5K9YA

Crystal structure of a thermophilic xylanase a from bacillus subtilis 1a1 quadruple mutant q7h/g13r/s22p/s179c
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
184
Chain Sequence
b'ASTDYWHNWTDGRGIVNAVNGPGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSNVTVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase A
publication title The role of local residue environmental changes in thermostable mutants of the GH11 xylanase from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Hydrolase
total genus 49
structure length 184
sequence length 185
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5k9yA00
3WP3A 4HKLA 2C1FA 3VZNA 1UU4A 4IXLA 1F5JA 1BVVA 3VLBB 3WQ0A 2BWAA 1H4HA 2D98A 1H0BA 1ENXA 3VL8A 2VULA 1XYNA 2DCYA 3VGIA 1M4WA 2B42B 1KS4A 1UKRA 4HKWA 3VZJA 4NPRA 3B7MA 1H8VA 4H7MA 1C5HA 3ZSEA 4S2FA 1OLQA 1UU6A 1XNBA 1HIXA 1BK1A 2F6BA 1T6GC 4S2GA 3VZOA 1BCXA 2DCZA 2BWCA 1REFA 1KS5A 3WY6A 3VHOA 2DCKA 3VHNA 2NLRA 1HV0A 3RI9A 2QZ2A 3VHPA 2JENA 2Z79A 2BVVA 3WQ7A 3WQ1A 1OA4A 4HK9A 2BW8A 3AKSA 1AXKA 3AMHA 3MFAA 5EJ3A 1XYOA 1XNKA 3WR0A 3M4FA 3AMQA 3VL9A 1YNAA 3VZLA 1H4GA 3AKQA 2QZ3A 3HD8B 4XQ4A 2VG9A 3WX5A 1NLRA 3MFCA 3VZMA 1REEA 4XQWA 1IGOA 2NQYA 3RI8A 4S2DA 1XYPA 2B46X 1XNDA 2JEMA 3WP6A 1HV1A 3LGRA 1XXNA 4XQDA 1OA2A 3AMMA 3AKTA 1UU5A 5HXVA 1REDA 3AKRA 1QH7A 1TE1B 2DFCA 1PVXA 5K9YA 2D97A 1OA3A 1XNCA 3B5LB 4HKOA 3WXPA 4HK8A 2DFBA 4XPVA 3MF6A 2JICA 3AMPA 3VZKA 1OLRA 3AKPA 2B45X 2VUJA 3O7OA 3LB9A 1H1AA 3WP4A 4S2HA 2VGDA 3AMNA 1QH6A 3MF9A 3EXUA 5K7PA 2DCJA 1W2UA 1C5IA 3WP5A 3WT3A
chains in the Genus database with same CATH superfamily
3WP3A 1JS9A 4GWNA 5FXZA 5BNNC 3VD3A 4D69A 4HLTA 5BY5A 4LHSA 3FHIB 4HG6B 1WWYA 4AHWA 2DVBA 4IETA 3AVRA 4PBPA 1ZBE2 1KJLA 1ONAA 2VULA 5J7MA 2XQXA 4LITA 4QHZA 1DQ1A 1UCXA 2PN5A 1DBNA 4WV8A 3MV01 4AE2A 2JDAA 3HOBA 2LUWA 3WNKA 2VW1A 4IQPA 2RVAA 1AYM1 1NG0A 2R1BA 3APBA 5GZEA 2D6NA 4MXVA 2C5DA 4S2FA 3GHNA 1JYVA 1CQ9A 3ST7A 1I1EA 1LODA 2DVAA 3N9PA 2XJRA 2RM22 3IDBB 5JXHA 1CAXA 1WW6A 3FMGA 3RZJA 4QB2A 5DN2A 3I54A 1RVF3 1VBB1 1W8HA 2OQ7A 3J8F1 5JR7B 2WA3A 4GB33 4M01A 1QEXA 4WM8B 3BKZA 4NWVA 4QX7A 1CAUB 2BEOA 5F3GA 2D3PA 4FOYA 2FDIA 4Y24A 1RINA 2B4KA 4FPJA 4LHLA 3U11A 1OQDA 1YFXA 3PJYA 2R042 4NUBA 4Q27A 5B2GB 3NV3A 4PT6A 4QKFA 5DG2A 3NJXA 3NNJA 1BEV3 1K5MC 3EQEA 1YQ8A 2RE9A 2YBSA 4Y5Z0 3VKLA 4EROA 2BW8A 4R9BA 3THTA 4QKBA 3W21A 3TEXA 1C8M2 4PLOA 2WO3A 2A75A 4C0BA 1WLTA 2FDKA 1GQHA 3ZIXA 5CFDA 1H6XA 1JI6A 4IE6A 5JR2A 5IATA 1H2LA 4ZXKA 1J1LA 2EIGA 5A7NA 2VMCA 1ND2A 2SLIA 4YZ4A 1H4GA 4XDQA 3USUB 4KGQA 4OMDA 4ZS2A 1VALA 3I49A 1YQ2A 4WBBA 2DURA 5IW0A 2BFUL 3GM8A 1OQEA 1JMUB 1QJU1 2R49A 3IN9A 3C3VA 3V64A 1LOBA 4RS5B 2ARAA 4P5YA 4C1WA 3C7GA 2GSYA 3OOXA 1FMD2 1GNYA 2ZTNA 1HV1A 3BCWA 4LIVA 3T4HB 1QJX1 2WNUA 1F5FA 1ZZ9A 1DIWA 3ILRA 1VBA1 3PURA 1JZ6A 1ZZ7A 3B02A 2HYKA 3OBTA 4K40A 2QUOA 4QHOA 3N4MA 3FC0A 2GC1A 4YYOA 4R4XA 4LIUA 5FK8A 2H6BA 3IZOA 4CDQC 4HPKA 4ORFA 5T5OA 3K48A 3WZ1A 2GP5A 5A1FA 2OVUA 3UKTA 5FPXA 3WNLA 5FBJA 4N9IA 4PF5A 1PGSA 2JB4A 2DDUA 1LKNA 2HWD3 4MXWA 2K2SA 3NJVA 4LBQA 3OG2A 5EHDA 1YCIA 4MYEA 5LATA 2UY8A 3PUHA 2BNMA 5KHIA 5A3PA 3AFGA 4MSVA 1DDLA 3ZXJA 1V6JA 3I59A 4YW6A 5BXXA 2GH2A 5ISLA 4HONA 3E6BA 2V73A 2WO1A 3FFQA 5FV3A 2FDHA 4YRDA 3UJQA 3MIBA 2VZTA 3LWCA 3LZZA 4GZ9A 4OVEA 4Y5TA 5F5IA 4CCNA 2ENRA 4XYXA 4BXFA 4H3WA 3KV9A 4R4ZA 5JVVA 1H9WA 3NKGA 1PO13 4CCEA 1MVEA 3H3UA 4ZHNA 2W94A 3TN92 2ZX0A 4AVSA 4XDPA 4BQ3A 1OF4A 3O1VA 1CZVA 1KGYA 1TG7A 1M4WA 3KVAA 4MVTA 5IWFA 5JOWA 3V0AB 4CDXA 4W65A 3QACA 2J22A 4GH4C 4NPRA 4QU1A 2OKXA 3SCHA 4QPGA 3GZAA 5IVVA 2XVGA 3WUDA 1G9CA 5IVEA 3SHRA 3ZFGA 4EWAA 5C4WC 1UY4A 1CAWB 4V1PA 4S2GA 2XXZA 5ABJC 4OQ9A 2I74A 2VJXA 2RV9A 3ZYGA 3FHAA 4IERA 4XJ8A 3POEA 1J58A 2ZA9A 3ZIWA 3IPVA 4QDRA 2JB8A 5DUUA 1AX1A 3ASIA 1QWRA 3I7DA 4Y5SA 3PU3A 5H9RA 3J7MA 1BMV1 4NRQA 3VBUB 1O4ZA 2P34A 4ITCA 4EZ4A 1U5YA 1PO21 5LZ6A 3WDVA 4HL0A 4AGVA 1W3VA 2A7AA 3OSDA 4BZ4A 3R4SA 1N3OA 3BOPA 3WQ1A 3JB4C 4P9JA 2VPVA 2PLV2 3NWKA 1UF2C 1AXKA 4TLGA 4IEZA 4LT5A 3FZ3A 1AL0G 4P9LA 4CU9A 5B4NA 1W6OB 5JCTA 5T5LA 2GALA 2R062 4QQHA 4QMAA 1T2XA 5FZAA 3DXUA 2Q8CA 2P3JA 3VKNA 2HWB1 2A6XA 4WM8C 1ZBA3 5ACA2 5FWJA 1OFSA 3ZYPA 5SV8A 4XQ4A 3WX5A 4EYUA 2VMIA 5CAZA 2WNEA 2VZVA 1MZFA 1RUI1 4GWIA 4XQWA 4AI3A 1PM7A 4HT1T 3TNQA 4P5HA 1W6NB 1DLLA 4IV3B 3GCXA 2LM3A 3LEGA 1COV1 5L9BA 1I3HA 4M3CA 5DZGA 2VE1A 3HQUA 5J36A 4AI9A 4B8EA 1DG6A 3LIHA 4BLIA 2YGMA 2BOIA 3LDKA 4FPHA 5DDJ1 4BIOA 2XJTA 5L19A 1PMJX 1N1VA 1APNA 3JD73 1YIFA 2AZ5A 2BGOA 4R8HA 1GNHA 5I0UA 2I2SA 5TSWA 1OA3A 4ISRA 4XF0A 4HVQA 3LIGA 1MS8A 4UI9L 2DFBA 3JZVA 4XPVA 5FYSA 1VBE2 3MUY1 2GNBA 1UY2A 2GZWA 3KT1A 1OLME 4NHXA 3T2OA 4BISA 4LHKA 2J1AA 1JN2P 4IEYA 4CEWC 1OF3A 4JRAA 2Y6GA 2DV9A 1WCKA 2DTWA 1UZZA 3LOIA 3I3DA 3NSTA 1CJPA 4XZUG 5FZLA 1Y9GA 1OPOA 3AYCA 1VRH3 1FOD3 1JYXA 2VTFA 4W50A 4K1ZA 3GZEA 1AYN1 2C1FA 4LO4B 3VDAA 3B9CA 3UGFA 1AL23 2HLEA 4K8RB 1H0BA 1TMF3 4RS5A 1ASJ3 1JXNA 3B00A 4IEUA 1N1SA 1W9SA 1MZEA 1S55A 2CWSA 2ZKNA 4GWMA 3AVSA 3ZX7A 1W06A 2FZ2A 1S0FA 2ZX2A 2W68A 4IV1B 4PIZA 