5K9XA

Crystal structure of tryptophan synthase alpha chain from legionella pneumophila subsp. pneumophila
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
272
structure length
262
Chain Sequence
AMNRIDKTLEKLKANRKKMLSPYITAGDPYPELTVSLMHQLVKSGADVLELGIPFSDEGPVIQRAMERALAHSIHCDDVLNMVRQFRKTDTETPVILMGYLNPIEQYGYDLFAQQAVEAGVDGTILVDLPPEEADGVSRVWQKHGLYSIYLCSPTTSAERMNYINQHANGYLYYVSLALKLPELKAQYLQRKAQSKLPLMVGFGIKTPEMAAQVAEFADGVIVGAALINEIIEAYEAKKDPLQASGALLSSMRQAIDNIGSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Tryptophan synthase alpha chain from Legionella pneumophila subsp. pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila (strain philadelphia 1 / atcc 33152 /
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
total genus 82
structure length 262
sequence length 272
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5k9xA00
3MYOA 5KINA 5L6UA 1VC4A 2NUWA 2ZRZA 4KWWA 3O16A 1OX6A 2H6RA 3GAKA 5H2ZA 1ME9A 3UWUA 3STCA 1RQHA 1A50A 3M5XA 1KFBA 5G1YA 4UNLA 3RU6A 5LGXA 3G0UA 4DELA 2ZBTA 2CLEA 2IQTA 4UTWA 4K8HA 2H3BA 3PG8A 1SSDA 3CEPA 4E2DA 1KTNA 2YX0A 1OF8A 3L0GA 1C8VA 3P8IA 4WJEA 4OQVA 1GOXA 3L65A 2A6LA 4M19A 1KFEA 4YL2A 2VOMA 5HUOA 5C54A 3TQKA 4QISA 2QJHA 3MO7A 1SUXA 5G4WA 3P82A 1ICPA 4N02A 4EF8A 5DELA 2QCDA 3G1FA 1X1OA 3FA5A 2E6FA 3NL2A 2NWRA 4JY8A 4LS0A 4M6VA 3WJZA 4EIVA 3G18A 1K3UA 3W07A 5DBUA 1TTJA 5D2VA 1OVDA 3NQ2A 5G2HA 2DZXA 4NNAA 3ABQA 5MHBA 3ZWTA 2OZ0A 4AWSA 4HSOA 2QCCA 1CI1A 5BMXA 3R13A 3M47A 2A7PA 4ZQPA 1A53A 3BLIA 1OFPA 3DKJA 4R33A 2JGQA 5AC8A 4MLJA 3NQMA 2Y89A 3P5YA 2FTPA 3QSTA 3L66A 3NPXA 3DHDA 1ADOA 3TV8A 4CLMA 3GDKA 1GTHA 1LP6A 1AW5A 1IXNA 2NLIA 3MP5A 1YDOA 1S5TA 1S5WA 1YDNA 2VEMA 3HGOA 5K4XA 3NQDA 3HG3A 5DXYA 4N9EA 4M7SA 1VQTA 2A85A 2PE4A 3PSVA 2HTMA 1P0NA 1WX0A 5F1UA 3BGJA 3VNDA 4BFAA 3M43A 4QAIA 3P8JA 3V75A 4O0ZA 4UFJA 3QMRA 3HG2A 1KM5A 4MLRA 2YDAA 2CZ5A 3PC0A 3A9IA 1MSSA 4IJBA 4FIRA 1NEYA 4X3ZA 3NXFA 4UMAA 3L5LA 1WBHA 4UFHA 3LDVA 2QDHA 4WOZA 3M6YA 4IPIA 3DGRA 3F4NA 1VYSX 4M5PA 3JS3A 4G1KA 3W7QA 2JK2A 2A4AA 1OX5A 1W54A 1XL9A 5LNSA 3T55A 2NV2A 1FDZA 2H3DA 2CWNA 1DVJA 4MY1A 1G69A 1S3HA 4Z0JA 1ML1A 2WV8A 3ABOA 1SR9A 1B57A 3D0CA 3DFSA 1T0OA 3N2XA 3EKZA 3OEXA 3EB2A 5TBOA 3M7WA 1H63A 3G0SA 1R2TA 5FF2A 1GVOA 4IGHA 1SZFA 1PHWA 2NXIA 3HG5A 1GVFA 3QEZA 3LHUA 4QM1A 3I6RA 2Y61A 5F1VA 2BLEA 2QJGA 4NJGA 2E6AA 4M6PA 3OA3A 4H3DA 4NZFA 3W75A 1TPVA 3MP3A 1OHLA 3LCHA 3HPZA 1PHQA 3S1VA 1IXQA 4CCEA 3IIOA 3H55A 3W1XA 2QDGA 2RDUA 4E0CA 3BLFA 5GVJA 2A7NA 4JYDA 3F03K 2XN1A 4AAJA 5LZLA 1SW7A 3HB9A 4QJ1A 4LOCA 2VFDA 2ZQ0A 1LRNA 5G4EA 3RFAA 3L0KA 3W7OA 3N14A 1TMHA 1FXPA 2ZTKA 2Q3RA 3IVTA 5AC6A 5DN1A 3LTYA 5H91A 1KFJA 5AHFA 4AHOA 5HUPA 4UTKA 5AOUA 2NXHA 1XBZA 3CT7A 3S5NA 4Q32A 3IIVA 1GYNA 3WJXA 5D32A 4JTGA 3C2OA 2GVGA 4XBKA 2YYTA 4P2VA 4GJ1A 4IX0A 1DBTA 1B4EA 1IIHA 3IGXA 2ZDRA 4DO4A 3ZFHA 3KAOA 4O11A 2DJXA 2YCEA 5FEWA 2Y62A 4WY0F 3I7RA 2QAFA 3V1PA 4JTEA 5CZSA 3MI6A 2CLMA 4LS2A 3AO0A 1H62A 3FIGA 2WPBA 4MKNA 3E12A 4XBSA 1A5BA 5HWNA 2VELA 2WSYA 4NU7A 1XCFA 2VEPA 1L6WA 3KVMA 2BXVA 3QQ1A 1NSJA 1XFBA 3QM3A 1LTDA 1OABA 3W3OA 4Y90A 4N4PA 4NJKA 4JIQA 3N73A 1FUYA 1XUUA 3ABRA 2V8ZA 1DJNA 3W7HA 2DU2A 2C13A 4JTFA 5I3GA 4UTJA 3EWUA 1IF2A 4O14A 3PBWA 3LI0A 5D03A 2YW4A 3G1AA 2B7PA 3FKKA 1H51A 3QC3A 3R12A 2RDTA 3TSMA 5C55A 3DI0A 1GG0A 4XWUA 1WA3A 2YR1A 3DBPA 4WZHA 3VE9A 3ATYA 2X1UA 4TX9A 3ZS4A 1XDLA 4NXKA 3C2EA 5A8GA 2E09A 4JTTA 3TR2A 3R2GA 1JJKA 4O28A 1VR6A 3IIXA 1MEHA 4TR9A 1VCGA 4GUGA 3EX4A 3F1QA 4MIMA 4RKAA 1HFBA 4O52A 1XUZA 3TW7A 5LNUA 4N4QA 2DORA 4YWIA 3BGGA 2NUYA 3TAKA 3O8AA 1SO6A 2R8WA 2NX9A 3GVGA 3EXSA 2J88A 2ABBA 3PB0A 5HNRA 1OFOA 4YMZA 2TPSA 3USBA 3M5ZA 2W0UA 3P74A 4JX4A 4JTIA 4XUGA 4BWLC 3MBFA 1KM2A 1XBXA 2C15A 1XI3A 4FX7A 5CSRA 1VCFA 1H7NA 4RXGA 2WSRA 4IMCA 1NF7A 5EBUA 3CB8A 3EX3A 4WY0B 3WJWA 4NZJA 5LNWA 1TREA 1H5YA 3DU0A 4I7VA 3HMJG 2I9EA 5CG7A 5CZJA 1A5AA 3C3NA 1BKSA 4DBDA 4FIQA 1L6YA 4JXCA 1ICSA 3BG3A 1G4PA 4UCGA 3RNDA 1I4NA 3TC6A 3THAA 1W3TA 3GXNA 1I45A 5KZDA 3GR8A 3W7NA 1YXYA 3W87A 3W1UA 5LSMA 4LU0A 3PWAA 1GPWA 1K03A 1SO3A 1MO0A 1DQXA 3P5ZA 3FJLA 3W2KA 2YPIA 1R30A 1FY6A 3W86A 4O1CA 4MYAA 5EY5A 3HPSA 3I7QA 1GT8A 5HINA 4NT0A 2FQIA 4NNCA 2ZZ7A 3S8HA 1B4KA 3UWWA 4RZ5A 1LOLA 4JTHA 2J27A 2PRMA 3A5VA 3O6YX 2ISWA 1E51A 2C14A 2J9XA 4LY8A 2HMCA 4Z1CA 2R91A 4UTUA 1LROA 1FCBA 5BOOA 1UCWA 3LI1A 1EUNA 4JDYA 4XKYB 4HKPA 2TRSA 1A5CA 1WDWA 3VE7A 2VFEA 3L68A 5EL1A 2FJKA 4QNWA 5T26A 3PVFA 1OYBA 3QPZA 4OHQA 5LHEA 1X6UA 1I2RA 4IMDA 3W74A 3JRKA 4JYFA 2V81A 5G1TA 1VYRA 1W5NA 2WJZA 1JCNA 5AYZA 3P61A 2QJIA 4UR8A 3CU2A 3UWZA 1ZNNA 2GPTA 2ZA1A 1W0MA 5I3HA 3N3MA 3NO5A 4HN4A 2J24A 3M5VA 3MP4A 3NOEA 3FEMA 4ZQMA 4P61A 4U28A 1JUKA 2A7RA 3C2FA 1H1ZA 1YXCA 1JCMP 4LC8A 1G4EA 3BV4A 3CQ0A 2CLFA 3EXTA 3TFCA 3B03A 1V7YA 2EAWA 3N9SA 1VCVA 5BRBA 2OT0A 4GRSA 1PV8A 2Y7EA 1TQJA 1GVRA 4LC6A 4O57A 1YXDA 3FYOA 3LHWA 2V5BA 4LV9A 3SSJA 3KRSA 1LDCA 4UMBA 3TDFA 4DPPA 5AHLA 4ZQCA 1OK6A 4XTIA 2ZRVA 5FEXA 5DCEA 1SW3A 2FPTA 4FNTA 1W5MA 1WXJA 1EP3A 5HWJA 4IPJA 5K4ZA 3PS7A 4K36A 4N9DA 3W2JA 4TO8A 5DCDA 4JGDA 1BWLA 1TPB1 1TJPA 