5K9YA

Crystal structure of a thermophilic xylanase a from bacillus subtilis 1a1 quadruple mutant q7h/g13r/s22p/s179c
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
184
Chain Sequence
ASTDYWHNWTDGRGIVNAVNGPGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase A
publication title The role of local residue environmental changes in thermostable mutants of the GH11 xylanase from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Hydrolase
total genus 49
structure length 184
sequence length 185
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5k9yA00
3VZNA 3AMQA 5HXVA 3MFCA 1C5HA 3AKRA 1TE1B 3WQ0A 1H4GA 2BWAA 2DCZA 4S2DA 4XQWA 4IXLA 3VL8A 1XNCA 4HKOA 3ZSEA 2DCKA 3RI9A 3AKQA 3VHOA 2BW8A 3VZJA 1KS5A 3WXPA 2VG9A 1REDA 2JENA 2DCYA 1H1AA 3HD8B 3B5LB 3AMMA 3WP4A 1BVVA 5K7PA 2NLRA 2JICA 3AMPA 1HV1A 4HKLA 3AKTA 3RI8A 1BK1A 3VZOA 1T6GC 4HK9A 1OLRA 1BCXA 1XYOA 3AKSA 1F5JA 1XYPA 1C5IA 3VGIA 1REEA 1OLQA 3VHNA 2B42B 4H7MA 2VGDA 3AKPA 4XPVA 2DFCA 1M4WA 3WP6A 3VZKA 2DFBA 2NQYA 3AMNA 2Z79A 4S2FA 1REFA 2B45X 1XNBA 2VULA 3WX5A 1ENXA 3WY6A 2DCJA 3MF9A 3WQ7A 3LB9A 4HKWA 1OA4A 2B46X 1UU5A 1KS4A 4S2GA 3VLBB 1NLRA 1OA2A 1UKRA 2QZ2A 1HIXA 1QH6A 3WR0A 1UU4A 1YNAA 3WT3A 3WP5A 2JEMA 4S2HA 5K9YA 1IGOA 1XXNA 3B7MA 3M4FA 5EJ3A 2VUJA 3WP3A 3AMHA 2D98A 2BVVA 1OA3A 3MFAA 3LGRA 1H8VA 1PVXA 2C1FA 3WQ1A 2BWCA 4HK8A 4XQDA 2D97A 3VL9A 4NPRA 3EXUA 1HV0A 1XNKA 1XNDA 1XYNA 4XQ4A 1UU6A 3VZLA 2F6BA 3O7OA 1H4HA 3VHPA 1QH7A 2QZ3A 1AXKA 1H0BA 1W2UA 3MF6A 3VZMA
chains in the Genus database with same CATH superfamily
2AZ5A 5FYVA 5JVVA 2VW0A 4CDQA 3POFA 3TAYA 4KBBA 2OQ7A 2CWSA 1D4VB 3E5UA 1E5IA 2R30A 3C8XA 2XMLA 3LFIA 4YM2A 3L2HA 1QWRA 5JZGC 3UL2A 2H0VA 1NA1B 2PQSA 1YI9A 3T09A 4NAMA 3ACIA 3ITQA 3MLKA 2JB4A 4FOQA 4QPYA 1QDCA 1MQTC 2ES3A 3J7HA 4JGZC 5BV6A 1POV0 1ZA4A 2A70A 2Y34A 2YXSA 4JC1A 2HWE1 4PHZA 1PNGA 1NY72 3ZN6A 2ADEA 5IHRA 4DRVA 2R1DA 5BUVA 1NLSA 1OHFA 1DCSA 3ZOIA 4WZCA 3VD3A 1H1AA 2GC2A 3D0JA 3HNBM 4JQTA 1SG3A 5KR7A 4XYXA 4BPZA 4CUCA 1OSGA 2Q1MA 2WAOA 2QQLA 4GKXA 4FOYA 4YW7A 1U5IA 3PNAA 1SHWB 2BYVE 3FUQA 1LCLA 5FZKA 5IVEA 4PDWA 5FP4A 2MEV3 4XF9A 5HPOA 2OVUA 3MBWA 3VKLA 3BU0A 1NZCA 2IFRA 4WM7B 5ANNA 4EROA 4EWDA 4Q4V2 1WCQA 3H50A 1AYN1 3DCQA 4R8HA 4XBQA 1B35C 4YGDA 4H7MA 2FBEA 2J1TA 5CBLA 4J25A 4YZ2A 2D40A 3M70A 4IEXA 5FY5A 4FPFA 1GQHA 1PIV3 1VRBA 4FPYA 2LALA 2Z79A 5C6CA 4E8DA 1GMMA 1S4CA 4IE0A 4D7TA 2QQWA 5FY0A 3RZJA 2YHJA 2WNOA 1S0GA 5KHGA 3W21A 5A1LA 4AEDC 4ISQA 1UYPA 1VMHA 5JIAA 4AFBA 1AR62 1EV11 5L7OC 2E51A 3RG0A 1DYKA 1US3A 3N9MA 5DAQA 4ORFA 2XJPA 4I2OA 3RZLA 2XL7A 2HWC2 3IDBB 1UYZA 3V0AA 4KG0A 4HLTA 1LOFA 3NJZA 1XE0A 4CRQA 2VQ0A 1RTVA 2W2IA 1IPJA 2Q1FA 1POV3 5T55A 1RXGA 1F35A 2BOIA 4FPHA 3WR0A 4M3CB 2XPJA 1D4M2 1HKDA 2JB8A 2XUEA 1C1LA 3LA2A 1M06G 1NA1C 5DG1A 5FYSA 5F2WA 4JGYA 4DS0A 1EY2A 1IGOA 1XXNA 4LO7A 3UJOA 4XBLA 2WRAA 3QCWA 5EJ3A 4COVA 2ORZA 2VUJA 3CLPA 5LWBA 2PXJA 3I3QA 3TOJA 1CAUB 3UKVA 2ZABA 1WMFA 3D3AA 4OUSA 3BUCA 2WSUA 4FFFA 4H3WA 3LEMA 4OUEA 1BHGA 2XJUA 3RS6A 5FZIA 2JECA 4CDXB 2GZWA 5I0RA 3EXUA 4Q29A 4BMBA 2XQRA 2OPWA 1TEIA 4WM7C 3DXUA 3MDPA 3MLJA 2VZ1A 3PURA 4CCJA 3RWKX 1AJOA 5FBZA 5HV4A 4ARYA 4YLZA 1PO12 3S0MA 3MIEA 2UWCA 3D0SA 1SFYA 2BP6A 1ZBA2 1VBA2 4KL1A 1RUG1 4AGVA 2OPKA 4Y1VA 4AAPA 5J37A 4XFIA 4RSUA 3ST7A 2B9UA 3NW4A 1A6CA 1RIRA 4XZPA 1E5HA 1NG0A 1A3KA 2X5IC 4F3JA 2IUWA 1Y9MA 3PMSA 5EHDA 1C5HA 4YG6A 1SLIA 4QX2A 4MZUA 2BWAA 4S2DA 1R1A2 1X50A 2HWF3 4Z8BA 3UNPA 1E57A 3WVJA 1UKGA 2DDUA 3I2GA 3AFGA 3CU7A 2VMEA 1R083 4CP9A 2SLIA 4AK3A 4RR3B 3VZJA 1JYNA 1VMJA 4RQPA 3BTXA 3ETQA 2ILMA 1DGRA 2CGOA 3KV6A 1DGRN 4COYA 4CCLA 5ACA1 3AXEA 3VDDB 4DEQA 1D2SA 1FI2A 3I3BA 1V70A 4EV0A 5LA0A 3M3CA 1MS1A 1K45A 3I3DA 2QQIA 3AL5A 4NHKA 2WO2A 2XH6A 4UFHA 4XXPA 1PGW2 4JRAA 3NV4A 3RI8A 1RUD1 4IV3B 5F5QA 4NHYA 1BCXA 4QHZA 2RM21 3NRUA 3USUA 1F5JA 4KGGA 4OHWA 1WD4A 4LT5A 5FKCA 1CAXA 1S0FA 2HWD2 1NZIA 3TEZA 1WCDJ 5LK5A 2W1SA 3AKPA 1QY4A 5T5OA 4RGGA 1JMUB 4DFSA 4JZRA 1QJU3 1DG6A 4Z07A 1ULPA 1JU3A 4FTSA 1REFA 4P5HA 4CEWA 4K1YA 3PJYA 2QQUA 1NLQA 2QQPA 2CV6A 1RGSA 3J8F2 4FTBA 4F8AA 1F31A 1ZZBA 1W0OA 1QXJA 1X33A 4LITA 5CFDB 4E2GA 1PVC2 2QBXA 3HQRA 4BQ3A 4CPBD 1PK6C 2WA3A 2A1XA 2FD8A 4Y20A 2LM3A 4ZONA 1LB2A 1CESA 4RS5B 2C26A 3LOIA 1UKRA 5F32A 4D7SA 5C9AA 1JZ4A 2VJXA 4UBGA 1A8DA 2RDRA 2JG8B 3M3QA 5JIUA 4EYUA 1MS8A 2AACA 3OY8A 2Q4SA 1W3VA 1YJLA 4BQ2A 5D8AA 1DQ0A 3CNAA 5C7GA 3R4DB 3GBFA 2K9ZA 4Q26A 1JXNA 2XBO1 3I54A 4LUKA 4ET7A 4LK7A 2R041 5JSRA 2J1AA 4MHRA 4SBVA 1E5SA 3DUIA 1CAWB 1HXS1 4QQHA 4RR3C 4N7IA 4XFFA 3SLIA 4A7ZA 1ND2C 4KI5M 1AUYA 1GP6A 3U11A 4Y4YA 2X10A 1J3QA 1RUC2 2ADDA 3BOPA 3HNMA 3SQOA 3VDDC 1N1TA 3JD71 4QKNA 5FPVA 1QNYA 3MIHA 4IEZA 4IDZA 3I59B 4ZKTB 4BE3A 2HWC3 4GD4A 1RUH1 3KQ4B 4LBMA 2I45A 3W59A 2NMNA 1QU0A 3FUOA 5B4NA 2VMHA 5C4WA 5GALA 1ZRCA 4IV3C 5HCAA 3BTYA 3IAQA 2WNUB 1D4M3 3C7OA 1GZ9A 1Z0HA 3TN91 1PGSA 4YW3A 1W6OB 3O7OA 1DZQA 1RXFA 3T0AA 1OD3A 2QUOA 2KD7A 4LO6B 3THDA 1OFNA 1W2UA 1SFNA 3WEZA 2OZ6A 4XFCA 3GBWA 3Q8FA 3K4DA 2RJ2A 3H8UA 5FXZA 2ET1A 3NVCA 5HXVA 3LD8A 