA 2X1SA 1GVFA 2E6FA 1KTCA 3ZWSA 4KKXA 3W1AA 3FJLA 3A5FA 5J5RA 2J27A 3USBA 3W7HA 3LBCA 4K36A 5AHNA 1W3NA 3GDTA 3DZ1A 1V7YA 1TPH1 2C16A 1W5NA 3GR8A 2J9YA 2QCDA 2TSYA 3W7LA 3KVKA 5EYWA 4OWGA 2F84A 3ATZA 3TX9A 4PCFA 4FNRA 2CLMA 4UNLA 2QDGA 4HSNA 1I45A 3EEGA 3DENA 3DFNA 3G8RA 5CZTA 1NF0A 3TA6A 2I9EA 3TMLA 1PV8A 2OJPA 2ZBTA 5HR6A 3PBVA 2DZVA 2A2IA 4HKPA 3T78A 3WK2A 1TV5A 3SIZA 4LV4A 4O14A 1JCMP 2DP3A 3W1QA 3TC6A 4RK8A 1TSIA 5HINA 4ADSA 3DHFA 1DORA 4W9TA 3OIXA 3TXZA 1VYPX 1K02A 5TIMA 4X9SA 3MHUA 1K7XA 4O10A 3FFSA 2RFGA 2J9XA
chains in the Genus database with same CATH superfamily
1V3LA 3CQ0A 1VRXA 4W7VA 4BI7A 1T96A 2XSXA 4OU1A 4CD8A 4A8LA 4JGDA 5FA5A 1BF6A 4H00A 4ZOBA 1HF6A 3GBDA 1R5YA 4RDYA 5EMLA 3EA1A 4PMYA 1PB0A 2QVNA 1AODA 4OHQA 3H54A 2YGYA 3ES8A 1O95A 4D6JA 5FF0A 3E0WA 1YEYA 3AMCA 5DMYA 1F5ZA 3VKBA 5C5YA 4PA8A 2Y8VA 1FHDA 1CX9A 4BI6A 3IJ6A 2QCCA 4POCA 3S47A 3LXBA 5LIWX 2PBGA 1I1WA 4LAZA 1V3HA 3GDLA 4S2BA 1MXGA 3SRDA 4O8RA 3VIFA 5DQPA 1IT0A 4O1EA 1DOSA 1NU5A 3N1AA 4Q4PA 5CPLA 5FJTA 2ACQA 4JTJA 4GNKB 1QNRA 3KP0A 4BQ2A 4AD4A 4HK6A 5ABGA 3SGZA 3EX2A 5XIMA 3LCGA 2XYLA 1QT1A 1RBOB 1NY1A 4J28A 3AQUA 1NSJA 1UKOA 4MOZA 5K3VA 5BMWA 2WQDA 1UC4A 1WYIA 4R5EA 3BV4A 3A21A 3IUIA 1IV8A 2D1ZA 5EY5A 4KWVA 4I7UA 2X09A 4AD2A 3SDOA 3PC0A 5G1MA 4DAIA 4OVXA 1XYFA 1V3IA 3AMDA 2WQPA 1KV5A 3OBKA 4P8XA 3CHDA 3B97A 2WLZA 4ILSA 1UMLA 1EX1A 1Z3NA 2E40A 2NWRA 4NY2A 2Q8LA 3UGVA 4CD4A 5BOFA 1E5JA 1WKYA 3LRLA 4RZ6A 2PTZA 4WOQA 4G7EA 4DEFA 1IZKA 1OFRA 5KINA 4QCEA 4E38A 1R38A 1ICQA 4MZYA 4IH3A 3FK4A 4ZA0A 8XIAA 2BFGA 1EEPA 4HZMA 3CO8A 1K70A 5K4XA 5JQ9A 1XLJA 3PK7A 2PGFA 4AZBA 4Q8TA 3UG3A 3LQGA 1W5OA 4GFSA 1VFSA 3FYYA 3LNMA 1RSCA 3N3TA 3LHUA 1XIIA 3PHAA 3NDZA 4DBWA 1XYAA 4H6RA 5H8MA 4N4QA 4NYUA 2ZRWA 2VTFA 2XIIA 2ATSA 1JXKA 1R9YA 4XBJA 1NEYA 3TTEA 1J2WA 2Y88A 3GUGA 4DLFA 2YB4A 5FJJA 1J12A 1FWEC 3PZNA 1XI3A 5EU9A 5DT7A 4BQ3A 4IJRA 3P82A 1EZ2A 4LVAA 4EPBC 3UP8A 1WV2A 2CWNA 1SU5A 1KQZA 4PCNA 2VX5A 3PG9A 2R91A 5IBXC 3TR2A 2GLKA 1XG3A 1XLAA 2Z26A 3AHYA 4YHGA 5KITA 1H63A 1KXQA 2FMNA 4GG9A 4PCTA 1TQJA 1JCNA 4E2VA 5AECA 3R5EA 3E74A 3DFQA 2XWEA 1POKA 4UTMA 3ANVA 7REQB 3Q67A 2DDXA 2WHMA 4LW7A 1VJZA 5F7UA 4BI5A 3N2OA 4Q4SA 7TIMA 3NL6A 4QX4A 1UBSA 4NJGA 3TK7A 1TZZA 1WXZA 5E09A 2VEIA 3ME3A 4WRHA 1XYBA 4DJFD 1FY6A 1CT5A 2H9AB 2V5LA 3MU7A 4GZEA 2GVYA 3BGGA 4O1AA 3QOKA 1ZAHA 2YKKA 5A5WA 3KE0A 4LVBA 4E2DA 4QITA 2C71A 4EXBA 5IRPA 2WVUA 3GVRA 1XM3A 3GHSA 4AG0A 1IEVA 2DZUA 3WQWA 3GHUA 1E0TA 4GVGA 5BWAA 4TR9A 4MB5A 3G3MA 1RK5A 4R9XA 1SO5A 4C1KA 1X38A 1QAPA 1XUZA 3O9NA 1DPMA 3BDKA 5HNNA 4O0KA 3S1UA 1G69A 2IMRA 4NZ1A 1C93A 4FI4A 4LGXA 1X7FA 3JZEA 2NUXA 3BAJA 1QUMA 4GJJA 3KWXA 2BLEA 3TC7A 4XUGA 4FALA 4X2PA 4CNSA 5JBDA 1LQAA 2WMKA 2KX9A 2PDYA 4PFMA 4MFDA 4UR9A 4BFAA 3NUKA 4H7CA 4K2SA 4NAFA 1MNZA 4QFUA 1ZRQA 2XIOA 1FBAA 3T55A 3U4FA 2EHHA 1AQHA 1JRBA 3TSBA 1M04A 4RNIA 2JKPA 1ZAIA 3MJMA 3LG3A 3GC5A 1B1YA 4A3RA 3EOEA 4YVPA 1YADA 1LROA 2YW4A 3MMWA 4FLSA 1CBGA 2DSZA 3CB8A 3SUVA 3VDCA 1E1CB 3CQKA 4H9TA 4KGLA 5CGTA 3L23A 4B3KA 4JTSA 4JX4A 4Q3MA 3PZOA 1U5JA 1EJ7L 3WLKX 3LOTA 2CFFA 1GOMA 2E5BA 5H8UA 3S42A 3PSVA 2IQTA 2UWFA 1OIFA 4RV3A 3V7PA 4O17A 3V4BA 4R88A 1MI3A 1FWWA 1PX4A 1H62A 1WO2A 2QQ6A 4WXZA 4AB4A 1GUVA 1XIMA 2WPGA 5HPOA 4XB3A 1P0NA 3DHDA 3H24A 1DQXA 2J7CA 1RA0A 1CGYA 4JBRA 1G6CA 4S3EA 3EXRA 1W9VA 4E0CA 2OLHA 1HW6A 4MNJA 3PZQA 3HB9A 3NQ2A 