2JE7A 2VVFA 3MW4A 1BXHA 2GNTA 3GNEA 2BOJA 1CZTA 4XXAA 1QOOA 4YVWC 3MIEA 5CYYA 3ABZA 2CL2A 3SITA 2WZR2 1KFUL 4LA2A 4GKXA 2JG9A 2X5IB 4BU2A 5JDBA 4DUWA 3G7DA 1V6KA 3KCYA 1OOPB 1EPZA 4LE4A 4L9BA 5EWSA 4CPBD 1GSLA 2CHHA 1US3A 3RVHA 3LQCA 3BTXA 2E31A 5A7WA 1D0GA 1F15A 1S1AA 3TEWA 4K7JA 1XSQA 1JZ4A 1UYXA 1V6LA 2WFF3 4K9SA 3HNYM 2NLRA 1HV0A 1VB2A 3QH7A 1JOBA 2RMU2 2EIEA 3NL1A 2ETEA 4GQ7A 5EP9A 4A2UA 3VBHB 2BPA2 5H9PA 2B7YA 1YJKA 2R16A 2K0GA 3OTFA 1RUOA 3H42B 1W2OA 2LRPA 2NPIA 3NJZA 4XAEA 2XL7A 4U36A 1O3RA 1DZQA 4Q4X2 1L7LA 3IAQA 1W8UA 4Q4Y1 1W6PA 4BK5A 1SACA 1LGBA 2C9KA 1FPN2 3VBFC 1AUYA 4R52A 1US2A 1RUC3 3T2PA 1YFYA 3OBAA 1PMHX 1CWPA 2OT7A 2EICA 5LBFA 2W92A 5IT6A 4MGQA 3VBUC 5C3QA 3GJAA 1AR62 3RS6A 1KDMA 1LULA 3H8OA 4S2DA 4RQPC 3SNMA 4O61A 2JEMA 1NOVA 1MS1A 2XJPA 2EIDA 3BU7A 1RHI2 1X7NA 4LKFA 1QQP2 3HQXA 2CAVA 4A3ZA 4BA6A 3LGRA 3OGSA 4CA9A 4DRVA 2Y0OA 4MGZE 1W6MB 5FXWA 3AMMA 1JZ2A 2FCVA 3WNMA 1TE1B 2OUJA 2TNFA 1PX4A 3I4IA 3KMHA 3N36A 1C1LA 1TME3 1XSRA 5A32B 2HWF1 3BODA 3OYWB 1GZTA 1MZ5A 3AP5A 3ZFFA 3O0XA 2VUAA 3HAGA 1TQ5A 1LB2A 4GMP0 5GLTA 4IV3C 4XJWA 5J3UA 1VBC3 1KRIA 5FO8B 2NN8A 2PHLA 2VUJA 1RUG3 4EWDA 3WP4A 2WS93 2RS51 5F8PA 4L2NA 5D8AB 4YGDA 2VNRA 2PHWA 3J7LA 2R32A 3KCCA 3WP5A 1CAVB 3KS7A 2V09A 3H1MA 2UWBA 4XFAA 1ZRDA 4YZ3A 2NMOA 1IS5A 1OHFA 3C7EA 2Q8EA 1XB9A 3VZNA 4TLFA 4AEMA 5LA1A 4Z82A 5JMCA 1H4HA 1EAH3 3C2UA 4YW7A 1ENXA 1VE0A 5K4LA 3VL8A 3AXDA 3WF1A 1OVSA 1W6NA 3ZYJB 4DNYA 5FY8A 4LQRA 4QDQA 4U2AA 2CAUA 1ULGA 2AEYA 4M0NA 5IFPA 1H9PA 2RS33 3KF5A 3K77A 4PLMA 4Z2AA 3JCIA 2BRTA 2W1WA 2P2KA 3OBZA 3UESA 3J7HA 1WMXA 1UPIA 1H8TC 3U4XA 4HOOA 1BBT3 4P00B 1XE8A 5FZFA 3BPSA 1XNBA 4CEYB 2E9QA 1BK1A 1RVF2 5IJRA 3RWNA 2WKKA 1ODNA 2BGPA 3VZOA 3AFKA 4N43B 1AJOA 2ZS6B 4GB32 3QH6A 3EJKA 4NROA 1O3SA 3NV4A 4ZZ5A 1GV9A 5JXIA 4FAGA 3CEWA 4F8AA 3CJIB 3J9SA 5FMOL 2RS13 5C9AB 5CFCA 1RYYA 2OXBA 4UF0B 3PLQA 1R1A3 2IC1A 3D82A 3H3LA 1IZ3A 4QX2A 1N3PA 3MGUA 2J1VA 2QQKA 4K8FA 1HN0A 1SLLA 1ZBE1 5J96B 3WHTA 1OVPA 3B69A 4QXCA 3ZN5A 5E16A 2IFRA 1BEV2 3VDCA 4RGKA 5FY7A 3P6BA 4XW3A 1Y7BA 2XLFA 4A7KA 1UY3A 4KH9A 3Q8EA 1GNZA 1E57A 1KQRA 1NCRB 2RR13 4V2VA 5AC92 1RMU3 1NUKA 3ON7A 1UXXX 3S0MA 2IXIA 2JX9A 1NE4A 3T2TA 3OY8B 1O8SA 2RM21 3U37A 2YHJA 2BDRA 4TN7A 3AKQA 3GGLA 5F9TA 1O6UA 3WEZA 4XTMA 2BNOA 1W9TA 4C90A 4UFHA 2DBNA 3W59A 1ND3B 5FZ0A 4YM3A 2CGPA 1LHOA 3GCWA 2RDSA 4IEXA 3DXTA 4CUCA 4Y26A 2D93A 3FLTA 4FTBA 4YG3A 3ZXLA 5FYMA 3VBOA 1G8WA 3AC0A 3RWKX 4PDWB 3CJXA 4AHXA 2CNAA 1QJY1 1I5ZA 3I2KA 2WWUA 3QCWA 3SCGA 5A70A 3RZGA 3POIA 1X82A 3MW3A 4CU8A 5AFBA 1C8M1 3L2YA 5KBFA 1M06G 1XNCA 2HWD2 2UU8A 3DYOA 4I0BA 3VBHA 2JE8A 5JIUA 4Z8BA 4B29A 4GIQA 4URTA 3E6CC 3K51A 2E7AA 4XUOA 4BCUA 1CX1A 2GH8A 2ZGMA 1SZBA 3KD4A 1W39A 4XTPA 1WKYA 3KV5A 3FWEA 4FI9A 4XAAA 2JJ6A 1LGNA 1F9KA 1Q56A 3OBRA 3UJOA 4OHVA 4KBBA 3AMNA 1HB3A 4Q4V3 3FBMA 3HBKA 1FMD1 4IE5A 3EHKA 1BK0A 2HKXA 1PO12 2XBO3 1YQCA 3CBNA 4N53A 4XDOA 1GUIA 1MQTC 1NA1A 2R0FA 3CF6E 3EO6A 1TZOA 2YB7A 5I8SA 1V9U3 4RSUA 1HB1A 3V0AA 1F35A 4IE7A 3B9IA 2HEWF 4I0WB 1RUD3 2VW0A 1CAXB 1JZ3A 4QQOA 3RJRA 3VN4A 5T52A 3VGIA 1S4CA 2JXAA 4TYSA 3B01A 5JXGA 5DZEA 4CYDA 4AFCA 3ACGA 4Y3OA 4BYYA 2VMDA 4UWDA 1JYIA 2FQPA 3LDRA 1HRV3 4AWDA 1JODA 3O1UA 2VU9A 5GLVA 4FO9A 5L73A 3SLIA 2XWJB 4DEQA 5J98B 4JGYC 4RA0A 2QQIA 1XRUA 4NRPA 2DF7A 3BVCA 1POV1 3BB6A 1D4M3 3GBWA 4J1XA 4CP0A 5A32A 4G4FA 4H7LA 3OYWA 1BJQA 4E27A 4F83A 5C8CA 3V65A 1PZ9A 4PIYA 4B4PA 4QPIA 4BQ5A 4HN0A 2JDMA 5BNOC 1DU3D 4UT5A 3SH4A 5FZDA 2R6QA 4BQWA 3LA3A 4AZZA 5JOZA 3AXEA 4Q0SA 1GOHA 3UKNA 3W9AA 5CFDB 5KHGA 1DGLA 4XUTA 2ATFA 4QX0A 4FPGA 4CRQA 4FXKB 5F3CA 5D8AA 1NAEA 4D7SA 2IVJA 2Y64A 1HXS3 1H2NA 4NAMA 5FWEA 3PVBB 5KC5A 2YROA 3CZUA 1AR91 4CEYC 3KB5A 4L99A 4QT6A 3MUZ1 2FDJA 1JHNA 1AR83 2UYAA 2JD9A 3BTYA 3OUJA 1UYYA 2OPWA 2VO5A 1ZBA2 1XNKA 3WR0A 4LE3A 1HRI3 3MIFA 4L8QA 5C9AC 2WNUB 1RUJ3 1UZWA 2Q1MA 5LASA 5CU1A 5J09A 5DG1A 1SG3A 2J1UA 3ZR6A 1CZSA 3ZN6A 1JYNA 1A34A 1ENSA 3RJ2X 4B1LA 1LECA 2QQWA 1LOFA 1L7QA 5CG9A 4JDMA 3WF2A 1AYM3 1YXWA 1Z0HA 2ZEZA 3LKJA 1H2KA 5BPXA 3RDIA 3ZN4A 1Q8QA 1XYPA 5IK8A 3U14A 2Y6FA 1HB4A 3FFZA 4N43A 3SXWA 4YVSA 1UX7A 4UYBA 3AZYA 2E26A 1W3XA 1PHMA 2HH9A 4LBQB 3ZPOA 4W4ZA 3SQOA 3NVCA 3CJIA 5CG8A 4FBFA 1PNGA 1K5JA 1VBB3 3JD72 4KBZA 4M0HA 1TNRA 1UQXA 1UU5A 2A73B 3I59B 4KWUA 4E4HA 2PLV1 3OD4A 5CADA 1V00A 4Q29A 4A42A 1WLDA 4LBOA 4BB3A 3SMHA 1SFPA 4IEOA 3VKOA 2DU0A 3IDEA 2C4XA 3DCQA 1NKGA 4AG4A 4HKOA 4EN8B 3I2DA 5EZWA 1QDCA 2L9LA 2VUDA 1ACCA 2VTXJ 1F2NA 1H1MA 1TVGA 5F1RA 3D4KA 2Z69A 3GBFA 1W8OA 5FO7B 3E5QA 3H9AA 1KD7A 1NCRA 5FREA 1YHFA 4FPKA 1C3HA 1JYCA 1J3RA 2PHUA 4UFMA 1QY4A 4Y1YA 1FOD2 1POQA 2ADEA 5JSOA 4PDWC 4OMCA 4D6QA 2TUNA 3EXUA 1DHKB 3KT4A 3IAPA 1XE0A 5FZ1A 4LBKA 1AL22 3SH5A 4XUQA 5F5QA 4HKLA 4QX8A 4NN0A 1TMF2 1A8DA 1O4TA 1ASJ2 1T6BX 2MEV1 2G1MA 3GBGA 3TB0A 5CBLA 2AYHA 3K4AA 1ND3A 3AM2A 4JGZB 2EF6A 4NVPA 3VDDC 2HWE3 3VBRB 2PHDA 2XONA 4FPYA 4JQTA 3GJBA 2WYFA 2XUMA 1FV2A 3O1MA 2YPJA 1NXD1 1KS4A 5EJ1B 1IKPA 3ZVXA 3VZJA 1CONA 3IPVB 4FPLA 1H8VA 3UK9A 2XLAA 2P3IA 1VBE1 2VCBA 3RMXA 3L9JT 5KR7A 1ZZ6A 