3UETA 1W0PA 3KT1A 3ABZA 4IE5A 2R0HA 2AYHA 4NR1A 4XQWA 2RV9A 3NQHA 4P00B 1I6XA 4BXSV 1H2KA 1CWPA 1LGNA 1OMIA 4ASKA 2E63A 2Y6KA 5KXCA 3VHOA 4RS5C 4KMQA 4IUGA 1ULEA 4E27A 2JG8C 2PHUA 3LOBA 2ETEA 4Q27A 1ZBA3 3B9CA 4YM1A 2WZR2 2EIBA 4LNVA 3GHMA 5DAVA 1XPWA 1TMF3 1BEV3 5E88A 2PHTA 5DAPA 2A6XA 1KJLA 3RJRA 5CISA 3J9SA 2OUHA 1V9U1 5A7WA 2RS51 1A78A 2DF7A 3IPVB 1I5PA 1Z7S1 1EYBA 4CDUA 3NNLA 3CJIB 4AI1A 2VBPA 3ZKUA 4UF0A 3CZJA 4L92A 2FMYA 1O3SA 2WR9A 1H6XA 4XPVA 2VTXJ 3WP6A 5DUWA 3NO8A 2VXJA 4RYDA 3KS7A 5HCBA 2OX0A 3ZIXA 4MXVA 1Q43A 1UZWA 3A4UA 3WSOA 4YRDA 2WNUC 3WG2A 1CONA 1MS5A 2CSGA 1G86A 4E2QA 4OFGA 4DOUA 2VZPA 4WVWA 1W6NB 3W20A 3WF0A 2A7AA 3CO2A 1GWKA 1QXPA 4P9JA 3VD5A 3JBG2 4EN6B 1O3TA 5K0UC 2CGNA 5IUQA 1L7RA 1R1ZA 3MLLA 2WABA 1XQNA 1RUE2 4I01A 4QX7A 4CXYA 5IW0A 5ANQA 1OA2A 1OPOA 1VB4A 4QPGA 4WVMB 4BJ0A 3UT0A 4BH9A 5JPMB 4CZSA 2C9KA 5CKNA 3VBRA 2W68A 3AVSA 4IE4A 4RN5A 3IDAA 2C5DA 1CD3G 4R9CA 2RG4A 2QVSB 2WT2A 5AC92 2TUNA 5KWRA 3JCIA 1CAVA 4GB33 4AQ6A 3SXWA 4RHV2 1VBB2 1WLWA 1BMV2 1GP4A 2VQTA 5FCCA 5ABJC 1O3QA 1O6UA 3ZYGA 4ZS2A 2NYYA 3DKQA 4X8NA 3J8F3 5JPNB 4L2NA 3TRSB 3LAGA 4NROA 1NUKA 2YDEA 4BCUA 1V6LA 2UYBA 1CIWA 1V00A 1OXCA 1PVC3 4BXFA 3WQ1A 1AX2A 1DP0A 2WJSA 1FAYA 4PJYA 1W2NA 5CVRA 4NWWA 4XBNA 1GNZA 4OUMA 1WMXA 2OXBA 3CJIC 3IZOA 3AP9A 1CZTA 1XYNA 2JDNA 2BGPA 1LOBA 4OHVA 3QOPA 5CZKA 1W2AX 4TSVA 4UOJA 1AXKA 4JDOA 2VO5A 3LA3A 2D6OX 4AGRA 1N3PA 2RR12 3ZDVA 1X9PA 5A6QA 1MPXA 2FDIA 3WV6A 4I02A 4XXAA 1RUC3 4P9YA 4HN0A 5IVFA 1YIPA 1QOSA 3VBUC 3FLTA 5EV7A 2HBTA 4M4PA 4LE4A 1FV2A 3HVDA 3FZ3A 1SBDA 3LF7A 4Q4X1 5H9SA 4PIZA 4I09A 3W9AA 4YGEA 3FFZA 2WKKA 4HT1T 5JOXA 4FBFA 1PGL1 1VBC3 1IHMA 4TLGA 1WW7A 1Y7BA 2YC0A 1OPMA 2N7GA 2JDYA 3S5AA 3WUCA 1YO8A 2JDUA 4INDA 1O4ZA 5FAXA 3UGGA 2H6BA 4QPIB 5FIXA 4AEKA 4B4RA 2R1BA 4GH4A 4MH0E 2D93A 4DQAA 3RVHA 3AYAA 4LK6A 5K7PA 1J3PA 3FMGA 1CPNA 2PHXA 2Q1ZB 2QNKA 3VBSB 4IGPA 1O7FA 2D44A 5C8CA 4LBLA 4MXWA 3PVOA 3HT2A 1ULOA 3ZFEA 1H1MA 3CHXA 1IPSA 1HQLA 2P1BA 3BOWA 3EJKA 4LO4B 2LTNA 1PM4A 4WZFA 3FBYA 3VZKA 4D94A 1ZYBA 1ZRFA 3IIIA 2WFF2 4Q1PA 4Q0UA 2VZSA 3GBGA 5EZWA 2RS12 1EUUA 2ZBJA 4LORA 5AVAA 3I2OA 5FPXA 2WZR3 3ZDSA 4MOAA 3OPZA 2WWJA 5K4LA 3H1MA 3ACGA 1XRUA 2ZKNA 1UU5A 4IE6A 2ZHKA 2EIDA 3WUDA 5F3CA 4S2GA 2DVGA 3JD73 3WDTA 2J1EA 4LQRA 3PUAA 1GQPA 1YIFA 1CQ9A 1I9RA 3BALA 1I1EA 3LEGA 2K2SA 3POEA 4HBNA 1JYVA 2C0ZA 5C70A 4G4FA 2ERFA 2WQZC 1CZSA 4QDRA 2LRPA 4BA6A 2ZHNA 4XFGA 5DDJ3 4N53A 2W5FA 5CU1A 1RHI3 4JQRA 3N7LA 3AZWA 3OYWB 5FO7B 4BOWA 1JU4A 3NWKA 4HSJA 2Y0IA 4EJRA 2D5FA 3WP3A 2G9ZA 4Q4W1 4YARA 2MEV1 2B8MA 1HRV1 4NN0A 4UW4A 5FRAA 1JUIA 2ZEXA 3ZX7A 3VD4A 4QPIC 3JBG3 4NUBA 4N43A 3MW4A 4LKEA 2WS92 5KXDA 1G9DA 4QX3A 4HK8A 4Q2FA 4AVAA 1S2EA 4W6YA 4CEYB 2IXHA 1V6OA 4I3PA 3CBNA 3MV01 4XUQA 4A6SA 3VBSC 5K0UA 1PIV1 1WCKA 1R64A 3D8CA 2FZ2A 4BISA 3B3QE 2GNDA 4JV4A 1UY1A 2ZAHA 4I0WB 5FFOC 3SHRA 5FOBB 2WN3A 4RHV3 1VBB3 4NHXA 3VZLA 3ZYHA 3T1MA 5LEJA 4JCKA 1H4HA 2JG9A 2HJIA 1SLAA 1Y43B 1N1SA 4B4QA 4OLLA 1KFUL 4U36A 3OGGA 4HL0A 2OKXA 3RYPA 3LPGA 1FMD2 1UD1A 4K8FA 1W39A 2FDGA 4CXWA 3POBA 3WDWA 3WF3A 2NMOA 1KFXL 3RGBA 4NHLA 2E32A 3DPRA 3POWA 5FZ8A 3THCA 1V9U3 2I07B 2WNVB 2K46A 5FMBA 5FXWA 4BLIA 1RITA 2A5ZA 2DCKA 3NV1A 3D4KA 3ZIWA 3W5NA 1RYYA 2LW8A 2Y33A 4LXLA 2X09A 5CEHA 4BIFA 3H7JA 2D3PA 2EXIA 2DUQA 2JENA 4LLFA 4CP2A 1C8M2 2EXKA 4FCAA 2LUWA 2R073 1AXYA 3UKNA 2P34A 3D82A 4BQ4A 5CADA 1ZZ8A 2IXIA 3NJYA 3WF2A 2RR13 1DGWA 1QGLA 3BCWA 5C33A 1HV1A 4HKLA 4WM8B 2R16A 5FPAA 2ZS6B 1HQWA 1W8OA 3CL1A 4L11A 5G04L 3ZSLA 3HT1A 1YRZA 2ZX3A 3CZUA 1C5IA 4AGGA 4D3WA 2HH9A 1GOHA 1PO23 5I0SA 1OLQA 2IC1A 3O14A 4BK4A 3NAPB 5DZEA 2FQPA 3ZXGA 1MQTA 1WCUA 3H3UA 3IMNA 4AG4A 4D6SA 1OH3A 4HZFA 3VKNA 3V0BB 2VM9A 4D69A 4QDSA 3U14A 4IV1B 4OI4A 3SH4A 4AEMA 4BHPA 2KA3A 1JYWA 1W8FA 4YVWC 2VECA 2Q8CA 2GSYA 3NNGA 3BTZA 1GYKA 4YSFA 2ZA9A 2HWF1 3T08A 1DQ4A 1K5MB 4FP3A 5A32B 4M00A 3C7FA 1KS4A 1WCSA 2FCUA 1Q56A 3CIHA 3AYEA 3LWCA 3MIDA 2G9GA 1R081 5KXEA 1JHJA 1XBFA 2IWGB 4LBQD 5JOZA 1K12A 1IS6A 4AYUA 1RUF3 4J1WA 4M4RA 3SH5A 3NJVA 2GH2A 3VKOA 4AVSA 4MGYE 2YFUA 1PX4A 3WT3A 4JKMA 2XWJB 4YVSB 2WC2A 3LIGA 2WIIB 4LHSA 5ISLA 3ASIA 1HQNA 2G1MA 5FMCA 5A33B 1K3IA 2QCSB 1OUXA 1TME2 2RS13 4MADA 4JHZA 5I91A 1TG7A 3EMRA 5FQ0A 1JZ5A 1GNYA 1COV2 3QBQA 4XF0A 3I3MA 2VU9A 3MFAA 1RUJ3 3NV2A 4AZZA 5JZGB 3GALA 2VBBA 1PHMA 4MV2A 4IEQA 4CCEA 2WN2A 5F1RA 4SLIA 1IS5A 3MUY1 3O0VA 3ZO0B 1UOBA 4Y5SA 3OBTA 1QJU1 5FZCA 4ZU7A 4XJWA 1OBNA 5CKMA 3ENRA 3N9QA 3WNOA 1NY71 1OLMA 4WVVA 4A7YA 3HNYM 1GOFA 4AVTA 1GZTA 4MGQA 5FZHA 5F5IA 1VBD2 2A75A 3NAPC 4QQLA 4AFDA 3VBHA 4RGAA 3HN1A 4P9XA 1I5ZA 5FMDA 5BNPB 2ZGUA 2YC4A 4AF9A 3ZFGA 2W1UA 1OUSA 4N9IA 2ZKLA 4F83A 1AR82 4IV1C 1OT5A 4MX3A 2VBDA 3WQ0A 3WDUA 5BNNB 4NRQA 5FYIA 1I3HA 2VMGA 1XU2A 2WS93 4XACA 4KWKA 2XLGA 4YG0A 1DU3D 1FATA 1XNCA 3A0NA 1MEC3 4Z82A 2EICA 1HLCA 4Z1VA 2CU5A 2V72A 4ZHNA 1K5MC 4FPOB 5DUXA 4XAEA 3AKQA 1QQP2 1GFF2 5A7NA 1LU1A 3OBRA 4FFGA 4NVPA 5E89A 1RUI2 4DXTA 5F3IA 1G9BA 3VD9A 1UIJA 3HD8B 4CTEA 4YVSC 1BVVA 5A3TA 3I7DA 1F15A 4FP2A 1FMD3 2HWC1 2VMCA 3KZ4C 