4MYAA 4HA3A 1CXHA 2DVTA 1FKXA 3TTSA 2BXVA 3O3RA 3AIEA 5D9MA 4JTTA 2WM1A 3GVVA 1C8QA 2HPMA 3USZA 2WVSA 4GUFA 3O05A 3VCNA 3T4WA 5LXXA 3OHMB 4OBSA 1FWAC 2OR2A 1Z8AA 4IFOA 3P14A 3GTNA 3HJEA 5U7SA 1GOKA 1TREA 1JI1A 2EJAA 1XDJA 4RPPA 1PKYA 2ZX9A 1DE5A 3F4VA 4M3PA 3QSRA 3DGBA 3F1QA 3GG1A 2PU0A 2VR4A 3IANA 5HAOA 2VMFA 3AWOA 1JDCA 5LNRA 2XIBA 1VH7A 4MM1A 4ENLA 5CBBA 1REQA 3KW3A 3AC0A 3W76A 4UWMA 5LKYA 3CL7A 1OZQA 1TYGA 2AKZA 3HG2A 3MZNA 5DT5A 3O6YX 3CIWA 2PA6A 2YCJA 3NO5A 3ZIZA 3M47A 1Y0EA 1T8XA 3EB4A 3T2PA 1S1PA 4FLQA 3QBUA 1W2VA 4HNVA 4PMXA 1ZUAX 4AZCB 2CLFA 3QF0A 1OADA 3P67A 4NX0A 3CQJA 1XLLA 4BQ5A 3B0YA 3TOPA 2RJGA 3A22A 4YVXA 3WDQA 2QNEA 5ABFA 1CLXA 1UYQA 3B0VC 3RRXA 7PTDA 2BX7A 2OOFA 4N02A 2WBGA 2QAFA 3IV3A 1KM0A 4KESA 2YXOA 2PDJA 3HURA 4MZ1A 1EF3A 2YCIX 1CEOA 4MKNA 3W23A 4D8LA 2J7DA 4GISA 3C0SA 4XKYA 4JTIA 5E9XA 2RJHA 4LU0A 2OQHA 1M5WA 4KFOA 1B3ZA 1Z48A 3PBWA 1JZ5A 3AXMA 3CWNA 1ENUA 3PZUA 3F5LA 3OG2A 3C4UA 3RM4A 4A8RA 3WX7A 1G94A 2WYSA 3KZPA 4MKSA 4JQ4A 1I2RA 1A80A 4KFPA 1GT8A 3AXHA 1JDFA 1MUWA 3G8EA 2PZ0A 1ADOA 3S1GA 3CZJA 3UZ5A 4AMCA 1E43A 2WJFA 2QCNA 3B05A 2AMXA 2HE5A 2BV9A 1XIBA 3M5XA 3ITGA 3O1NA 2VGBA 5D8ZA 3B8VA 3V5OA 1OCQA 2VX6A 1LDCA 4PMUA 3R10A 4K38A 5EA9A 3CT2A 4V28A 2RUSA 4NKCA 2DUAA 1QXLA 3BMVA 4GZJA 3AIUA 4QG9A 3C2YA 1BQGA 3S5YA 1UD2A 1KXTA 5E93A 3ABXA 2I5QA 4LC8A 1OFQA 3D46A 1XYCA 2GGEA 4YS1A 4BWLA 2VEPA 3HZ3A 5D03A 4GZ7A 1OZMA 1KTBA 1SZFA 3CYJA 4ZXLA 3W24A 3DU0A 1UZHA 1XGDA 2VCBA 1QTWA 3T42A 1OFBA 1OGBA 3RILA 4WGXA 1Y8BA 2OKTA 1H7WA 4HK7A 4TXEA 3TH6A 1LBMA 3W7DA 3N12A 3GU9A 2ALDA 3OBAA 2GFTA 4WEVX 3AJ7A 1BYBA 1NDZA 1QHPA 1UR3M 3WD0A 3UPWA 5CC5A 2I56A 2AQWA 3EWYA 5CPMA 1XH2A 3HF3A 1GOQA 4TV5A 1ME7A 3LB0A 3GXIA 2CBVA 3LSBA 1VJSA 2VVNA 4QIUA 5DBUA 1MDRA 1H0GA 2WB5A 3I6RA 3B8IA 2HMCA 2VO5A 2PWHA 2QW5A 3LA4A 4IMFA 4JTCA 1DWFM 3U0HA 3L4WA 2FZ9A 2EF9A 3SJ3A 1ITQA 1GVYA 3QM3A 2IW0A 3EMQA 4G7EB 4NASA 4QXIA 1K8ZA 5F2LA 2X1TA 1S5VA 3OU8A 4GUHA 3VDHA 4JX5A 4D6CA 2GK1A 4PFHA 3IVUA 4E4FA 4BF9A 3U3HA 3HG5A 2VC5A 3ZYZA 4WDWA 5I00A 1CXLA 1RVKA 3YPIA 1R0MA 1V51A 3T44A 1O7AA 1OG6A 2F7FA 1ZJAA 3CUZA 2PWGA 1GG0A 1JPKA 1DJWA 3UY8A 3EA3A 1E6PA 1J01A 3SSZA 2NQZA 3AU6A 1GQKA 3MYPA 3R11A 5EMYA 3NVDA 3UR7A 1AK5A 4F3HA 3NWRA 4PB4A 1ZY9A 4DYJA 3W1LA 2W62A 2FVKA 3H21A 5F4XA 3OZPA 3F2CA 3M0ZA 1TPDA 4GC3A 4QEHA 2E6YA 4FR1A 1KWGA 5DBTA 1QPOA 2WSQA 1JUEA 4M80A 3NR0A 2X0YA 3K4DA 1U30A 5ABEA 4UTLA 2QPSA 2BOEX 1LP6A 4CU8A 3WDHA 4HHPA 1VIZA 3JUGA 3C2EA 4HOZA 1XIFA 2ON3A 4F0MA 4JTRA 5LYRA 3VNZA 3OA3A 4RV8A 2VEMA 3WENA 3QY7A 1UKQA 2XFYA 4NNAA 1OC5A 3B8SA 1A4LA 2WSPA 3U9IA 1FDJA 1IXPA 1Y65A 3W88A 3TTYA 4DZHA 1X1OA 2WJZA 1KFWA 3MPGA 3EKLA 3GTXA 1D3GA 4XBSA 5TD4A 4I90A 4PCPA 4PC8A 1OJXA 1TWZA 5JUVA 2RH9A 2ZZ5A 3N73A 4R85A 3C5QA 1RJPA 1LBFA 1RLCL 4HMDA 5F2MA 4I9JA 2XZ7A 3W7OA 4GUJA 3UVAA 3GXFA 3LDVA 5F1VA 5CLTA 2A7NA 3ANUA 6A3HA 2J8TA 2ZXDA 4J3UA 3U4AA 4RCXA 4PYSA 3WD1A 3SW6A 2J77A 3H53A 3M41A 1UR9A 4JQ3A 5BYWA 4H3DA 3L5LA 1Z44A 1A3HA 4JY9A 3L2MA 3EWUA 3VIJA 1V0KA 1R2SA 3THAA 1LLOA 4C65A 1MUMA 4UIOA 4KWOA 2C19A 2YFOA 2QJGA 1LT7A 4K6AA 2A3LA 1QBAA 1BEUA 2Y85A 3VIMA 1CIUA 4KRZA 4TTGA 4PBGA 3DI1A 3VABA 1A3XA 4RNJA 2V5JA 1P6WA 2BG5A 1SJDA 4D71A 3SCSA 1PZ2A 1IZJA 1UKPA 4GE8A 3BUVA 3ZSTA 4C1NA 1CLVA 2XGZA 4Y90A 4QR6A 1MFUA 2H6RA 3T0BA 3WJSA 3UXLA 4XZBA 3ARUA 4MWAE 1VHCA 1M7PA 3PAOA 3CHVA 1AD4A 2WVVA 3C86A 