2VCAA 3POBA 4LR4A 4XCBA 1W0OA 1Q43A 4AEJA 3JUUA 5FCCA 1UZVA 2JG8C 4MGTA 4E2SA 1GBGA 1VRBA 3OD0A 4CXYA 2DUOA 1LRHA 2W46A 4DS0A 1UY0A 5I0DA 2D7FA 2GC2A 2GDFA 2X8KA 4YPJA 3NO8A 1QJZA 4OLLA 5A7OA 1OKQA 2B5HA 5IFTA 5BNPA 1PGL2 3AP9A 2HBUA 5JOYA 5ANQA 2Q5TA 3NNFA 2WFF2 5FUPA 1OFNA 5IYYA 3ZXFA 4NHLA 3THDA 4E8CA 3PTYA 1ULFA 5FZ6A 4LHNA 1N47A 5C33A 4FPCA 1DCSA 2QZ2A 4W6YA 1D2QA 5FP9A 1LOGA 2J1EA 1SBEA 3VHPA 4JRLA 4ARYA 1Y43B 4KU8A 3LDBA 2HWC3 3CIHA 2VH9A 2AENA 2QQMA 5EQUA 1GLHA 4HK9A 3VDDA 4AL9A 4BK4A 3OB8A 4CU6A 5FAXA 5LY1A 3WF0A 3AJZA 3M8LA 4Q26A 3IMNA 2EXHA 3R6SA 3EYPA 5FZGA 1RUC2 2Y26A 4M3CB 1B09A 2D5FA 5T3NA 2ILMA 4I0AA 1YNAA 1ULEA 3MPPG 2WT1A 1BYHA 1O5LA 5CFDC 1RUE3 4SBVA 3Q8FA 1REEA 1ND2C 4P9YA 3R0RA 5JI9A 1AXZA 4ZKTB 4HBNA 4CDWA 2WRAA 4QU2A 4MHRA 2ZGOA 1QGLA 3PNAA 2R1DA 1SCRA 4Q1PA 3ZSMA 2ZMKA 5CNAA 1O59A 4LUKA 1CPMA 1DYKA 1N1TA 1YFUA 2WNUC 3POYA 5FP8A 4XJAA 1TME2 2ZGNA 5IHRA 1O3QA 2A6VA 1EYBA 4Q4X1 4EN7B 3KM5A 4E2GA 1W8TA 2LW8A 3I3EA 3B5LB 3G6JB 4K1YA 5C5TA 2XGXA 5BNQA 1O3TA 2A3XA 2VQAA 3O1PA 2YDEA 1NE6A 1VBC2 3VZKA 4F3JA 1OPMA 3ACIA 4GKYA 2A3YA 1PO23 1RUG2 1PZ8A 3JQWA 2WS92 1W2AX 1QNYA 3NAPB 1AR61 4MOAA 4XJZA 5ERLA 4FPOB 2R073 4FXGB 4BQ2A 1QH6A 2XDVA 1RUH1 4WVVA 5FYIA 4KQ7A 5K7PA 3RRDA 1RXFA 2C0ZA 3K3NA 4AGGA 5HPOA 4YG6A 1EAH2 5C8WA 5IVFA 2BV4A 4QX5A 2ZHMA 4XZPA 4QM8A 2P1BA 4AR2A 4YW4A 3Q8AA 4JV4A 2BWAA 2QQUA 5LB6A 4AOCA 2E32A 4BIFA 5FYZA 2VVEA 1LHUA 3A21A 4GALA 2RS32 4QWNA 3FUQA 3B93A 4NIAA 2HEVF 3D0JA 1O91A 2JG9B 3H1YA 4DFSA 1HB2A 3DKWA 1BBT2 3KV6A 3MIGA 1QOSA 4LORA 1ZX5A 4H14A 4P9GA 2VNVA 1JZ8A 1YQ6A 3CQOA 4RHV3 1OQ1A 4XFCA 5A3OA 5A7WB 1DZRA 3VKMA 4AVVA 4CCJA 5JOXA 1OLQA 4LJHA 4CDXC 4OQ8A 1UU6A 2DBIA 5T5PA 4QPGC 1EUUA 1GZCA 1BCXA 3HNBM 3NMBA 5LA2A 4X6RB 5JSRA 3AZWA 3OUIA 5M0TA 2RS12 4KU7A 3ZFGC 1R1A2 1I9RA 3R4UA 1UMZA 4GWJA 3N7LA 2R7EB 3LA2A 2JE9A 1DGRA 1SBDA 1YC61 2YG0A 2ZKLA 2BNNA 3CKHA 2PELA 4NMIA 4H55A 3WW1A 1LEMA 1W6PB 1STMA 3PL0A 4Q1RA 3TOJA 4LO8A 1RJ7A 1HJGA 1LU2A 1OSGA 2GNMA 2JWPA 5AVAA 3VHNA 5GZCA 2VVDA 2ZX1A 5F6KA 2P3YA 1VBD3 3IWZA 3VHRA 4LK6A 5LK7B 2Z79A 2RR12 2BYVE 2YU1A 3ATGA 1RMU2 1UZ0A 2Y38A 4UFLA 5FMBA 2E6VA 4JGZA 3RZHA 4AVBA 3WCSA 5DAWA 2W08A 5C5UA 3VBRA 5DQ0A 5LWBA 2V4VA 4DUVA 1RVF1 1W2TA 1YLLA 2VXRA 5FR3A 1GP6A 1AR71 3VZLA 2DTYA 4BM8A 1WLCA 4ZPIA 1ZREA 2Y6KA 3VUOA 1L3JA 3ORJA 4LKDA 3ILFA 3VZMA 1J84A 2EVXA 1W8NA 2C9AA 3A23A 3S7EA 3WLUA 4AI0A 1HKDA 2CSGA 2NYYA 3NNGA 5CEHA 4B4RA 4EJRA 2DCTA 1K42A 3WINE 3T30A 3FX3A 4XF1A 3AP7A 1A78A 3OEAA 3ZFFB 4BMBA 2VBDA 2RDNA 1IG3A 3WDXA 2GMEA 5EYYA 4R9AA 4LBNA 1L7RA 4IEQA 5IAVA 2LROA 2OX0A 2QQVA 4YFZA 1K45A 3DV8A 5AC91 4OUSA 5A6YA 1KXGA 3IIIA 3U78A 3UYJA 4AQTA 5K9YA 1SCSA 2ZX4A 2XPJA 5J1XA 2D97A 3BU0A 2ZEYA 4FT8A 3UV9A 4RGAA 1VMJA 4HK8A 4EWEA 2DUPA 1CVNA 1NLQA 2G19A 3MBWA 3HN1A 2JECA 4GJYA 3AKPA 5KWRA 1RITA 4DXSA 2E7TA 4OFGA 1W8WA 2DUQA 5ABJA 4Q4V2 1UIKA 5FZBA 3WG1A 4DY5A 4NIIA 2XBO2 1G6NA 4PIXA 1OH3A 2WBKA 2RG4A 5IK4A 1V9U2 5IAXA 4QKNA 4TTGA 4A7YA 1ULPA 2RJLA 2IFWA 1RUD2 1R081 3WDWA 2RDQA 2IXHA 1DQ2A 4L92A 1C8NA 1YWKA 5LEKA 2KXLA 1XPWA 3ZDVA 1MPXA 1W28A 4IUGA 3LOBA 4OCTA 1SMVA 3DECA 3MPBA 5CIRA 1WD3A 2RJKA 2HWD1 4HSLA 2Y33A 4BPZA 3I3QA 5DMYA 5CFCB 4CCCA 4ASKA 2KD7A 4RS5C 3WDTA 3KZ4C 3B7MA 3WF3A 1HRV2 2ZMLA 1XBFA 2Z4FA 4H7MA 4NO4A 1PIV1 4O65A 1G9AA 2VQ0A 2XUEA 2P4EA 4NPLA 3FUOA 3ES1A 4JTNA 2F4PA 5F6LB 5JPNB 3I2IA 2MPFA 1CGPA 2CV6A 5FP4A 1LNSA 4URAA 1NY71 3IT8A 4DOUA 5H9SA 4IE0A 1S0BA 4YFWA 4JX0A 4I30A 2MHFA 2XQRA 4WVMB 5DXDA 5FZEA 1DFQA 1PO11 2D3RA 2QCSB 4GD4A 1GICA 3LAGA 2HWF3 1VIWB 2CYFA 4IDZA 5LK5A 3WCRA 2VCMA 4WVZA 3CU7A 3NAPA 2X05A 1MEC1 3QBQA 1HXS2 3ZXKA 3O1RA 2JG9C 3ACHA 2D43A 4COYA 1JYTA 2DCKA 2G9GA 1ULOA 1SLTA 1YIPA 3LPGA 5K0UA 3URFA 4OHYA 1RIRA 4ZS3A 4XE9A 5FP3A 2W3JA 4LLFA 5FQ0B 3MEPA 3T09A 1AR82 4NIDA 2W1UA 2EXIA 3K4ZA 1D0HA 3LFIA 1R093 1HRI2 4E4ZA 4NIHA 4W6WA 3PJQA 1RUJ2 4MGYE 5HBAA 1CD3G 2G9FA 5F32A 4W8JA 1RUF3 1XQNA 3VBOB 4B1MA 2VZPA 1EV11 5GLWA 2VOTA 2Z5WA 4ZONA 2Q8DA 2E7QA 1AYM2 4CEWA 5IK7A 3KQRA 4PQ9A 2OW4A 4M4RA 4QDSA 4BE3A 4HN1A 2PAEA 2NZ9A 4FP2A 4QAWA 1ZA7A 2W9XA 2WN2A 3DN7A 5FZIA 1CPNA 1Q3EA 2WA4A 4Q0PA 5G04L 2W87A 1G9BA 3TBDA 1OKOA 2ZX3A 5EIYB 2FDGA 3HVDA 4YG0A 1LR5A 1SLCA 3ROUA 5F5AA 4QPYA 1XXNA 3ZYFA 3IDAA 1IOAA 2Q30A 4HXCA 2IXCA 5I8YA 3DL3A 4LBQD 1X36A 3ZMNA 3S5AA 5A6ZA 1BQPA 5CKNA 5DAPA 4FSJA 4N53B 1NA1B 4K20A 4FPFA 4UOJA 4EE2A 3GZTB 1OT5A 2IXJA 4CP9B 3RMYA 4BQ1A 1DQ6A 1DZTA 2G9ZA 1GYKA 3IKWA 3J26N 4QKDA 4L11A 1D2SA 2A3WA 2HEYF 3N9NA 4JKKA 3O7OA 3ZFFC 3LB9A 1X33A 3GXUA 1WMFA 3O5SA 5E8AA 3KSCA 3A0KA 4S2HA 3AL6A 2JDYA 1IS4A 5DUVA 4A6SA 4CCDA 4CXXA 1JW6A 3LD8A 4DQAA 1WD4A 1C5IA 5D21A 4Q0QA 5AFEA 1LHVA 2VOXA 5C3SA 1VAKA 1ZRCA 3D3AA 2HWE2 5B4XA 2XH6A 1ST8A 4KWLA 1JU4A 3BIEA 1XYNA 2GNDA 1IQDC 3A7QA 2PHFA 1V6IA 4NRMA 5C8CB 1PK6A 2BQPA 2B42B 3BPZA 2YV8A 1PVC3 3PDQA 4HKWA 4MH0E 3N9QA 4QPIB 5FY1A 5FZ3A 5K0UC 2CDOA 4AQSA 3I3MA 5F5CA 3S7IA 1VPHA 1C5HA 3LFMA 3ZSEA 2N7GA 1NZCA 2XL9A 1QOTA 3ACFA 3NQHA 1IPSA 2WZEA 3ILNA 4EN6B 2F6BA 1OC1A 1QJY3 5LBEA 3UGGA 1S0DA 2DCZA 2ZBJA 