1DQWA 3WK3A 1EIXA 1K7XA 2Q8ZA 3PUEA 3LV6A 1OYCA 3DI1A 4FX6M 4WXYA 4O1AA 5KSWA 2PCQA 3CWNA 1ICQA 2C6QA 4Q4KA 3W23A 3LLFA 3UZ5A 3HG4A 3LRKA 4GNJA 2V2CA 1P1XA 2BWGA 2C1HA 2PC4A 1OX4B 3CIWA 2ZYFA 3RLUA 2J6XA 1FCUA 3ZR4A 3LCIA 4LNYA 5D05A 3T7VA 1L9WA 1FWRA 2F84A 2JKAA 5D38A 2Z0IA 3HGRA 3DKLA 2YFOA 3KVLA 1K8ZA 2DZSA 2NX3A 5K9DA 1H7XA 3M41A 3K30A 3O07A 2CW6A 5F4SA 1TRIA 2JKEA 4JTUA 3W70A 3GDMA 4PODA 3VKJA 3G1VA 3MUXA 4LWWA 4D2JA 3MYPA 4N9CA 4IQLA 1LBLA 2ZZ1A 5K2ZA 3TQVA 1H7RA 1Q6OA 3TNOA 3MMTA 3ABSA 1ZAIA 3G1SA 5HJLA 1G7UA 3IGUA 4FF7A 1F73A 3NQAA 4BF9A 1IIGA 1WAUA 5BNKA 4UFKA 5K9CA 1OFAA 1VS1A 4IXXA 2NV1A 1TIMA 3EWZA 1F05A 1AG1O 5D09A 1J2WA 2YXGA 5F2GA 1KFKA 1IXOA 1YTKA 1OG0A 1SW0A 4ICNA 2P0OA 2GUUA 1AW1A 2E5CA 1ZAHA 1P4CA 3M1ZA 1GEQA 1KA9F 3NQ6A 4RXFA 5K3VA 1TTIA 4HNTA 3E0IA 2FPYA 4A21A 4QNEA 4J9JA 3B0PA 1I8JA 2A5HA 5A5WA 3LBCA 3WJYA 4CCCA 3S5ZA 5C2XA 4I9AA 3N2MA 3B4UA 4OT7A 3LRMA 4S1FA 3Q2DA 1M6JA 4OWGA 1KM6A 1D9EA 4IOTA 4LUJA 2HS6A 1RD5A 4HNVA 1WOBA 3GR7A 4RX0A 4UTHA 1KM0A 1DJQA 2A2IA 2WQPA 2F7FA 3G0XA 1QCWA 3OVPA 4BI7A 3DENA 4O50A 3G8EA 3U6WA 3O6DA 1TCDA 4O4VA 1SFLA 1YPIA 1TSIA 3U2OA 5LNRA 3W1RA 3A22A 4H6KA 4U4MA 4JTKA 4QITA 4A22A 4JEQA 1NF0A 3W7MA 3LXBA 3DHFA 4FXRA 3BK0A 2B7QA 2A6NA 3Q58A 3NDOA 2P10A 4ZVJA 4O4WA 1TJRA 3TXVA 3W7IA 1YADA 3TJLA 5C6MA 3L67A 2NUXA 5AC7A 3BO9A 4MFEA 4ZMGA 5HR7A 3KRUA 1FWSA 3TK7A 1CW2A 1Q3NA 4O8RA 4EOUA 1R2RA 3O1NA 4BI5A 3INPA 2VFIA 1RQBA 3KHJA 3R89A 1KBIA 3N34A 5CPOA 3DAQA 4BI6A 1GYLA 4NVTA 3CIXA 2X30A 1W5QA 3NQCA 4WY0A 4XKYA 1TRDA 1P0KA 4DO5A 1LRTA 2V30A 3M0ZA 4KFOA 3P81A 4FB7A 3PG9A 1GZGA 1DKWA 1VH7A 4X22A 4ADSA 1Z41A 1JCXA 3C6CA 1OFQA 4KKXA 3HPXA 4UTIA 1F2JA 4GFSA 4A29A 2PRLA 4O0KA 5KITA 3GLCA 2GQ9A 4CNOA 4B5NA 3PF3A 3HJZA 3W76A 1T8XA 4EVZA 4ZZ9A 2TYSA 5J5RA 3W7EA 4O53A 4AF0B 4JD4A 2QAPA 3NQVA 2YW3A 1I2NA 1OK4A 1SQ7A 3KRZA 3LHTA 2FFCA 1N7KA 4NUWA 3EKLA 4E2BA 4QIUA 5CPMA 4ORIA 4K6AA 5F4WA 4DBEA 2ALDA 1FDYA 3NL3A 1TTPA 1K8YA 3SJ3A 3LRLA 3T78A 3W85A 4CNNA 3SZ8A 1SZNA 2Z2UA 4K38A 4MOZA 3QFEA 4N9BA 3W2LA 8TIMA 3TX9A 1JULA 3PR2A 4LTSA 3TSBA 2QEZA 2QCEA 3O15A 4N2YA 4POCA 3WJSA 1OYAA 4W9TA 2CU0A 2H8XA 1LM1A 3UQNA 1TPUA 1LOQA 5DY3A 5KZEA 1JVNA 1TV8A 4MYXA 2DZVA 3B04A 4UC5A 1TTQA 4AWTA 3GXTA 3QF0A 3S9YA 5D2YA 5EMUA 5D30A 3C2VA 4CCDA 2RDWA 3LCXA 1EWDA 5K9XA 4LVAA 4R7JA 4DF0A 6ALDA 3BLEA 1AK5A 1BEUA 3GNNA 4FNRA 4AB4A 3G8RA 3NL5A 1HG3A 3Q37A 1G67A 2NX1A 2YFNA 3O6CA 4PA8A 5FEZA 3OBKA 3A23A 5FEPA 3GZ3A 4JICA 5BMWA 3LLDA 4S2BA 1G4SA 1HTIA 4JYEA 5CPLA 2QCMA 3NA8A 1ZFJA 2A1YA 4DF2A 3S1WA 2GQ8A 2ISSA 3PBVA 1OX4A 4ADTA 4C1LA 1GG1A 3IVUA 2XN0A 1U5JA 1XKYA 2ZFAA 3GDRA 3M44A 1EP1A 3S1XA 1OF6A 3FYPA 3WFAA 1THFD 3P67A 4CQ9A 2FIQA 2Z6JA 2FB2A 2Z6IA 5LHFA 3PUDA 1G7VA 2CLIA 4LUIA 3GDLA 4K7YA 4QSHA 3G1YA 5CGQA 1FCVA 3RK8A 2ZRWA 1P5BA 3VI2A 4MZ1A 3NYZA 4O10A 3FLUA 4I7WA 5FF4A 1ME7A 1JUBA 5HMSA 4RK8A 4DPQA 3P62A 2GVJA 4PL2A 4FXSA 1KFCA 3EXRA 5LKYA 3DFQA 3O63A 3HBLA 4MUZA 3E49A 1FXQA 3DH7A 3BW4A 1GQNA 1LRQA 1QAPA 2E5BA 3NG3A 1CX9A 1M5WA 2VEIA 2C3ZA 1LYXA 4R34A 4TMCA 3BW3A 5J5DA 3UXAA 4MVAA 3IGSA 4HIBA 1VHNA 2ZA2A 1HO4A 1MXSA 2X2GA 1TPFA 1N8FA 4ZQNA 4JX5A 3SY5A 2AQWA 2D73A 2C19A 1LOSA 2AAMA 3NM3A 3DFNA 3W1LA 3LTSA 3S5YA 4MY9A 3B0VC 2Y6ZA 2V2HA 1FX6A 1QO2A 4YCOA 5D33A 2YGYA 2DZPA 4GXMA 4GWEA 3CWOX 3PUOA 4GUHA 1KLYA 3A5FA 2GJNA 4UTTA 3PBYA 5I3IA 3UWYA 1TV7A 5HULA 5ABTA 1F6KA 2ZCGA 4GUJA 5FF3A 1QDSA 1AMKA 1W3NA 1Z42A 3HOJA 1VLWA 3F4WA 3TXZA 3C4UA 3TW6A 3QW3A 5AYXA 1F76A 3EX1A 4ADUA 2V2DA 5F2IA 2JBMA 3BG9A 3H54A 4YLWA 5I3KA 2HS8A 4NQ1A 5I3FA 3MHUA 3W7PA 2BSLA 5D2XA 3LTPA 3B8DA 2B7OA 2J9YA 3C0JA 4WUIA 2TSYA 3L21A 1QWGA 1B9BA 2G96A 1H50A 5D2TA 1ZAJA 3KX6A 3EEGA 4A3UA 4WXZA 2X1SA 1ONRA 2P1FA 3L0NA 3G24A 3QH2A 1SSGA 3W7DA 4RZ6A 2E77A 4UR7A 5CZTA 1PL9A 4ONVA 1ZENA 4MFDA 3W2UA 2OMAA 4JR5A 4ML9A 3TUUA 1QFEA 1EEPA 3C61A 2EKCA 3MI2A 4NX5A 1QOQA 7TIMA 3GAYA 2Y63A 3GKFA 1M7PA 1KBJA 3TU9A 2ZZ6A 2VFHA 3LOTA 2ZRXA 3L9CA 3LXAA 3BVJA 5SWUA 3KFTA 1UASA 3LCGA 1WBJA 4CQAA 4N6FA 4JDBA 1JRCA 5U7SA 5FF0A 1OFDA 1JRBA 1JCJA 1QMLA 1L2UA 3E02A 4L4MA 1ZCOA 5G2WA 4K7VA 3W7GA 3IEBA 2E6YA 4LVDA 4A2RA 4O12A 1XBVA 2R14A 6TIMA 1VPXA 3LCLA 2OT1A 3MBDA 2OJPA 2EF9A 3IIPA 2H90A 2QCHA 3G22A 5EA9A 1KM1A 3CEUA 1O95A 1T96A 2OCZA 1YTEA 3LCWA 4FNUA 3DFPA 3P60A 3UY7A 2X1TA 4JIPA 1HL2A 4NXSA 3OHIA 5AYYA 2YZRA 3AJXA 1Z44A 1DV7A 4PFMA 1EPXA 3ATZA 2VENA 3TAOA 3DZ1A 4L4LA 2W6RA 3NQFA 4PL1A 3BG5A 4K8EA 2CZDA 4HPJA 4PH6A 2QCFA 3M9YA 2WNNA 3GIYA 1VZWA 4XQ6A 3CTLA 3QYQA 1K02A 1KV5A 3UYCA 4Y8FA 1BTMA 3W1QA 5E93A 1J5TA 3W7RA 1FWTA 2PURA 4RR4A 3LCFA 4IWWA 5E0KA 1R46A 3FS2A 4LVBA 3FOKA 2X16A 3W7KA 3P80A 1ALDA 5G5IA 2CLLA 1LLZA 4AVFA 2RKXA 2ZA3A 1OJXA 1IXPA 1TPDA 1MEWA 3I68A 3TROA 1DORA 2Q3OA 3MW7A 1G6CA 3IV3A 4AF0A 5LNVA 5F2LA 3UXDA 4FO4A 1H7OA 3EX6A 2OX1A 3H53A 3GK0A 3W73A 4M6QA 1W5OA 1H7WA 4NJHA 5AFDA 4O17A 3UPBA 2CLKA 4EF9A 1I2QA 1AW2A 4GC4A 1EP2A 3FKRA 3HO8A 1VLIA 1OFBA 4JTSA 4BWLA 3UWVA 4DQWA 4IMEA 4AH7A 1W37A 4PCFA 4RV8A 3CPRA 3IVSA 1I2PA 2NXGA 2V5LA 4LVFA 4KFPA 3T4CA 3MJYA 4AHPA 3PY2A 3QMTA 5EKYA 4M7TA 4GBUA 4LS1A 3I7SA 1IGSA 