5IWFA 1ZX5A 3AKSA 3FC0A 4JRLA 1UZVA 5DZGA 3AYCA 3LSDA 3JXSA 5GZCA 3IDCB 4N7UA 1SDDB 1UOFA 1D4M1 2E7TA 4QKBA 4AFMA 1C4RA 2ZMKA 4YNIA 3LE0A 2A6ZA 4BQXA 5A3LA 4GZ9A 3V56A 1VIWB 4XDQA 2NQYA 5A7QA 4AEJA 2VMIA 5FUPA 2QQVA 3AMNA 1O4TA 1RMU2 1A8MA 4Z92B 3UGFA 1SPPB 4Q4Y3 3W5MA 2WQ4A 3VKFC 1C8M3 1FPN3 4R52A 5T52A 3RZZA 3MF9A 4WBBA 1JOPA 2CNAA 4QX8A 1BKZA 4ITCA 3J7NA 3MGUA 2VR4A 5FZOB 1RUNA 5GLTA 1JZ3A 1F9KA 1ZBE2 2B46X 3KD4A 4Q4W3 4XDPA 5BNPC 3H8OA 2OQ6A 1HRV3 2YY1A 4XFAA 1KEXA 1NLRA 1CAUA 3HWJA 4UFKA 3JQWA 3BGAA 5TSWA 3WG3A 1H6YA 3H3LA 5BNNC 4C8DA 4A42A 5CB7A 2RMU3 3AP7A 3DEMA 3N9OA 1AF9A 5FO8B 1ZBA1 5JXGA 4CDXA 3VV1A 3WINE 4O9EA 3URFA 1TMF1 1BEV1 5CNAA 4QQPA 4W4ZA 4P5YA 3HR9A 2X5IB 4AQSA 5JXJA 2NM1A 3M4FA 1WA6X 5FPBA 2J7MA 1UMHA 3B00A 1PX3A 3U4SA 3WW2A 5LEKA 2BVVA 1GNHA 1JN2P 2B7YA 1X82A 4R4XA 2C24A 5FMOL 3SCFA 3FN9A 4IEUA 4XEZA 3PMEA 4KGQA 3UGHA 3C7EA 4ARXA 1G7YA 1LNSA 1OI6A 2EXJA 4N8MA 5FYMA 3O1MA 4LA2A 2J22A 3O1RA 2WDBA 1S0BA 1BK0A 1OF4A 4AE2A 2WNEA 1IS4A 4XQ4A 2C4XA 4CDQB 2BRTA 3FL7A 3RZMA 1Q5OA 1DQ6A 2PLV3 2VQAA 1VBE2 3QH7A 3MUZ1 2ZGKA 4MYEA 4DEVA 1O5UA 1HRI2 3AM2A 4MO3M 4RR3A 1W8NA 3WZ1A 3DGTA 3N7MA 1JOJA 4PLOA 4NIGA 3WNNA 2ZX4A 3WG4A 1ZM1A 1APNA 3I2DA 1WUVA 1S2BA 3NNMA 4CU9A 1COV3 4TXWA 1L7QA 1VB2A 2BV4A 3ZYFA 2ZHLA 3JQXA 3GCWA 4NO4A 2DCTA 1WA4A 5FV3A 2I2SA 3KCCA 3ZN6B 3IDEA 4O9GA 3VBFC 1O91A 3MPPG 2D6KA 4GQ7A 4FXKB 3DECA 5KHJA 2UWBA 4A2UA 4XAAA 1DZRA 1UZZA 4QGNA 1GOGA 4GB31 1DDLA 5FLJA 2AGSA 2BDRA 1IQDC 3BIWE 5JR2A 4UAPA 5J96B 3O1UA 3J8F1 3S7EA 4PDWB 3KMHA 2QFEA 4GKYA 2GNMA 4BK5A 4NPMA 4QPWA 2QDRA 1OD5A 4ZZ5A 1NXD1 4CUAA 1PK6B 3CF6E 1LU2A 2RJLA 1PVC1 3K75B 5D2AA 4XJ8A 5CIRA 3WNLA 5FREA 4JVAA 2GMEA 4KNCA 2XKOA 2DVDA 1C3HA 3KT7A 4O65A 1OLRA 4JHTA 3ZMNA 3SKJE 4W6WA 1JS9A 1XYPA 1JH5A 3ZSMA 1H8TA 5CFDA 1ND3B 1REEA 2Y6GA 5KHHA 1DIWA 5HBAA 5IATA 1MZ6A 4QKFA 4AXOA 4RS5A 4R9BA 4S2FA 1ND2B 3I2HA 4L8QA 5FYZA 2WLPA 1UOJA 3B94A 3GGLA 3KV5A 4XMIA 2Y64A 3IT8A 3WNKA 1GUIA 3V0AB 1RUC1 5CFCA 4CDQC 1LOCA 1UPSA 2RS32 3RFRA 1EV12 4AHYA 5J3UA 1CAWA 4HKWA 3BU7A 3A7QA 5DUUA 1MR5A 1DHKB 3C2UA 1CR7A 3VLBB 1IKQA 4LHKA 2Q30A 3LFMA 1UZYA 2VNRA 1UOGA 4JGYB 1VBC1 3M3IA 4XW3A 5J48A 1JZ6A 4Z2AA 4TYSA 3ACHA 3ZN5A 3K3NA 5IFPA 1QHDA 3SNMA 1MZFA 1SEFA 3PUSA 4AVVA 4H55A 3ROUA 1QJY2 2FMDA 5FY7A 1RMU3 4CVUA 1AXZA 4LKFA 2EAKA 2IZWA 2GH8A 4AWDA 5AFEA 2ZHMA 5FK7A 4YM0A 4BB3A 4PDWC 4PI0A 2DVAA 2D98A 2MHFA 1KQRA 4HOOA 1W8WA 3USSA 3WNMA 1MS9A 1L3JA 1ZBE3 1LEMA 5A7SA 4C91A 2BWCA 3SCHA 2ZX2A 4E4ZA 5JAXA 3Q8EA 4PIXA 3ACFA 1HB3A 4IEOA 4LBQB 1QF3A 5F8PA 3WHUA 5I0TA 4Q4V3 1N3QA 2GC3A 3H0OA 2YBPA 4XCBA 4YW5A 5A1AA 2B4KA 3MICA 4EN9B 1WBFA 4LLOA 4FSJA 4DXSA 1ND3C 4M0HA 2WZR1 3RSJA 4C90A 5FYUA 1J59A 2VCAA 4XUOA 1IKPA 2VE1A 3D6EA 1LJ7A 4MGTA 4GIQA 2BNNA 1XSQA 3MF6A 5JUVA 5LK7B 4XABA 1LTEA 4KQ7A 1ULFA 4IGQA 3RWNA 4D7YA 3TEWA 3EYPA 1AR63 4OYUA 2Y0OA 3VZNA 1KITA 4CP9B 2YGLA 1LHWA 1Q8SA 1H4GA 1LOFC 2DU0A 4Q1RA 1LEDA 1ZZ6A 4O7XA 1US2A 4BIOA 3WDXA 2W52A 2ARCA 4YPJA 4KU8A 3PTYA 2Y6LA 4OCTA 5FZ1A 5IYYA 5DDJ1 3GJAA 1FOD2 3Q9OA 2BW8A 2JXAA 3IKWA 4C0HA 3M1HA 3WXPA 1RHI1 4JGYC 4QX0A 1OOPA 3KVBA 1F5FA 4RD7A 5L19A 1HRI3 3KGLA 3USUB 3WP4A 3JBG1 5JMOA 1AX1A 1CAXB 1QOOA 2A6VA 5A3UA 2GP5A 3ZSKA 5JSPA 1YLLA 3OBAA 3VZOA 2VTXA 4LUMA 2XWBB 2GAUA 1FXZA 2UWAA 1RC6A 4DUVA 3VGIA 2RHPA 4BQWA 1W9FA 4PBPA 2VCBA 3VHNA 3BN6A 1M4WA 2XVGA 2VNGA 4RHV1 1VBB1 5ABJB 3TNQA 1RB8G 4ES9A 1H2LA 2DTYA 3ZXFA 2D6LX 1PO13 1XNTA 2FZ1A 3WX5A 4QB2A 3WDVA 5IAXA 1VBA3 5FZ6A 1GZWA 4Y20B 3GZEA 4OULA 5C9AB 3J7MA 1CJPA 3P1IA 5AFBA 5LY1A 1SBEA 4D0QA 5EYYA 3SEEA 3OY8B 2YROA 2EIGA 5FO9B 5D8AB 3H8XA 1PZ9A 4UFJA 5EJ1B 2DU1A 4Y33A 1UPIA 1VAMA 1O4YA 1R1A3 2X29A 3OUIA 2ZGRA 2TNFA 3VDAA 3LEKA 3VKMA 4AQ2A 5L36A 1YFYA 4OHZA 1H30A 4RQPC 4AI0A 4K9SA 5IVBA 2WSVA 1S0IA 4K21A 3ZN4A 5IAVA 3OEBA 5F5CA 2E33A 5F6KA 2E31A 2R071 4A44A 4K20A 1QMJA 5SV5A 4Y1UA 2Q8OA 1S0EA 2GP3A 1YUDA 2RR11 1HXS2 1VE0A 3DKWA 1JUHA 4FPGA 3WF4A 2W0XA 2W1QA 3SEPA 3VBUB 1VJ2A 4LEJA 2YV8A 5I0DA 3O12A 3OGRA 1BXHA 2RS33 4KG8A 5FY9A 2JDPA 3MIBA 3RYRA 1RVF2 1Y4WA 3HBKA 1XNAA 4A3ZA 2BQPA 4XZUG 4DUXA 2PN5A 2VZQA 1ZREA 5IVYA 1PO21 2ARBA 1YYNA 2W3JA 2D97A 1RUH2 2XHNA 3R4UA 5FWEA 3OOXA 4NIAA 5CYYA 3EHKA 5J7MA 1Q8VA 2ZEWA 2HWD3 2D43A 4YZ3A 4AVCA 1XNKA 3T2TA 3H3ZA 4CP1A 2AREA 5EFUA 3E5XA 5FZEA 2BBAA 1EPWA 2KM2A 4B1LA 1QJY3 2P6HA 2PHWA 3ZXEA 1P8JA 1SBFA 3FJSA 4CDWB 3TN92 4QQ2A 1YXWA 2GC0A 5JR7B 1NAEA 2YB7A 2E9QA 1W8ZA 3OD0A 3ZXLA 3MO4A 5FP3A 1WLTA 4Y22B 4XHXA 5L9VA 2MPFA 1UO9A 2VZVA 5CAZA 4QX1A 5FZLA 2LROA 2ZMLA 3AKRA 5FP8A 5C9AC 2O0OA 3VB9A 1ZRIA 2AEYA 2XJSA 3EQEA 3VL8A 4CP0A 5KXBA 1AYM2 2XL9A 5DG2A 5LBEA 4EE2A 1LENA 1RUF1 4PF1A 2G4IA 3GZTB 5T5PA 5D8AC 2CAUA 2DBNA 3VBSA 3N4MA 2WFF1 2CDPA 3EO6A 1WBLA 1OQDA 1KS5A 5LA9A 2Y60A 4EWAA 1W9SA 4LPLA 5AC93 4XDOA 2RS11 1OKQA 2VH9A 5A7WB 5LRRA 2HEYF 2O14A 3OUJA 2QQJA 5FYHA 4YW4A 4CDUB 4LO8A 2RDNA 4JKLA 1NE4A 3B69A 4XTMA 5FP7A 1RUJ1 4UF0B 3S6PA 1ASJ2 3BYWA 1RUOA 1WMDA 2VCMA 1FNYA 3RMXA 2RS52 1JTZX 1IZ3A 3N3HA 1Z7S2 2A6WA 2GMMA 2VMDA 2FDKA 1VRH2 3NJXA 4YFWA 1W8TA 1XU1A 