4AHZA 4W6XA 1FOD1 3TEZA 1C8M3 3RZZA 3VBSA 2ZGLA 4Q8KA 2J1TA 1J3PA 5GM0A 1S0IA 4B7EA 2NP0A 2XJVA 1AL21 5F7UA 4WM7B 1B35B 3OPTA 3RFRA 1TMF1 2D6KA 2QQLA 3JU9A 5FKCA 5FOBB 4C91A 5K8SA 4AFDA 5FIXA 2ZABA 5CFCC 4XFBA 1UOBA 2I45A 2LALA 1H6YA 3HBZA 5F2WA 5A80A 4YGEA 2HWC2 1O4YA 5JI7A 4PBOA 4LPLA 4D0QA 4MLOA 3CL1A 3ZN6B 3ZYHA 2W2IA 5FZ8A 3T0BA 4YM1A 2X10A 2LTNA 2QE3A 3GF6A 1XNAA 3H0OA 4AW7A 3P1IA 4YVSB 1NYWA 4JKLA 3ES4A 1FV3A 4JZRA 2VY0A 1RUE2 4WVWA 2MNGA 3DPRB 4RN5A 3RPQA 3ZO0B 2QZ3A 3RQ0A 4EN0A 4OI0A 4DIQA 2BVBA 4RR3B 2UY9A 4PI2A 1W2NA 4MZUA 4YGBA 4QGLA 5C3RA 3ZPYA 2NMNA 2ZZJA 1PGL1 2WFF1 3LEMA 3O0WA 3ZFEB 3JXSA 2UWCA 1NXMA 1NCQB 1VB4A 4IV1C 1WBLA 3BIWE 4IL7A 3UETA 4Q4W3 4TZDA 3GHMA 3Q8BA 4WVMA 1Q8VA 2WAAA 4QX1A 1DQ4A 1UW8A 4DB5A 2VZSA 4BWOA 1MZ6A 1GOGA 1WLWA 2JDPA 1AHSA 2D3SA 4ATFA 3DUIA 1Y4WA 4OZOA 1BMV2 4Y1VA 1QF3A 1GMMA 2X5IC 3ECQA 5APAA 4FOWA 1R1ZA 1RUC1 1OOPC 2WSVA 3Q9OA 4AEKA 5A6XA 1TEIA 5FPVA 1PO22 3AP4A 2WAOA 5FQ0A 2JDKA 1OUXA 5FY9A 2WN3A 3MLLA 3I2GA 1OXCA 4XETA 1TNFA 2R072 3BOWA 1SLBA 3VBHC 4A4AA 1AR93 2QJVA 3MV11 4N9HA 5E88A 1CJDA 1NX9A 4KMQA 5L7OB 4ARXA 5FYUA 5FPAA 1DYPA 4EQVA 3H8UA 2ET1A 1E5HA 2R041 3HWJA 3IM0A 1J59A 5EJZB 5FBZA 5D1IA 4IXLA 1LHWA 1RGSA 5C3PA 2D98A 3OJBA 2ZGRA 3M3EA 2WZPP 4N53C 2GAUA 4JHZA 4I2OA 2VOVA 4B7KA 1WBFA 3N35A 5A1LA 4P9IA 4KNCA 3MLKA 2YFUA 4Q0VA 2DVFA 4RHV2 5BNPB 2FDFA 1V6OA 2ZHLA 1UD1A 3JBG3 4CUGA 4YLZA 3RYPA 4XOGA 4BQYA 1XNTA 1ENQA 2BGCA 2JDZA 4QQLA 1I6XA 1HQNA 4ZZ8A 5JWPA 3M3OA 2WWSA 5A7SA 1NT0A 1S2EA 2WS91 3BALA 4Y4YA 1QXPA 4X6QB 3WNPA 1UMIA 1YFWA 2OZJA 5FXXA 3A4UA 1P8JA 5IVBA 4AVAA 1JHJA 5HV0A 2E33A 4KWKA 2XKPA 4XBQA 1HQWA 4K21A 2GN3A 4A41A 4CP9A 2C6SA 4LK7A 5JMOA 2W95A 2Q4SA 4IEWA 1DGRN 3WY6A 2WNVB 5I93A 5IVCA 3M70A 1WZXA 5E6HA 1LHNA 4QPIC 4HMZA 1VBD2 2LS6A 1WCQA 1U0AA 2WSUA 2WZ8A 3OGVA 1RJ8A 4XURA 4CVUA 1O5UA 3I97A 1MS3A 4XFFA 1UMHA 2D6MA 3WQ7A 1OLMA 1IG0A 3ME2A 5JAXA 5D8AC 5JZGB 1HW5A 1GQGA 1LAJA 3I2HA 4D7TA 4CDWB 1W8ZA 1Z7S3 5KXDA 2MEV3 3CMGA 2XMLA 1G7YA 1G9FA 4X8NA 5BNNB 4R9DA 4P02B 2RS11 3UL2A 2ARBA 5J48A 3NKTA 4QB1A 4J25A 1SBFA 4AEDA 4NPMA 2YC0A 3INAA 4EZHA 2CWMA 3DYPA 4IGPA 1NLRA 3POJA 1HX6A 4FP3A 5AVPA 3QOPA 2J42A 2NQYA 4NHYA 4XBNA 3WHUA 1V0AA 1NQDA 3TN91 2KA3A 4UBGA 1S0CA 1UIJA 2HYXA 1Q8OA 4FVVA 4D8MA 4QHBA 1N1YA 4MUVA 3ZKYA 4FTSA 3LEKA 4OHZA 2AH2A 4AI2A 3H8RA 2WT0A 4WM7A 4N43C 1B35A 1RMU1 4UFIA 3AKTA 4GMP1 4LKSA 4OUMA 4YW1A 5HXVA 3ZYBA 4A44A 2BUKA 3D6EA 5FTTC 4RFT0 3FL7A 4HETA 3CJIC 4XBLA 5FRAA 2P6CA 3TWIA 2WDBA 5CA6A 3S57A 4XABA 4LXLA 3RZLA 3AYEA 4Y20B 1SPPA 4LLOA 3THPA 3BUCA 4B3NA 4B4QA 1JZ5A 2W1SA 2VR4A 2VMEA 5IVJA 1OLRA 1E5RA 4AFAA 3LA7A 3VD9A 3BN6A 3RZMA 1OBNA 1MACA 2VM9A 1UPSA 3WQBA 5CKMA 1GQPA 1GWKA 1S2BA 4XUNA 4PCRA 1QMJA 4F7ZA 1NCRC 1S0GA 3H3ZA 2Z2SB 4LULA 1CESA 1IPJA 1OH4A 2OZ6A 3DPRA 3WSOA 5BNOA 3J8F3 1YO8A 1JUHA 2R0HA 3SH3A 4K6BA 5C3OA 2CTVA 4RR3A 3T1LA 5EPAA 1F5JA 2ARCA 3WDYA 3WQ0A 5HCAA 3POSA 3ZFEA 2R061 4YARA 2VBPA 2WO2A 1NCQA 1ND3C 4JCKA 3TRSB 3RGBA 2JIJA 4UW3A 5ACA1 3AZXA 1WA4A 4M3CE 1XJAA 3EMRA 5L36A 1DQ5A 4ZU7A 1W0NA 2XB6C 2XLGA 4QB6A 5JSPA 4OI2A 2UYBA 4O9GA 4O9EA 4C1XA 3VD5A 1VRH2 2GP3A 5I0RA 1W05A 1O7FA 1U5XA 3RYRA 1UOGA 2ZZQA 2QBXA 2VD7A 3MO4A 3UT0A 1MS0A 4OUEA 2HWF2 5I0SA 3RYKA 4CDQB 5E89A 1V9U1 1QJEA 1U12A 1Q8SA 2XG3A 4JTOA 1W03A 2J7MA 5L9RA 3V56A 1AVBA 2ZJCA 2IXLA 1WCUA 2YFZA 1J83A 5DUWA 1QJU3 4TXWA 1F8VA 3CDZB 3FN9A 4DY3A 5L7OA 3N9OA 4CXWA 3ALQA 2JENA 2XOMA 4KWJA 4QXHA 1QJX3 1R092 1RUH3 5LY2A 1UKGA 2ORXA 3U4SA 5JXJA 1VBA3 2VZQA 1RUF2 3AKSA 3GYDA 5FKBA 2VZRA 5FXVA 3MFAA 4FPEA 3WV6A 3K2OA 2VW2A 3WD5A 3AMQA 4CU7A 4JC1A 2AACA 5GALA 4GAZA 4XIKA 1PGW2 3SCFA 4CDUA 2CGOA 3HD8B 3TYJA 4D94A 4QX3A 2YU2A 1SLAA 4NHKA 4RD7A 3KT7A 4JVAA 4XUPA 4ES8A 2KM2A 1JU3A 5LA0A 4Q2FA 2B9VA 4O7XA 2BTVC 4PI0A 1HXS1 2VBBA 3U10A 1QHDA 2P5BA 2FHRA 4NJ4A 2B9UA 5DABA 5C4WB 5L9VA 3U75A 3LF7A 5ABJB 1Y9MA 2E53A 3HN3A 3MICA 2D6OX 1E5SA 5GLZA 1QU0A 1QJFA 2WQZC 4ZY9A 1REDA 2DU1A 2WNVA 4SLIA 2A6WA 5FZMA 1HRI1 3W5NA 4MV2A 2XJSA 1RUJ1 1OUSA 3E1F1 1R64A 3POGA 2D40A 2ZXQA 3USSA 4YM2A 3ZOIA 2WZR1 2R30A 3E5XA 2JG8A 1PX3A 1IPKA 3I2FA 1QDOA 4M3CF 5JZGA 3PTRB 4HVRA 2WFPA 3O0VA 5GJ6A 4COZA 5GZDA 2GU9A 2BFUS 4XHXA 1BZWA 4ET7A 4MO3M 2VGDA 5DZFA 4Y1ZA 2RMU1 2WWJA 5BNNA 3QD6A 3KGZA 5FZOA 3WNNA 2GC3A 2GMMA 3OCPA 1MVQA 3F2ZA 1AR73 2QQOA 3ZSJA 2H0VA 3VLBB 1KFXL 5J37A 5IK5A 2SBAA 2W39A 2DWRA 4AAXA 1WUVA 3TNPB 1WA6X 4BDVB 3UNPA 3RNSA 1PVC2 4R9CA 1RB8G 1W6QB 1FPN1 2O1QA 3GDBA 5F3IA 2NM1A 3VKFC 1IKQA 2Z42A 2OA2A 2UURA 1K3IA 4AXOA 3M1HA 3BTAA 1OD3A 1QJY2 1V6NA 1UYZA 1V6MA 1YJLA 2AGSA 2VCCA 4QM9A 2XHKA 2OYZA 3PVEA 4DEVA 2IVIB 3TEYA 5FDBA 1HIXA 3S30A 5K0UB 4AQ2A 3NV2A 4COVA 4AAPA 1AXYA 4IEVA 1RHI1 5GZFA 5AC93 1QQP1 1FX5A 2WQ8A 1K12A 2PQSA 2ZCWA 4FCAA 4IE4A 1EPWA 4Y20A 5FYVA 4CUBA 2HWB3 5FLIA 3PMEA 1DF0A 3FLRA 3ZYIB 1QIQA 2HWE1 1AX2A 1RUI3 3J7NA 3L2HA 1J1TA 1O8PA 4BLJA 4Z1VA 1K5MA 5FPUA 4C8DA 1XC6A 2BBAA 4PHZA 2XJUA 3RI9A 5GZGA 4ASMB 2YY1A 4CPBA 4N8MA 4J1WA 1COV3 2JIGA 4NE9A 4CEWB 3T08A 3WNOA 2OPKA 4N7UA 3ZR5A 4M4PA 1SHWB 4RGGA 5FMDA 1Y3TA 