4M51A 3T0DA 2D73A 3RFAA 3KP1A 1DEDA 4UOZA 2AGTA 5G1TA 3G18A 4TV6A 4AW7A 3VD4A 2OFJA 2MUCA 1F61A 1KXHA 3SUWA 4IIFA 3SFWA 5FF3A 1FKWA 4DN1A 3AIBA 3GNNA 1ZBCA 1UD8A 2XTKA 3VKAA 2WZMA 3DKLA 4XK2A 1BXNA 1BTCA 2HXUA 4JFVA 4CN4A 2WLYA 4ES4A 1SW7A 1SW3A 4CNPA 1FQ0A 4U2YA 2WC7A 4JFTA 2IKJA 1OYAA 1M6JA 1ZS2A 4PTNA 2YL8A 2QYGA 4RR4A 3R25A 5HATA 4D6IA 2XM2A 4D1IA 4EE9A 1W3LA 2Y5EA 3JW7A 1AW1A 4R7WA 3B4UA 2Y7EA 3T8LA 2ZZ3A 5AY7A 3G6LA 4QLLA 4TU1A 1DJNA 2XN1A 2VCCA 3N2TA 2CLIA 1ML1A 4AIBA 2YBTA 5T8GA 5IOBA 4Y9NA 1KV8A 2WW5A 3MZ2A 2HISA 1OY0A 1E70M 1HL2A 1XD1A 3VNYA 1GVRA 2OOGA 1B9ZA 5G4HC 3ZLGA 1IYXA 1W8GA 2Y2WA 3MHGA 1C8YA 4MUZA 1OINA 3O15A 3TYDA 3ZR6A 3HM7A 1SSGA 1SMAA 3MANA 5IFPA 3CT7A 4I8YA 3KRSA 2ZXQA 2VWTA 3N04A 4RE0A 5A69A 1QRQA 1QI5A 1MW0A 1US3A 1KCKA 1REQB 4E2OA 5A2AA 1O12A 4M56A 3CHFA 1NOUA 2YDSA 5L6UA 2QCFA 3SUUA 9XIAA 4WF7A 1H7PA 2O9OA 1A53A 2NV2A 3SRKA 4DWSD 3SQSA 1RJQA 3ZJ8A 3CHCA 3UCQA 2Z4GA 4B9ZA 3HGJA 4ZMGA 2EG6A 4YWSA 3WLRA 3M6YA 2VZSA 5ABFB 2GWNA 1MNSA 1MDLA 3A6OA 4H01A 5AC8A 1US2A 3BLLA 3ERPA 1RHCA 1HP5A 3E0LA 3I4KA 4NJHA 1PSCA 4JL2A 1L2UA 4PUDA 4AD1A 2PRLA 4PBEA 1FH7A 4GGHA 2FZ8A 1XLKA 2C7FA 3W7KA 1PDZA 1UZ4A 4GH1A 4LPCA 2O4QA 3AYRA 3Q45A 1W5MA 5CC3A 3CUGA 4GPNA 1THFD 2A6LA 2XIMA 4OZOA 2OWCA 1V6YA 4NI8A 3UZYA 4NVTA 1JZ3A 3GQYA 3GM8A 2VC7A 3F7JA 1SFLA 1B3YA 3KS5A 3W2NA 3IS4A 2FDSA 5LA1A 2ZUSA 1QWGA 2V6AA 4HA0A 1T99A 4LTSA 1E6ZA 2ZTJA 2Q71A 1LG1A 1IEXA 1I60A 3H7UA 1TVPA 3RPDA 1FWTA 1GJUA 1LL6A 1OCJA 4REQB 3KM8A 4FB7A 3IIVA 4O1FA 4IPPA 3CZLA 3ARPA 4DNMA 3BLDA 1EBHA 1M41A 4EAYA 1PIIA 4MJMA 4QJ1A 3APYA 4HU4A 2ISFA 3M0HA 4UR7A 4XVEA 3LRKA 4LOCA 4IMGA 3IJIA 4J3WA 3VDAA 4YTTA 4ZB0A 2WSYA 4ZEPA 1NIUA 3VVGA 1P7TA 3HPXA 3GDKA 1W9BM 2VENA 4XAZA 3OGVA 3FAWA 3JVAA 4O8AA 1O1HA 3MUAA 1R7OA 4WOZA 4B2DA 2HS6A 2PE4A 5GPRA 5F4SA 5D04C 2BDQA 1O5KA 4HIBA 3WH6A 3WLJA 2WJEA 3O63A 5M17A 3TNBA 3V36A 4CCEA 3HPAA 4MAVA 2Y63A 1VPXA 1EHAA 1TJ0A 2HVNA 3WQ5A 2GSJA 5BZAA 4XBKA 3DUGA 4S39A 4OIFA 3UBPC 5C55A 3QYQA 1T0OA 1MYRA 4ACYA 3H4XA 3R89A 4MWAD 1E1FA 3EOUA 1MQQA 3BCFA 4Q4MA 3VCRA 1PWMA 5FF4A 3P8JA 1LZOA 1FCBA 2W66A 1E56A 1JYWA 1IEIA 3AS1A 3FYPA 3L4ZA 2AQOA 3C0QA 4H41A 2WZIA 3EB3A 3M7SA 1OX4A 4NRRA 4RW5A 3F5JA 4DJDD 3ICJA 1XW8A 4HHMA 1UC5A 3QW3A 1E6RA 2PP3A 1HKWA 1C29A 3GZ3A 1TG7A 3LHZA 1BXCA 3RM9A 2FVMA 3QHMA 3APGA 1GKPA 4TTUA 2GK1B 4GY7A 2C0HA 4FNUA 3TUUA 2GJXA 4S3AA 3WEZA 1SQ7A 3LV6A 3BLPX 1UIOA 2VQTA 1H09A 3DXIA 1FXPA 3GG8A 1GQIA 1S2UA 4KT2A 4YTQA 4TMCA 4FNTA 1YYAA 1Z42A 3DESA 3VYLA 7CGTA 1EZWA 1UH4A 3VOJA 4ZB2A 4LBUA 1IQ8A 3ARXA 4HZ7A 1GKQA 3T1GA 5LNVA 1EIXA 1FWCC 5A1AA 3S6DA 4GQ0A 4ORIA 8XIMA 3VZZA 4IP4A 1X98A 4AD0A 2O4MA 4BWLC 2NW0A 1SYTA 3ONBA 4IMAA 1W31A 4IG2B 3IVSA 4LQ1A 4UZUA 3ABOA 1TA3B 3SI9A 3IV8A 3F5KA 4GYJA 3ABSA 3DGRA 2ZUMA 5BW6A 4AISA 2VGIA 4GX8A 3B9DA 2OSWA 4RZBA 1BF2A 1GJPA 4TOQA 3MI6A 3U8GA 3BICA 3PPHA 3WH8A 3WUFA 4G56A 4AD3A 3DC8A 5C7HA 3LCFA 1EIBA 2RHGA 1XSIA 4IMDA 1V6WA 2WJDA 1A0CA 1PTDA 4K7VA 3OJGA 3WELA 4FO4A 2HEJA 4W8BA 1XLDA 4Q7NA 2W79A 3H2NA 2NUWA 4H4IA 1Q6OA 3MYOA 1S2CA 3CAQA 1O5QA 4MY8A 1PTAA 2ZZ7A 3QTGA 2INFA 3BC9A 4HTYA 2Y62A 1QVBA 4AX7A 3DG3A 4FNQA 2NQHA 1K4HA 3N4FA 1S5MA 2CYGA 2EGZA 1L2QA 1JAEA 1JF5A 1ISZA 7A3HA 2ZRYA 1BFNA 3F4CA 1GEQA 4QQUA 3VFCA 1MZHA 5GNXA 4ONVA 4WKFA 1PDYA 4J7RA 3INPA 3V5FA 4R7OA 1UWSA 3K1GA 2R1MA 4JYDA 2QV4A 3WMLA 1DYSA 2UY4A 4XAYA 4A3HA 2OYLA 