3E1F1 2B42B 1IPKA 4CCKA 1YWKA 1JYIA 4DNYA 1MS3A 1FOD3 2DFBA 3OTFA 1DGWX 1ZA7A 5FZ3A 1AHSA 1J84A 1LOEA 4OMDA 2EA7A 1SLBA 1GQGA 2B45X 4OZXA 1MVQA 2UY8A 3UYJA 3RRDA 5A3WA 4D8MA 5F7UA 1GSLA 2O8QA 4IEWA 2PQQA 2RJKA 4DXRA 2PHRA 4QPGB 5FZAA 4JTOA 1U5XA 4P9LA 1HJFA 1HX6A 5LBFA 3VHRA 1MZEA 1NKGA 4M01A 3OYWA 5LY2A 3HN3A 2WS91 4P14A 3VN4A 4CDWC 5GLWA 5GKAC 2D7FA 1MEC1 1PZ8A 2FDHA 5IVVA 1BLZA 2XOMA 3CMGA 4KWUA 1ZZ9A 2P3KA 1UY4A 2YC2A 4CPBA 4I3GA 4R4ZA 3PL0A 3MW2A 5FYCA 2XLFA 5KHKA 4A3XA 4OI2A 5FBJA 1YQ2A 3KVAA 4CEYA 2P6CA 3BIEA 2J42A 4QM9A 4HPKB 3ZR5A 3VDBA 1W28A 1WGPA 4YZ5A 2R49A 5FYBA 3TEXA 5KHIA 2P3YA 5FOJB 1NT0A 1S0JA 4YFZA 2UYAA 3AMHA 1FMD1 4Y26A 2OW4A 2GNTA 2QTWB 4XE9A 2XDVA 3BI3A 4CDUC 3IN9A 1POQA 2JKBA 4ZXKA 2PAMA 5LB6A 3R6SA 3M3EA 3U78A 2GC1A 3WW4A 3PVBB 2ZPXA 1W6MB 4Y4RA 1AR92 5BNOB 1AL22 1W3XA 2V4VA 1HV0A 1SFPA 4MHUA 3C7HA 1XNDA 2NN8A 3UV9A 3B93A 3AZXA 2WNVA 4Q4Y1 4QWNA 4MGZE 1W90A 1C8M1 3JZVA 4P9IA 1FPN1 4PT6A 3T1LA 3VBOB 1NCQB 3ES4A 1VALA 3RYKA 4L97A 1PMHX 5LZ6A 5EP9A 1VAKA 2G19A 3GXUA 1JI6A 4BU2A 2J1SA 3AMQA 4QGMA 3N35A 3N9NA 5AVPA 4UXAA 3MFCA 1RVF3 3OB8A 4QPGC 3ZLIA 2AH2A 4YW2A 5FZDA 5BNQA 4IL7A 4NRPA 2XHKA 3W58A 1RUE3 2EAAA 4Q0VA 4WM8A 3ZSEA 2RMU1 4EN7B 1DZTA 2VD7A 3T0BA 4PBOA 4GALA 4GH4B 4CUBA 4IESA 1PGL2 2LS6A 2ZX1A 1HB1A 3PUQA 2VG9A 1AX0A 1YC61 2IFWA 1W05A 2VQUA 3N9PA 4IEVA 1YQ5A 5DN2A 4YVWB 1U5YA 1ZVFA 2ZGTA 3ETPA 2OA2A 3NAPA 5C5TA 3RMYA 2IXKA 4KWJA 5B2GB 2UURA 4HFSA 4AHZA 4Y1ZA 3OF1A 2WYFA 2VZUA 2H6CA 3V0BA 1J58A 2WUHA 2NLRA 1LULA 2JICA 3HOBA 2G9FA 3MI8A 3Q8BA 4OI1A 1DLCA 2ZZQA 1TVGA 5FK8A 1URXA 4WV8A 1LHVA 1XE7A 4A41A 3S57A 2NZ9A 3LDKA 2ZCWA 3SISA 5JCTA 3WD5A 4AI8A 1LODA 1AYM3 1ZNPA 2GDFA 2WAAA 2VNOA 1W9WA 1VR3A 2YPJA 3PHMA 4NRMA 5L73A 1K5MA 2VGDA 4MVTA 5DPNA 5A32A 1CN1A 3U10A 4CA9A 1ENSA 3LSEA 2PLV1 4HG6B 4RL7A 3T2PA 5C71A 5F3GA 1WZXA 4ONUA 4FT8A 1C57A 4LA3A 2WWSA 4NIHA 5BNOC 2JJ6A 2CAVA 5HI0A 4RA0A 3KHCA 2BEOA 1ZRRA 1KDMA 4YZ1A 3U0ZA 1COV1 3VBOC 1PMIA 2YZ4A 1UW8A 1QDOA 2CTVA 4PIYA 1NCQC 4YZ4A 3K4AA 3ZFFA 5I8YA 5I8TA 5CG8A 3E6BA 5A33A 1GU3A 1W6PB 4RGKA 2R062 4QX5A 3OGJA 2XKPA 3E6DA 1UXXX 2W94A 4LIUA 1S2KA 2JWPA 4N53B 4UFMA 3HIFA 5LA2A 4Q5OA 2E53A 5FKBA 1W8HA 5JZGA 1GWMA 1UY0A 1MS4A 1QH6A 4LE3A 4J6GA 4JGZA 1VBD1 1W6QB 3QD6A 4HXCA 4LOTA 4L9BA 2XG3A 4W65A 3I2KA 5H9PA 4N43B 1O59A 2WT1A 4GH4C 5JOWA 1SLLA 5LBCA 2JDAA 4J1XA 5GLZA 1V6JA 5HCFA 2ZJCA 4BQYA 4XFHA 3RQ0A 1AR81 1NQJA 3TBDA 4DO0A 3VD7A 4NWVA 5IT6A 1ENRA 3PVNA 1ULDA 1GP5A 4DMIA 4WVZA 4FOVA 1FV3A 3LGRA 2BTVC 1X9TA 2VVDA 4XHBA 3AZVA 3FBMA 3PUHA 5FZBA 5GZFA 2JIGA 5C8CC 3ZFEC 1KRIA 1J3RA 3VL9A 4QMAA 4JX0A 2JG9B 1YQ8A 3T2OA 2HWB2 2ZGNA 4MUVA 1B35A 5FY4A 2RVAA 2OIIA 1EAH2 4DY3A 1W9YA 1OC1A 4OMCA 2WFF3 5FJKA 5FYTA 1W99A 4Q0QA 2JD9A 4NHMA 1DFQA 2W47A 5E16A 2WO7A 2ZGOA 1ST8A 4META 2F4PA 4CCOA 4AEDA 3KLSA 3JU9A 5FP9A 3UKTA 1FNZA 5FZ4A 5L7OA 1V6IA 4AFAA 4EN8B 2YFZA 2GN3A 2WT0A 3MEPA 1H9WA 2VNVA 4YW1A 1JZ2A 4FAHA 2BOJA 4FQ4A 4JTNA 1X36A 5D1IA 1Y9QA 3ELNA 5H9QA 2Z42A 1G9CA 1AR93 1JZ8A 1AL23 4N53C 1RMU1 1SLTA 2PTMA 5F3EA 3ZYJB 5IK7A 2Y6JA 1Q8QA 1G9AA 2R6QA 1NA1A 5FY8A 3WG1A 1UWWA 2J1RA 4DINB 3X29B 5DXDA 4P08A 3WOGA 4AOCA 1UX6A 3ZMOA 1ZBE1 2JE8A 2Q5TA 1JYCA 3ON7A 4N43C 3RPQA 2VVEA 3AKTA 3LEIA 3WCSA 1IS3A 4XFBA 1QJX2 1UIKA 4AI2A 1T6GC 3KQRA 4GMP0 4Q4V1 4LR4A 5A7OA 3M7AA 1ULGA 3SCGA 2VW2A 5FZOA 1JBCA 1W03A 4QU2A 5HCHA 4UWDA 1CJDA 1KXGA 2BGCA 1N47A 1DYPA 3H7YA 1IG0A 3T4VA 2XGXA 1R092 2W08A 5HV0A 5F39A 3ILRA 4WM7A 1QKQA 2BFUS 4XJZA 3LDRA 4N9HA 4OZOA 5I93A 4JDMA 1VPHA 2JG9C 5FTTC 4ZZ8A 2P4EA 1ENXA 3GF6A 3RZGA 3A22A 4OVEA 4UW6A 5E8AA 3RZHA 2DYCA 1AR61 2PHDA 2V5YA 5DUVA 5BXXA 3AZZA 3WQ7A 1AR72 4E4HA 3F95A 1Q8OA 3R05A 5EYXA 4MLOA 1O8SA 2CHHA 3TNPB 5F6LB 2X5IA 2WINB 1PZ7A 3DPRC 4DRRA 2HWF2 3KB5A 2EXHA 4XUNA 2AC1A 3VDCA 2C6SA 1XOYA 1C8NA 4CU7A 4URAA 5LCWL 1LOAA 2P3IA 4B29A 3FLRA 4IEYA 1CVNA 1WLCA 4NMIA 3I4IA 3ZYBA 1HIXA 4IQPA 5FQ0B 2IVJA 4AHXA 1UU4A 2WZ8A 3ZSJA 3WP5A 2EIEA 1NX9A 3K77A 5EJZB 5C8WA 2H0BA 1HRI1 4XC9A 3SMHA 3OJBA 1O5LA 2BNOA 5K9YA 3OEAA 4EZ4A 3U07A 4X8PA 4M3CA 4YW6A 4QT6A 3N36A 3BKZA 4YG3A 3VBFB 1V0AA 1FX5A 3AL6A 4TZDA 3ILNA 3O1SA 2R063 5FZGA 4GMP3 5A6XA 5A3PA 3AJYA 3I2JA 3PIGA 2XR4A 3AP4A 2QQKA 4GWNA 2TEPA 1ONAA 5JSOA 4XF4A 3FHIB 5FWJA 5JI9A 3O1OA 3VBHB 1QXRA 1UYYA 1LKNA 1QJU2 2FDFA 1PO11 3P5BA 3ZFGB 1RL3A 2WLQA 1GKBA 1VBA1 1LR5A 2KXLA 2VW1A 4UYBA 3T4HB 3THPA 4QKDA 4H7LA 4XJ9A 4EZHA 1HDKA 2JDHA 3IBMA 3VUOA 3KF5A 2WWUA 5FZFA 4I0AA 5FZ0A 4JKKA 4K1ZA 3LIHA 4GJYA 3HJRA 2YUEA 2X05A 4Q0PA 1Y9GA 5EPAA 2SBAA 4E4DX 2ZEYA 3PTRB 4P9WA 1NCRB 4COUA 1S55A 4XOGA 1JYTA 2B5HA 2D6PA 3H1YA 1R1A1 5BPXA 4HMZA 4XVHA 4E4SA 1PK6A 1YJKA 4Y1XA 4TLFA 4Y5TA 1UAIA 4RFRB 2Y6HA 4GWIA 5LATA 5IK5A 4MGKE 1UYXA 2HWB3 1OQ1A 4B7KA 1WLDA 1D0HA 4DZGA 1BYHA 1EAH3 1WW6A 1NYWA 3KCYA 3WLUA 4C1WA 1ND3A 4OI0A 4XURA 4HETA 3I2FA 5J36A 2WO1A 2RS31 3AMMA 1K42A 1TME3 2I74A 2W95A 2D6MA 1BBT2 1MACA 4M3CF 3K46A 2ZGLA 1ND2A 5K8SA 1PGW1 4IGOA 1CX4A 4LHLA 1U12A 3VDDA 2F4LA 1HJGA 4PF5A 1OVSA 3BODA 2E7AA 3ECQA 2HWD1 3ILFA 3KF3A 3PUIA 4QU1A 