4XJ9A 2YYOA 3N3HA 2WIIB 4LOSA 3T3YA 1YI9A 2FD8A 2W1QA 2VMHA 1R083 3HEIA 5DDJ3 3ZXGA 1GANA 3PU8A 3M4FA 1GWMA 4I01A 3QLQA 4PLNA 4A7ZA 3OPZA 2ZGPA 4JGZC 4PF1A 5F2SA 5DPNA 1ZVFA 1ZZBA 4DPNA 5IVYA 3VBRC 1RL3A 2VG9A 4UFKA 3W58A 5A3MA 5LBBA 1W90A 1CR7A 2QQPA 1DLCA 3ZDSA 2XJQA 3CNAA 2ZPXA 3ZXAC 2FZ1A 3ETPA 3RI8A 4FTEA 5FZKA 4CTEA 1PIV3 4D3WA 4Q4W2 1PNFA 4JDOA 2K46A 3GALA 2HWC1 1G9DA 2QKDA 4XQDA 4CDQA 1HLCA 2A6ZA 3D5OA 4YVWB 5JPMB 2GC0A 4P9XA 1AYN3 3O1OA 4JHTA 1U5ZA 3POWA 1WW4A 1ALYA 2JDUA 2YC2A 3HT1A 4GB31 5FPLA 3H8XA 4UW4A 4MGKE 1MEC3 5LBCA 5LRRA 4FFHA 5F3EA 2PAKA 2VZOA 3BGAA 1RUE1 1GR3A 4GA9A 1I5PA 3ZSKA 3THCA 3AYAA 1SQ4A 2JICA 5EFUA 1AR92 3ELNA 3PVOA 4COWA 4OI1A 4META 1ENRA 4XJUA 2TEPA 4QQ2A 1H1AA 2A6YA 5ANNA 1UN1A 3PMSA 3ZSLA 1PK6B 5JIAA 4Q8LA 2EALA 5G05L 3MF9A 1BEV1 1WW5A 2JDNA 3V0BA 3PUIA 2IZWA 4QPWA 2ADDA 5I8TA 4PQQA 4LOTA 5GLUA 2E63A 1EV13 1UY1A 2V72A 3K75B 3N7JA 1YI7A 3VB9A 5LCWL 4Y4RA 3VBFB 5F39A 4FOQA 2ZACA 5DAQA 5HCBA 3ACLA 2QTWB 2BJSA 3T0DA 2PYTA 4GH4A 1C57A 2B8MA 5FYHA 1ZNPA 3VBSB 3JBG2 3C7HA 4UAPA 2Q8OA 1ZRFA 1X50A 3HQRA 3ZYRA 2YZ4A 3HMYA 1HQLA 3SC7X 4E9KA 4RQPB 5A3WA 5C4WA 2JKXA 3OGJA 1F4AA 4CUAA 3WG4A 4DXRA 1BLZA 5KHKA 3MIDA 1GOFA 3JQXA 4XFIA 1LENA 4HFSA 5FYCA 2R071 4LKEA 3PVNA 5LRSA 1A8MA 1MS5A 3I2OA 1AJKA 4Q4Y3 3ZXEA 1OURA 2D44A 2ZAHA 2PHTA 1E5IA 4Y22B 2ZGKA 1GZ9A 1EY2A 3PUQA 3M3QA 4E4SA 1J3QA 1KS5A 2V4AA 2H6CA 3O1SA 1W9YA 2W0XA 2Y6LA 3EBRA 1XU2A 3LSDA 4AVCA 3H1WA 4YZ2A 5CISA 1A6CA 1LOAA 3AB0A 1GZWB 1UWWA 3PUSA 5EYXA 4TSVA 4CP2A 4I3GA 3K3OA 3NAPC 4CCLA 1H1IA 1V70A 2BVVA 3A22A 3E6DA 3MIHA 4RHV1 2AC1A 1Z7S2 1CX4A 4Z07A 3WUCA 4MG2A 4KG8A 1Q5OA 2MEV2 2JKBA 2CY6A 3C8XA 3MYXA 4I09A 1PMIA 4V2WA 4WZFA 4WM8A 4AFMA 1D4M2 4XFHA 1LESA 1XYOA 4UXAA 1CAUA 4YZ1A 5D2AA 1W6QA 5A3TA 4XVHA 2CDPA 4YZ5A 1S0EA 4Y1XA 5SV5A 1W0PA 4NOTA 2KR2A 4AQ6A 4XF4A 3O14A 2WR9A 1IS3A 4P14A 3X29B 4XILA 4EV0A 2B46X 3WW2A 4QQPA 3WP6A 5FOJB 5KC6A 1GP5A 1H8TB 1RTVA 1VBD1 3OUHA 1Q8PA 1X8MA 1GKBA 3DEMA 2RS53 4AK3A 2VAUA 1VMHA 4AVTA 4BHPA 1JYWA 2VUCA 4I02A 3USUA 1LCLA 2RHPA 1OA2A 1WCSA 2EA7A 2FBEA 1G86A 4CP1A 1UAIA 3E5UA 4JKMA 3LSEA 2DFCA 1RXGA 3P5BA 4N90A 2W91A 2VNGA 4A6OA 2YBKA 4ZU4A 3FE5A 1XOYA 1SLIA 2PAMA 4A3XA 3I2JA 4BXSV 4NHMA 4LBJA 4ZXEA 4NR1A 2AR6A 2ZOEB 3MF6A 5JLVA 5KXBA 3EB7A 1OD5A 3K46A 1UX6A 3AP6A 1H30A 4YW2A 4E2QA 1VJ2A 3KQ4B 4XXPA 3CHXA 1X9TA 2XKOA 4DXTA 3E97A 4P08A 3P3NA 1LEDA 1VBB2 2P6HA 2WUHA 3J8F2 1GWLA 3ZKUA 5LW9A 2OQ6A 3KVBA 2D5HA 5FZ9A 2PMWB 1SDDB 1MR5A 3MI8A 5GKAC 1FI2A 1SFYA 1YEWA 1ODMA 5A33B 5HI0A 4IEPA 3KHBA 1N3QA 2D6LX 1ZBA1 1ULDA 1UYPA 1UNBA 4YW5A 1ZBE3 2A5ZA 5KHJA 5DAVA 1UKRA 3M3IA 2ZEXA 2F4LA 4FOVA 4AI1A 1AX0A 2QFEA 3HR9A 3W20A 4YVWA 3FBYA 4L97A 4WZCA 1PK6C 1DGWX 4D7YA 2B39A 3LCPA 3IDCB 2CU5A 5FYYA 1KDKA 2A70A 1IHMA 5A7QA 3SKVA 2FCTA 3AK0A 4H2AA 1S2KA 4BJ0A 3OPWA 1UO9A 3N9MA 3R4DB 2G4IA 3NRUA 2VQUA 2RM23 5F37A 2YC4A 3JD71 1QJU2 5FPZA 4CCOA 3VBSC 4EN9B 4OYUA 2BZDA 2ZGTA 2WC2A 1QJX2 1CAWA 5FLJA 1RUH2 1POV0 2WO7A 4CZSA 4OZXA 4AEDB 1VBA2 5FY4A 1NQJA 1VMFA 3B3QE 5A6QA 5A1AA 4Z92B 3MZHA 2BBVA 2O8OA 2FCUA 4M00A 2ORZA 2R043 1BVP1 3VBFA 1JBCA 4E8DA 3DF0A 1YRZA 3SISA 4LTAA 4QD2A 2Y6HA 5FYTA 2EXKA 1VRH1 1MQTB 3JB8A 1YUDA 2BU9A 2VQTA 3VD7A 1UOFA 3VBUA 3HJRA 2QQJA 2CGNA 4RQPA 2FMYA 4PJYA 2VTXA 1VR3A 3KGLA 1ASJ1 1IS6A 1CIWA 4MGIE 4LA3A 1SEFA 1IGOA 5FMOS 5HCFA 1PZ7A 2XHNA 1W99A 3AZVA 3POFA 4HSJA 4DUXA 3VD4A 1DGWA 4UW6A 4E4DX 2JDHA 2EAKA 1SPPB 2WABA 2HBTA 4AHYA 3SEEA 2Q0AA 1W6OA 2IXKA 2YGLA 3ZMOA 5FK7A 1BKZA 2WJSA 4FFIA 4Y22A 4D6SA 1FMD3 4XMAA 3WW3A 2VMGA 1R091 3KV4A 4JGYB 5HXMA 4YNIA 3AKRA 1RUF1 3R05A 2W52A 1LU1A 3KF3A 5BUVA 4OHWA 1GZWA 4GULA 2EAAA 5BNOB 2ZHNA 3A0NA 4IV3A 1QXRA 4N7IA 5C70A 2OS2A 5BYNA 2RDRA 2BERA 1PGW1 3AMPA 1DYOA 3D8CA 4OI4A 1JH5A 4DMIA 3FJSA 3NJYA 2QQNA 3T1MA 2WLQA 4DO0A 3MDPA 2P17A 5A3NA 2H0BA 2YBPA 1ULCA 3AL5A 2W5FA 5FZCA 1ZZ8A 5I91A 4Z2WA 4ISQA 4DRRA 3NW4A 2AREA 2Y0IA 2GMPA 1W04A 2DCJA 1AR72 4BQ4A 1POV3 4MHUA 2DVGA 2I07B 3VBOC 1UU4A 3VV1A 1WGPA 2WL1A 1W8FA 1WW7A 3UKVA 2YUEA 3AZZA 4J6GA 2WYSA 4KI5M 3W5MA 2QDRA 1NLSA 2DCYA 1YQ5A 2VZUA 4CSWA 3I3BA 1H8TA 2DYCA 5T50A 1JUIA 3TN93 3ZXDA 4CCMA 2ZEWA 3ZM8A 2EXJA 3CZJA 5HV4A 1FNZA 1U5IA 2D6PA 5FUNA 3HPNA 3LPFA 4UFJA 1C28A 1QKQA 4XC9A 5EV7A 5FZ7A 2A71A 1T6GC 4GMP3 4JAAA 5CKQA 1UZYA 5A3UA 3RG0A 2HWB2 5KXCA 5T5JA 4LO6B 2QDNA 5FJKA 2FMDA 2VL4A 2WNOA 1RUI2 4A45A 1W9WA 1LTEA 2VZ1A 1UXZA 2GN7A 3TAYA 4IV1A 1NA1C 1TME1 2ZGQA 3LEIA 4ZU5A 1VAMA 4UBHA 3T4VA 1KITA 1COV2 5CB7A 2XVLA 2XR4A 4FQZA 1KEXA 1WMDA 3WG3A 1PVC1 3FLPA 4YGCA 2Y8KA 4XF3A 3HIFA 3IBMA 4GJZA 4CDUB 4HZFA 4LEJA 2PQQA 3D0SA 4LO7A 1VBC1 2QVSB 4OULA 1OA4A 1RUG1 1QNWA 5DDJ2 1R082 1MS9A 2X5IA 5A33A 5A7PA 1OOPA 4HVOA 5EJ3A 3I8TA 3WW4A 4D6RA 2J1SA 2PLV3 1JZ7A 5FJHA 4I3PA 2HJIA 1JTZX 1VP6A 3VL9A 3IIAA 4MGSA 5T55A 3U07A 3CO2A 4QGNA 2K9ZA 4CCKA 3VDDB 1S0JA 2R063 3H7YA 4IGOA 1EAH1 1SFNA 4FQ4A 5BV6A 1C4RA 4LBLA 5ACA3 1D7PM 1PIV2 5C8CC 3PUAA 4NAOA 4Q5OA 4QGMA 1RUNA 1X9PA 1QXJA 1GFF2 5I0TA 4IGQA 4AEDC 2RS31 3O12A 2OUHA 1KJRA 1NY72 3WVJA 4XF9A 2O14A 3DYMA 4AF9A 