2QUTA 4WX2A 1DOSA 3NR0A 3GB6A 2DZWA 3S42A 5C5YA 4JX6A 1VJIA 1GJPA 4NNBA 5FI8A 1FWWA 3W2MA 3R5EA 4RCXA 3W22A 1XDMA 2CZEA 2WO5A 1TB3A 3YPIA 5AHIA 3A24A 5CSSA 4PTNA 2V82A 3RLVA 3OVRA 2J9ZA 1QPQA 3O06A 3UNDA 3DFTA 1TYGA 4NX0A 1V5XA 3LBMA 2GVLA 2O7SA 3GDTA 1UUMA 2CLHA 4HPXA 1KTCA 5AN7A 2E1DA 1VHCA 4Z08A 1QR7A 3QW4B 3TJXA 1GVSA 3IIZA 4O16A 1TPEA 5G2IA 3NGJA 1DHPA 3C52A 3TKFA 1UBSA 1W8SA 4RZ4A 3W7CA 4DEFA 3FJ6A 3KOFA 4NJIA 4AEOA 1X7FA 3PSWA 1NFBA 4Z1AA 5L9FA 1D3HA 3EWWA 3WK0A 1X8FA 1SO4A 4H4IA 2ATMA 1KFLA 2R94A 1AL7A 1SU5A 3LHYA 1XM3A 3G3DA 2CLOA 1HUVA 2QF7A 1ZHAA 5CKSA 2Q8LA 4WOQA 3RMJA 3TMLA 3LM7A 2AGKA 1JUEA 4RJEA 4BK9A 4GE8A 3W7JA 4K37A 1O60A 4TMBA 4I7UA 4LRSA 1UB3A 2E68A 3HGSA 3SGZA 4IUOA 3W1TA 1A5SA 5AHMA 3W88A 2FLIA 4UIOA 5IM51 2JKPA 1QO5A 1YYAA 4MZ8A 4XTDA 1MZHA 4OV9A 2G95A 3TSDA 4A2SA 3TH6A 2Y85A 5AB3A 1R2SA 1FCQA 3UZJA 2B7NA 1W56A 2G97A 5DY2A 2LLEA 5F4XA 2BTMA 3STFA 2E5DA 1H60A 4LT9A 1ME8A 1UUOA 3EWYA 1UJPA 3LGEA 4IMGA 1MEIA 3Q94A 2O7QA 1SFJA 3NPWA 4BR1A 3RF9A 2DJLA 2ISVA 4OE7A 4UMCA 3W1PA 1F7BA 3PULA 3NQEA 2ZZ5A 4O54A 4RLIA 5D04C 2C18A 4JS3A 3CC1A 3W83A 3FFSA 3NQGA 5AHEA 1SZEA 4GUFA 2ATSA 5K7JA 4UFLA 1VYPX 1XC4A 3W1NA 4O1DA 2C16A 2QCNA 1JQXA 2Y7DA 4X9SA 5FF7A 2RH9A 2B4GA 4WQ6A 4HNUA 3GXPA 5EYWA 2KZHA 3QMSA 5E1QA 4AMAA 4LVGA 4MJZA 1KTBA 2EGZA 4UTMA 4FNPA 1FDJA 2FB3A 2YSWA 4MJMA 3UY8A 5FESA 4FEZA 5IBXA 3UWQA 2ZRYA 2ABAA 4LV4A 3BPWA 4FNSA 2GJLA 3T40A 3HF3A 2QUVA 1F6PA 1T99A 3MI3A 5D37A 1TPC1 4OV4A 4ZQOA 3QJAA 4IXHA 1G4TA 3N9RA 1Y0EA 3MHGA 1W1ZA 3NM1A 4AXKA 3B05A 3M5YA 1KM4A 1BWKA 1W5PA 4Y96A 2QCGA 4UTTC 3G1XA 2XN2A 2NZLA 2I14A 1PCWA 3OVQA 3NL6A 1Q6RA 1SO5A 2G5WA 2H8ZA 4X2RA 1WOAA 2RHGA 5HQEA 1F74A 2ZTJA 2HSAA 4OBTA 4Q33A 1TO3A 3CHVA 3ZWSA 5I3JA 5D2WA 4CNPA 3HGJA 2V0TA 1LBMA 2GOUA 3PBUA 1GVQA 2VKZG 2VXNA 4PEKA 1D3GA 3S6DA 4JTJA 4MPQA 3P7YA 1C9DA 3BARA 4UXDA 4NJJA 4Z1BA 3WK2A 1O4UA 3C8FA 5AHNA 3LHVA 3GKAA 1SPQA 1EUAA 1NAL1 5DXXA 1PS9A 2A0NA 1KLZA 1QPOA 3G1HA 3STEA 3GNDA 5LGZA 2QR6A 4LW7A 4FNQA 4AWUA 3B06A 3TE9A 4ORMA 2GQAA 3NQ7A 3KXQA 1H1YA 3OIXA 3LX9A 3PB2A 3W71A 3PM6A 1JR1A 3PAJA 5IBXC 4QQ3A 3W7LA 3E96A 1JCLA 3T44A 1Z48A 4UFIA 3KVKA 1O5KA 3ANYA 3W84A 2Y70A 1WYIA 1EWEA 3EX2A 2QCDB 4UTWC 1XBYA 1QNVA 5KTLA 2Z1BA 2C0AA 1QPRA 1OFEA 3NPUA 2BZNA 3P84A 3W1AA 3KVJA 5U4NA 2B0MA 3NPVA 1ZY9A 2V9DA 3THQA 2DZTA 4AHQA 1M7OA 3CLMA 3G3MA 3HIJA 3IRDA 3SR7A 1DL3A 3QRHA 2WKJA 3QPYA 4HHPA 1YLVA 4O19A 1RR2A 3DFOA 1YDVA 4HNNA 4JNMA 4CQ8A 2DZUA 3NZ1A 1YTDA 1WQ5A 4E38A 1QOPA 2FPVA 3UPWA 1EA0A 2Y7GA 4FX8A 4HSNA 1KV8A 4IMFA 2EHHA 1W3IA 1JCYA 3CM4A 1H7PA 2WSQA 1H61A 3OG3A 1RPXA 4GUIA 3SFKA 3WK1A 1PCKA 4O18A 4LRTA 2ZZ2A 1LORA 4Y9AA 4EWND 4TU1A 1RV8A 1LCOA 3JR2A 3N19B 3L2IA 3NNTA 2WOQA 3NVTA 4R53A 3VCRA 1I2OA 2I1OA 2CZFA 4Z0SA 3SECA 1F5ZA 1WV2A 3LHZA 4ZL1A 3DXIA 2NWSA 2JGYA 3NZRA 3QSRA 2EPHA 3SI9A 1X1ZA 4WD0A 1QPNA 1TPWA 3BW2A 4DO6A 4TIMA 4UTLA 1ZJIA 1L6SA 4Z1DA 1FBAA 2VFFA 1PVNA 2Y7FA 3L5MA 4FHAA 2ZZ4A 4HT3A 1K7FA 2CFFA 5TQLA 3VFLA 1EX5A 1LZOA 3GYEA 3LV5A 1C29A 3TIMA 3TQ0A 1EB3A 2BX7A 1AL8A 1KM3A 1VGAA 3MHFA 5CPNA 1Q6QA 3SIZA 4O1BA 5DCBA 5BW6A 4KWVA 1N55A 3B0UX 3NQ8A 1B3OA 1K8XA 4YCPA 3S1UA 3U8GA 3W1MA 4PC8A 3C56A 1HO1A 1Q45A 2Y88A 3STGA 2A21A 2VFGA 5DLCA 4N6EA 5KZMA 5HWMA 2ZZ3A 4YXGA 1S5VA 2W79A 4IX2A 5F2MA 4O13A 1O94A 2E6DA 2QUUA 4ALDA 1Q6LA 4KFNA 3ELFA 1W31A 3LB0A 1PIIA 1YPFA 3TA6A 3TMQA 4C1KA 3A21A 3S5OA 3UD6A 1TV5A 5EPDA 3R8RA 3W6YA 4UUIA 5TIMA 2XFWA 3SW6A 1GWJA 4MZYA 2WNZA 4JY9A 1SZGA 5D02A 3O05A 2DP3A 4UNKA 4DF1A 3I65A 1J4EA 3TC7A 2VC6A 3W72A 4UFMA 3C2RA 3MWAA 4JN6A 2QKFA 4K39A 1RZMA 2PRHA 1RQEA 1RVGA 2QCLA 1O5XA 1JQVA 3EWXA 3TFXA 4Y6GA 3LERA 4OGZA 1ZALA 5DBTA 1LLWA 2UV8G 3QQ0A 3G1DA 1R47A 1PE1A 3E9AA 1U83A 3EWBX 4MY8A 4OU1A 3L5AA 4JTLA 1GTEA 3W9ZA 1OFRA 1XXXA 2RFGA 1FWNA 2WNQA 1LBFA 4O15A 1TPH1 4DXVA 3M16A 3QZEA 3TCEA 1NVMA 5KMYA 5HR6A 5CZ0A 2YYUA 3S0CA 1KW1A 1TQXA 4S2CA 2ZRUA 2FDSA 1K7EA 4ZQRA 3NEVA 3LXCA 3NAVA 2X1RA 2VEKA 3SGUA 1FQ0A 1VRDA 3GX9A 2TMDA 4XZ9A 3HQ1A 3W2NA
chains in the Genus database with same CATH superfamily
2OQLA 3CL6A 1VC4A 2NUWA 3LEPA 4IP7A 1HF6A 2XFYA 3GAKA 4F0LA 3CH9A 2EO7A 2CHRA 3F4CA 1RQHA 9XIMA 1C3FA 1H5VA 3L12A 2W62A 3M5XA 5G1YA 4M0XA 2Z24A 3CEPA 3VK5A 3AHYA 2MNRA 3TYCA 4MPKA 4G8TA 1KTNA 3U48A 1OF8A 4M51A 2ISFA 3VKKA 4M19A 1EOMA 3JUGA 4HPGA 3QY8A 4ZE5A 1GQLA 3TQKA 3PZOA 3KTSA 1MFVA 1ONEA 4PMNA 3TYAA 5G4WA 1ZL1A 1ICPA 3E0LA 1QNSA 1K9EA 3FA5A 3FJ4A 2NWRA 1DP0A 4M6VA 1G0CA 2OWWA 1ZSXA 3EOOA 1OVDA 3NQ2A 4NYYA 2DZXA 4IJRA 3GG1A 4X2PA 3V0SA 3LMZA 4NAEA 1CI1A 1TX2A 3NYDA 2A7PA 4ZQPA 1A53A 3DKJA 4R33A 2JGQA 4GI8A 5AC8A 5F7UA 2HK1A 4QP0A 4XAZA 3L66A 3NPXA 4LYPA 5DANA 1WE5A 3TV8A 4BZYA 1UH3A 3HG3A 5DXYA 2OR2A 2GGHA 5T9BG 5CC6A 1VQTA 1XJBA 2A85A 1RY0A 2DDXA 4J3SA 5ECUA 3MMDA 3VNDA 3T4WA 3GC4A 4BFAA 3M43A 4QAIA 2POZA 3H2MA 3V75A 2J13A 1B30A 3KE0A 4O0ZA 1KCLA 3UEQA 3N6QA 1DWIM 3LM3A 2YDAA 1Q6DA 3A9IA 3OTRA 1MSSA 1ODZA 1PJ9A 1NEYA 4X3ZA 3POHA 4H01A 4UFHA 3QR0A 3LDVA 2F6UA 1Q85A 4GHRA 2VMFA 1UR2A 4M5PA 1M9HA 1AH4A 3IJ8A 4XG1A 3MVIA 1V02A 1OC6A 3R1ZA 2NV2A 1DVJA 3MT1A 1G69A 