4QHOA 3SITA 4LHNA 4E8CA 5LW9A 1SDWA 2A3XA 4ASLA 4CE8A 1CGPA 3CDZB 4IV3A 4K6BA 1QJY1 1AZDA 1XC6A 3L9JT 3WNXA 4A7KA 3INAA 2CYFA 2HWE2 2Z2SB 1WKYA 1SACA 2RDSA 4QXBA 3VBHC 2ATFA 2CWMA 2P37A 1VBD3 2PAKA 3Q8AA 3ZFGC 4AVBA 4DY5A 3E6CC 1OURA 1J83A 1WW5A 3LB9A 4A45A 3ZPOA 1LHNA 1EPZA 4FPJA 5EIYB 2FCVA 2HYKA 3HQUA 1DQ5A 2QDNA 1ACCA 1AR83 4OHXA 5M0TA 3I49A 5FYYA 1QJX3 1T2XA 3AB0A 3BVCA 4AHWA 4DIQA 2VTFA 1OQEA 3PLQA 5F2SA 1NCRC 3FWEA 2E7QA 2A3YA 3PIJA 4CCMA 1XB9A 3DXTA 2VCCA 1AYN2 1C28A 3IM0A 5DMYA 4DUWA 4PLNA 3FLPA 1R093 3POYA 4K3UA 4QXKA 3SH3A 3CKHA 2R7EB 1QQP3 3JB4C 4LBQA 1GICA 2JG8A 3POSA 1TMF2 1BEV2 3H1WA 1RUI3 1RJ8A 4D6RA 5FZ9A 1JW6A 2CDOA 2KR2A 2XVLA 1AR73 3FHAA 4QB6A 4OQ9A 3WCRA 4F7ZA 5JI7A 1UL9A 3ZVXA 2ZXQA 3U4XA 2HLEA 1TNRA 4XQDA 3I8TA 1OVPA 2CGPA 1ODMA 1NXMA 5I0UA 4NPRA 2QJVA 2VOKA 1FOD1 5T54A 2ZZJA 4ZU5A 3GYDA 3K3OA 3I59A 1A34A 2GN7A 4FI9A 4QAWA 1LAJA 3N9LA 1UU6A 2FDJA 2BVBA 2F6BA 2BFUL 5G05L 2FHRA 3VHPA 3F2ZA 2Q8EA 2WNUA 3HAGA 3HPNA 5APAA 3ALQA 4AL9A 2VZTA 2BERA 2GALA 3NKGA 3ORJA 2QKDA 5H9RA 1W6OA 2PFWA 3NKTA 2YBKA 4FQZA 1QIQA 5DAXA 4COZA 3MIGA 2BBVA 2ENRA 2O1QA 3AP5A 3R4SA 1W2TA 2RDQA 1D2QA 1LRHA 3T30A 4C1XA 5DABA 2IVIB 5FPLA 2E6VA 2GMPA 4GB32 3A0KA 2VUAA 5GLUA 4CDXC 2X8KA 5IVJA 2XJVA 1RINA 4LMFA 1ALYA 2XQXA 3BPSA 1N1YA 4XUTA 5JMCA 3O0WA 4PI2A 2QQNA 1RUG2 4QD2A 4ZPIA 3B5LB 5ABJA 3SC7X 1FYUA 5I8SA 1UMZA 2VY0A 1X8MA 3EBRA 2JKXA 1H8TB 2VOWA 3AMPA 2Q8DA 2K0GA 1NOVA 2OUJA 1BK1A 4CU6A 4HK9A 1XYOA 3DV8A 1AVBA 1QJZA 5FXVA 2D3SA 3ACLA 4RQPB 2ZX0A 2EALA 3WDYA 4LKSA 2DFCA 5CFCB 3IPVA 3WW1A 3WQBA 4HANA 1TZOA 5JXIA 3ES1A 3CJIA 4V2VA 1YI7A 4IW3A 5F5AA 3K51A 4TWTA 2VOXA 2OZJA 1AJKA 4FXGB 2NP0A 1HN1A 5DZFA 1VBE3 3I2IA 3L2YA 5ACA2 3MZHA 3FX3A 1HN0A 5DAWA 3I97A 2XB6C 5DQ0A 3AYDA 1GZCA 5IK8A 1BBT3 1RVF1 4JAAA 1QEXA 4Y3OA 5E1RA 2VVFA 1DQ1A 5A3NA 4Y24A 4XILA 1RUE1 1X8EA 1MZ5A 1SCRA 2VOTA 3VBUA 4FTEA 1RUD2 4PCRA 2QZ2A 1W6NA 3A23A 1J1TA 2RM22 1XJAA 4CEWB 1VBC2 1LOGA 5FY1A 5C3OA 2VL4A 2VPVA 4DXZA 3IIAA 5AC91 2ZOEB 4LBKA 2P2KA 2FCTA 4Q8KA 4V1PA 4K7JA 4HONA 4QQOA 4BMEA 1BMV1 4WVMA 4S2HA 3WF1A 2HWE3 2E26A 4QGLA 4Z2WA 4ES8A 1OFSA 3B7MA 4IETA 4URTA 5J1XA 1VMFA 2Z69A 4HVQA 2DVFA 2UU8A 3WNPA 4DB5A 3ZXJA 1YCIA 1U5ZA 2RE9A 5J98B 4CDWA 5GZDA 4FFHA 4ATFA 1PVXA 1AL0G 4FPCA 1LGBA 1AYM1 3ZXAC 1PM7A 2YMZA 4ZXEA 1H8TC 5CFDC 4Y22A 1OH4A 3TEYA 3ME2A 2HEVF 1UY2A 4G3YC 5FDBA 3IAPA 1AYN3 1U0AA 2IXCA 3OPWA 3OGVA 4CYDA 3DL3A 1H2MA 3P3PA 5FZMA 4IE7A 1JYXA 4W50A 5FR3A 1WD3A 4LO5B 2VAUA 2XBO2 4A4AA 3AFKA 2A3WA 5CFCC 2R042 4UW5A 1EUTA 1STMA 1ASJ1 5LRSA 3VZMA 4X6RB 2GU9A 3ZYIB 3OG2A 5B4XA 1Z78A 2W39A 5C4WB 4FPKA 2MNGA 2R0FA 4AW7A 1JZ7A 3MW3A 1EV13 1TE1B 2VC9A 3JD72 4XUPA 2ZACA 1VRH1 1OOPB 4ZU4A 3TB0A 4BM8A 5C3QA 4HKOA 3PVEA 2YPDA 5LA1A 1J1LA 3OGSA 3RI9A 3LDBA 1UZ0A 5DDJ2 4ISRA 4H14A 4K40A 2DTWA 2HKXA 3KGZA 1RHI2 2ARAA 2JDMA 1DQ2A 5FUNA 4CEWC 1ZRDA 1Y3TA 4PQ9A 2PMWB 3EB7A 5IFTA 4O61A 2W46A 1UX7A 1LGCA 2QQOA 3HMYA 2C9AA 2BNMA 3O1VA 4RFT0 4B4PA 1WW4A 2F17A 3AVRA 4QPIA 2XJRA 4ZS3A 3K2OA 3LQCA 3IB3A 4LBJA 3ZXKA 4EWEA 4XIKA 1V6MA 4ATEA 1LECA 1WWYA 3KCXA 3AK0A 1RJ7A 2EF6A 1UNBA 1GZWB 4C0BA 1DGLA 3C3VA 2PYTA 3B01A 5SV8A 4A6OA 1F2NA 1KDKA 3CEWA 5KC5A 2VULA 3AC0A 3ZR6A 4CCDA 1V6KA 4IEPA 4MGIE 1S0DA 1T6BX 1RUG3 4XF3A 2ZMNA 2DUOA 5FLIA 3O1PA 3N7KA 2VZOA 3ZPYA 3U1XA 3OPTA 2A73B 4Y1YA 1OLME 4HPKA 4I30A 3E5QA 4R9AA 3CJXA 1OA4A 2X53S 4GXLA 3OSDA 3A21A 4HVRA 1V9U2 4W8JA 4KBZA 5C4WC 3THTA 1AR91 4CUGA 2YG0A 4L99A 1AL21 4BWOA 1NE6A 4NAOA 2PAEA 2DWRA 1OOPC 1DYOA 3NNJA 4B3NA 2YU2A 3LA7A 2J1VA 3FE5A 1ENQA 2JEMA 5FLHA 5C3RA 1W6MA 2YU1A 2R072 5CKQA 5BNOA 3JB8A 3KV4A 2Z5WA 2DBIA 4KWLA 3AZYA 5ACA3 3MHZA 5A6ZA 2J1UA 3O5SA 3VBOA 1NCQA 4YGCA 3T0DA 3VBRB 3MPBA 3R0RA 4BQ5A 5C3SA 3GZAA 5FZ7A 2HBUA 1H2NA 1RUD3 1CAVB 1PO22 3M8LA 3FFQA 3RZKA 1F4HA 2PHFA 2VZ3A 1KD7A 2RM23 2W92A 3GNEA 4KH9A 2V5DA 4NE9A 2OYZA 2PHLA 1MS0A 2ARXA 1GANA 3NV3A 2VUCA 4UBHA 1PNFA 2DURA 1K5JA 1C1FA 3KM5A 4FOWA 1X7NA 3LPFA 4LULA 4AQTA 4XCAA 2ID4A 5A1FA 4W6XA 2CY6A 2A71A 1N1VA 1S1AA 4LKDA 2QZ3A 2V73A 3AP6A 2VOVA 1H0BA 2VUDA 1HB4A 1N3OA 5FJHA 2TBVA 3S30A 3GZUC 1CPMA 1CZVA 3H9AA 5J09A 2OS2A 2OT7A 3M3OA 4YVWA 4B7EA 3NSTA 4XF1A 3DYMA 4LOSA 4NOTA 3IMMA 2DCZA 3O0XA 2DV9A 1YFXA 3AX4A 3ZFEB 5C5UA 1UCXA 4BQ1A 1WMEA 4H2AA 3ZYPA 4M3CE 5T5JA 1KJRA 5HXMA 1JOBA 1VLNA 2ZAAA 3K48A 1RUF2 5IJRA 1LESA 4BLJA 4E9KA 1L7LA 3DYOA 5GLVA 1SQ4A 2ZGQA 1E5RA 2XVKA 2WBKA 2JE9A 2YBSA 2XLAA 4XJAA 1ULCA 3GJBA 1QJFA 3ZKYA 2DCYA 2XBO3 5BYNA 2R043 4YWAA 4BYYA 2JDKA 1HXS3 3POGA 2BUKA 5BY5A 2R061 2DUPA 1RUJ2 4GMP1 4LJHA 1XSRA 2R32A 5A3OA 2Y8KA 1PMJX 1FT9A 3HQXA 2XUMA 1W2OA 4UFIA 4K8RB 4OQ8A 3T2QA 2W91A 5C3PA 5KBFA 5EWSA 4Q4X2 4HN1A 1RUH3 3VBRC 4AAXA 1W6PA 2O8OA 4X6QB 3ZYRA 1LHUA 3P6BA 3LCPA 1O8PA 4UT5A 2Q0AA 1W0NA 2XXZA 2Z4FA 4FO9A 5A80A 1VP6A 4MG2A 4GWJA 3U37A 5A6YA 5JXHA 1TQ5A 1UXZA 2B39A 2ZGSA 4LIVA 1BQPA 4LBNA 5JLVA 5JOYA 1F8VA 1XNBA 1UMIA 3KV9A 3J4UH 3KWVA 1DLLA 3WY6A 3QACA 4AI3A 3TN93 2XJQA 1W6QA 5C8CB 5CA6A 2JD4A 4MXWB 3OUHA 2YYOA 2WO3A 1Q3EA 1W06A 2EVXA 2VXRA 4YGBA 4IV1A 5JDBA 