3NNLA 4DINB 3CLPA 2JG8B 2O0OA 3OGGA 4Y1UA 1BBT1 1AYN2 2VZ3A 3IB3A 4P9WA 5FY0A 3RZKA 3WNXA 2IUWA 3GZUC 1FATA 1URXA 1QH7A 5EXOA 1MEC2 4WM7C 1LOCA 1B35C 3AJYA 1Y9QA 5FZOB 5FMCA 2RJ2A 3FHQA 1HJFA 1C1FA 3AX4A 4Q0UA 2P37A 1OMIA 1R1A1 1ZRIA 1ZM1A 1ZYBA 3KLSA 2DVDA 3DGTA 2W47A 3PHMA 4FFFA 4Y33A 1VBE3 1W6MA 2B45X 2Y34A 3J4UH 3ITQA 2PHXA 2Q1FA 3N7KA 3KHCA 4KL1A 2E51A 5C6CA 1LOFC 3WG2A 1MQTA 2O8QA 5CVRA 4Q4W1 5JUVA 5HCHA 2BP6A 2V5YA 1EV12 1F31A 3OGRA 4C0HA 1W2UA 4YW3A 4DXZA 1X8EA 3Q8CA 2RR11 2PA7A 4YVSC 5FFOC 3ZLIA 4INDA 2J1RA 1BVVA 4AFBA 5FY5A 3T2QA 3C7FA 2WT2A 5T54A 3C7OA 3DPRC 3H7JA 3O1TA 5FP7A 4G3YC 1MS4A 2Y60A 2VNOA 3K4DA 4FAHA 3UGHA 3OF1A 4RR3C 1ZRRA 2AUYA 1ND2B 2ZAAA 3OEBA 5FZ4A 3ZFEC 3KWVA 2P3KA 1FT9A 1CAVA 3RSJA 1RC6A 4JGYA 4UW5A 1NCQC 5A3LA 1FYUA 5C71A 1FNYA 4ATEA 4XFGA 3VDBA 3DKQA 4GXLA 4NWWA 1Z78A 1K5MB 4Q4Y2 3SKJE 1H2MA 4LMFA 2BWCA 4QXKA 2UWAA 2X09A 1GP4A 1ZZCA 3MLJA 3P3PA 5FPBA 1REFA 3S6PA 2QNKA 2WLPA 4KG0A 5FYBA 4BMEA 2XVKA 5E1RA 1ZA4A 3N7MA 4RFRB 2TBVA 2ZHKA 1EUTA 3B94A 4FFGA 2WZR3 2YXSA 4JDNA 2ARXA 4XMIA 1HN1A 3T0AA 2X29A 3ENRA 3VHOA 4HPKB 4IW3A 4CEYA 5H9QA 4LUMA 1EP0A 1SDWA 3F95A 3JBG1 3LE0A 3M3CA 3AYDA 5FZHA 2OIIA 4MXWB 3WDUA 1IQAA 1FAYA 1W9FA 2A1XA 2RMU3 2YMZA 4LO5B 1DP0A 3M7AA 4X8PA 4YWAA 5FLHA 5LA9A 4BOWA 2VOKA 5C9AA 2EIBA 2IWGB 5L7OC 5IUQA 4YSFA 1LJ7A 3AMHA 4UF0A 4K3UA 4Q4V1 4HANA 4MADA 3ETQA 2VC9A 2Y6JA 2XBO1 3SEPA 4Q4X3 3MHZA 4KGGA 4ASLA 1AF9A 2VXJA 2ERFA 2ZGSA 1WCDJ 4LBMA 2JD4A 4COUA 5C7GA 3U1XA 2AEZA 1UL9A 4ONUA 1FPN3 1GU3A 5LEJA 1RUD1 3H50A 2PFWA 3IMMA 3MFCA 4LNVA 4CE8A 3PIJA 5FUIA 3WOGA 2ID4A 1LOEA 3PIGA 5DAXA 4BQXA 4OHXA 4CDUC 5BNPC 2RS52 1XNDA 1D4VB 1AR63 1JOJA 2C26A 1AZDA 2X53S 4AYUA 4XHBA 3OY8A 3HT2A 4TWTA 4CDXB 5KXEA 1WMEA 2ZMNA 1HRV1 2ZGUA 1RHI3 2VMFA 2VECA 4QPGB 1FXZA 1QQP3 4XACA 4DZGA 1F4HA 1LGCA 3N9LA 1Z7S1 3BI3A 3KCXA 4ES9A 1XE7A 4RYDA 3ZFGB 4NIGA 1BHGA 1DQ0A 4YM0A 1D4M1 2ET7A 4AGRA 1PVXA 2F17A 3V0BB 2XWBB 2PXJA 3WXPA 3MW2A 2WINB 1A3KA 3BYWA 1JOPA 2WNVC 2Q1ZB 4BH9A 1OI6A 1HDKA 4G9SB 4MX3A 3BTZA 3NV1A 2C24A 5FO9B 2PTMA 3M2MA 2WQ4A 4XCAA 1VLNA 4XEZA 4JQRA 4PDWA 4QXBA 5KHHA 2V5DA 3NNMA 1VAVA 2ES3A 4GH4B 1UOJA 4L0PA 4XIOA 4RL7A 5CZKA 5DUXA 3WF4A 2VOWA 3S5QA 1YYNA 1XU1A 4AI8A 3HNMA 5JZGC 4IESA 3U0ZA 4CDWC 1NZIA 2PHRA 1CN1A 2YPDA 1CIYA 1PM4A 3WT3A 1AR81
chains in the Genus database with same CATH topology
3WP3A 4GWNA 5BNNC 4D69A 4HLTA 5BY5A 3FHIB 4AHWA 2DVBA 4IETA 4PBPA 1ZBE2 1KJLA 1ONAA 2VULA 5J7MA 1DQ1A 1UCXA 2PN5A 1DBNA 4WV8A 4AE2A 2LUWA 2VW1A 4IQPA 5GZEA 1AYM1 1NG0A 2R1BA 3APBA 2D6NA 4MXVA 2C5DA 4S2FA 3GHNA 1I1EA 1CQ9A 3ST7A 1LODA 2DVAA 2XJRA 2RM22 3IDBB 1CAXA 1WW6A 3FMGA 3I54A 1RVF3 1VBB1 3J8F1 5JR7B 2WA3A 4GB33 4M01A 4WM8B 4NWVA 1CAUB 2BEOA 2D3PA 4FOYA 4Y24A 1RINA 4FPJA 3U11A 4LHLA 1OQDA 1YFXA 3PJYA 2R042 4Q27A 5B2GB 3NV3A 5DG2A 1BEV3 1K5MC 3EQEA 2RE9A 4Y5Z0 3VKLA 4EROA 2BW8A 4R9BA 3THTA 1C8M2 4PLOA 4C0BA 2A75A 1WLTA 1GQHA 3ZIXA 5CFDA 1H2LA 4ZXKA 1J1LA 2EIGA 1ND2A 2SLIA 4YZ4A 1H4GA 4XDQA 3USUB 4KGQA 1VALA 4WBBA 2DURA 2BFUL 3IN9A 1OQEA 1QJU1 2R49A 3V64A 3C3VA 1LOBA 4RS5B 4C1WA 2GSYA 1FMD2 2ZTNA 1HV1A 3BCWA 1QJX1 2WNUA 1F5FA 1ZZ9A 1DIWA 3ILRA 1VBA1 1ZZ7A 3B02A 2HYKA 3OBTA 4K40A 2QUOA 3N4MA 3FC0A 2GC1A 4YYOA 4R4XA 2H6BA 4CDQC 4HPKA 4ORFA 5T5OA 3K48A 3WZ1A 2OVUA 3UKTA 5FPXA 4N9IA 4PF5A 1PGSA 1LKNA 2HWD3 4MXWA 2K2SA 4LBQA 1YCIA 4MYEA 2UY8A 2BNMA 5KHIA 3AFGA 4MSVA 1DDLA 3ZXJA 1V6JA 3I59A 5BXXA 2GH2A 3E6BA 2V73A 3FFQA 4YRDA 3UJQA 3MIBA 3LWCA 3LZZA 4OVEA 2ENRA 4XYXA 4H3WA 4R4ZA 5JVVA 1H9WA 3NKGA 1PO13 1MVEA 3H3UA 3TN92 2ZX0A 4AVSA 1M4WA 4MVTA 5JOWA 4CDXA 4W65A 3QACA 4GH4C 4NPRA 3SCHA 4QPGA 3GZAA 2XVGA 3WUDA 1G9CA 3SHRA 3ZFGA 4EWAA 5C4WC 1CAWB 4V1PA 4S2GA 5ABJC 2I74A 3ZYGA 4IERA 4XJ8A 1J58A 2ZA9A 3ZIWA 3IPVA 5DUUA 1AX1A 3ASIA 1QWRA 3I7DA 5H9RA 1BMV1 3VBUB 1O4ZA 2P34A 4ITCA 1U5YA 1PO21 3WDVA 4HL0A 4AGVA 2A7AA 4BZ4A 3R4SA 1N3OA 3BOPA 3WQ1A 3JB4C 4P9JA 2VPVA 2PLV2 3NWKA 1UF2C 1AXKA 4IEZA 4LT5A 3FZ3A 1AL0G 4P9LA 5JCTA 1W6OB 5T5LA 2GALA 2R062 4QQHA 4QMAA 3VKNA 2P3JA 2HWB1 2A6XA 4WM8C 1ZBA3 5ACA2 1OFSA 3ZYPA 5SV8A 4XQ4A 3WX5A 2VMIA 5CAZA 2WNEA 1MZFA 1RUI1 4XQWA 4AI3A 1PM7A 4HT1T 3TNQA 4P5HA 1W6NB 1DLLA 4IV3B 2LM3A 1COV1 1I3HA 4M3CA 5DZGA 5J36A 4B8EA 1DG6A 4BLIA 2YGMA 5L19A 4FPHA 5DDJ1 4BIOA 2XJTA 3JD73 1N1VA 1APNA 5I0UA 1YIFA 2AZ5A 5TSWA 4R8HA 1GNHA 2I2SA 1OA3A 4ISRA 4XF0A 1MS8A 2DFBA 3JZVA 4XPVA 1VBE2 2GNBA 2GZWA 3KT1A 4LHKA 4IEYA 1JN2P 4CEWC 4JRAA 2DV9A 1WCKA 2DTWA 1UZZA 3LOIA 3NSTA 1CJPA 1OPOA 3AYCA 1VRH3 1FOD3 4K1ZA 1AYN1 2C1FA 4LO4B 3B9CA 1AL23 1H0BA 1TMF3 4RS5A 1ASJ3 1JXNA 3B00A 4IEUA 1N1SA 1MZEA 1S55A 2CWSA 2ZKNA 4GWMA 3ZX7A 2FZ2A 1S0FA 2ZX2A 2W68A 4IV1B 4PIZA 2JE7A 2VVFA 3MW4A 1BXHA 2GNTA 3GNEA 4XXAA 1QOOA 4YVWC 3MIEA 2CL2A 3SITA 2WZR2 1KFUL 4LA2A 4GKXA 2JG9A 2X5IB 5JDBA 3G7DA 1V6KA 3KCYA 1OOPB 1EPZA 4LE4A 4L9BA 5EWSA 1GSLA 1D0GA 1S1AA 4K7JA 4K9SA 1V6LA 2WFF3 1KRIA 2NLRA 1HV0A 1VB2A 3QH7A 2RMU2 3NL1A 4GQ7A 4A2UA 2ETEA 3VBHB 2BPA2 5H9PA 2B7YA 1YJKA 2R16A 2K0GA 3OTFA 1RUOA 2NPIA 3NJZA 2XL7A 4U36A 1O3RA 1DZQA 4Q4X2 4Q4Y1 1W6PA 