5KA5A

Hiv-1 gp41 variant v549e resistance mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
85
structure length
79
Chain Sequence
MQLLSGIEQQQNNLLRAIEAQQHLLQLTVWGIKQLQARGGHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Receptor Activation of HIV-1 Env Leads to Asymmetric Exposure of the gp41 Trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords Transmembrane glycoprotein gp41
total genus 36
structure length 79
sequence length 85
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ka5A00
1DLBA 3MHHC 1I5XA 1QR9A 1SZTA 1Y66A 2P6JA 5HFMA 2EZOA 1MG1A 1QR8A 2M7WA 2OT5A 5H9CA 1JPXA 4E2LA 2EBOA 3GWOA 1MOFA 5KA6A 5CN0A 4G2KA 1EBOA 3B8NA 5CMUA 1F23A 4JF3A 1K34A 3P30A 4JGSA 4JPRA 2X7RB 1I5YA 3MHSC 1K33A 1QCEA 3K9AA 3M99B 1JQ0A 4FIPC 4N23A 3H01A 1DF5A 1Y4MA 3B77A 4N21A 3B8MA 1ENVA 2EZPA 5HFLA 4FJCC 2LP7A 3CP1A 5KA5A 1DF4A 4FK5C 1QBZA 3CYOA 2MK3A 3WFVA
chains in the Genus database with same CATH superfamily
2YC0A 3MAQA 2PI5A 1Y66A 3ABKB 2ZE6A 2QWOB 3SR2C 1OZ0A 3ABTA 4OXSA 3TXQA 4X8AA 5KUKA 2Y48A 3TXSA 5IWAB 1OCCC 1O9GA 1W59A 1OJHA 2E5LB 1JQ0A 4JAUA 2WLHA 1V54B 1H8EG 2HHHO 3QO7A 2YIBD 5C93A 3OR6C 1XL6A 1JMKC 1I94B 3AK2A 4MVMA 2ZE5A 5LHIA 2PF4E 4DV1O 4IHJA 4OX9O 2OYQA 1QU7A 1K5QA 2K1EA 1IBLB 4W4LA 1Q6HA 2QEXV 1ZLZA 2CTRA 1A32A 1HWYA 1NT2B 1AB3A 4LFCB 3D3QA 4B3SO 1Y76B 4D7TA 4FM0A 2W0FC 4LF4O 3EFFK 3RW0A 1MG1A 2WWWA 4GYCB 4DV7B 1FFXB 1HNWO 4GLXA 4DUZO 3ZRSA 2AHZA 5B1BB 4ZHQA 4DV3O 4RQFA 3L71H 4QGPA 3F5WC 3JARA 1S76D 3ZX6A 3TK1A 3OR7C 2OTJV 3JATB 4Z2WA 4ZKIA 5HFMA 1Y76A 4IIJA 4NB5A 4GKKO 1PKXA 2HJFC 2YXHA 4JZGA 4IT5A 4JI7O 3B2EE 4LF8B 1KKDA 1P84F 2IH1C 1AVMA 1KQSU 2UUCO 3HKEA 5KHHA 1M93A 3ZHRA 4LH7A 5JVDB 4KXRA 4LF7O 4DXWA 4DR3B 5B1NA 4EB6B 1ZL8B 1Z2GA 5EYPB 3VQWA 5LA6A 