1UF2C 2JDZA 4FVVA 1BZWA 4COWA 1MEC2 4TN7A 4P9GA 5F9TA 1GWLA 2WYSA 3D5OA 3RNSA 5F37A 2BPA2 2HWB1 3BPZA 2JIJA 2Y38A 2ZEZA 4XMAA 5T3NA 1IG3A 4QHBA 1EAH1 3M2MA 1LHOA 5IVCA 4JDNA 4PLMA 4XTPA 4TTGA 1IOAA 2BJSA 2WL1A 2ORXA 1BJQA 3GDBA 1YFWA 2VZRA 5L9BA 5LBBA 2D3RA 2PELA 4NJ4A 1TME1 5L9RA 3U75A 2XONA 1DF0A 4FPEA 3O1TA 2HEWF 2GNBA 1W04A 4FAGA 3ATGA 3GM8A 4AR2A 4EQVA 1CIYA 3T3YA 3WHTA 4YVSA 5T50A 1JHNA 5FXXA 1ASJ3 3LKJA 2NPIA 2AENA 2DVBA 5EXOA 3FHQA 2QE3A 5KC6A 2IXJA 3V65A 2RS53 1GR3A 3G7DA 5JWPA 1POV1 3MYXA 1UY3A 1Z7S3 3I3EA 5A70A 4N90A 4GA9A 1VRH3 2P3JA 3C7GA 4IERA 3APBA 3IWZA 3PDQA 3UJQA 1SCSA 4DPNA 4CCNA 4R9DA 1MVEA 4Q4Y2 1F4AA 1FPN2 4ASMB 3B02A 2B9VA 2W87A 4HVOA 4MSVA 4XETA 4YM3A 1YEWA 4B8EA 5D21A 5FMOS 4ZY9A 1QJX1 2ZTNA 2W1WA 2A6YA 2IXLA 4Q4W2 2MEV2 1HRV2 3J7LA 5K0UB 5A7PA 1SLCA 3PU8A 4UFLA 4L0PA 5BNPA 1SMVA 4IXLA 4CCCA 4FPLA 4I0BA 3SKVA 4NIDA 4LBOA 4BDVB 1R091 2ZGMA 1VAVA 3P3NA 4AI9A 2RMU2 1QQP1 2ET7A 3DN7A 3MV11 3ZXDA 1TNFA 2HYXA 4CEYC 5BNNA 1JODA 1PIV2 2WFPA 1NQDA 1ZZCA 4FFIA 4MGSA 3H8RA 4AFCA 3GCXA 3K4ZA 3RDIA 1HW5A 1RUI1 4KU7A 1REDA 3Q8CA 1GBGA 2V4AA 3UESA 2AUYA 4GULA 1AR71 2L9LA 3N7JA 3H42B 2WZPP 3DPRB 5FPUA 1OF3A 1G8WA 4CXXA 1YQCA 1YHFA 1KGYA 2Y6FA 3AJZA 3CQOA 3DYPA 4HSLA 5FUIA 2AR6A 3NL1A 3V64A 1SZBA 1EP0A 5LASA 5A3MA 3NNFA 1GV9A 2P17A 2QQMA 3LZZA 1ZZ7A 5FPZA 2BU9A 1D7PM 3TWIA 2ZGPA 3QLQA 2D6NA 1QJEA 1YFUA 3BTAA 3J26N 3BB6A 2D5HA 3DF0A 2WNVC 4YYOA 4D6QA 2PLV2 3MIFA 2W9XA 1OKOA 3QH6A 3ZFFB 1V6NA 3ZM8A 5E6HA 4CU8A 3POIA 2XJTA 5GJ6A 2DCJA 3OCPA 1O3RA 5CG9A 3KSCA 4GJZA 2UY9A 3RJ2X 1SPPA 4CSWA 1IQAA 1MQTB 2PA7A 4JGZB 4WM8C 1QNWA 4Q0SA 2JE7A 1UQXA 4BZ4A 4GAZA 1Q8PA 3OBZA 2WZEA 4Q4X3 4QXHA 3VBFA 2Y26A 3B9IA 4QM8A 1HB2A 4QXCA 2BZDA 4XIOA 5EQUA 4GWMA 3UK9A 1S0CA 3PU3A 1W9TA 5GZGA 3E97A 1YNAA 3HBZA 4M0NA 4PQQA 3KHBA 4U2AA 1H1IA 2YGMA 1GLHA 4V2WA 1D0GA 1QOTA 1W8UA 4NPLA 3WW3A 4E2SA 2P5BA 1DBNA 3S5QA 2BGOA 4OHYA 4G9SB 2CL2A 3JUUA 1ODNA 1OA3A 4Q8LA 3AXDA 4UW3A 1H8VA 1B35B 2C1FA 1UN1A 2WQ8A 5T5LA 4LTAA 2WA4A 1XE8A 2JX9A 1BVP1 2AEZA 2V09A 3NMBA 4P02B 1NCRA 5GM0A 3HEIA 1G6NA 5IK4A 4NIIA 4Y5Z0 3OD4A 4QDQA 1R082 3GHNA 3G6JB 3KT4A 1H9PA 4AEDB 1YQ6A 3PJQA 1VBE1 4UI9L 5GZEA 4QB1A 3TYJA 5L7OB 4XJUA 3S7IA 2VMFA 1CX1A 1QH7A 1BBT1 1G9FA 3POJA 1B09A 4EN0A 5ERLA 4B1MA 3ZFFC
chains in the Genus database with same CATH topology
2AZ5A 5JVVA 2VW0A 4CDQA 3TAYA 4KBBA 2CWSA 1D4VB 3E5UA 2R30A 4YM2A 3L2HA 1QWRA 5JZGC 3UL2A 2H0VA 1NA1B 1YI9A 3MLKA 4FOQA 4QPYA 1QDCA 1MQTC 2ES3A 4JGZC 5BV6A 5BYNA 1POV0 1ZA4A 2A70A 2YXSA 4JC1A 2HWE1 1PNGA 1NY72 3ZN6A 4DRVA 2R1DA 5BUVA 1NLSA 1OHFA 4WZCA 1H1AA 2GC2A 3D0JA 4XYXA 4BPZA 1OSGA 2Q1MA 4GKXA 4FOYA 1U5IA 3PNAA 2BYVE 3FUQA 1LCLA 4PDWA 2MEV3 4XF9A 2OVUA 3VKLA 1NZCA 2IFRA 4WM7B 4EROA 4EWDA 4Q4V2 3H50A 1AYN1 4R8HA 4XBQA 1B35C 4YGDA 4H7MA 2FBEA 5CBLA 4YZ2A 2D40A 3M70A 4IEXA 4FPFA 1GQHA 1PIV3 4FPYA 2LALA 2Z79A 5C6CA 4D7TA 2YHJA 1S0GA 5KHGA 4AEDC 4ISQA 5JIAA 4AFBA 1AR62 1EV11 5L7OC 2E51A 3RG0A 1DYKA 4ORFA 2XJPA 4I2OA 2XL7A 2HWC2 3IDBB 3V0AA 4KG0A 4HLTA 1LOFA 3NJZA 4CRQA 2VQ0A 1RTVA 5T55A 1IPJA 1POV3 3WR0A 4FPHA 2XPJA 4M3CB 1D4M2 1HKDA 1C1LA 3LA2A 1M06G 1NA1C 5DG1A 4DS0A 4JGYA 1EY2A 1IGOA 1XXNA 4LO7A 3UJOA 4XBLA 3QCWA 5EJ3A 4COVA 2VUJA 3CLPA 3TOJA 1CAUB 3UKVA 2ZABA 1WMFA 4OUSA 2WSUA 4H3WA 2XJUA 3RS6A 2JECA 4CDXB 2GZWA 5I0RA 3EXUA 4Q29A 4BMBA 1TEIA 4WM7C 3MDPA 3MLJA 1AJOA 5FBZA 4YLZA 1PO12 3S0MA 3MIEA 2UWCA 3D0SA 1SFYA 4KL1A 1ZBA2 1VBA2 1RUG1 4AGVA 2OPKA 4Y1VA 5J37A 4XFIA 4RSUA 3ST7A 2B9UA 3NW4A 1A6CA 1RIRA 4XZPA 1NG0A 1A3KA 2X5IC 4F3JA 3PMSA 1C5HA 4YG6A 1SLIA 4MZUA 2BWAA 4S2DA 1R1A2 1X50A 2HWF3 4Z8BA 1E57A 3WVJA 1UKGA 3AFGA 3CU7A 1R083 2SLIA 4AK3A 4RR3B 3VZJA 4RQPA 3ETQA 2ILMA 1DGRA 2CGOA 1DGRN 4COYA 5ACA1 3AXEA 3VDDB 1D2SA 1FI2A 4EV0A 1V70A 3M3CA 1MS1A 4NHKA 2XH6A 4XXPA 1PGW2 4JRAA 3NV4A 3RI8A 1RUD1 4IV3B 5F5QA 1BCXA 2RM21 3USUA 1F5JA 4KGGA 4OHWA 1WD4A 4LT5A 1CAXA 1S0FA 2HWD2 1WCDJ 5LK5A 3AKPA 1QY4A 5T5OA 4RGGA 4DFSA 1QJU3 1DG6A 4Z07A 4FTSA 1REFA 4P5HA 4CEWA 4K1YA 3PJYA 2QQPA 2CV6A 1RGSA 3J8F2 4FTBA 4F8AA 1F31A 1ZZBA 1W0OA 1QXJA 1X33A 5CFDB 4E2GA 1PVC2 1PK6C 2WA3A 4Y20A 2LM3A 1LB2A 1CESA 4RS5B 3LOIA 4D7SA 1UKRA 5C9AA 4UBGA 1A8DA 2JG8B 3M3QA 5JIUA 1MS8A 3OY8A 2Q4SA 1YJLA 5D8AA 1DQ0A 3CNAA 3R4DB 3GBFA 2K9ZA 4Q26A 1JXNA 2XBO1 3I54A 4LUKA 5JSRA 2R041 4SBVA 3DUIA 1CAWB 1HXS1 4QQHA 4RR3C 4N7IA 4XFFA 3SLIA 4A7ZA 1ND2C 1AUYA 4Y4YA 1J3QA 1RUC2 3BOPA 3VDDC 1N1TA 3JD71 1QNYA 3MIHA 4IEZA 4ZKTB 3I59B 4BE3A 2HWC3 4LBMA 1RUH1 3W59A 2I45A 2NMNA 1QU0A 3FUOA 2VMHA 5C4WA 5GALA 1ZRCA 4IV3C 5HCAA 2WNUB 1D4M3 1GZ9A 1Z0HA 3TN91 1PGSA 4YW3A 1W6OB 3O7OA 1DZQA 2QUOA 4LO6B 1OFNA 1W2UA 1SFNA 2OZ6A 4XFCA 3GBWA 3H8UA 2ET1A 3NVCA 5HXVA 1W0PA 3KT1A 2R0HA 2AYHA 4NR1A 4XQWA 1I6XA 1H2KA 1LGNA 1OMIA 2E63A 5KXCA 3VHOA 4RS5C 4E27A 1ULEA 2JG8C 2PHUA 3LOBA 2ETEA 4Q27A 1ZBA3 3B9CA 4YM1A 2WZR2 4LNVA 3GHMA 1TMF3 1BEV3 5E88A 2PHTA 2A6XA 1KJLA 3RJRA 3J9SA 2OUHA 1V9U1 2RS51 1A78A 2DF7A 3IPVB 1Z7S1 1EYBA 4CDUA 4AI1A 3CJIB 4L92A 2FMYA 1O3SA 4XPVA 3WP6A 5DUWA 3NO8A 3KS7A 5HCBA 3ZIXA 