1KGUA 1U5HA 4KCTA 2EKGA 3KHDA 3AS0A 4PMDA 2PTXA 4C6DA 3GH5A 3EOSA 3E0VA 2E6FA 1F8IA 2XPKA 4MNMA 5T9BG 1KTCA 3EMCA 1EJUC 4A8NA 3B4YA 5A8NA 4XZLX 3G2GA 3A5FA 4ZE5A 1JF6A 2YLLA 4URIA 2X7VA 1POJA 2GGJA 3GDTA 1WDQA 4C1NB 4W4QA 2TSYA 4GMEA 5EYWA 4NAEA 4OWGA 3SJNA 2QDGA 1I45A 3PZTA 5JBEA 3DENA 3DFNA 1PIFA 2XIJA 2I9EA 1VBHA 1DJIA 3WK2A 1E9ZB 5EFDA 1TSIA 2VJXA 2OLSA 4YTRA 4ADSA 4W9TA 3SY1A 1HKVA 5TIMA 3E5BA 4GABA 1MMFA 3W29A 4YTSA 1AFSA 1DIKA 1KRCC 3VIKA 4Z2JA 1AJ2A 2GGIA 1OK6A 1VP5A 1RLDA 2YCLB 3BZJA 1SZNA 2ONEA 5D4YA 2V38A 5I6SA 2D3LA 1UPMB 1UR8A 1GVQA 4JIQA 4ICMA 3GC4A 2YB1A 3U2OA 2D69A 4HHHA 5TNVA 2FDMA 1KR1A 3VOCA 3UJEA 2G97A 4CN1A 1FWIC 3VIPA 2FVLA 1QNOA 3IIOA 1KBLA 2EQDA 3ZZ1A 3SR7A 1G7VA 4XQ6A 4JIHA 4FLOA 3RNDA 1A50A 1FWBC 3E2VA 3JU2A 4IL2A 5FJIA 4A21A 3S6OA 4GUGA 2Z27A 2QDHA 4GINA 3M16A 2I9UA 1ONEA 2DH3A 4GXMA 2ANUA 3P61A 3MO7A 2CXEA 4NZCA 4R3UA 1VEMA 2E1WA 3H2AA 3VMOA 3VNLA 1SO4A 4H8NA 4KRUA 2HPIA 3QGAC 2PUZA 4UTIA 1J6PA 1IIHA 4LRTA 5CPQA 4HTBA 3FV9A 5LZLA 5G2WA 4A3UA 4M6QA 4QROA 3WLSA 1DTUA 3HQPA 2BS9A 5BMXA 3HQ1A 4ZQPA 1A0EA 3LS9A 1BRLA 2DEPA 3PJUA 3VA8A 4Z2IA 2FB2A 5EBUA 4OV4A 2V82A 1EXPA 1B3WA 4Z42C 3STFA 2ASHA 3RK8A 3CV2A 3PUOA 3KX6A 3TAOA 1MXDA 3AXKA 4AYSA 9RUBA 4U28A 2G8ZA 3CIVA 5EPDA 3S6TA 3TN5A 2FHBA 3M9YA 4J3XA 1EP3A 4LBRA 4UFHA 3OGSA 1EO5A 3EKZA 2G5WA 3W25A 3DH7A 1KFJA 4UTWA 2E9MA 1GYNA 2D0HA 3B3DA 1V03A 1OGGA 1AZ1A 4YNGA 3VD3A 1U1UA 2ZZ4A 1WAWA 3B0XA 1OD8A 5JMUA 1IIGA 3EDJA 3WN6A 1XJBA 4C7FA 4JN7A 3IAPA 4BA0A 1RUSA 4CN6A 2J7HA 3PZMA 2BHUA 2PD9A 1HGYA 4YN5A 3LCWA 1XIEA 2RKXA 5JBFA 2V3GA 4J27A 6TIMA 1LL7A 3WDIA 4ZE4A 4BZYA 1QW9A 2X2YA 4HMNA 5L9FA 1RH9A 3W1TA 2PP0A 1TV3A 4LSBA 3RCMA 1QJWA 1DIEA 4XV0A 1R6WA 1WP6A 5LNUA 3EMZA 3OLEA 2POTA 2EKCA 1FDZA 3GNDA 4U5KA 3B8WA 4UFLA 4FIQA 1SJCA 2INEA 1TIWA 3ZLHA 2PD5A 4UR8A 4L9YA 4ACZA 3NQDA 1X6UA 4HNLA 2PTWA 3IRDA 3KBNA 3HGRA 2E6AA 3QZEA 3M0YA 3NQ8A 1EUNA 2EPOA 4CQ8A 3G3DA 3MUCA 5J04A 1OEPA 2YCKX 1UOZA 4H6EA 2QUUA 2FGLA 1EKOA 2YZ5A 1F6YA 3GE7A 1IWAA 4F0SA 3CIXA 5HA7A 3V0UA 1HO4A 1TUXA 2J13A 1GHSA 3RO6A 3WLQA 3WF3A 4ADUA 4S3KA 3FW6A 1UJQA 2OG9A 5DCEA 4PSRA 2HQAA 1P7TB 3BLFA 4FK9A 3TNOA 1GOXA 3BH4A 2GL5A 3C2VA 4AHQA 4CEXC 1JPMA 3SRFA 1M3UA 1ZCCA 2A1YA 3AISA 4Z2GA 3UNTA 3TYZA 2J7BA 1UWUA 3L66A 1H0IA 4B3LA 2YW3A 4AWSA 2OGYA 5D2VA 3VOGA 3TQKA 1RD5A 3W74A 3HGSA 2VXNA 1WBHA 4X9YA 1EPVA 3GDBA 2HBVA 1F73A 2XH0A 2AOSA 1E0WA 4A2RA 1QO5A 4IFKA 3WEOA 4PUNA 4WK9A 3B9NA 3KL5A 1JDEA 3RXZA 2Q09A 1QFEA 3QR3A 4EK7A 2D0GA 3PF3A 3FDKA 4JD4A 1GKRA 3EGJA 1HTIA 3K1DA 1XGZA 2D22A 1SJAA 4MDOA 3GS6A 3PS7A 2GGGA 3T2OA 3LLXA 4EXAA 5CKSA 2FTWA 2VDHA 1V0MA 1AQMA 5I7GA 4KEUA 2ZZ2A 5H1WA 1XF0A 1C7SA 3EWBX 1UD5A 4YTUA 4DIAA 1OX4B 1PPIA 4QSHA 1R85A 3HO8A 2AKMA 1NARA 3UERA 5CPNA 4B16A 3C2FA 2ZRUA 1Q7QA 3OYZA 4L7ZA 1JQXA 4DB7A 3R8HA 1SZEA 3AS3A 3LBMA 3A13A 1VCVA 1SSDA 4PUUA 2GZXA 3WNPA 3GAYA 1DXIA 1UQZA 2CITA 1MW2A 1AVAA 6PTDA 1M7OA 3KCJA 1B30A 1P0DA 4JDYA 4KFNA 2YYTA 4N2YA 4C7GA 3O06A 1XINA 3EA2A 3IRSA 3A4AA 1JXJA 2W4XA 1UP3A 3CO4A 1WOAA 1XRFA 5IXEA 4MGGA 2HSAA 4GK8A 4NXSA 2FZDA 1ISXA 1ZNNA 3EPMA 3U2EA 1GK8A 1D9EA 3QRHA 3S1VA 3GNXA 3F03K 3W53A 1KC7A 4C6LA 2OB3A 2O9RA 3GVQA 3B03A 5AYXA 3N3MA 1QI4A 3W81A 3W2KA 4ZB5A 1NWRA 3NZQA 3UNDA 3CL6A 1Z41A 2BP1A 2X16A 4M1BA 3NQMA 4M6PA 3FCPA 5I0DA 2C1IA 1GW9A 4IMEA 5DMNA 1SFTA 1ICSA 2Z2UA 3O6AA 3XINA 2PTYA 1PZ0A 2IUZA 5I02A 