1SACA 1LGBA 1FPN2 3VBFC 1AUYA 4R52A 1RUC3 1YFYA 5IT6A 3VBUC 1AR62 3RS6A 1KDMA 1LULA 4S2DA 4RQPC 3SNMA 2JEMA 1NOVA 1MS1A 2XJPA 3BU7A 1RHI2 1X7NA 1QQP2 3HQXA 2CAVA 4BA6A 3LGRA 4DRVA 2Y0OA 4MGZE 1W6MB 3AMMA 1TE1B 2OUJA 2TNFA 3I4IA 3KMHA 3N36A 1C1LA 1TME3 5A32B 2HWF1 3BODA 3OYWB 1MZ5A 3AP5A 3ZFFA 3O0XA 2VUAA 3HAGA 1TQ5A 1LB2A 4GMP0 5GLTA 4IV3C 4XJWA 5J3UA 1VBC3 5FO8B 2NN8A 2PHLA 2VUJA 1RUG3 4EWDA 3WP4A 2WS93 2RS51 4L2NA 5D8AB 4YGDA 2VNRA 2PHWA 3KCCA 2R32A 3WP5A 1CAVB 3KS7A 2V09A 3H1MA 2UWBA 4XFAA 1ZRDA 4YZ3A 2NMOA 1IS5A 1OHFA 3VZNA 4TLFA 4AEMA 4Z82A 5JMCA 1H4HA 1EAH3 3C2UA 1ENXA 3VL8A 3ZYJB 3AXDA 1W6NA 4DNYA 4U2AA 2CAUA 1ULGA 4M0NA 1H9PA 2RS33 4PLMA 3JCIA 3U4XA 2P2KA 1UPIA 1H8TC 1BBT3 1XE8A 1XNBA 4CEYB 2E9QA 1BK1A 1RVF2 3RWNA 2WKKA 3VZOA 3AFKA 4N43B 1AJOA 2ZS6B 4GB32 3QH6A 3EJKA 1O3SA 3NV4A 1GV9A 4FAGA 3CEWA 4F8AA 3CJIB 3J9SA 5FMOL 2RS13 5C9AB 5CFCA 3PLQA 1R1A3 2IC1A 3D82A 1IZ3A 1N3PA 3MGUA 4K8FA 1SLLA 1ZBE1 5J96B 3WHTA 3B69A 3ZN5A 5E16A 2IFRA 1BEV2 4XW3A 1Y7BA 2XLFA 4A7KA 4KH9A 1GNZA 1E57A 1KQRA 1NCRB 2RR13 5AC92 1RMU3 3S0MA 2IXIA 2JX9A 1NE4A 3T2TA 3OY8B 2RM21 2YHJA 3AKQA 5F9TA 4XTMA 2BNOA 4C90A 3W59A 1ND3B 4YM3A 2CGPA 1LHOA 4IEXA 4Y26A 2D93A 3FLTA 4FTBA 4YG3A 3ZXLA 3VBOA 1G8WA 4PDWB 3CJXA 4AHXA 2CNAA 1QJY1 1I5ZA 3SCGA 3QCWA 1X82A 3MW3A 5AFBA 1C8M1 3L2YA 5KBFA 1M06G 1XNCA 2HWD2 2UU8A 4I0BA 3VBHA 5JIUA 4Z8BA 4B29A 4GIQA 4URTA 3E6CC 3K51A 2E7AA 4BCUA 2GH8A 2ZGMA 3KD4A 1W39A 4XTPA 3FWEA 2JJ6A 1LGNA 1F9KA 1Q56A 3OBRA 3UJOA 4OHVA 4KBBA 3AMNA 4Q4V3 3FBMA 1FMD1 3EHKA 2XBO3 2HKXA 1PO12 4N53A 1MQTC 1NA1A 2R0FA 3CF6E 3EO6A 5I8SA 1V9U3 4RSUA 3V0AA 3B9IA 2HEWF 4I0WB 1RUD3 2VW0A 1CAXB 4QQOA 3RJRA 3VN4A 5T52A 3VGIA 2JXAA 4TYSA 3B01A 5DZEA 4CYDA 4AFCA 4BYYA 1JYIA 2FQPA 1HRV3 4AWDA 2VU9A 5GLVA 4FO9A 5L73A 3SLIA 2XWJB 5J98B 4JGYC 4RA0A 1XRUA 4CP0A 2DF7A 1POV1 3BB6A 1D4M3 3GBWA 4J1XA 5A32A 4G4FA 4H7LA 3OYWA 1BJQA 4E27A 4F83A 5C8CA 3V65A 1PZ9A 4PIYA 4B4PA 4QPIA 4HN0A 5BNOC 1DU3D 3SH4A 2R6QA 3LA3A 5JOZA 3AXEA 4Q0SA 3UKNA 5CFDB 3W9AA 5KHGA 1DGLA 2ATFA 4CRQA 4FPGA 4FXKB 5D8AA 4D7SA 1HXS3 1H2NA 3PVBB 5KC5A 2YROA 1AR91 4CEYC 3KB5A 4L99A 4QT6A 1JHNA 1AR83 2UYAA 1ZBA2 1XNKA 3WR0A 4LE3A 1HRI3 3MIFA 4L8QA 5C9AC 2WNUB 1RUJ3 2Q1MA 5J09A 5CU1A 5DG1A 3ZN6A 1ENSA 3RJ2X 5CG9A 1LECA 1LOFA 4JDMA 1AYM3 1YXWA 1Z0HA 3LKJA 5BPXA 1H2KA 3RDIA 3ZN4A 5IK8A 1Q8QA 1XYPA 3FFZA 4N43A 3SXWA 4YVSA 3AZYA 1PHMA 4LBQB 3NVCA 3CJIA 5CG8A 4FBFA 1PNGA 1VBB3 3JD72 4M0HA 1TNRA 1UU5A 2A73B 3I59B 5CADA 2PLV1 3OD4A 1V00A 4Q29A 1WLDA 4LBOA 3SMHA 4IEOA 3VKOA 4AG4A 2DU0A 3IDEA 4EN8B 4HKOA 3I2DA 5EZWA 1QDCA 1F2NA 1H1MA 5F1RA 3D4KA 2Z69A 3GBFA 5FO7B 3E5QA 3H9AA 1KD7A 1NCRA 5FREA 1YHFA 4FPKA 1C3HA 1JYCA 1J3RA 2PHUA 1QY4A 4Y1YA 1FOD2 5JSOA 4PDWC 2TUNA 3EXUA 1DHKB 3KT4A 4LBKA 1AL22 3SH5A 5F5QA 4HKLA 4NN0A 1TMF2 1A8DA 1O4TA 1ASJ2 2MEV1 3GBGA 3TB0A 5CBLA 5I8YA 2AYHA 4JGZB 1ND3A 3AM2A 2EF6A 4NVPA 3VDDC 2HWE3 3VBRB 2PHDA 4FPYA 2XUMA 1FV2A 2YPJA 1NXD1 1KS4A 1IKPA 3ZVXA 3VZJA 1CONA 3IPVB 4FPLA 1H8VA 3UK9A 2XLAA 2P3IA 1VBE1 3RMXA 3L9JT 1ZZ6A 4LR4A 1W0OA 1Q43A 4AEJA 3JUUA 5FCCA 2JG8C 4E2SA 1GBGA 3OD0A 2DUOA 1LRHA 4DS0A 2D7FA 2GC2A 2GDFA 2X8KA 3NO8A 1QJZA 4OLLA 1OKQA 2B5HA 5BNPA 1PGL2 3AP9A 5JOYA 2Q5TA 2WFF2 1OFNA 3ZXFA 4NHLA 3PTYA 1ULFA 4LHNA 1N47A 5C33A 4FPCA 2QZ2A 4W6YA 1D2QA 1LOGA 3VHPA 1SBEA 4JRLA 1Y43B 4KU8A 2HWC3 2VH9A 2AENA 1GLHA 4HK9A 5FAXA 3AJZA 3M8LA 4Q26A 3IMNA 2EXHA 3R6SA 1RUC2 2Y26A 4M3CB 1B09A 2D5FA 5T3NA 2ILMA 4I0AA 1YNAA 1ULEA 3MPPG 2WT1A 1BYHA 1O5LA 5CFDC 1RUE3 4SBVA 1REEA 1ND2C 4P9YA 3R0RA 5JI9A 1AXZA 4ZKTB 4HBNA 4CDWA 4QU2A 2ZGOA 1QGLA 3PNAA 2R1DA 1SCRA 4Q1PA 3ZSMA 2ZMKA 5CNAA 4LUKA 1CPMA 1DYKA 1N1TA 1YFUA 2WNUC 3POYA 4XJAA 1TME2 2ZGNA 1O3QA 2A6VA 1EYBA 4Q4X1 4EN7B 3KM5A 4E2GA 3B5LB 3G6JB 4K1YA 2XGXA 5BNQA 1O3TA 2A3XA 2VQAA 2YDEA 1NE6A 1VBC2 3VZKA 4F3JA 1OPMA 4GKYA 2A3YA 1PO23 1RUG2 1PZ8A 3JQWA 2WS92 1QNYA 3NAPB 1AR61 4XJZA 4FPOB 2R073 4FXGB 1QH6A 4WVVA 1RUH1 4KQ7A 5K7PA 3RRDA 2C0ZA 4AGGA 4YG6A 1EAH2 5C8WA 4QX5A 2ZHMA 4XZPA 4QM8A 4YW4A 4JV4A 2BWAA 4BIFA 2VVEA 1LHUA 4GALA 2RS32 3FUQA 3B93A 2HEVF 3D0JA 1O91A 2JG9B 3H1YA 4DFSA 3DKWA 1BBT2 3MIGA 1QOSA 1ZX5A 4H14A 4P9GA 4RHV3 1OQ1A 4XFCA 3VKMA 1DZRA 4AVVA 5JOXA 1OLQA 4CDXC 1UU6A 5T5PA 4QPGC 1GZCA 1BCXA 4X6RB 5JSRA 3AZWA 2RS12 4KU7A 3ZFGC 1R1A2 1I9RA 3R4UA 1UMZA 3N7LA 3LA2A 2JE9A 1DGRA 1SBDA 2ZKLA 2BNNA 2PELA 4H55A 3WW1A 1LEMA 1W6PB 4Q1RA 3TOJA 4LO8A 1RJ7A 3VHNA 1LU2A 1OSGA 2GNMA 5AVAA 5GZCA 2VVDA 2ZX1A 5F6KA 1VBD3 3IWZA 3VHRA 5LK7B 2Z79A 2RR12 2BYVE 3ATGA 1RMU2 2Y38A 2E6VA 4JGZA 4AVBA 3WCSA 2W08A 3VBRA 1RVF1 1YLLA 2VXRA 1AR71 3VZLA 2DTYA 4BM8A 1WLCA 1ZREA 3VUOA 1L3JA 3VZMA 3ILFA 2EVXA 2C9AA 3S7EA 3WLUA 4AI0A 1HKDA 2NYYA 4B4RA 4EJRA 2DCTA 3WINE 3FX3A 4XF1A 3AP7A 1A78A 3ZFFB 4BMBA 3WDXA 2GMEA 5EYYA 4R9AA 4LBNA 4IEQA 4YFZA 3DV8A 5AC91 4OUSA 1KXGA 5K9YA 4AQTA 1SCSA 2ZX4A 2XPJA 2D97A 4FT8A 3UV9A 4RGAA 4HK8A 4EWEA 2DUPA 1CVNA 3HN1A 2JECA 5KWRA 3AKPA 1RITA 2E7TA 4OFGA 5ABJA 2DUQA 4Q4V2 1UIKA 3WG1A 4DY5A 2XBO2 1G6NA 4PIXA 5IK4A 1V9U2 4A7YA 2RJLA 2IFWA 1RUD2 1R081 3WDWA 