4MXVA 1Q43A 3A4UA 4YRDA 2WNUC 3WG2A 1CONA 1MS5A 1G86A 4E2QA 4OFGA 4DOUA 4WVWA 1W6NB 2A7AA 3CO2A 1QXPA 4P9JA 4EN6B 3JBG2 1O3TA 2CGNA 5IUQA 1R1ZA 3MLLA 1XQNA 1RUE2 4I01A 1OA2A 1OPOA 1VB4A 4QPGA 4WVMB 5JPMB 4BH9A 4CZSA 3VBRA 2W68A 2C5DA 1CD3G 4R9CA 2WT2A 2QVSB 5KWRA 5AC92 2TUNA 3JCIA 1CAVA 4GB33 4AQ6A 3SXWA 4RHV2 1VBB2 1WLWA 1BMV2 5FCCA 1O3QA 5ABJC 3ZYGA 2NYYA 4X8NA 3J8F3 5JPNB 4L2NA 3TRSB 3LAGA 2YDEA 4BCUA 1V6LA 2UYBA 1CIWA 1V00A 1PVC3 3WQ1A 1AX2A 2WJSA 1FAYA 4PJYA 5CVRA 4NWWA 4XBNA 1GNZA 4OUMA 3CJIC 3AP9A 1XYNA 4OHVA 1LOBA 3QOPA 4TSVA 1AXKA 4JDOA 3LA3A 2D6OX 4AGRA 1N3PA 2RR12 3WV6A 4I02A 4XXAA 1RUC3 4P9YA 4HN0A 1YIPA 1QOSA 3VBUC 3FLTA 5EV7A 4LE4A 1FV2A 3FZ3A 1SBDA 4Q4X1 5H9SA 4PIZA 4I09A 3W9AA 4YGEA 3FFZA 2WKKA 4HT1T 5JOXA 4FBFA 1PGL1 1VBC3 1IHMA 1WW7A 1Y7BA 2YC0A 1OPMA 2N7GA 3WUCA 1YO8A 4INDA 1O4ZA 5FAXA 2H6BA 4QPIB 4AEKA 4B4RA 2R1BA 4GH4A 4MH0E 2D93A 4DQAA 3AYAA 5K7PA 1J3PA 3FMGA 1CPNA 2PHXA 2Q1ZB 2QNKA 3VBSB 1O7FA 2D44A 5C8CA 4LBLA 4MXWA 3PVOA 3HT2A 3ZFEA 1H1MA 1HQLA 3BOWA 3EJKA 4WZFA 4LO4B 2LTNA 3FBYA 3VZKA 4D94A 1ZYBA 1ZRFA 2WFF2 4Q1PA 4Q0UA 5EZWA 3GBGA 2RS12 2ZBJA 5AVAA 5FPXA 2WZR3 3ZDSA 3OPZA 3H1MA 1XRUA 2ZKNA 1UU5A 2ZHKA 3WUDA 4S2GA 2DVGA 3JD73 3WDTA 1YIFA 1I1EA 1CQ9A 1I9RA 3BALA 2K2SA 4HBNA 2C0ZA 4G4FA 2ERFA 2WQZC 4BA6A 2ZHNA 4XFGA 5DDJ3 4N53A 5CU1A 1RHI3 4JQRA 3N7LA 3AZWA 3OYWB 5FO7B 4BOWA 3NWKA 4HSJA 2Y0IA 4EJRA 2D5FA 3WP3A 4Q4W1 4YARA 2MEV1 2B8MA 1HRV1 4NN0A 4UW4A 5FRAA 1JUIA 3ZX7A 4QPIC 3JBG3 4N43A 3MW4A 2WS92 5KXDA 1G9DA 4HK8A 4Q2FA 4AVAA 4W6YA 4CEYB 2IXHA 1V6OA 4I3PA 3VBSC 5K0UA 1PIV1 1WCKA 3D8CA 2FZ2A 3B3QE 2GNDA 4JV4A 2ZAHA 4I0WB 5FFOC 3SHRA 5FOBB 4RHV3 1VBB3 3VZLA 5LEJA 3T1MA 4JCKA 1H4HA 2JG9A 2HJIA 1SLAA 1Y43B 1N1SA 4B4QA 4OLLA 1KFUL 4U36A 3OGGA 4HL0A 3RYPA 1FMD2 1UD1A 4K8FA 1W39A 3WDWA 2NMOA 1KFXL 4NHLA 3DPRA 3POWA 1V9U3 2I07B 2WNVB 4BLIA 1RITA 2A5ZA 2DCKA 3NV1A 3D4KA 3ZIWA 4BIFA 3H7JA 2D3PA 2EXIA 2DUQA 2JENA 4LLFA 4CP2A 1C8M2 2EXKA 4FCAA 2LUWA 2R073 1AXYA 3UKNA 2P34A 3D82A 5CADA 1ZZ8A 2IXIA 2RR13 1DGWA 1QGLA 3BCWA 5C33A 1HV1A 4HKLA 4WM8B 2R16A 2ZS6B 1HQWA 3CL1A 4L11A 3ZSLA 3HT1A 1YRZA 2ZX3A 4AGGA 1C5IA 4D3WA 1PO23 5I0SA 1OLQA 2IC1A 3O14A 3NAPB 5DZEA 2FQPA 3ZXGA 1MQTA 3H3UA 3IMNA 4AG4A 4HZFA 3V0BB 3VKNA 4D69A 4IV1B 4OI4A 3SH4A 4AEMA 4BHPA 2KA3A 4YVWC 2VECA 2GSYA 1GYKA 4YSFA 2ZA9A 2HWF1 1DQ4A 1K5MB 4FP3A 5A32B 4M00A 1KS4A 1WCSA 1Q56A 3AYEA 3LWCA 3MIDA 2G9GA 1R081 5KXEA 4LBQD 2IWGB 5JOZA 1IS6A 4AYUA 1RUF3 4J1WA 3SH5A 4AVSA 2GH2A 3VKOA 4MGYE 3WT3A 2XWJB 4YVSB 2WC2A 2WIIB 3ASIA 1HQNA 5A33B 2RS13 2QCSB 1TME2 5I91A 5FQ0A 1COV2 3QBQA 4XF0A 2VU9A 3MFAA 1RUJ3 3NV2A 5JZGB 3GALA 4MV2A 1PHMA 4IEQA 5F1RA 4SLIA 1IS5A 3O0VA 3ZO0B 3OBTA 1QJU1 4ZU7A 4XJWA 3ENRA 1NY71 4WVVA 4A7YA 4AVTA 1VBD2 2A75A 3NAPC 4QQLA 4AFDA 3VBHA 4RGAA 3HN1A 4P9XA 1I5ZA 5BNPB 2ZGUA 4AF9A 3ZFGA 4N9IA 2ZKLA 4F83A 1AR82 4IV1C 4MX3A 3WQ0A 3WDUA 5BNNB 1I3HA 2WS93 1XU2A 2VMGA 4KWKA 2XLGA 4YG0A 1DU3D 1FATA 1XNCA 3A0NA 1MEC3 4Z82A 4Z1VA 1HLCA 1K5MC 4FPOB 5DUXA 3AKQA 1QQP2 1GFF2 1LU1A 3OBRA 4NVPA 5E89A 1RUI2 1G9BA 1UIJA 3HD8B 4CTEA 4YVSC 1BVVA 3I7DA 4FP2A 1FMD3 2HWC1 3KZ4C 1ZX5A 3AKSA 3FC0A 4JRLA 5DZGA 3AYCA 3LSDA 5GZCA 3IDCB 4N7UA 1D4M1 2E7TA 4AFMA 1C4RA 2ZMKA 4YNIA 2A6ZA 5A3LA 3V56A 1VIWB 4XDQA 2NQYA 4AEJA 2VMIA 3AMNA 1O4TA 1RMU2 1A8MA 4Z92B 4Q4Y3 2WQ4A 3VKFC 1C8M3 1FPN3 4R52A 5T52A 3RZZA 3MF9A 4WBBA 2CNAA 1BKZA 4ITCA 3MGUA 1RUNA 5GLTA 1F9KA 1ZBE2 2B46X 3KD4A 4Q4W3 5BNPC 4XFAA 1HRV3 2YY1A 1NLRA 1CAUA 3HWJA 3JQWA 5TSWA 3WG3A 5BNNC 5CB7A 2RMU3 3AP7A 5FO8B 1AF9A 1ZBA1 4CDXA 3VV1A 3WINE 4O9EA 3URFA 1TMF1 1BEV1 5CNAA 4QQPA 3HR9A 2X5IB 4AQSA 2NM1A 3M4FA 3B00A 3WW2A 5LEKA 2BVVA 1GNHA 1JN2P 2B7YA 1X82A 4R4XA 5FMOL 3SCFA 4IEUA 4XEZA 3PMEA 4KGQA 1G7YA 1OI6A 2EXJA 4LA2A 1S0BA 4AE2A 2WNEA 1IS4A 4XQ4A 4CDQB 1Q5OA 1DQ6A 2PLV3 2VQAA 1VBE2 3QH7A 2ZGKA 4MYEA 1O5UA 1HRI2 3AM2A 4RR3A 3WZ1A 3DGTA 3N7MA 1JOJA 4PLOA 2ZX4A 3WG4A 1ZM1A 1APNA 3I2DA 1WUVA 1S2BA 1COV3 1VB2A 2ZHLA 3JQXA 4NO4A 2DCTA 1WA4A 2I2SA 3KCCA 3ZN6B 3IDEA 4O9GA 3VBFC 1O91A 3MPPG 2D6KA 4GQ7A 4FXKB 5KHJA 2UWBA 4A2UA 1DZRA 1UZZA 4QGNA 4GB31 1DDLA 5FLJA 2AGSA 3BIWE 5J96B 3J8F1 3S7EA 4PDWB 3KMHA 2QFEA 4GKYA 2GNMA 2QDRA 1OD5A 1NXD1 1PK6B 3CF6E 1LU2A 2RJLA 1PVC1 4XJ8A 5CIRA 5FREA 4JVAA 2GMEA 4KNCA 2XKOA 2DVDA 1C3HA 3KT7A 1OLRA 3ZMNA 4W6WA 1XYPA 1JH5A 3ZSMA 1H8TA 5CFDA 1ND3B 1REEA 5KHHA 1DIWA 5HBAA 1MZ6A 4AXOA 4RS5A 4R9BA 4S2FA 1ND2B 4L8QA 2WLPA 3B94A 4XMIA 3IT8A 3V0AB 1RUC1 5CFCA 4CDQC 1LOCA 1UPSA 2RS32 1EV12 4AHYA 5J3UA 1CAWA 4HKWA 3BU7A 5DUUA 1MR5A 1DHKB 3C2UA 1CR7A 3VLBB 1IKQA 4LHKA 2Q30A 1UZYA 2VNRA 5J48A 4JGYB 1VBC1 3M3IA 4XW3A 4TYSA 3ZN5A 1QHDA 3SNMA 1MZFA 1SEFA 4AVVA 4H55A 3ROUA 1QJY2 2FMDA 1RMU3 1AXZA 2EAKA 2IZWA 2GH8A 4AWDA 5AFEA 2ZHMA 4YM0A 4PDWC 2DVAA 2D98A 2MHFA 1KQRA 3USSA 1MS9A 1L3JA 1ZBE3 1LEMA 4C91A 4E4ZA 2BWCA 3SCHA 2ZX2A 5JAXA 4PIXA 4IEOA 4LBQB 3WHUA 1QF3A 5I0TA 4Q4V3 1N3QA 2GC3A 3H0OA 4YW5A 3MICA 4EN9B 1WBFA 4LLOA 4FSJA 1ND3C 4M0HA 2WZR1 3RSJA 4C90A 1J59A 1IKPA 3D6EA 1LJ7A 4GIQA 2BNNA 3MF6A 5LK7B 1LTEA 4KQ7A 1ULFA 