3G1HA 2I5GA 1H51A 3G0XA 1C8VA 2PP1A 3FKKA 4PMQA 1XIJA 4LAMA 3TXVA 4QNEA 3ARVA 1W0MA 4AAJA 3ZXWA 3QHOA 2AL2A 3TW6A 1V6XA 4BQ4A 5DCBA 1W1TA 2DZTA 4FLRA 1Z7AA 4ZENA 2GSEA 4OT7A 3WFZA 3T09A 3FEMA 3B06A 1XISA 1ITXA 3BLIA 2GQAA 3V1PA 4DLMA 1KKRA 3NQAA 2ZE3A 2XN0A 3CGTA 4DBDA 2FB3A 4JX6A 4GI8A 5G1YA 2Y24A 2A79A 3GB6A 5I3GA 4AHOA 1E5NA 3N19B 3BANA 4HU8A 2DZWA 3ZR4A 1JCLA 1UR2A 2XG9A 3UT0A 3H2MA 1SGJA 2ISSA 4TVCA 4Q4QA 4C6BA 4IQDA 1O60A 4C6CA 4L4PA 2F6UA 1T5AA 1JR1A 5KETA 1HJSA 3QC3A 1OVDA 1EDGA 4BS0A 2X40A 1X1NA 3VM7A 2DVXA 4XUYA 4F8XA 2JF7A 2DZXA 1W1YA 1BWKA 2QDDA 3KRZA 3LRMA 4UZSA 2EPHA 3NGJA 1SFJA 3LCHA 2PCQA 3RMEA 2R14A 4KPLA 2R8WA 4ZODA 2R6OA 4YYCA 2GGHA 1UUMA 1TELA 1PX3A 2HBXA 4M6VA 3PSWA 3IJ8A 3P60A 4LAUA 2Z1XA 1Q4WA 4M19A 4R27A 1KFCA 2V3EA 4KERA 4HB7A 2XU2A 3VZXA 1UIPA 2ZKMX 3LTYA 3POHA 3H4GA 1R3TA 2ZOXA 4NAEB 2QUNA 1XDMA 2V2HA 1B4EA 2VHLA 3M5ZA 4UTUA 2WKGA 4WCJA 5FF2A 2OPJA 3W2JA 2EEXA 3A24A 3WMSA 3ARTA 3HQOA 2YDQA 3IGHX 3IUHA 3GC2A 3RMJA 3HQNA 2VKZG 2Q8XA 3SQLA 2PDUA 4YYFA 3HMJG 1I2NA 1MSSA 3PFRA 1IT8A 1KD0A 1IEQA 2Y5JA 5IHRA 3GWQA 5C9WA 2FIQA 4NX5A 4MJ2A 4H2HA 3NA8A 4J3VA 5AYYA 2WOQA 1S1RA 3GXNA 4F4RA 3OZYA 2P76A 3E49A 3O0KA 1SMDA 2CZDA 4DM1A 1VF8A 2BSLA 4U5IA 2L5HA 4BF5A 1CGXA 3P81A 3SCRA 3FY1A 4HN8A 3LN3A 4JFSA 3V16A 4PMNA 3AYSA 3SBFA 3BLKA 2ZC1A 1AW5A 1BGAA 1DJQA 1E73M 3Q4DA 4DHGA 4ZO8A 4AEOA 1Z32X 3KAOA 1TRIA 2WWDA 3EKGA 3PZIA 1F3TA 3P93A 3LM3A 3T07A 1FHVA 1TVLA 1Q6GA 3IWPA 3WLIA 1J5TA 5JIPA 2OTDA 1SUXA 3WNNA 1R3RA 1KTNA 2YYUA 1M7XA 2PEVA 4LAOA 4E4UA 4U3AA 5AYIA 3LPPA 4CCDA 1YLVA 3N9RA 2QCHA 4F0HA 4DUWA 2OVLA 2RDTA 2EXOA 2WKLA 4DWDA 2O7QA 4P7LA 4PRRA 5F2IA 2B81A 4RJEA 4GQBA 3W01A 4GQRA 1P6BA 2ZUTA 3L4YA 3M0LA 4X60A 4AZ6A 3AALA 1A5AA 1B3VA 2WCSA 1XBZA 5D2TA 4B5SA 4H83A 4P8UA 4RNHA 3PUDA 1JDDA 5FD0A 3QPYA 1W9DM 3U2CA 1KCZA 5CPSA 4L4MA 2Z1VA 3FHAA 3GK0A 2XH4A 2FPYA 4DYEA 2PDFA 2XH7A 5HMSA 4S2CA 4GKLA 3N25A 1LYXA 3PP7A 2CBJA 3ARWA 1B4KA 1K4GA 2WBKA 4LS0A 4AC1X 2XVPA 2ALRA 3QQ0A 5D05A 2VELA 4GO9A 3HPZA 1HFBA 1TV7A 5AFDA 3W9ZA 2BXYA 2GOUA 3A5VA 4UTFA 1W56A 3AIRA 1CXIA 3FX4A 5TQLA 4AWEA 4XZWA 4QE4A 3STCA 1J4EA 4HCDA 4FIRA 4PEKA 1H49A 4JTKA 4FX7A 2XVGA 2OO6A 4DJED 4O0ZA 3BCJA 4HQVA 1J9YA 4MSSA 1NH6A 3CTLA 4TX6A 1FCQA 4LUSB 1YE4A 2Y7GA 2C1HA 1B0IA 3A47A 3SB0A 1A5SA 4IX2A 1S38A 4KIRA 4FXFA 4G6CA 3RU8X 1D7KA 4HBKA 3QV7A 4QDWA 1Q65A 4JAWA 4DF1A 4UQCA 1L8PA 4P8WA 4L1XA 5A6BA 2OWXA 2ACRA 3SCVA 3QGKC 2BHZA 1EEXA 2V5DA 3SUSA 4PODA 4G7FA 1NM9A 3SUTA 4AH7A 1YE6A 3MTWA 3W02A 4H9UA 2QCGA 4GGBA 2QCLA 3UCDA 1D8CA 1KO0A 2NX1A 5CG7A 4LB4A 1KB3A 2G50A 2NLYA 4EX4A 1G4SA 2FHCA 4ACZB 1TJ2A 3ANYA 2W67A 2CLOA 4S3JA 4Y9OA 4HPXA 4JTQA 4GXWA 1OF8A 2X41A 4G5DA 1W3TA 1ZZMA 3B9OA 3BW4A 4UMCA 3W7NA 3DFYA 3M0XA 3TR9A 2P3EA 4V33A 5AHEA 4JICA 2RDWA 3W87A 4NZ3A 1DIOA 3UVIA 2UZ9A 1XUUA 4GOAA 4AIOA 4HOXA 3I4EA 2QMKA 3H2EA 3N29A 2D24A 2TYSA 4O4WA 3IAQA 5G4WA 4J4KA 2CLLA 1I2OA 5IDZA 1R30A 4O13A 2FFCA 1LWJA 2PZNA 3A4WA 4HPGA 3OLIA 4QRNA 3W75A 1JZ4A 4DELA 2B7OA 1EDTA 2QV5A 4GC4A 2YDRA 3ALFA 2YA1A 2Y7FA 1J5SA 3L0GA 5LHEA 1X8CA 3CV6A 4UFJA 3QFEA 2ACUA 1EYWA 2BNJA 3MV01 2CLKA 2DQWA 1Q2RA 4UTWC 2PF8A 5KZEA 5GJMA 3OB8A 4IIEA 5BROA 3C6CA 1O66A 5FJUA 4AXNA 2PWVA 5I77A 2BGNE 4PUKA 1JDAA 1A5OC 5KSWA 2CZVA 4KEMA 1KGXA 2P1FA 1XLBA 4GD0A 3UA4A 4WVXA 1F4AA 3EWWA 1A47A 4O18A 3NXFA 5D37A 3TAKA 3TJ4A 3AOFA 1PCWA 1DXEA 2QCMA 