3H6OA 4Z0JA 3E38A 1BYDA 4FLQA 3DFSA 1T0OA 4GZIA 3VNMA 3CH0A 3OEXA 3BAWA 3UGRA 3NEHA 5CLTA 1PUDA 3KCJA 1PKMA 4PTXA 4ZXOA 4IGHA 1PHWA 1V3LA 1BGGA 4B2DA 4WCJA 1MQPA 2QNEA 3TYZA 4QM1A 1UP3A 3BUVA 1DWHM 4JFTA 5I5RA 4V2XA 4X0NA 4Z42C 4H3DA 2DSUA 3LCHA 4CCEA 3N6JA 1NDVA 4IFKA 1D3CA 2XN1A 5LZLA 1SW7A 2X0HA 4LOCA 2VFDA 3RM4A 1EO5A 4D1IA 1FXPA 4LB4A 2ZTKA 1R3SA 3SADA 5H91A 1KFJA 3S2NA 3MCMA 1WNOA 3EKGA 1ITXA 2NXHA 2V5DA 2PTXA 4Q32A 3S5NA 1SM9A 5D32A 1JDAA 3G77A 2HNHA 4JTGA 2PDXA 1ITUA 3UR5A 1IEXA 4P2VA 5HNNA 1X6LA 1DBTA 4QJ5B 2PTDA 1D2KA 5I24A 2IW0A 3ZFHA 2Z2BA 1VFFA 4A3RA 4ICCX 1WXYA 4WY0F 3G5EA 4JTEA 3V1PA 1YE6A 3T0DA 3MI6A 1WKYA 1XPGA 2G4JA 2WPBA 4MKNA 3E12A 4XBSA 4GYKA 1E9LA 4NU7A 3WDJA 1EXPA 2PDJA 3ITOA 4HD5A 2RJGA 2WC4A 1PZ2A 3AHXA 3R79A 3FGCB 5I07A 1XFBA 3QM3A 1LTDA 4QCEA 1P7TB 4N4PA 2PDUA 1AD4A 4JIRA 4EAMA 1XLAA 1XUUA 1FWIC 2ZUTA 3ABRA 1DJNA 3AZSA 3QR3A 4JTFA 3QN3A 3EWUA 1IF2A 4C6NA 2VI0A 4O14A 3PBWA 4L5ZA 5D03A 2YW4A 3G1AA 2B7PA 3QC3A 3P0WA 2P50A 4UQCA 5C55A 2HVNA 3DI0A 3T6CA 1WA3A 3UA3A 4Q8MA 4WZHA 3T42A 4TX9A 4NXKA 1RXOB 5A94A 3E0WA 2E09A 4JTTA 3TR2A 3IIXA 1UKQA 1VCGA 3EX4A 4HU3A 4KETA 4MIMA 4RKAA 1HFBA 1UD6A 4S3FA 5LNUA 4N4QA 4F0RA 3K4WA 3GVGA 3EXSA 2J88A 3UBPC 3T8QA 3QV6A 4JX4A 5EFFA 4DBUA 3TOYA 1KM2A 1XI3A 1NTHA 1VCFA 1H7NA 3ANVA 4YJ5A 4AZ5A 2JEPA 4M6UA 4WY0B 5FJIA 2Q02A 3KBJA 5D9PA 3CZLA 1FKWA 1KXQA 3HMJG 2I5GA 3C3NA 3OLEA 3QGAC 5E9AA 4QJ4B 1ICSA 3BG3A 3VDGA 4ZB5A 4UCGA 1PPIA 4I5XA 3RNDA 1CXFA 2XINA 3W1UA 4DN1A 1PTAA 3GW0A 1GPWA 1K03A 5B80A 1I75A 3RIKA 3W2KA 4RNIA 1C8XA 3EOLA 1FY6A 1X8CA 4B15A 1GKQA 2V3EA 2XIQA 3LD5A 4M24A 5ABEA 3L4YA 1BF6A 2FQIA 3EMZA 1PKLA 4NNCA 4WSHA 4D6DA 2BS9A 3SQSA 3MSGA 3SUSA 4RZ5A 4DNHA 1LOLA 4ZA0A 2J27A 2PRMA 3VIHA 3THUA 1SMDA 2ISWA 4IF2A 3KZSA 4W7WA 3PJWA 2HMCA 4L6OA 2R91A 3GHTA 4UTUA 1NIUA 3I10A 5JBEA 2BV9A 5XIAA 1EUNA 3D3AA 4XZWA 4HKPA 1XFCA 3KBVA 2J8GA 3KWSA 5EL1A 2FJKA 4QNWA 2VOTA 1OYBA 4IISA 1X6UA 1MRQA 3W74A 5G1TA 3CUHA 3P61A 2QJIA 1EBGA 4UR8A 5GJNA 4LGXA 2ZA1A 1W0MA 3N3MA 1MRAA 3MA8A 5TF0A 2Z1WA 1S46A 3NOEA 2GDQA 3H70A 1E43A 3W24A 4ILSA 2G41A 2A7RA 2ZOXA 2WC7A 4DZAA 1B1YA 2D3LA 1G4EA 2XVNA 3CQ0A 1NOFA 3WQWA 1A5KC 2IS7A 3B03A 4PE8A 1V7YA 1V6TA 3WLIA 1VCVA 4LUTA 1ZS2A 3QY6A 1IEIA 2OX4A 4OOUA 3CT2A 2J75A 3IUIA 5AHLA 4JKMA 1HVQA 2DT1A 5DCEA 4IIFA 3KTXA 4FNTA 4Q8NA 3PS7A 2G3JA 4K36A 4Y8EA 1RJQA 2J7FA 4DM2A 1BWLA 1TPB1 1TJPA 3WK3A 1K7XA 5BRQA 3LV6A 3DI1A 4FX6M 2PCQA 3O3RA 3ICJA 3BANA 4GKTA 2IXUA 1KRMA 2IPFA 1IZKA 1JPMA 1VFHA 3VA8A 1AH0A 4BQ5A 5A3HA 2BWGA 3QKEA 3MSYA 2ZYFA 3RLUA 4D6IA 3CBWA 3QZ6A 5A6SA 1WAWA 1LUCA 1I9CB 1DYSA 3WYZA 1KCKA 2F84A 1XG3A 4QR6A 2ONEA 1YNPA 3FXGA 3KVLA 1K8ZA 5FJJA 3W81A 3E3HA 4I6KA 1TV3A 3E0FA 4DJDA 2CW6A 3VD7A 3W70A 1E4LA 4US5A 2ZE3A 3MUXA 3H2CA 3RYSA 1MNSA 1LBLA 1FWBC 3TQVA 1Q6OA 3TNOA 4P5UA 3MMTA 3VM7A 1ZAIA 3IGUA 4FF7A 4Q8PA 1JZ7A 1F73A 3OZMA 4D8ZA 3W4RA 4IXXA 4UQBA 2NQLA 4BF5A 2WLZA 3EWZA 1IV8A 4W5ZA 2VX7A 2YLLA 1AG1O 5D09A 3N11A 5E70A 1KFKA 1OG0A 4ICNA 2P0OA 2GUUA 2C0HA 1XIDA 1R3WA 3VMOA 1W3KA 2YL9A 1P4CA 1W2VA 2WJFA 4RXFA 4L9XA 3CO4A 4JTDA 2UY5A 5M3WA 5C9UA 4J9JA 3B0PA 5A5WA 3CK5A 1S3TC 2YBVA 3SUUA 1BSIA 1DJGA 4I9AA 3U2EA 1KC7A 1Y5WA 2HBXA 4JFWA 2HNEA 5I06A 1BG4A 1FHVA 2J6VA 4LUJA 3NSNA 1RD5A 4HNVA 4RX0A 1KM0A 1DJQA 2Y2WA 5A2CA 1V6UA 1OEPA 5A6BD 4BI7A 2DT3A 2GVYA 2VNCA 4O50A 1CLXA 4GH3A 4GQGA 4QLLA 1VFMA 4E4UA 3D3FA 3MKKA 1KBKA 3H2FA 2DVXA 3U2ZA 4A22A 4PUEA 3UP8A 3A4AA 2J47A 4XD6A 2O4MA 5A1AA 3BK0A 3TLLA 3Q58A 4ZVJA 4B3LA 3W7IA 1J6PA 4D6FA 3JZEA 1PDYA 3L67A 1VAHA 2NUXA 1CB7B 3PPFA 4MFEA 5HAOA 1V8EA 3A3XA 4GI4A 1Q3NA 3AIVA 1R2RA 2VWSA 1REQA 3FEQA 4BI5A 3INPA 4NI8A 1RQBA 2VX4A 3KHJA 1FH9A 2EEXA 3N34A 5A6TC 4ZSTA 3CIXA 1W5QA 2EBNA 3GO2A 4ZXLA 4XKYA 1OGSA 4S3EA 2YXXA 1LRTA 2PU0A 1UC4A 1VH7A 1TJ0A 4IIEA 4X22A 1P0BA 1AQ0A 5HQMA 1JCXA 3N1AA 3EA2A 4KKXA 3HPXA 3MDWA 3GLCA 4B5NA 3HJZA 3QR1A 4TXEA 4DVOA 3UG4A 3GFYA 1V6VA 3RCYA 1T8XA 2GYIA 2QVHA 2TYSA 2AL1A 3W7EA 2FKPA 2OWXA 1BXCA 2J66A 2QAPA 1Q7ZA 1BD0A 5D9OA 1QUMA 1SQ7A 3VGHA 5JUVA 2V3GA 3WMLA 3IJ6A 3LHTA 2FFCA 3M0HA 2OGYA 1JNEA 4WDXA 3WF2A 3K1GA 2C1IA 4EWJA 3NL3A 1K8YA 3T78A 5REQA 1HKWA 1YDYA 2PWUA 3CIVA 2OSYA 4Q8UA 2PEVA 4F0MA 4S3KA 3KCOA 2Z1VA 4N9BA 4WKHA 4W8LA 5C9ZA 5EGRA 4EKJA 5IDZA 4POCA 1OYAA 3VFCA 1LOQA 3V18A 5DY3A 4AD3A 1MXGA 3B4YA 3U4AA 4QE5A 4N7QA 5JBFA 1XQKA 3UCCA 3RN6A 5HPCA 4FP1A 1G9HA 4H9TA 5J04A 3S9YA 2RDWA 2VGIA 3BSGA 2FVMA 3BLEA 1CPUA 2Y8UA 1HG3A 3Q37A 5FEPA 1YPXA 3A23A 4LBRA 1FWFC 3W38A 3B8WA 1SJDA 5CPLA 3IACA 4G56A 2GOKA 4DF2A 3OA5A 3S1WA 3CNYA 3H8AA 3LGDA 1O12A 1U5JA 2J77A 1R9YA 3RPDA 4L80A 3FYPA 2OYLA 4NAFA 3F5JA 2PDQA 3WFAA 1THFD 1HKIA 4QLJA 2Z6JA 4K7YA 3RJYA 2GGEA 3IJLA 3G1YA 3RO6A 4H1ZA 1TWIA 1MDLA 1CCWB 4XD5A 4MZ1A 3N9KA 3NYZA 2INZA 3UR8A 4I7WA 1ME7A 1TE6A 4KBXA 4WHBA 3M0JA 5HMSA 3SRFA 1LL4A 5IDIA 2MANA 3QYSA 2G50A 1KFCA 5LKYA 3AIUA 1B90A 3HBLA 4Q8TA 3F4DA 1GQNA 1CX9A 3GY1A 1M5WA 4MWAB 4XAYA 1XISA 3BW3A 3H21A 4XD3A 2UBPC 1GKRA 3VKBA 4HIBA 1HO4A 2WZHA 2D24A 1BTCA 1J18A 4C7GA 3AMLA 2AQWA 1FWEC 2C19A 2AAMA 2CZVA 4XZNX 1RBLA 1EJWC 1GJWA 3S5YA 