3RWNA 4D7YA 1AR63 3VZNA 2Y0OA 1KITA 2YGLA 1LHWA 1Q8SA 1H4GA 1LOFC 2DU0A 4Q1RA 1LEDA 1ZZ6A 4BIOA 3WDXA 2W52A 4KU8A 3PTYA 5DDJ1 1FOD2 3Q9OA 2BW8A 2JXAA 3IKWA 4C0HA 3M1HA 3WXPA 1RHI1 4JGYC 1OOPA 1F5FA 4RD7A 5L19A 1HRI3 3KGLA 3USUB 3WP4A 3JBG1 1AX1A 1CAXB 1QOOA 2A6VA 5JSPA 3ZSKA 1YLLA 3VZOA 4LUMA 2XWBB 2GAUA 1FXZA 2UWAA 1RC6A 3VGIA 2RHPA 4PBPA 3VHNA 1M4WA 2XVGA 2VNGA 4RHV1 1VBB1 5ABJB 3TNQA 1RB8G 4ES9A 1H2LA 2DTYA 3ZXFA 2D6LX 1PO13 2FZ1A 3WX5A 3WDVA 1VBA3 1GZWA 4Y20B 4OULA 5C9AB 1CJPA 5AFBA 1SBEA 5EYYA 3OY8B 2YROA 2EIGA 5FO9B 5D8AB 1PZ9A 2DU1A 1UPIA 1VAMA 2X29A 1O4YA 1R1A3 2ZGRA 2TNFA 3VKMA 4AQ2A 5L36A 1YFYA 4OHZA 1H30A 4RQPC 4AI0A 4K9SA 2WSVA 1S0IA 4K21A 3ZN4A 5F6KA 2R071 4K20A 1QMJA 5SV5A 4Y1UA 2Q8OA 1S0EA 1YUDA 2RR11 1HXS2 3DKWA 1JUHA 4FPGA 2W0XA 3VBUB 1VJ2A 4LEJA 2YV8A 3O12A 1BXHA 2RS33 4KG8A 3MIBA 3RYRA 1RVF2 2BQPA 2PN5A 1ZREA 1PO21 2ARBA 1YYNA 2D97A 1RUH2 3R4UA 3EHKA 5J7MA 1Q8VA 2HWD3 2D43A 4YZ3A 4AVCA 1XNKA 3T2TA 3H3ZA 4CP1A 2AREA 5EFUA 3E5XA 1EPWA 2KM2A 1QJY3 2PHWA 3ZXEA 1SBFA 3FJSA 4CDWB 3TN92 4QQ2A 1YXWA 2GC0A 5JR7B 2E9QA 3ZXLA 3OD0A 1WLTA 4Y22B 4XHXA 2MPFA 5CAZA 2ZMLA 3AKRA 5C9AC 2O0OA 2XJSA 3EQEA 3VL8A 4CP0A 5KXBA 1AYM2 2XL9A 5DG2A 1LENA 1RUF1 2G4IA 3GZTB 5T5PA 5D8AC 2CAUA 3VBSA 3N4MA 2WFF1 3EO6A 1WBLA 1OQDA 1KS5A 4EWAA 2RS11 1OKQA 2VH9A 5LRRA 2HEYF 4YW4A 4CDUB 4LO8A 4XTMA 1NE4A 3B69A 1RUJ1 3S6PA 1ASJ2 1RUOA 1WMDA 1FNYA 3RMXA 2RS52 1JTZX 1IZ3A 3N3HA 1Z7S2 2A6WA 2GMMA 1VRH2 4YFWA 1XU1A 2B42B 1IPKA 1YWKA 1JYIA 4DNYA 1MS3A 1FOD3 2DFBA 3OTFA 1DGWX 1AHSA 1LOEA 2EA7A 1SLBA 1GQGA 2B45X 4OZXA 1MVQA 2UY8A 3RRDA 1GSLA 2O8QA 4IEWA 2PQQA 2RJKA 2PHRA 4QPGB 4JTOA 1U5XA 4P9LA 1HX6A 3VHRA 1MZEA 3VN4A 4M01A 3OYWA 4CDWC 4P14A 2WS91 5GLWA 5GKAC 2D7FA 1MEC1 1PZ8A 1ZZ9A 2P3KA 4I3GA 4R4ZA 3MW2A 2XLFA 5KHKA 4A3XA 4OI2A 4CEYA 4QM9A 4HPKB 1WGPA 4YZ5A 2R49A 5KHIA 5FOJB 1S0JA 4YFZA 2UYAA 3AMHA 1FMD1 4Y26A 2OW4A 2GNTA 4XE9A 4CDUC 3IN9A 2JKBA 4ZXKA 2PAMA 3R6SA 3M3EA 2GC1A 3WW4A 3PVBB 2ZPXA 1W6MB 1AR92 5BNOB 1AL22 1HV0A 1XNDA 2NN8A 3UV9A 3B93A 3AZXA 2WNVA 4Q4Y1 4MGZE 3VBOB 1C8M1 3JZVA 4P9IA 1FPN1 3T1LA 1NCQB 3ES4A 1VALA 3RYKA 4L97A 1VAKA 3AMQA 4QGMA 3N35A 5AVPA 4UXAA 3MFCA 1RVF3 4QPGC 5BNQA 2AH2A 4YW2A 4IL7A 2XHKA 3W58A 1RUE3 2EAAA 4Q0VA 4WM8A 3ZSEA 2RMU1 4EN7B 1DZTA 4PBOA 4GALA 4GH4B 1PGL2 4IESA 2ZX1A 2VG9A 1AX0A 2IFWA 4IEVA 5FLHA 5AC93 4YVWB 5GLZA 1U5YA 1ZVFA 2ZGTA 3NAPA 2OA2A 3RMYA 2IXKA 4KWJA 5B2GB 2UURA 4HFSA 4AHZA 4Y1ZA 3OF1A 2H6CA 3V0BA 1J58A 2NLRA 1LULA 2JICA 3MI8A 2G9FA 4OI1A 3ZFEB 2ZZQA 1URXA 4WV8A 1LHVA 1XE7A 2NZ9A 2ZCWA 3SISA 5JCTA 3WD5A 4AI8A 1LODA 1AYM3 1ZNPA 2GDFA 2VNOA 1VR3A 2YPJA 3PHMA 5L73A 1K5MA 2VGDA 4MVTA 5A32A 1CN1A 3U10A 1ENSA 3LSEA 2PLV1 4RL7A 4ONUA 4FT8A 1C57A 4LA3A 2WWSA 5BNOC 2JJ6A 2CAVA 5HI0A 4RA0A 2BEOA 1ZRRA 1KDMA 4YZ1A 3U0ZA 1COV1 3VBOC 1PMIA 2YZ4A 1UW8A 1QDOA 2CTVA 4PIYA 1NCQC 4YZ4A 3ZFFA 5I8YA 5I8TA 5CG8A 3E6BA 5A33A 1W6PB 2R062 4QX5A 3OGJA 2XKPA 3E6DA 1S2KA 4N53B 3HIFA 2E53A 5JZGA 1MS4A 1QH6A 4LE3A 4J6GA 4JGZA 1VBD1 1W6QB 3QD6A 4L9BA 2XG3A 4W65A 5H9PA 4N43B 2WT1A 4GH4C 5JOWA 1SLLA 5HCFA 4J1XA 1V6JA 2ZJCA 4XFHA 3RQ0A 1AR81 1NQJA 3TBDA 4NWVA 5IT6A 1ENRA 3PVNA 1ULDA 4DMIA 4WVZA 4FOVA 1FV3A 3LGRA 2BTVC 2VVDA 4XHBA 5GZFA 3AZVA 3FBMA 3U11A 5C8CC 3ZFEC 1KRIA 1J3RA 3VL9A 4QMAA 2JG9B 2HWB2 2ZGNA 4MUVA 1B35A 2OIIA 1EAH2 4DY3A 2WFF3 4Q0QA 4NHMA 1DFQA 5E16A 2ZGOA 4META 2F4PA 4AEDA 3KLSA 3JU9A 3UKTA 1FNZA 5L7OA 1V6IA 4AFAA 4EN8B 2GN3A 2WT0A 3MEPA 1H9WA 4YW1A 4FAHA 4FQ4A 4JTNA 1X36A 5D1IA 1Y9QA 3ELNA 5H9QA 2Z42A 1G9CA 1AR93 1AL23 4N53C 1RMU1 1SLTA 2PTMA 3ZYJB 5IK7A 1Q8QA 1G9AA 2R6QA 1NA1A 3WG1A 4DINB 3X29B 5DXDA 3WOGA 1UX6A 3ZMOA 1ZBE1 4N43C 2Q5TA 1JYCA 3RPQA 2VVEA 3AKTA 3WCSA 1IS3A 4XFBA 1QJX2 1UIKA 4AI2A 1T6GC 3KQRA 4GMP0 4Q4V1 4LR4A 3M7AA 1ULGA 3SCGA 2VW2A 1JBCA 4QU2A 1CJDA 1KXGA 2BGCA 1N47A 1DYPA 3H7YA 2XGXA 1R092 2W08A 3ILRA 4WM7A 1QKQA 2BFUS 4XJZA 4N9HA 5I93A 4JDMA 2JG9C 5FTTC 1ENXA 3GF6A 4OVEA 4UW6A 5E8AA 2DYCA 1AR61 2PHDA 2V5YA 5DUVA 5BXXA 3AZZA 3WQ7A 1AR72 1Q8OA 3R05A 5EYXA 4MLOA 3TNPB 5F6LB 2X5IA 2WINB 1PZ7A 3DPRC 4DRRA 2HWF2 3KB5A 2EXHA 1C8NA 1LOAA 2P3IA 4B29A 3FLRA 4IEYA 1CVNA 1WLCA 3I4IA 1HIXA 4IQPA 5FQ0B 4AHXA 1UU4A 3ZSJA 3WP5A 5C8WA 2H0BA 1HRI1 3SMHA 3OJBA 1O5LA 2BNOA 5K9YA 3U07A 4X8PA 4M3CA 4QT6A 3N36A 4YG3A 3VBFB 1FX5A 4TZDA 3ILNA 2R063 4GMP3 3AJYA 3AP4A 4GWNA 2TEPA 1ONAA 5JSOA 4XF4A 3FHIB 5JI9A 3VBHB 1QXRA 1LKNA 1QJU2 1PO11 3ZFGB 1RL3A 2WLQA 1GKBA 1VBA1 1LR5A 2KXLA 2VW1A 3THPA 4H7LA 4XJ9A 1HDKA 3IBMA 3VUOA 4I0AA 4K1ZA 2YUEA 4Q0PA 4E4DX 2SBAA 4P9WA 1NCRB 4COUA 1S55A 4XOGA 2B5HA 2D6PA 3H1YA 1R1A1 5BPXA 4HMZA 4E4SA 1PK6A 1YJKA 4Y1XA 4TLFA 1UAIA 5IK5A 4MGKE 1OQ1A 2HWB3 4B7KA 1WLDA 1D0HA 4DZGA 1BYHA 1EAH3 1WW6A 1NYWA 3KCYA 3WLUA 4C1WA 1ND3A 4OI0A 4HETA 5J36A 2RS31 3AMMA 1TME3 2I74A 2D6MA 1BBT2 1MACA 4M3CF 2ZGLA 1ND2A 5K8SA 1PGW1 1CX4A 4LHLA 1U12A 3VDDA 4PF5A 3BODA 2E7AA 3ECQA 2HWD1 3ILFA 3SITA 4LHNA 1SDWA 2A3XA 4ASLA 1CGPA 4IV3A 4K6BA 1QJY1 1AZDA 3L9JT 3WNXA 4A7KA 3INAA 2CYFA 2HWE2 2Z2SB 3VBHC 1SACA 2ATFA 2CWMA 2P37A 1VBD3