3WKZA 1F6PA 4DJFA 7TAAA 3FN9A 4PMZA 3WF2A 3N2XA 1G4TA 1XHGA 3RJXA 3GDMA 3W1XA 1B3XA 3I6EA 4J3TA 3QGVA 3VOIA 2A7PA 2VR2A 3LPFA 5FSEC 4B5TA 4DZIA 4U4MA 1XLGA 3FJ6A 1H41A 2RGMA 1Q7ZA 1UHVA 2G3IA 2PWUA 1JCTA 5CEWA 1K77A 1W1VA 4FEZA 1UUQA 4F48A 1FWSA 1H5YA 1M1BA 4GKTA 4F0KA 1W3IA 2WO5A 3WL0A 4JY8A 4I7WA 1E4IA 2QJJA 3PNZA 3W84A 1KXVA 3NJ3A 3T0AA 1D8WA 4YPJA 1ZBVA 4L80A 3VDGA 4B4HA 4OOUA 1Y7VA 4US6A 1PZ3A 3UXDA 5D9PA 1H7XA 1JFHA 3CUIA 3ITYA 3P3BA 3P7YA 1TJPA 2ICSA 1TPC1 1ADDA 3W26A 3RLHA 1J11A 5DFAA 3W72A 1C7TA 2IPGA 3WBYA 1J18A 1IXNA 3GNRA 1UCWA 2Z7KA 3WUBA 3NTYA 4NNBA 3KOXA 4ZOEA 2A3BA 4AX6A 4AZCA 2C79A 1TCMA 2ESCA 2FPVA 5FF7A 3T0CA 1U83A 3B9EA 4FOJA 3L2LA 3P5ZA 2J79A 1C90A 3SN4A 3RU6A 1W2PA 2F9RA 4MFEA 4ZTYA 4PN2A 4AU0A 1UJPA 3LBOA 3CJPA 5EKYA 2EBNA 4GY1A 2AL2B 1W17A 5LIUX 1Q2SA 3THCA 3PNUA 4GQGA 4DI8A 3E02A 4KCUA 1L6WA 3MO4A 1TUFA 4NNCA 1W37A 2ODOA 5CQ1A 3LQLA 5DX7A 1J6OA 1XD0A 4UNKA 1R86A 1X7IA 1EX5A 4K7YA 2OYKA 4J9JA 4KWWA 5DRIA 2VX7A 2XINA 3FAXA 4GVHA 3CYVA 3TEVA 3W7EA 1ICPA 3WIJA 1W9XA 3N18A 4I5XA 4Y9AA 1W1PA 2WHJA 3E12A 3VNJA 4WD0A 1VCGA 3PM6A 1HX0A 2FTYA 3VGDA 1ZSXA 1XH1A 1O68A 1NOWA 1XFBA 3W70A 3MP5A 2YLAA 3T8QA 3NL3A 3MUY1 1VFFA 1HJUA 4J3ZA 1EJWC 3WCZA 1KBJA 4DO7A 1EH9A 4I6VA 1F76A 3T40A 3UU0A 1VPYA 4G8TA 1DJGA 1ELSA 3L65A 5H91A 2Z1KA 4ZOCA 3ZT7A 3CUFA 4L65A 5CSYA 4LUTA 1CYGA 5E0CA 1LBLA 5KEZA 3VKJA 1D7FA 4C7DA 3GIQA 3ZJ7A 3UZZA 1E4NA 3M7WA 2QLYA 3WLNA 2UY5A 3WZ0E 5J8LA 4D6HA 3CAVA 5C54A 1TPVA 4JTGA 1EP2A 3A64A 4HA1A 3HTWA 1H7OA 3M07A 4RE2A 1F05A 4NRSA 4IJBA 1D3CA 3LNPA 4O53A 1SZGA 1HP4A 5LA2A 3RX2A 1OG0A 4ICCX 5IFTA 3E38A 1E40A 4N9CA 3ABQA 3WDRA 4OV9A 2VDGA 2Z2AA 3TWAA 1I0BA 1OFOA 3OVGA 3E0FA 1WBJA 2PBOA 1KR0A 2V63A 4IP7A 3CMGA 5EGRA 2QJHA 3VMNA 1WB0A 1W3KA 5F2GA 4HMCA 2JEQA 3ENLA 4DPPA 3O6CA 3DI0A 4PEEA 1OCBA 3WQ8A 4C6QA 3M44A 3IIZA 4DZAA 5CSRA 3PJTA 3QV8A 2PWEA 1RQHA 1L8NA 3WDPP 4H9VA 4JTFA 4JYFA 4CQDA 2G3JA 2ZDSA 3M0VA 1TTQA 4G9PA 3S5NA 4KRTA 4J3SA 3H12A 5BNKA 5D09A 4US5D 3NQ7A 3Q37A 4M0XA 1LQ0A 1LLZA 2DIJA 3N11A 2NVCA 3MC5A 3U2ZA 3BOLA 4H19A 1S2VA 2C18A 1ZJHA 3QMRA 3L4UA 4PTWA 4Y8EA 3WD2A 3NZ1A 4X0VA 3TE9A 1BTMA 2FZNA 1VEPA 2NQJA 2ABAA 3TSDA 4PZVA 1VBRA 5FJOA 3BAXA 3W3OA 3LMZA 2GOKA 3P8IA 1S5NA 3M6DA 3UXAA 3PULA 2Z1WA 3UPMA 1GTHA 3GTIA 3I7RA 3URQA 5JXQA 2GQ9A 2VUYA 1V02E 2Y7DA 5A6JA 2CIPA 3GDRA 3VC6A 4NT0A 2O0TA 4JKMA 2H8ZA 2WNNA 4F0RA 4XD5A 4TMBA 1FWHC 3M1ZA 2EPKX 3GXPA 5DO8A 4L61A 3TP4A 1JQVA 1O5XA 2DZSA 1VB9A 3VKKA 3D5HA 3N2CA 1GHRA 4GJ1A 3TU9A 5I06A 3ABZA 4L6OA 1OYCA 1NF7A 1UWTA 3DFSA 2I14A 2NUYA 4NILA 5HQLA 2GSHA 2WPBA 2IPJA 4I6KA 5LIKX 3CEUA 3LENA 4LYPA 4L9ZA 2V3FA 2PTDA 4Y96A 2Y70A 4BEQA 1F6KA 3WO8A 2ZFAA 3GTFA 1K6WA 3AI0A 1C8XA 1CGVA 2A7RA 4J5NA 4JDBA 1RY8A 4CNNA 1J0ZA 1KRMA 2YBVA 2BOGX 3OGRA 3CZ8A 1TTIA 2BOFX 1UR0A 4L4LA 3C8NA 2NV1A 2NT0A 1GVSA 2E77A 3O0FA 1HUVA 2VFDA 1ZFJA 3NSXA 4S3BA 3ITLA 3CHEA 3RO8A 2YZRA 2O55A 3DERA 4J2PA 4JXCA 3NQVA 4C6IA 4YCPA 3H2FA 4CQ9A 5I09A 3WJWA 1SO3A 1E4LA 4JNYA 4WDTA 4IPJA 2QMJA 3M64A 3N6QA 4B92A 3QXBA 3VKDA 1EP1A 1XFCA 3PB0A 4KETA 3QY8A 4QGCA 3TW9A 1UA3A 3RX3A 1YX1A 3TN4A 4LJ3A 5G2HA 4OTKA 1T6MA 2ZRZA 3W4RA 3SCQA 2GJNA 2NVDA 3M5YA 1PWLA 4MAZA 3U57A 4WY0F 3EDDA 4YL2A 1VFLA 1WXYA 4A29A 3TYBA 1MZRA 4JHOA 3NQBA 1IGWA 1AG1O 3BSMA 1N8WA 4IGNA 4MY1A 1I75A 2OCZA 2J6VA 3ZT5A 3R2GA 4JYEA 1C92A 1JNEA 3GNOA 3DCPA 1FWDC 3GUWA 1QK2A 3WQDA 