2V2HA 4PTMA 4YCOA 4CUCA 3GXMA 5HULA 3R6IA 3N12A 4HVXA 5ABTA 1F6KA 4GUJA 1XLJA 3I4EA 1Z42A 3HOJA 2Z27A 1EC9A 3F4WA 1EF3A 5AYXA 4MKVA 3CXOA 3AISA 3PTQA 4MNJA 3BG9A 4EANA 2HS8A 3QGVA 2B7OA 5DRCA 3UJ2A 1NOWA 2TSYA 3L21A 1QWGA 4ECLA 2Y5SA 3O6AA 1H3GA 5D2TA 5CH9A 3CV6A 5T9CE 4A3UA 2X1SA 2W91A 4PMJA 4LAOA 4S3BA 3W7DA 4LJ3A 2GWNA 2Y8KA 3W2UA 4JR5A 1UP2A 4F66A 3C61A 4MJ2A 4NX5A 4XD4A 4IQJA 3GAYA 1GOMA 1NU5A 1R7OA 3WLHA 2ZZ6A 2VFHA 1NWTA 2CBIA 2XHYA 2GJXB 3L9CA 2NQ9A 3URBA 3VILA 5SWUA 1G94A 3AZRA 2NSOA 2AQVA 3TZNA 1J0ZA 2WVVA 2HK0A 4CQAA 4JDBA 2PGEA 3G6MA 2ALRA 3AXIA 1J5SA 3BJSA 9CGTA 1JCJA 1ZCOA 1UZHA 4K7VA 3RO8A 3W7GA 2X40A 1V0MA 4M8UA 1XF0A 2J7GA 4GKLA 3AYVA 3CPUA 3H2AA 1VPXA 2OT1A 2X0SA 2FZMA 2BHZA 1KGXA 1SFTA 2H90A 4CU6A 1GKPA 4AVFA 1YE4A 1YTEA 4GZEA 5D8WA 2X1TA 4JIPA 1HL2A 3WMSA 2VR2A 4N42A 3OHIA 2O55A 5AYYA 2WZIA 5EMJA 4DM1A 3ATZA 3CZGA 3GVQA 4R7OA 1WPCA 4CD5A 3A4JA 1DEDA 3NQFA 2D0HA 4B92A 4PL1A 3BG5A 2QJNA 2Z28A 3GZAA 3SCQA 1VFOA 1PYFA 2GDVA 4XB3A 2QCFA 4KIRA 1RCQA 3GIYA 5C8BB 1QVBA 1ZQ5A 1KV5A 3UYCA 4LCRA 1O6IA 4JKLA 2X16A 1P43A 3BMVA 4QEEA 1ALDA 2DIKA 1BQCA 4HZ7A 1TPDA 2UZ9A 3BOXA 2QQ6A 1X1NA 2D22A 4AF0A 3IV3A 4JTQA 5LNVA 5F2LA 4L6DA 4IT1A 2OX1A 2PI6A 3JZUA 1V3JA 3BZGA 3DG7A 5LA1A 3C0LA 3ZIZA 3UPBA 3SCNA 1AW2A 5HMFA 2XH0A 1OFBA 4JTSA 4L1GA 3SQLA 4B90A 1UD8A 3U2CA 1W37A 2O9PA 3ISIX 1ITQA 3IVSA 5JH1A 2CBUA 1CLKA 1ZLPA 4AHPA 3OU8A 1EJTC 1JL8A 1IGSA 1NDZA 4M1BA 2WM0A 4WX2A 1B54A 1DOSA 3GB6A 1GZJA 3VIMA 2DZWA 5C5YA 4JX6A 3TTOA 4A8NA 2EG7A 5FI8A 3W2MA 2GLKA 2QJJA 3TVAA 3ITGA 3W22A 3CZKA 1XDMA 4J40A 1J01A 2C1GA 4U31A 4GH1A 3FJNA 5E0CA 1WDDA 3U9IA 1TYGA 3N4AA 4KCWA 2GVLA 2O7SA 4H8HA 1KKRA 3WH9A 1K6WA 2CLHA 3O2LA 1E3XA 3NQBA 4Z08A 1GVSA 3IIZA 1DJIA 3TKFA 1UBSA 2XGZA 4K68A 1F61A 3KOFA 3T09A 4NJIA 2NLYA 1QBAA 1X7FA 3BICA 4ZB2A 2G8ZA 2WLYA 2DUAA 3ZT6A 3J7HA 2WW5A 2ATMA 4I9MA 1DE5A 1EHNA 1HUVA 1UR0A 1C91A 2QF7A 1BAGA 4ENLA 4WOQA 3TMLA 4PMOA 1EH9A 2EXOA 4RJEA 1UQZA 3SCPA 1RCOB 3APTA 4K37A 4LRSA 2WPGA 2E68A 2PDKA 3KBMA 3CAQA 4ZO7A 2G3NA 1NDYA 4IUOA 3BC9A 3W1TA 4C7DA 5AHMA 3N13A 3LYEA 2JKPA 1YYAA 1MZHA 3W25A 4OV9A 1VENA 2SFPA 3TSDA 3FNDA 4BKNA 3FN9A 2HXTA 1R2SA 1GQJA 4P8VA 1F07A 3APYA 5C2GA 1FH8A 2G97A 3C86A 1IT7A 1KD0A 4QHRA 1JAKA 5A95A 1OIFA 1V3MA 2HWGA 4PBGA 1H60A 1UZ1A 2IKJA 2Q01A 2XWDA 1ME8A 1UUOA 1UJPA 1MW1A 2BODX 4XBJA 3VIOA 4HP5A 5FSEC 2WJDA 4DYJA 4C6CA 3W26A 3V5OA 3ARWA 2EPMX 5D04C 2C18A 4Z2LA 3W83A 3FFSA 2ZICA 2PP1A 4LBSA 3ZQ9A 2OO6A 5K7JA 3MKVA 3TA9A 2C16A 2GJRA 3VM5A 1JQXA 4AX6A 3ERPA 4BQ2A 2DT2A 2PP3A 5FF7A 5GNYA 1QT1A 5EYWA 3RM9A 1Z32X 5E1QA 3GTNA 4MJZA 1KTBA 2EJAA 4H9ZA 2BOEX 3WBWA 4MJMA 3FVMA 5FESA 3TP4A 4HJWA 1OGBA 3UWQA 5CSUA 1E6ZA 3LZ5A 4FNSA 4H7CA 2QUVA 1P0DA 2REQB 3BCDA 5BOFA 1GVEA 3SY1A 4IXHA 3A47A 4KRUA 3EB4A 3TZFA 3B05A 3M5YA 3VGEA 1BWKA 4US6A 4WKAA 4Y96A 4DJDC 2QCGA 7PTDA 4F9DA 1E4IA 1IYXA 3OVQA 1J12A 1U1HA 1XGEA 3FDKA 4DIAA 3NL6A 2H8ZA 2FVKA 4PUMA 2J8TA 1F74A 4V27A 2YKKA 3H4WA 4AEFA 4W87A 4MADA 4Q33A 3FY1A 3GNXA 5I3JA 2CESA 1W1PA 1WZLA 2ZUNA 1XRTA 1DIKA 3QLDA 1UKPA 2PWEA 4PEKA 4KRZA 4UXDA 1FWHC 3WUBA 2CITA 2BASA 5DXXA 1PS9A 2GZXA 1JXKA 1PSCA 1P7TA 4KWOA 3STEA 3GNDA 2XDFA 2YDQA 4FNQA 1UROA 2RGLA 1BKHA 3OIXA 2WVVB 3W71A 3PM6A 2GGJA 1EDTA 6PTDA 3KVKA 3H12A 4E8GA 4WLCA 3BMWA 3FSUA 4KS0A 1WYIA 3EX2A 4UTWC 5KTLA 2Z1BA 3PN8A 5E6YA 2P88A 2O92A 3KVJA 2B0MA 3THQA 2DZTA 4F40A 4AHQA 1CXIA 1IT8A 3CLMA 3HIJA 3CO8A 3QRHA 3QPYA 1QI3A 1J8VA 1K77A 4ZEPA 3B9OA 3NZGA 5AZ1A 4HNNA 1Z69A 4RDYA 4GVFA 3WLMA 2UWFA 5C70A 1W1TA 1WQ5A 1W3JA 3CLWA 2WHJA 4A8LA 1AZ2A 3EBVA 1TJ1A 4XUYA 5A6AA 3NDYA 3FDGA 1L8PA 2BNJA 4MG4A 4AW7A 2O9OA 3SFKA 2POTA 4KGLA 2YL6A 4DBSA 4EWND 3VCNA 1ZP3A 1LCOA 3TONA 4ACZA 4WRHA 1IEWA 2OPJA 5DO8A 1GEHA 3QTGA 3WL1A 3VCRA 1I2OA 2B81A 1BGAA 2CXGA 4YS1A 1UKOA 3DXIA 2NWSA 1X96A 2EPHA 1GQKA 3GIPA 3T0AA 1TPWA 1P1MA 3BW2A 3RX2A 4M82A 2IPWA 3WF0A 4ZENA 4DAFA 2ZZ4A 4JN8A 5DT5A 1EYEA 3DG6A 3TN3A 3VX0A 5B7ZA 3KRBA 3PANA 4ZE4A 4MGGA 2NQHA 4IIBA 2BBFA 4AZ7A 5C9WA 1G01A 1VGAA 4NY2A 1EQCA 1QNRA 1TVLA 2NQZA 3SIZA 4O1BA 5DCBA 3DYPA 3NQ8A 1K8XA 4AIEA 3S1UA 1E72M 1JFXA 2PC8A 1XSJA 4XIAA 5DLCA 1WKEA 2W79A 2HEJA 3ZJKA 1XRSA 4P7LA 3TEVA 4JHOA 2QUUA 5A2AA 3ELFA 5I7GA 4C1KA 2EPKX 4GD0A 2W66A 3B9EA 2NT1A 3RRXA 1GWJA 2YCJA 1NP0A 4GA8A 5FD0A 5AC4A 1T6MA 3UJEA 1JYVA 3W37A 2AL2B 2XIMA 3COTA 2YLAA 3BSHA 2BY0A 1RVGA 3K8KA 2XUCA 1IQ8A 4Y6GA 4PB3A 3A12A 1U1JA 1YNYA 1ZALA 4D6JA 1PE1A 3L5AA 1Z89A 1JYWA 3CHFA 3M16A 5HR6A 2DH2A 5CZ0A 2YYUA 1TQXA 3GVWA 4DXXA 1K7EA 4ERAA 2HVOA 3LXCA 2X1RA 4HK7A 4OUIA 4X61A 2FZDA 4LF1A 2TMDA 2HCVA 3W2NA 1HP5A 2P3ZA 5I03A 5KINA 2XVLA 1KO0A 5L6UA 1R7AA 4GIRA 1OX6A 4HCDA 4CD6A 5H2ZA 1S38A 3CJPA 5H8PA 4A3QA 1AMYA 4E3VA 1IR1A 3NSMA 4UNLA 1CGWA 3RU6A 4DELA 2ZBTA 2CLEA 4LEQA 2H3BA 5HDRA 4OVXA 3QTPA 3DC8A 1N2VA 4E2DA 1HZYA 2YX0A 3ZVHA 3ES8A 1C8VA 5D4YA 4GXWA 4WJEA 3UT0A 3RX4A 1GOXA 3L65A 1TV4A 2VOMA 3LMYA 3PZVA 4TV5A 4MB1A 2R1KA 2QJHA 4AZIA 4GYJA 1R86A 1W1A1 3VZXA 4FOKA 3DIPA 4N02A 4EF8A 2QCDA 3G1FA 4NAEB 5H8UA 3EEZA 3ARPA 5CPTA 3U7VA 4EIVA 3G18A 1K3UA 3RCNA 4A05A 3HMCA 4JFVA 2VC7A 