1M57C 3OGCC 3RYFB 5J2UA 2EIJB 3I56V 2H94A 1IBMB 4RO2A 4YJ2B 1QCEA 4JI5O 4CS2A 3G71V 1KBHA 2A3QA 4PDLA 1GMGA 4J11A 1Y74B 1NR7A 4NTXA 4BWAA 4MT8A 3ABMC 4X64B 5A9GA 4JTAB 1I0HA 3K06A 3AEIA 4G2KA 3S3WA 2O57A 4WFAV 4MS2A 1W2BU 2GSMB 3L9DA 1RSOA 5B3SC 4Q6GA 1PL0A 1KECA 5JWPA 1J5EB 4BIUA 2AW9A 4MVQA 4UCUA 5IJ9A 2ZR2A 3ZHUA 1SZTA 4OPAA 2EZOA 1X4TA 2WLKA 3K5OA 3CCSV 4H44B 1YVWA 2GUZA 3IGAC 2Q0OC 1M56C 3P3NA 1YJWV 1OCZB 1H2MA 4JI6O 4JYCA 4CH4A 4YIPA 4JI5B 4JYAB 2BSKB 3ABMB 2A9HA 2FMLA 3FAVB 5LL6Y 2IW5A 5C8YA 3ZMUA 3OMNB 2DYRC 1AP6A 2JK5C 4MVSA 1CXZB 1VQPV 1OCOC 4RQEA 3Q4HA 5GW7A 5LXTA 4FM2A 5AG2A 4DV1B 2FL4A 4OX9B 5EBLC 3U11A 2QKAA 3P3PA 2Y4TA 2GHYA 2UUBO 2ZCEA 2IU3A 4TQDA 2XAFA 1KC8W 2QGNA 2BSKA 1BSMA 2UXBB 2LO1A 3MDSA 2AHYA 1KD1W 4I5SA 4DV2B 1VQ7V 1VQKV 3OE7G 4NXMB 2NR5A 2YDEA 1D2DA 1OCOB 3K5NA 4HAMA 1ZTEA 4WBNA 3G4SV 1VP7A 4X66B 3BVOA 2P5OA 5IJ0B 1N36O 3B40A 1LUWA 3N2GB 3A8TA 1R1BA 3LUTB 4LF8O 1K34A 1V9PA 3FB5C 3KKYA 4YY3B 4UCOA 2UUCB 4PJ0Z 2A06H 2CTPA 1JOYA 3AG2C 1J95A 2ZIMA 4I50B 2BTQB 4XDKA 2EZPA 2KB1A 5B3SB 3BRCA 2MK3A 4FLUA 1BMFG 4DW0A 1F51A 4NTWA 5IJ0A 1EM1A 2ZIOA 4DR4B 1JJOA 2QKSA 1WNSA 5L3EA 3ZHQA 1R3KC 3ZHVA 1Q82W 1SS3A 2E5LO 4QIWF 1Q43A 1FFXA 2Y4UA 1Z5WA 2Q4PA 2RJZA 3RT3C 4KL1A 3RWRD 3CCUV 4X88A 1YJNV 2M7WA 2VQEO 2ZINA 2BOCC 1VQ9V 1XQ8A 5D5PA 2OIEA 3JASB 3OTOB 5CBFA 4UVCA 3R65A 4GX1A 2PUSA 5IDJA 2ADQB 3B8MA 4UCTA 5IYBO 4ICGA 1CP9A 3CCRV 3FX7A 2Y0IA 5CB4A 4I4TB 2HR3A 2D2CB 4J80A 1AJQA 4DR4O 4PA7A 2VRZA 3LDEA 2P22C 3ETEA 3CCMV 4B3TB 4X65B 3N2KB 3ZMSA 1SC5B 3K0GA 3BA8A 2FB5A 4JI6B 1R6NA 5EZYA 4YHHB 5GTIZ 2XTAA 5IYZB 4CH5A 3JAWB 1BHAA 2LP7A 4LC1A 5K1PA 4UB8Z 4X20B 1M56B 1NR1A 5CA1B 4DV4B 4I55A 4ABMA 1YI2V 1M4UA 5CB4B 1IZ3A 4WF9V 3CS5A 1LR1A 3T2MA 1KP2A 3ASOC 4C7UA 1ROPA 4JI8B 