3IARA 3AMLA 3T4CA 4CQAA 4AIUA 1Y5WA 1LOLA 4O19A 2VR5A 1KFLA 3KVMA 4G2DA 3CU2A 5A2BA 4XVDA 1ODUA 3VZYA 3CUXA 5D9NA 4WDUA 1AJZA 1AL8A 3A3HA 2A85A 3DG7A 2FZBA 3KWSA 1EGVA 5JH2A 2G41A 5HQMA 1NFPA 4NJJA 3FYOA 1NVMA 5HJYA 1R7AA 1F8MA 1DHKA 3QMTA 3N9KA 3H8AA 1QPQA 4Y9PA 1XR2A 3E9AA 2JF6A 4HU3A 3R0UA 1R47A 4ASTA 1XXXA 4JN8A 4FX6M 4PH6A 1O94A 4Z1BA 2OT0A 4JIRA 4FAMA 2BB0A 4O28A 1XKJA 3EDEA 3TW7A 3W73A 4Q6XA 3FVMA 5D2WA 1UW9A 2FGZA 1N55A 1VPQA 1A5MC 1UD4A 4EVZA 2DT1A 1QASA 1VIWA 2E09A 2FQIA 3MUXA 4O4VA 1ISYA 1JIBA 4Z08A 4YLWA 2VX4A 1O6IA 1RZMA 3QEZA 3ZWSA 4GYFA 4RDWA 2UBPC 4QAWA 3W1AA 3FJLA 4M6UA 3QPEA 2VVSA 5C70A 1UWIA 1FWGC 3H23A 1W3NA 3DZ1A 2QXWA 1W5NA 1U22A 2OZTA 2QCDA 1VFHA 3W7LA 4GFIA 5CAHA 3RYSA 2FH6A 4DBUA 3II1A 2F84A 3TX9A 2YBUA 3ITVA 4DZ5A 2CLMA 4PULA 4E3VA 4U3CA 1Q8JA 3EEGA 5A6AA 3GNPA 5CZTA 1IT7A 2OJPA 3DHUA 5HR6A 1Y5VA 3KTSA 3PBVA 2DZVA 3T78A 1TV5A 1B90A 4LB3A 1JCMP 4F79A 5HJXA 1JZ2A 2HVOA 3TC6A 3QFWA 2EG7A 3OIHA 3EPOA 1K6AA 2XIQA 3DHFA 3DHPA 3OIXA 5A6SA 4BEUA 1KKOA 1GVEA 1K7XA 3VNIA 4ZR8A 2J9XA 3QC0A 3DIPA 1LL4A 5MF5A 3ZJ6A 4CVWA 3CAKA 1VBUA 5DLCA 2EO7A 3RJYA 2OELA 2P8CA 1WCGA 3PR2A 3OBEA 3MJYA 3FGCB 1OIMA 5E0KA 3VUSA 4OKDA 4GI6A 4UQAA 1YTKA 5HDRA 1DWHM 4K1WA 2JK2A 1V0NA 2R24A 9CGTA 3EOOA 1VLWA 3UFYA 3WUGA 1DTNA 1B31A 4GA8A 3VTRA 2BODX 1NDWA 1UG6A 1TPFA 4IZGA 3S0CA 5KMYA 3LPGA 1ISWA 1LM1A 1BXBA 2G4JA 2Q6ZA 1EWDA 1K8CA 2QEZA 4Q22A 4NZFA 2ZTKA 2PDKA 5LA0A 5EBAA 1KGWA 1K9FA 3RAOA 4OFCA 1GYMA 1YW1A 3EX1A 4Q33A 3AZSA 4DJFC 4W84A 2CETA 2OEJA 5AYBA 2WMIA 3WLLA 2VZOA 2D2HA 3RIKA 2R82A 4J35A 3ARQA 5MHBA 1O5RA 4ZQRA 5KZDA 2WWCA 4ATDA 3G1FA 3POCA 3R0KA 4O12A 3F2DA 3A3XA 4WGHA 3UWYA 2ZZ1A 1UZDA 3HBLA 6CGTA 5H2ZA 4IT1A 1XV8A 1XLHA 4JQ2A 2VP8A 1BAGA 3C0LA 3ZOAA 3GVGA 4MVAA 4EWND 2FPTA 3PUGA 1EA9C 1TQXA 3I68A 1XL9A 4LUTB 4REQA 1J0YA 5AVHA 3URNA 3N14A 4FNSA 3AWNA 5I07A 1E71M 3WBEA 3NG3A 3DKJA 1YXCA 1RK6A 3AROA 3KZSA 4WJ8A 1LCOA 1LOQA 1FP8A 2BZNA 3RPMA 4L6HA 2ZWZA 2V2DA 4I7VA 3K8KA 3W0KA 2QGHA 1GWJA 4ERIA 2MNRA 3WMCA 5D32A 5FEXA 4LAKA 1R3WA 3DC0A 3MVTA 3H6OA 3EBVA 1EDQA 1CWYA 1V3MA 4JTHA 3WLMA 4LBSA 2XGBA 4QS6A 3OLDA 2PLCA 4CGTA 2Z00A 3K13A 1WKDA 3ZFHA 2OODA 3EX3A 4HP5A 3STEA 2VOTA 2PDLA 2BVDA 5LHFA 3TA9A 2ISVA 4P2VA 2E6DA 3E2QA 3JRKA 1V5XA 2PGEA 3TJLA 3UA3A 4A05A 1A5KC 4DWSA 2G3FA 3AUOA 2AMGA 4O57A 5I2UA 1LQ2A 3BWWA 1FH9A 3WF0A 4C6FA 4LUJA 3WNLA 1R3SA 3L4XA 2IKGA 1GVIA 2QJMA 3BO9A 4K3ZA 1Q6EA 3KUMA 1AH0A 2W0UA 1W1B1 2YJQA 4XZNX 2YOCA 3GR4A 3T08A 2HZGA 1QOXA 2D20A 3MI3A 2REQB 2ZUUA 2VCAA 3OOQA 3QMSA 3U6WA 5REQA 1MWOA 3BL3A 4EF9A 1QK0A 1CGUA 4W5UA 2GVLA 3WH7A 4LV9A 6TAAA 3ZM8A 4H8VA 2Z2BA 3ARYA 4F2TA 1EA0A 3QQWA 3W7MA 4JFWA 3QTPA 3WNKA 5HNRA 3DECA 1TVNA 4NG3A 4JKLA 2OZ3A 3TCEA 4K1GA 5TBOA 1OQFA 4HOWA 3CNYA 2UY2A 1CNVA 3NO1A 3QYSA 4FS9A 1UBPC 2GJPA 3PWAA 3H7VA 3TONA 3BW2A 1E1EA 2VGFA 1XLCA 3C56A 3LYEA 5A8MA 1R8LA 3E0IA 3VK5A 1QCWA 3NPXA 3W28A 3FA4A 4WY0B 4CD6A 4QLKA 2NT1A 1X97A 1RP8A 2V5BA 5EMKA 4D1JA 2JEPA 4Q8VA 1AW2A 3UWEA 3RCYA 4HYVA 1OYBA 1AA1B 3L68A 4IG2A 3NEHA 5HPCA 1TA3A 2VRJA 3N2BA 4H1ZA 4A35A 1KWKA 2J7GA 2FZMA 1DHPA 2W9MA 3AHZA 2RDUA 2CZFA 2NXGA 2CCRA 1E6XM 1X6LA 1P6CA 1UH2A 4XAFA 2WZTA 1E0XA 1FXQA 3CV1A 4Z17A 4Q4OA 4LNCA 3DX5A 3O6DA 3BQ6A 4ZQCA 4Z1DA 3UY7A 4XD4A 4YXGA 1ZQ5A 1YKWA 2E8ZA 3GFXA 2ZIDA 4S38A 1Q6CA 2YR1A 1EF2A 2DIEA 2GUBA 3W1UA 1YQ2A 3H55A 1DWAM 1YDNA 4H2CA 1Q13A 