1TFVA 2BXZA 2WC3A 3ABQA 5MHBA 2OZ0A 4MDPA 3ZLFA 3M47A 3BLIA 2V63A 1EZ2A 3NQMA 2Y89A 3S83A 3QSTA 5T8GA 3N18A 3UF9A 4GX9A 2UY4A 1ADOA 3GDKA 1GTHA 2NLIA 1YDOA 2V67A 4QG8A 1S5WA 1PZ1A 3NQDA 2PCEA 5MKGA 1IHIA 4N9EA 1B3ZA 3U5YA 3URAA 2OVLA 3BCFA 2PE4A 3PSVA 4OECA 1P0NA 5F1UA 3P8JA 4HCHA 4RW5A 3IJ7A 3LENA 3CYVA 2I57A 1MQRA 3PC0A 4IJBA 3N2OA 2GSEA 2DVUA 2GGIA 1EYWA 2PD5A 4R88A 1E6XM 2NV9A 1QI0A 4UMAA 4TOQA 3DDMA 5JVLA 2QDHA 4IPIA 3F4NA 4PZVA 5FA5A 1RCXB 4D6CA 1HQTA 3JS3A 1XX1A 1RY8A 3BGAA 4IQEA 1W54A 3MUY1 6ENLA 5DMNA 4BJHA 5E5CA 2CWNA 4LF2A 1BFNA 4MY1A 1TMLA 2WV8A 4ZB0A 1SR9A 1B57A 3D0CA 3H22A 3EKZA 3NOYA 4WVXA 4HHHA 3R58A 5TBOA 3M7WA 2WQDA 1U5HA 1GVOA 1JZ2A 1SZFA 2NXIA 1ADSA 1DXIA 5CAHA 3NZQA 1GVFA 3QEZA 4GY1A 5F1VA 4NJGA 3OA3A 3TJIA 1YQ2A 3W75A 1XRFA 4PGLA 1PHQA 3S1VA 3H55A 2IUZA 3RCMA 1NQ6A 1H0GA 3BLFA 4AD5A 2A7NA 1NP2A 2PLKA 1QJWA 3N2CA 4QJ1A 4L4PA 3WL0A 2HBVA 4EPKA 1YMYA 3AS2A 3CMJA 4IM4A 3W7OA 1E5JA 3KS5A 2QMKA 5DN1A 3LTYA 2Z1XA 2XIBA 4UTKA 3GE7A 3S9ZA 4M3PA 5HNUA 1XBZA 1OC5A 1UBPC 3WJXA 3IGHX 2YCLA 3B40A 4XBKA 4DYKA 4GIEA 1XLEA 3GS6A 1KWKA 4OOZA 1S5NA 2DJXA 2E7FA 2PPGA 4XVEA 2QAFA 4GY7A 3CUFA 3AYSA 1H62A 3FIGA 1J10A 2VELA 3T2QA 4YIWA 2BXVA 3QQ1A 5FJRA 5G4HC 3BQ6A 4Y90A 4JIQA 2PBGA 2FGBA 2PS2A 1NM9A 1JNDA 3AMKA 1R0MA 2C13A 1EA9C 2VUNA 2A3CA 1A0DA 3FKKA 1H51A 3R12A 3M6DA 1XINA 3OQ8A 2WMIA 4Q6JA 1XV8A 1LQ2A 2YR1A 3DBPA 2HISA 3VE9A 4FR1A 2E28A 1XDLA 3C2EA 1XHGA 2QDEA 3R2GA 3USZA 1JJKA 5E09A 1VR6A 1MEHA 4GUGA 2Q09A 1Q6EA 4GVHA 1I1XA 1KBLA 3ITYA 3OZOA 2NUYA 3N17A 4A3HA 4LY4A 3PB0A 3IJIA 1VIZA 1OFOA 3PNUA 2E25A 4JTIA 3ORWA 4FK9A 2XM2A 4S23A 3GU9A 2PODA 1XH0A 2PAJA 2VGGA 4CNUA 2YCIX 3W27A 3CB8A 3EX3A 4BCEA 4NZJA 1TREA 1DTNA 1FRBA 2VP8A 2CCRA 2C8NA 4DLMA 1V0KA 1BKSA 1NFGA 4ZTYA 3CYJA 1G4PA 1I4NA 2NVCA 1W3TA 1I45A 3W7NA 1YXYA 4XVDA 4K1GA 4L65A 3SIMA 1B2YA 3PWAA 5CEWA 2PA6A 3QOMA 2G4FA 1MO0A 4R27A 4C60A 4WIWA 2VZUA 3W86A 3HPSA 5HINA 3DYMA 3KTCA 5JQ9A 1JAEA 1X7IA 5GNXA 4REQB 1HIZA 4JTHA 4IG2A 4YHGA 4C65A 3A5VA 2BGQA 3O6YX 3AMGA 1J96A 3AU6A 2VDGA 3VDCA 4U10A 4A4AA 3WQ6A 4LY8A 3HA1A 2RJHA 3ZLHA 4Z1CA 2IXVA 1FCBA 1TELA 4JHMA 4KT2A 1OCNA 2TRSA 4C6LA 2VGFA 4QGCA 4ERGA 2D2OA 4LXFA 5T26A 3SGGA 4D71A 3PVFA 3QPZA 3LUTA 2OLHA 9XIAA 2A79A 4JYFA 4QDMA 3T8LA 1VYRA 4B9YA 3OIHA 4HYWA 1WB0A 1LG1A 3CU2A 5I78A 5A69A 1WDRA 4ATLA 3R8HA 2PZ0A 1OZQA 4J7RA 1JPHA 4ZQMA 4U28A 1UPPA 3PBGA 1JUKA 4JAWA 3C2FA 1K70A 3T0TA 3WD3A 1JCMP 3TTYA 4P7NA 3OP2A 4KW2A 2VX6A 3Q4DA 1JDFA 4X63A 2CLFA 3EXTA 2HE5A 5BRBA 2EAWA 2WMGA 4GRSA 1J0KA 1PV8A 2VTFA 2Y7EA 1TQJA 2D69A 4LC6A 4O57A 3AOFA 1KXTA 5ABGA 1YXDA 4FPSA 1YX1A 2V5BA 4LV9A 3SSJA 4JTRA 3DFHA 5FEXA 1SW3A 5JXQA 1EP3A 5HWJA 1ISVA 3PUGA 5GNZA 5ENLA 1XIFA 1TVNA 5I77A 1MI3A 4YN5A 1BPLB 4E4FA 1OYCA 4ZOBA 3WUGA 2QV4A 3CWNA 1ICQA 5CCZA 1XDJA 4Q4KA 4YVVA 3UZ5A 1W3LA 2TODA 3HG4A 3QOKA 1P1XA 1EF2A 2C1HA 2PC4A 3CIWA 1A49A 3N04A 2BOGX 3LCIA 1DJWA 4LNYA 5D05A 1Q8JA 3EAUA 1V02E 1HNYA 2JKAA 3WDHA 2Z0IA 3HGRA 3TTQA 4AD0A 4IICA 1TA3A 1UD5A 2PBOA 3K46A 1TRIA 5EBAA 4JTUA 3VKJA 4D2JA 4HPHA 3MYPA 4M29A 4WR3A 2ZZ1A 1GOWA 1H7RA 3F5KA 3KL5A 3ABSA 1E6PA 2GK1A 4AVNA 4KERA 1XIBA 1Z8AA 3NQAA 4MAVA 5K9CA 1OFAA 2DW6A 2NV1A 1TIMA 3S1GA 1ONWA 3PWGA 2YXGA 1QXLA 1IXOA 4KPLA 3Q65A 2PLCA 4HA1A 2V68A 4R85A 4CNSA 1PX8A 1FVPA 1TTIA 3RITA 2Q71A 3KBWA 3E0IA 2OB3A 2GQ3A 4A21A 4QNEA 2A5HA 4CCCA 4GYPA 3RPMA 5C2XA 1JF6A 4OT7A 3PZIA 4S1FA 1T5AA 3Q2DA 4OWGA 1D9EA 4IOTA 4CD7A 3Q67A 3CASA 3GR7A 3S6TA 4JQ1A 3G0XA 3ARUA 3IS4A 4B4HA 1LT8A 3G8EA 1HP4A 4NILA 1YPIA 4NI3A 3GXDA 5LNRA 5FAGA 3FSTA 3R43A 1TWZA 4JTKA 4PSRA 3LPOA 1VJSA 1TCMA 2PDMA 3ZXWA 2F8QA 1RJRA 4LAMA 3NDOA 2P10A 4O4WA 3TXVA 3ITVA 5HPOA 1KCZA 3XIMA 4FLRA 5FACA 6A3HA 4IFOA 5AC7A 2YB4A 4FOUA 3IJDA 2W5FA 3R89A 4AYGA 1RBOB 3SM0A 2PDFA 2X30A 2NVDA 1LQ0A 4YTSA 1PX3A 1P0KA 2VD9A 4FB7A 1M3UA 2D23A 4QAWA 4FLOA 4UQ9A 1Z41A 1E0TA 1CBGA 3HN3A 3UJFA 1GGOA 3GUWA 3EA3A 4O0KA 4RPPA 2GQ9A 3VO0A 1V3IA 3W76A 1R3QA 4ICMA 4DUOA 3A3HA 3URQA 3CMGA 1WUFA 3BH4A 4EVZA 4ZZ9A 5J5RA 1B9ZA 3VD5A 4JD4A 4GOAA 1DPMA 1EOKA 4PEEA 1JD7A 1WUEA 3KRZA 5I79A 2VVNA 1N7KA 1UW9A 3HU7A 4NUWA 2WVUA 4E2BA 1TMQA 4F4RA 3ALGA 1SVDA 3KHDA 3SJ3A 3VX1A 1SZNA 2EJ1A 1CGYA 3FAXA 2PDLA 3NWRA 3WLTA 3W2LA 3BLLA 4ZSUA 1KR0A 4TV6A 1KRBC 1US3A 3LSBA 1ZTVA 2QCEA 3FHAA 3WNPA 1U1UA 1LM1A 2H8XA 3HFTA 1KR1A 4HHMA 4DWSA 4C6MA 3STPA 5KZEA 2VEGA 2HPMA 2V6AA 1TV8A 1D8WA 1EJXC 4UC5A 1TTQA 4IPNB 1A80A 3GXTA 1XYCA 1NARA 3C2VA 5D30A 3LCXA 2V38A 3VOGA 5K9XA 6ALDA 3WLRA 3VVGA 3GXFA 4FNRA 4B5SA 5GPRA 1UUQA 3SY8A 1G67A 2YFNA 3O6CA 4PA8A 3SURA 5IHRA 3FAWA 1W9PA 4S2BA 4ZGYA 5FKYA 1HTIA 1VD6A 4JYEA 1SFSA 2QCMA 4MKSA 1ZFJA 3T0CA 2ODOA 2X8RA 1LUCB 4UOQA 5C2CA 1HVXA 2BMBA 2GQ8A 4P7RA 2XN0A 4F9JA 3IK4A 3OW1A 3VCCA 3P67A 3SB0A 4B5VA 5LHFA 4CVWA 4LUIA 1NELA 1FFQA 3GDLA 4CKQA 2C79A 2WAGA 4QSHA 1C7TA 2OSXA 1VBHA 3AXXA 1UPMB 1FCVA 4A3YA 4O10A 1OADA 3FLUA 4QSFA 5FF4A 4Z2IA 3OYXA 5M1TA 2Y1HA 4I9JA 2FZNA 3FA3A 4L9ZA 1KQYA 1J79A 4XZLX 4FXSA 5DQPA 3WLLA 1UR8A 3N25A 4EE9A 4MUZA 3E49A 4GYPC 3DH7A 3BW4A 3GFZA 1LRQA 5EMMA 1WZKA 2GWGA 2DZBA 2VEIA 2Y0FA 