2IXHA 1DQ2A 4L92A 1C8NA 1YWKA 5LEKA 2KXLA 3LOBA 1SMVA 5CIRA 3MPBA 1WD3A 2RJKA 2HWD1 4HSLA 4BPZA 5CFCB 4RS5C 3WDTA 3KZ4C 3B7MA 1HRV2 2ZMLA 4NO4A 4H7MA 1PIV1 1G9AA 2VQ0A 3FUOA 3ES1A 4JTNA 2F4PA 5F6LB 5JPNB 2MPFA 1CGPA 2CV6A 1NY71 3IT8A 4DOUA 5H9SA 1S0BA 4YFWA 4I30A 2MHFA 5DXDA 4WVMB 1DFQA 1PO11 2D3RA 2QCSB 1GICA 3LAGA 2HWF3 1VIWB 2CYFA 5LK5A 3WCRA 4WVZA 3CU7A 3NAPA 1MEC1 3QBQA 1HXS2 3ZXKA 2JG9C 2D43A 4COYA 2DCKA 2G9GA 1YIPA 1SLTA 3URFA 5K0UA 4OHYA 1RIRA 4XE9A 4LLFA 5FQ0B 3MEPA 1AR82 2EXIA 1D0HA 1R093 1HRI2 4E4ZA 4W6WA 3PJQA 1RUJ2 4MGYE 5HBAA 1CD3G 2G9FA 1RUF3 1XQNA 3VBOB 1EV11 5GLWA 2Z5WA 2E7QA 1AYM2 4CEWA 5IK7A 3KQRA 4PQ9A 2OW4A 4BE3A 4HN1A 2PAEA 2NZ9A 4FP2A 3DN7A 1CPNA 1Q3EA 2WA4A 4Q0PA 1G9BA 3TBDA 2ZX3A 4YG0A 3ROUA 1LR5A 1SLCA 4QPYA 1XXNA 1IOAA 2Q30A 2IXCA 3DL3A 4LBQD 1X36A 3ZMNA 1BQPA 4FSJA 4N53B 1NA1B 4K20A 4FPFA 3GZTB 2IXJA 3RMYA 4BQ1A 1DQ6A 1DZTA 3V0AB 1GYKA 3IKWA 3J26N 4L11A 1D2SA 2A3WA 2HEYF 3O7OA 3ZFFC 3LB9A 1X33A 5E8AA 1WMFA 3O5SA 3KSCA 3A0KA 4S2HA 1IS4A 5DUVA 1JW6A 4DQAA 1WD4A 1C5IA 4Q0QA 5AFEA 1LHVA 2VOXA 1VAKA 1ZRCA 2HWE2 2XH6A 4KWLA 1XYNA 2GNDA 2PHFA 1V6IA 5C8CB 1PK6A 2BQPA 2B42B 3BPZA 2YV8A 1PVC3 4HKWA 4MH0E 4QPIB 4HVQA 4AQSA 3S7IA 1C5HA 3ZSEA 2N7GA 1NZCA 2XL9A 1QOTA 3ILNA 4EN6B 2F6BA 1QJY3 1S0DA 2DCZA 2ZBJA 4AHZA 4W6XA 1FOD1 1C8M3 3RZZA 3VBSA 2ZGLA 4Q8KA 1J3PA 5GM0A 1S0IA 4B7EA 2NP0A 2XJVA 1AL21 4WM7B 1B35B 1TMF1 2D6KA 3JU9A 5FOBB 4C91A 5K8SA 4AFDA 2ZABA 5CFCC 4XFBA 2I45A 2LALA 3HBZA 4YGEA 2HWC2 1O4YA 5JI7A 4PBOA 4MLOA 3CL1A 3ZN6B 4YM1A 2LTNA 2QE3A 3GF6A 4AW7A 3H0OA 4YVSB 1NYWA 3ES4A 1FV3A 2VY0A 1RUE2 4WVWA 2MNGA 3DPRB 3RPQA 3ZO0B 2QZ3A 3RQ0A 4EN0A 4OI0A 2BVBA 4RR3B 2UY9A 4MZUA 4YGBA 4QGLA 3ZPYA 2NMNA 2ZZJA 1PGL1 2WFF1 3O0WA 3ZFEB 2UWCA 1NXMA 1NCQB 1VB4A 4IV1C 1WBLA 3BIWE 4IL7A 4Q4W3 4TZDA 3GHMA 4WVMA 1Q8VA 1DQ4A 1UW8A 4DB5A 4BWOA 1MZ6A 1WLWA 1AHSA 2D3SA 4ATFA 3DUIA 1BMV2 4Y1VA 1QF3A 3ECQA 2X5IC 4FOWA 1R1ZA 1RUC1 1OOPC 2WSVA 3Q9OA 4AEKA 1TEIA 1PO22 3AP4A 5FQ0A 3MLLA 4XETA 1TNFA 2R072 3BOWA 1SLBA 3VBHC 1AR93 2QJVA 4N9HA 5E88A 1CJDA 5L7OB 1DYPA 3H8UA 2ET1A 2R041 3HWJA 3IM0A 1J59A 5FBZA 5D1IA 4IXLA 1LHWA 1RGSA 2D98A 3OJBA 2ZGRA 3M3EA 2WZPP 4N53C 2GAUA 4I2OA 2VOVA 4B7KA 1WBFA 3N35A 4P9IA 4KNCA 3MLKA 4Q0VA 4RHV2 2DVFA 5BNPB 1V6OA 2ZHLA 1UD1A 3JBG3 4YLZA 3RYPA 4XOGA 2JDZA 1ENQA 2BGCA 4QQLA 1I6XA 1HQNA 5JWPA 3M3OA 2WWSA 3BALA 2WS91 4Y4YA 1QXPA 4X6QB 1YFWA 2OZJA 3A4UA 4AVAA 4KWKA 2XKPA 4XBQA 1HQWA 4K21A 2GN3A 4IEWA 2Q4SA 1DGRN 3WY6A 2WNVB 5I93A 3M70A 1LHNA 4QPIC 4HMZA 1VBD2 2WSUA 1U0AA 1RJ8A 1O5UA 4XFFA 1MS3A 2D6MA 3WQ7A 3ME2A 5JAXA 5D8AC 5JZGB 1HW5A 1GQGA 4D7TA 4CDWB 1Z7S3 5KXDA 2MEV3 1G7YA 1G9FA 4X8NA 5BNNB 4R9DA 2RS11 3UL2A 2ARBA 5J48A 3NKTA 1SBFA 4AEDA 2YC0A 3INAA 2CWMA 1NLRA 1HX6A 4FP3A 5AVPA 3QOPA 2NQYA 4XBNA 3WHUA 3TN91 1NQDA 2KA3A 4UBGA 1S0CA 1UIJA 1Q8OA 4FVVA 4QHBA 1N1YA 4MUVA 4FTSA 4OHZA 4AI2A 2AH2A 2WT0A 4WM7A 4N43C 1B35A 1RMU1 4YW1A 3AKTA 4GMP1 4OUMA 5HXVA 2BUKA 3D6EA 5FTTC 4RFT0 4HETA 3CJIC 4XBLA 5FRAA 3TWIA 5CA6A 3AYEA 4Y20B 4LLOA 3THPA 4B3NA 4B4QA 1OLRA 4AFAA 3LA7A 1MACA 1UPSA 1S2BA 4PCRA 1QMJA 4F7ZA 1NCRC 1S0GA 3H3ZA 2Z2SB 4LULA 1CESA 1IPJA 2OZ6A 3DPRA 5BNOA 3J8F3 1YO8A 1JUHA 2R0HA 3SH3A 4K6BA 2CTVA 4RR3A 3T1LA 1F5JA 3WDYA 3WQ0A 5HCAA 3POSA 3ZFEA 2R061 4YARA 1NCQA 1ND3C 4JCKA 3TRSB 5ACA1 4UW3A 3AZXA 1WA4A 4M3CE 5L36A 1DQ5A 4ZU7A 2XB6C 2XLGA 5JSPA 4OI2A 2UYBA 4O9GA 4O9EA 4C1XA 1VRH2 5I0RA 1O7FA 1U5XA 3RYRA 2ZZQA 1MS0A 2HWF2 5I0SA 3RYKA 4CDQB 5E89A 1V9U1 1U12A 1Q8SA 2XG3A 4JTOA 3V56A 1AVBA 2ZJCA 2IXLA 5DUWA 1QJU3 1F8VA 4DY3A 5L7OA 3ALQA 2JENA 4KWJA 1QJX3 1R092 1RUH3 1UKGA 1VBA3 1RUF2 3AKSA 3GYDA 3MFAA 4FPEA 3WV6A 2VW2A 3WD5A 3AMQA 4JC1A 5GALA 4XIKA 1PGW2 3SCFA 4CDUA 2CGOA 3HD8B 3TYJA 4D94A 1SLAA 4NHKA 4RD7A 3KT7A 4JVAA 4ES8A 2KM2A 4Q2FA 2BTVC 1HXS1 3U10A 1QHDA 2FHRA 2B9UA 5C4WB 5ABJB 2E53A 3MICA 2D6OX 5GLZA 1QU0A 2WQZC 1REDA 2DU1A 2WNVA 4SLIA 2A6WA 1HRI1 4MV2A 2XJSA 1RUJ1 2D40A 3USSA 4YM2A 2WZR1 2R30A 3E5XA 2JG8A 1IPKA 4M3CF 1QDOA 5JZGA 4HVRA 2WFPA 3O0VA 5GJ6A 4COZA 5GZDA 2GU9A 2BFUS 4XHXA 1BZWA 2VGDA 5DZFA 4Y1ZA 2RMU1 5BNNA 3QD6A 3KGZA 2GC3A 2GMMA 3OCPA 1MVQA 1AR73 3ZSJA 2H0VA 3VLBB 1KFXL 5J37A 5IK5A 2SBAA 2W39A 2DWRA 1WUVA 3TNPB 3RNSA 1PVC2 4R9CA 1RB8G 1W6QB 1FPN1 2O1QA 2NM1A 3VKFC 1IKQA 2Z42A 2OA2A 2UURA 4AXOA 3M1HA 3BTAA 4DINB 1QJY2 1V6NA 1V6MA 1YJLA 4QM9A 2AGSA 2OYZA 5LRSA 2XHKA 3PVEA 5FDBA 1HIXA 3S30A 5K0UB 4AQ2A 3NV2A 4COVA 1AXYA 4IEVA 1RHI1 5GZFA 5AC93 1QQP1 1FX5A 2ZCWA 4FCAA 4Y20A 1EPWA 2HWB3 5FLIA 3PMEA 1DF0A 3FLRA 3ZYIB 2HWE1 1AX2A 1RUI3 3L2HA 1J1TA 4BLJA 4Z1VA 1K5MA 2XJUA 3RI9A 5GZGA 4ASMB 2YY1A 4J1WA 1COV3 4CEWB 2OPKA 4N7UA 4RGGA 1Y3TA 4XJ9A 2YYOA 3N3HA 2WIIB 1YI9A 2VMHA 1R083 5DDJ3 3ZXGA 1GANA 4I01A 3M4FA 3QLQA 4PLNA 4A7ZA 3OPZA 2ZGPA 4JGZC 1ZVFA 1ZZBA 4DPNA 3VBRC 1RL3A 2VG9A 3W58A 5A3MA 2QQPA 1CR7A 3ZDSA 2XJQA 3CNAA 2ZPXA 3ZXAC 2FZ1A 3RI8A 4FTEA 4CTEA 1PIV3 4D3WA 4Q4W2 1PNFA 4JDOA 3GALA 2HWC1 1G9DA 2QKDA 4XQDA 4CDQA 1HLCA 2A6ZA 3D5OA 4YVWB 5JPMB 2GC0A 4P9XA 1AYN3 1U5ZA 3POWA 1WW4A 1ALYA 3HT1A 4GB31 4UW4A</