4FNPA 4AD5A 3OA5A 5C0QA 1TR9A 2D2OA 1RALA 4MWAA 2Z25A 4QQ3A 3G1SA 4J40A 3B40A 3W27A 1MQRA 1UPPA 3AAMA 3ATYA 3FOKA 1J8VA 4AEFA 2PWFA 4GYKA 3QPZA 2P53A 2ZYFA 4PBFA 3RUBL 3UJ2A 5AHMA 3IGUA 2P50A 2WZEA 3N6HA 3PBYA 3CZEA 2ZX8A 4GXPA 3UQNA 4DJDA 4HU0A 1KLZA 2PWDA 4OBTA 3BJTA 1QMLA 4JS3A 5DMLA 2PSNA 1NDVA 1Q5MA 2PLMA 4UCFA 3CZGA 1CTNA 1FHUA 1OM0A 2CPUA 4JNMA 2B0MA 3NO3A 1OT1A 5C9UA 4ZQNA 1RBAA 4LVGA 4PL2A 2C3ZA 1DVJA 1EO7A 4ZFCA 3EXSA 3NQFA 2FYMA 5LIXX 1OSEA 1HJQA 1VYSX 4ZO7A 8TIMA 1AQ0A 4HYRA 3LGEA 1E51A 3THUA 1V3JA 2HS8A 2QHAA 3W22A 1N8FA 2PDIA 2EJ1A 2WHLA 2OLAA 3TN6A 1YRRA 1XLEA 1UD6A 3AYTA 3MW7A 3WEMA 1RQBA 4LS2A 1YIXA 1X1ZA 3AIQA 3OPSA 2G3NA 4UOJA 1IR1A 4IPLA 4R53A 1M01A 1DJXA 1MEWA 4NF7A 4Q8QA 1E9IA 3RHGA 5HNTA 4LY4A 2TAAA 1U33A 1V6TA 1K7FA 1HVQA 1GZ1A 4AVOA 4HVXA 3GYEA 2CNCA 3LCLA 1ALDA 2V69A 4XWUA 5C8BB 1I8JA 3PB2A 3GH7A 4CNUA 4Y8FA 3S2CA 1JCXA 4I8DA 4KQNA 1OCNA 4BF7A 2YCLA 3LGGA 4MPQA 1VFMA 1KA9F 4A8IA 1R3YA 2ACSA 2HTMA 1CLKA 4W7UA 2CBIA 5A6LA 5B80A 4UB9A 3URBA 4MF4A 4UQ9A 2PS2A 1H5VA 2F38A 1EOMA 1XC4A 3QLDA 4M82A 4EPDC 1FP9A 3N4AA 3W7QA 5AC5A 2ZDRA 2ZQ0A 3G0SA 4D8AA 4W88A 3G5EA 4N4PA 1N8IA 3HA1A 3WJYA 4NJKA 2QS8A 5A8PA 1JYVA 4AZ5A 1TV8A 3OVRA 4DO6A 3DFOA 3W7JA 3BGJA 4PGLA 4MIMA 4O15A 8RUCA 3VDBA 1VKFA 1G4EA 3HMCA 4I5RA 1LRQA 1J0KA 2XVKA 3PTDA 1FX6A 3SGUA 4IGMA 4MB1A 4RPQA 4C6JA 2QCDB 3GRIA 3LHYA 3K30A 2E28A 4XIMA 3G1YA 3G1VA 1AQFA 3SY5A 1BGGA 3C8FA 4V1YA 2I57A 4B91A 1DKWA 2PODA 2G3MA 4O16A 3R43A 2NV9A 2PLJA 5K9XA 3QV9A 2BHYA 2ZCGA 2C13A 3L0NA 3O16A 3QVQA 4Q4KA 1TCDA 1JYNA 3UW6A 5GQBA 5BXSA 4TQTA 3IK2A 4PL1A 3P74A 1JL8A 1ZAJA 3G1DA 3AMKA 1UP0A 3EAUA 1IZCA 2MANA 3QR1A 3WK0A 3UETA 1AL7A 4JR5A 4PRWA 3MBFA 4QLJA 3TYCA 1M68A 3B8UA 3VIIA 1KM5A 2D0FA 3APTA 1XDLA 2VZVA 4XO7A 2UY3A 3EWXA 2OZ8A 2E68A 3S2JA 1KRAC 3WSUA 4KW2A 3TDFA 3T81A 1HKIA 3MKKA 2PLKA 2IKHA 1W5PA 1A49A 3ARRA 4L9XA 4IIGA 4BHYA 1WDDA 3CUHA 1IF2A 1QHZA 3F4WA 1YPFA 4PB5A 5A95A 2GVGA 2QJIA 4QJ5B 3TQ0A 3E6EA 1A5CA 3FS2A 3C52A 3CWHA 3NCOA 3GAKA 2GQ8A 3OP2A 2V5KA 2XFWA 3WQ4A 4IM4A 4OE7A 2J88A 4IX0A 4H9YA 4FXRA 5CGQA 4W87A 3WUEA 3LI1A 2X2GA 3GXMA 1LOSA 3ALGA 4EF8A 3MMUA 2FGBA 4HN4A 2NXHA 4C6EA 4A22A 3GXDA 2WMIB 3P5YA 4F66A 1JPIA 1YXYA 5A6BD 3A4JA 1NDYA 4WDXA 3NOYA 5FI8A 1YPIA 4FF5A 1TJ1A 2Q3OA 1G01A 1FWJC 3R13A 1EQCA 4ZTXA 4IP5A 2YL6A 4AIEA 4D72A 3RM8A 1AH3A 1VQTA 5E9AA 1S39A 1NTHA 3WQPA 3UF9A 2WC4A 6REQA 4P5UA 3WK3A 3CM4A 1PIGA 4ZO9A 5HWMA 4HNCA 3WH9A 3DFPA 4A2SA 2VM8A 5CZ0A 4OJYA 4XAPA 4WQ6A 4M1RA 4E3TA 4HPNA 4FA3A 4IUGA 4N0RA 4W89A 2NX9A 1UKTA 1EB3A 2ZX7A 3KOWA 4GBDA 3LU2A 1Q6LA 3NZPA 3E5PA 3NDOA 1KCLA 3W7RA 1Q45A 1TMQA 1PHQA 5DXXA 2Y89A 4Z2LA 5I3HA 4IUOA 1DIDA 1EWEA 2B7QA 1R2TA 2YL5A 3CAWA 4FR6A 3CXOA 3GHTA 3PWIA 3HJZA 4ZQOA 2JIWA 5DY2A 2XZ9A 1CPUA 3SCPA 4DWSB 2G95A 6ALDA 4F9JA 3MT1A 4IIDA 3K8MA 5K7JA 4FOKA 2QF7A 2OEMA 1S3HA 4HCHA 5B7YA 5FOOA 5E5CA 4AZIA 5K9DA 2HWGA 4AXKA 3EPNA 3LLFA 4ZCWA 1T41A 2PC8A 3MDUA 3LHVA 5HOSA 1E0UA 4GIAA 3HG3A 4WSHA 1NJJA 1H1ZA 4H7ZA 3H2CA 3R6IA 5F4WA 4QCFA 1BQCA 5T26A 1SR0A 2ZVIA 3LI0A 4K8GA 2A21A 3CLWA 5REQB 3VINA 3BE7A 3E96A 3LXCA 1JFXA 2KZHA 1TPEA 4C91A 4PUWA 1P5BA 2C6QA 1GVOA 2GPTA 5HULA 3TCSA 5TAOA 1PL9A 4QHRA 4HZ6A 3N17A 3ITCA 3TV8A 1JZ8A 1JUBA 1W32A 1DL3A 4ZQMA 4L5ZA 5M2FX 4MHBA 3B8DA 4BY3A 5I5RA 1C9DA 1M53A 2Y5SA 4IWWA 4JCLA 4DXKA 3M0IA 1AUSL 3HPFA 1G0CA 2GDQA 4UQEA 1YDOA 3CWOX 4Y7EA