2WCAA 3PJXA 4MVAA 4I90A 3IGSA 3WQPA 1MXSA 2X2GA 4UCFA 3WX7A 2BFGA 3G1RA 5I0DA 3L2LA 2D73A 4Q6XA 1LOSA 2CWXA 4MY9A 5AY7A 3B0VC 2Y6ZA 1QO2A 1X97A 3KM8A 3CWOX 4JQ4A 3PUOA 5AYIA 1OD8A 3WO8A 1KLYA 4O1EA 4PRWA 3UWYA 3TYEA 1PKNA 1DQUA 2PWHA 4YTTA 2ZCGA 2WZEA 1AMKA 3C0QA 1W3NA 1EJ7L 4LAZA 2AKZA 3TXZA 3MUIA 3FHQA 4C6OA 4ADUA 3XISA 1HJXA 3UJRA 4NQ1A 5I3FA 2PZNA 2BSLA 2OZ3A 3B8DA 3R11A 4H9MA 1O66A 3C0JA 2OTDA 1H4PA 4GQ0A 5D9MA 4REQA 2WMKA 5LXEA 2ZX7A 4XX6A 3QH2A 2Q6ZA 3GHUA 3IUHA 4EK7A 5HBFA 1ZENA 2Y4SA 4U5KA 2ZX6A 4ML9A 3TUUA 1J11A 1EEPA 2UY3A 4L4OA 2BVWA 4G1NA 3WQOA 2D2GA 3IAPA 3GKFA 1KBJA 3WEZA 4JZ5A 1AJZA 4LYRA 1P6CA 3LXAA 4DUVA 3GDBA 3BVJA 3S4TA 2JEQA 5C9XA 3KFTA 1RAKA 4IGSA 3CQHA 3LCGA 4PCTA 1KRAC 1F8MA 1JRCA 5FF0A 3S46A 4NG3A 4NP7A 3AXMA 4L4MA 3BAKA 3DEQA 5CPQA 2ZC8A 1V6YA 3L4WA 3ZR5A 5IOBA 1XBVA 1C7SA 6TIMA 2NT0A 4H7ZA 1Q13A 1HJQA 1H11A 2OJPA 2VWTA 2QW5A 1KM1A 3CEUA 1T96A 3LCWA 4FNUA 3DFPA 3P60A 4J3VA 4M81A 4NXSA 4OZOA 1YNQA 3ITLA 2VX5A 1Z44A 2QMJA 4PFMA 4ATWA 2VENA 5DMMA 3TAOA 2PDYA 4TX8A 1GK8A 4UWMA 3WDQA 3WQ4A 4HPJA 4HA3A 3M9YA 4XQ6A 4E4PA 1W9BM 3APGA 1GNXA 3W1QA 4MAZA 5E93A 1UP0A 5E0KA 5M03A 3S47A 5G5IA 3KWXA 2CLLA 1DJXA 3RM8A 3NFUA 1E73M 5JMUA 4AZCA 1R5YA 3IWPA 1R6WA 3CL8A 2V5CA 3VD4A 1JZ5A 2WBGA 4C5YA 3GG8A 2OO0A 1DORA 1XYZA 2OSWA 3UXDA 3H53A 5DX7A 3GK0A 3W73A 1W5OA 3UCDA 4QX4A 5AFDA 1PBGA 4O17A 4AQLA 4EF9A 3PTDA 5FJPA 3TQPA 1CDGA 3HO8A 4AIBA 4LUSA 2EPLX 4S3AA 4DQWA 4IMEA 4GIYA 3LLXA 1JPDX 1UWUA 4RDVA 4OBSA 4AFYA 2FHFA 1QW9A 4UQEA 1I2PA 2WKLA 2V5LA 4KFPA 2PGWA 4M7TA 4GBUA 2CNCA 1G1YA 3KS6A 3VIGA 4H04A 3E2VA 3MSRA 3SO7A 3S42A 3V0UA 1EJSC 3VKAA 1GJPA 3NSXA 3AC0A 4KH2A 2H9AB 1XYMA 3YPIA 3EWDA 2V82A 1LWIA 2J9ZA 1QPQA 3O06A 4MUPA 3UNDA 1HKVA 3LBMA 4UQDA 3M4HA 1TUXA 2WMIB 1UUMA 1KTCA 1K4GA 2E1DA 1VHCA 1W17A 4B2DD 3MS8A 3TJXA 3VMPA 3VGGA 4O16A 1DHPA 1W8SA 3W7CA 3AS1A 1YW1A 4DJFD 2WMHA 1E0UA 4XO6A 1JGIA 4AEOA 3PSWA 3BXWA 3O7UA 4TX6A 1V4YA 1XGZA 1KFLA 3AROA 1AL7A 1SU5A 3HFYA 3G3DA 2Q8LA 2YXOA 1TG7A 4RDZA 3W7JA 4D72A 4V33A 1UB3A 3HGSA 3GU2A 8RUCA 2ZDSA 1RA5A 3TN4A 1IT0A 1HW6A 1A5SA 2PF8A 5IM51 1QO5A 4XTDA 1B3VA 1E1FA 3BL3A 3AU2A 2Y85A 3KUMA 2VYOA 5CSYA 1FCQA 4CGTA 1W56A 7REQA 5DY2A 5F4XA 2LLEA 2FZBA 3STFA 6XIAA 2QULA 3V4BA 1MUWA 4JKKA 4MDOA 4N0RA 4IMGA 3TOPA 4KEMA 2O7QA 3LPGA 1GW9A 2DJLA 2ISVA 4OE7A 4PBEA 4UMCA 3W1PA 3ZJ7A 1J0IA 3AICA 2JALA 4AD4A 2HV5A 2PDPA 1A5MC 1XIIA 2HZGA 1SZEA 3MZNA 4H6EA 3S2LA 3WH5A 1E40A 4FAMA 1VYPX 1XC4A 1V7AA 8A3HA 4O1DA 3H24A 1FOBA 4UZUA 4X9SA 2BG5A 2B4GA 4WQ6A 3VOCA 3GXPA 4HNUA 3GG7A 2XPKA 3QMSA 4LVGA 2X0YA 4UTMA 2VUYA 1FDJA 1JZ8A 3VTRA 2FB3A 2WVSA 4Z1YA 2YSWA 3UY8A 2X7VA 3BCJA 3UVIA 2FVLA 4CQBA 4RNFA 2ABAA 2GL5A 3BTNA 3BPWA 3VUSA 3T9PA 5LIUX 3UPMA 3HF3A 1F6PA 1T99A 4OV4A 1G4TA 1X38A 2EQDA 3N9RA 1GVYA 3VIPA 1W1ZA 1VF8A 4UTTC 5LIXX 3SN4A 3T0BA 2XN2A 4A6GA 1IEVA 4HA0A 5BXRA 2ZVIA 1JPKA 1M7XA 2G5WA 2RHGA 3L23A 2HSAA 4OBTA 2E8ZA 3WMCA 3HM7A 1TO3A 2G3MA 3RHGA 3HGJA 4BQ4A 4XZBA 4Q4MA 2V0TA 1GVQA 1VEMA 2VXNA 1PTGA 3EPOA 3UETA 3PHAA 4JTJA 4C6KA 4MPQA 1FWAC 3P7YA 4IIDA 4AYSA 1ZGDA 2XM1A 4NJJA 3WEMA 6REQA 1O4UA 2WBKA 2WXDM 3C8FA 1GW1A 4GQBA 4YU1A 2A0NA 4B16A 4DY1A 2QR6A 1QK2A 4JPGA 2GQAA 3AXHA 1H1NA 3KXQA 1GOIA 4LB3A 3LX9A 1Z3NA 3PB2A 1Y65A 3DBNA 1PZ3A 3W7LA 2J78A 3E96A 1F3WA 1O5KA 2OZ8A 1EWEA 2QCDB 4NHVA 3WBEA 1XBYA 2PSNA 1KQZA 2C0AA 2QVNA 1OFEA 4XZMX 1R8LA 3F2CA 3BZJA 2BZNA 2PDGA 3P84A 3T2PA 3W6MA 2E0PA 2HPIA 1NDWA 2V9DA 3OG2A 4HOWA 4PBFA 1JDDA 1RR2A 5T91A 1NFPA 3DFOA 1YDVA 4JNMA 3RLHA 4JNZA 4DWSB 5AC5A 5PTDA 3NVDA 2WWDA 3M64A 1M65A 1W91A 4LYQA 3AZTA 2FPVA 2YBUA 4E38A 3WNLA 4QG9A 2FZ8A 2EHHA 2WZMA 1JCYA 3EMQA 3WD2A 4WF7A 2VQTA 4GUIA 3WK1A 1PCKA 3PFRA 2DFAA 3SDOA 4Y9AA 3B8TA 2ZUVA 4JOMA 1P6BA 3UFYA 1YBQB 3RAOA 3D46A 3CUJA 4QS5A 2I1OA 4KWUA 3SQMA 4Z0SA 5BOEA 4PRTA 5BWFA 4J3ZA 4HCLA 1GHRA 1QPNA 1WZAA 3UZXA 4IL0A 4CU7A 3CHEA 3BLOA 2XH7A 4MJ4A 1L6SA 4LYKA 1GZ1A 1HXJA 2Y7FA 4DJEA 1KB3A 3REQA 3PAOA 3VFLA 2QV5A 1EX5A 2GJPA 3AHTA 4NASA 2IPGA 3LV5A 2R6OA 1H2JA 3UCQA 4EX4A 1H41A 2GDUA 1CT5A 5E9XA 4QBXA 4PMXA 3MHFA 3HPAA 4ZO6A 2RUSA 1Q6QA 2AAAA 1TX0A 2ZADA 3K4AA 4Y9NA 1A5NC 4KEUA 3PJTA 5BW6A 4YCPA 4J4KA 2DEPA 3KW3A 2Y5EA 1HO1A 3EPNA 3PZGA 2CKSA 1E9YB 2VCBA 3VZYA 2FFIA 2ZZ3A 3BAIA 1IZCA 4CQCA 4KCUA 1VRXA 1W31A 1YPFA 3KOYA 4WJXA 3TA6A 4IZGA 4H2HA 3TMQA 3HV9A 2PTWA 3UD6A 5EPDA 1F6YA 5TIMA 2HDJA 2VGBA 4MZYA 3VDAA 3SRHA 4JY9A 3B9NA 2I5IA 2VC5A 5D02A 3O05A 4S38A 3ABZA 1TR9A 4UNKA 3VXGA 1J4EA 4MB4A 1TKKA 3W72A 1AUSL 2A3AA 1QATA 2PRHA 1UQYA 4URIA 3DG3A 3TFXA 2O9TA 3LERA 4OGZA 3CAWA 4ML4A 1R47A 4A8IA 3E9AA 1U83A 4OU1A 1PIFA 1W3HA 4GMEA 3ARVA 1FWNA 1JYXA 1JEZA 1LBFA 4O15A 2EKGA 4DXVA 1WO2A 4HZMA 3S0CA 4S2CA 2ZRUA 2FDSA 3OGVA 2W4XA 5A6BA 3FGCA 4ES4A 2VEFA 1VRDA 1E5NA 3L4XA 3HQ1A 4MB5A 3VNIA 4JTAA 3EOEA 3H2NA 2FMNA 4XKMA 5FJOA 5BU9A 3MV11 1L0PA 2JF6A 4O1FA 3UWUA 3ZOAA 4AY8A 1A50A 1R87A 1KFBA 2VR5A 3E74A 3M0VA 3OZPA 4DWSC 4QG6A 5LGXA 3G0UA 4MB3A 3LSCA 4K8HA 4U33A 3W01A 1SSDA 1XIJA 2J62A 4C6PA 4C6EA 2WZTA 1XLBA 4I6VA 3W29A 4GGHA 4ZCWA 2YOCA 4RE0A 3HPFA 3WENA 4NL1A 4LANA 2A6LA 1C8YA 2F9RA 4YL2A 4J28A 5C54A 4LEFA 3D6NA 4QISA 3CUIA 2YB1A 2VHLA 3MO7A 4QDPA 3CV1A 4MM1A 2B31A 5DELA 3ZJ6A 4GI9A 4JY8A 3WJZA 1W1YA 1TZZA 3WFLA 3W07A 4GY0A 2VT0A 2XVPA 2Z29A 5G2HA 3ZWTA 3ZVHB 4FR6A 3M0MA 2EPNA 1E9ZB 1BYBA 6REQB 3F2DA 4MLJA 2DSWA 3P5YA 2FTPA 5I3DA 2XU2A 3DHDA 1AJ2A 1QTWA 3AIWA 4CLMA 2ZKMX 1T7LA 1AW5A 1LP6A 1RSCA 3TN6A 3MP5A 3ZLGA 1S5TA 1YDNA 2VEMA 3HGOA 4OTKA 2ASHA 3B0YA 4GG9A 2BP1A 2HTMA 1XLLA 1UR1A 1WX0A 3BGJA 2IMRA 4GYFA 4UR9A 3HTWA 5AVNA 1EQPA 1OBAA 3L7RA 2NW0A 2CIPA 4HBKA 2PD9A 1A3XA 4E2OA 3L5LA 4PB5A 5H6HA 1OIMA 3DGRA 1WCGA 3WLQA 2RAGA 2PDWA 4G1KA 3W7QA 2BY3A 2JK2A 2A4AA 1OX5A 1ZBWA 2CPUA 4NZ5A 1XL9A 1F3XA 1XH2A 5LNSA 1F3EA 1ZBVA 3T55A 4AZHA 1FDZA 2H3DA 1C8QA 1ML1A 4OFCA 2G0WA 2XIJA 3N2XA 3UXLA 3EB2A 4IGMA 4KEZA 5EFDA 2ZXQA 1H63A 3G0SA 2P76A 3FV9A 5FF2A 2PF0A 1HJSA 2VRJA 3HG5A 2WHMA 3AWNA 4XK2A 3JU2A 3LHUA 3U7BA 4LBUA 3I6RA 4W85A 1UKSA 2E6AA 4KCTA 1ECEA 4NZ4A 3ZSTA 3MP3A 1OHLA 3HPZA 3WKZA 4AG0A 3GSMA 3IIOA 1IR2A 2V3FA 3B3DA 2QDGA 4E0CA 1FFRA 2E4TA 3ARTA 4JCLA 5GVJA 3F03K 2WSPA 3HB9A 4HGXA 3ITTA 4U2ZA 4JL2A 2ZQ0A 1LRNA 5G4EA 4NSBA 2QHAA 2QT3A 3N14A 3IVTA 1GOKA 1QASA 2R1LA 5AHFA 4INFA 1J0YA 5AOUA 1HKJA 1Q5MA 1XLHA 3CT7A 1UD2A 1GYNA 5REQB 1DWAM 1MZRA 3C2OA 2GVGA 4C90A 2AL2A 2YYTA 4GJ1A 1IIHA 4GGBA 2ZDRA 4Z2HA 1ZU8A 3KAOA 1DJYA 2YCEA 3LNMA 5KEZA 2Y62A 2VJXA 2P53A 3I7RA 6TAAA 2WNWA 3H2OA 2Z00A 2GUYA 3L4VA 4U3AA 1A3WA 3AO0A 2KX9A 3GR4A 2ZVRA 1A5BA 4W5UA 2WSYA 4I9TA 5HWNA 2WKGA 3VU2A 1XCFA 1L6WA 3KVMA 3RR1A 3LNPA 3W3OA 3IUDA 4AIUA 4NJKA 3WDRA 4XSLA 3MB9A 2RGMA 2DU2A 4XAFA 4HNLA 4UTJA 1AVAA 1XPYA 4YYFA 1AQHA 2RDTA 1E3ZA 5I2UA 4B4FA 1GG0A 4XWUA 2ZIDA 2HQAA 4EPBC 3ZS4A 2X1UA 2J7HA 2BDQA 3BOLA 3RMEA 4O28A 3NZPA 1XSKA 5CJMA 4C6DA 1EKOA 4F2BA 4M1RA 1XD0A 4QE1A 4ZBCA 4MSSA 3GH4A 4C1NB 2NX9A 1E0XA 1UWQA 3HZ3A 3M5ZA 5ECVA 4Q4QA 4C7FA 1NQKA 3KLLA 4XUGA 4BWLC 1M01A 3LN3A 1XBXA 4FX7A 1RK5A 5CSRA 1AQFA 3SAZA 1CXEA 2WSRA 4IMCA 2P3EA 5EBUA 3BURA 3WJWA 5LNWA 1JFHA 2MUCA 1B0IA 3DU0A 2VL4A 4I7VA 1HJVA 3E5PA 5CZJA 1UJQA 3A64A 4K2SA 3TC6A 1MWOA 4HOXA 1CB2A 3AIRA 3GXNA 2F2KA 4H6QA 3VZZA 5LSMA 1SMAA 1SO3A 1DQXA 3GIQA 1R38A 1XSIA 1XYBA 5J8LA 3UR2A 4O1CA 4MYAA 3I7QA 2Y8VA 3K13A 3R25A 1FHDA 3S8HA 2WANA 1B4KA 4DZ5A 3UWWA 2ESCA 2WYSA 4R7WA 4AXNA 4GX8A 1Q7MA 1E51A 5FJTA 2C14A 2J9XA 4LNCA 1W9VA 1XIHA 2XSBA 5BOOA 1PAMA 2I9UA 1UCWA 2WCGA 4XKYB 4IP4A 1A5CA 3P6LA 1WDWA 3VE7A 2VFEA 1WKFA 3SUWA 1JYNA 1WKDA 4OHQA 3VINA 4DB7A 4WGHA 1JD9A 3SCUA 3U0HA 2VQUA 1POKA 3W6LA 2JQXA 3QXBA 3JRKA 3WH8A 3KZPA 1W5NA 1JCNA 5AYZA 3KBSA 3OPSA 1R3VA 2W9MA 3WQEA 4GO8A 1ZNNA 2GPTA 4Q8VA 2YDSA 2BGSA 1AA1B 1ZCCA 2QUMA 2Z2AA 4HN4A 4L9YA 2J24A 1OZMA 3U4FA 3BQ5A 2XFRA 4JL1A 1I60A 4P61A 1E70M 4LC8A 5FSDC 3BV4A 3OBEA 4U2YA 1ZJAA 5C7VA 3W53A 2OT0A 4UNIA 4IMAA 1GVRA 3WNNA 2C91A 4PR4A 3LHWA 2YL8A 4UMBA 2ZX5A 4XV0A 1D7FA 1OK6A 2ZRVA 3K8LA 1TZ7A 2FPTA 1W5MA 1WXJA 3WQFA 4IPJA 4PRRA 3EOUA 4N9DA 2FMOA 4TO8A 1IWPA 1GONA 5DCDA 1V93A 3R10A 4JGDA 1EJVC 4XAGA 3LBOA 4O1AA 1EHAA 3WY1A 2I17A 3H7UA 4KQNA 4AUBA 3W23A 4GNJA 5IHSA 2OXNA 2V2CA 1OX4B 1EGZA 3MMWA 2GSJA 1OM0A 3T7VA 2FGLA 1L9WA 4Q7NA 2PDIA 3O0KA 1MQQA 4PMVA 5D38A 4LCSA 2YFOA 1UR9A 1UWSA 5CPSA 1KXVA 5K9DA 3K8MA 3GH7A 1H7XA 3M41A 3O07A 4LUSB 2WVTA 2ZWZA 1OWQA 2JKEA 1A0CA 3GDMA 3OB8A 1H09A 3G1VA 4LWWA 4IQLA 5K2ZA 4QEHA 5IFPA 3G1SA 2ZUSA 1RLDA 2PWVA 5HJLA 1KNWA 4U3CA 4O8AA 5BNKA 1PYMA 4UFKA 3L2MA 1S2TA 1ZJHA 4NRSA 3I6EA 4GINA 3MANA 1K9DA 4DX3A 1J2WA 1FP9A 3V35A 5F2GA 2A3LA 2CEQA 1BXBA 1A0EA 2OYKA 1AW1A 4J3UA 3AIBA 1PWLA 4HHLA 2E5CA 4PMZA 1ZAHA 2W61A 3UXIA 1BVWA 1EDQA 1KA9F 3NQ6A 2ICSA 3GWQA 2X09A 1O1ZA 2FPYA 1QNQA 2VRKA 1I8JA 3PFMA 4ATDA 1JF5A 3S5ZA 2I7GA 1C93A 3WLPA 3LRMA 1M6JA 1MFUA 4P8XA 2YZ5A 4WEVX 4KWSA 3E5BA 5H1WA 2WWCA 2A2IA 2CC0A 4G7EB 1S39A 3DENA 3KDOA 3U6WA 3O6DA 2WHKA 3EDEA 4LUTB 3M0XA 3S9IA 1TCDA 4O4VA 3H2EA 1SFLA 1S2AA 3TYDA 3U2OA 1TJ2A 2OODA 4H6KA 4QFUA 4U4MA 4QITA 1ISWA 3DERA 2ZXBA 3VABA 1BG9A 4JEQA 4LH8A 2GUBA 2IKGA 3SEPA 3DHFA 4FXRA 2B7QA 4EACA 2VZOA 2A6NA 2C71A 1TJRA 2D3NA 3FW6A 3S5SA 1ZBCA 4PUUA 3I4KA 1NY1A 1BRLB 5C6MA 2ADAA 2DSVA 3BO9A 3MKCA 4PB4A 4CEUC 4EPDC 1CIUA 4PCPA 3KRUA 2WHLA 4GNKB 1KRCC 3O1NA 4FLSA 2OEJA 2VFIA 4PMRA 5CPOA 1Y7VA 4Q7BA 4PMDA 4FI4A 4Q22A 2OWCA 1HGYA 1U5VA 1CWYA 3N29A 4S3DA 3VD9A 3M0ZA 1UKTA 1TIWA 4KFOA 2QPSA 3PG9A 2IQDA 4M80A 3TN5A 3QHNA 1RLCL 2XSXA 4K8GA 4BHYA 5ABFA 3C6CA 1F2JA 4GFSA 4A29A 2PRLA 3CZJA 4YVXA 4CNOA 1EZWA 1GOOA 5GQBA 4GVIA 4B91A 3WLSA 1XS2A 4AWEA 4O53A 4AF0B 1L6FA 4K3ZA 3NQVA 2YW3A 1I2NA 1K9TA 4HOZA 3AUOA 3EKLA 4QIUA 4ORIA 4K6AA 5F4WA 1WDSA 1M04A 4Q8WA 3W85A 3SZ8A 2Z2UA 4CQDA 1XLFA 3THDA 3TX9A 8TIMA 3PR2A 2WMJA 4LTSA 3D5HA 3B8IA 1FWGC 3O15A 1UMYA 3WJSA 4O0QA 1Z9AA 1SGJA 4GC3A 3PZUA 1NWRA 2DSKA 1TPUA 3S2MA 2IKIA 2OG9A 1JVNA 3OLDA 3VD3A 3WBYA 4MYXA 3RDKA 2DZVA 4LQ1A 3B04A 4AWTA 1CGTA 3QF0A 3BWWA 2XH4A 1LL6A 4JTCA 3C0SA 3GYCA 1JZ4A 1BEUA 2QIWA 5ABFB 3GNNA 4UQAA 2JE8A 2J7DA 1UIOA 3NL5A 4HU0A 2PFHA 2NX1A 2D0FA 5FEZA 4YPJA 2BOFX 3OBKA 3CAVA 1R85A 2OYMA 3KOWA 3GZ3A 2V3DA 4JICA 1D8CA 2VDIA 4KEVA 3LLDA 1GUVA 2RDXA 4E8DA 5A2BA 1R3TA 2QLYA