1EZVH 1XOUA 4O4JA 1JX9A 2F66C 3F7YC 2XT9A 4TV8A 2JGUA 3N27A 3AG4C 2DYSC 3H1JH 1AI4A 4LF7B 3WFVA 4X62B 4RWUA 4DUYO 1XNRO 3L72H 1G1XB 3SYAA 1RPOA 4J7JA 3ZMTA 1VQLV 2VQFB 2KKWA 2F1MA 1Q81W 1PNKA 3OEEG 3O65A 1NU1H 3I5DA 4BAYA 3CD6V 1F4NA 2DYRB 3R66A 3AG1B 1R6KA 4EEQA 5GONB 2LQTA 4TV9A 3SPIA 3ETQA 1VF7A 4U3JB 3SJAC 1FXHA 1W0KG 1BZKA 4EFBA 3E35A 4NXNO 2QTOA 1GN6A 3ZRXA 4FFKA 1CPYA 3OGIB 2QM4A 3CMEV 4AQYB 1SA0A 1VF6C 5H6QA 1S77D 2YEVB 5EC1C 2ZM6O 1IURA 1QQCA 4ZHQB 1OCRC 4YXWG 4DRXB 3BPZA 3JARB 1DTOA 1BL8A 2VQFO 1VQOV 4LCUC 1N33O 5B1OA 3QO8A 3SPHA 2DOSA 1YJ9V 4X1IA 3S3XA 1V54C 5DN6G 2LW7A 4O2AA 1H2LA 5JJJB 1MNGA 5CBHA 2LGQA 5J2TA 3UT5A 2DE0X 5KHKA 2F23A 2F4VB 2P67A 4B7EA 4UVBA 1FXKB 1PPJH 4X1YA 2QR4A 3OUSA 3ZRWB 2XOKG 3QF7A 1U97A 2FTKA 2JEXA 3OEHG 5LA6B 5KAFZ 3SGIA 5BXZA 1YZBA 5KMGA 2JS3A 4XDJA 4X89A 2YI9A 3OAAG 2BTQA 4IGGA 2B1IA 5CA3A 1CEZA 5DEDA 3APOA 5CBGA 4U7NA 4O4LB 1OV9A 1Q90D 2XAQA 1M1KW 3AG1C 4YIOA 4LWSB 2Q9LA 3CE2A 3EHBB 3K79A 4DW1A 3OM3B 4K8XA 4PV1B 2CUGA 3WB0A 1AJPA 1XBLA 1D5AA 4TUYA 4DR5O 1TAEA 4UCSA 2EULA 4IHJB 2EILB 2L6LA 3JALA 4JAAA 2Q73A 5DM6V 1QBZA 4X62O 3IC9A 3SJCC 2IH3C 1XNRB 1Q6UA 2DYSB 1I5XA 1ZWIC 3DXRA 4NR1A 3L75H 3GWOA 4DV7O 1THZA 2EX3A 3ASNC 2R9IA 3PN1A 1GN3A 4RUEA 1SQVH 2E74B 4DV3B 4UCVA 3CRAA 1TVKA 1VIBA 4PDMA 4I9QA 1QVGU 3Q4HB 4ZI7B 4CBCA 4AI8A 1DLBA 4LFAB 5EZYB 5IYZA 1OCCB 3OMIB 3VOUA 1F23A 4B3RB 3ETGA 1P4RA 5CA1A 3FB7C 4JAVA 5IYCO 4DR5B 3E86A 1XREA 4DK1A 1Q3EA 1ENVA 2RNBA 1HNXO 3HKEB 3ZRVA 2AZ2A 1S3JA 3ZN0A 1JR9A 1YDXA 1ZX3A 2P4VA 1AI6A 4GUNA 3ZCCA 1SRYA 4X1KB 3B8NA 2PGGA 3VBBA 4DV2O 4GX2A 3HKCA 4JPRA 1RM1C 1JFFB 5LGTA 1V55C 3CXHF 4J42A 2F93B 1GN4A 1WP8A 3G6BA 4ZBMA 3E2EA 2OIGA 1PP9H 4QPKA 3T1YO 1I94O 3ZMZA 2CTWA 3F5TA 3OUFA 1N34B 3D36A 5CMUA 4JGSA 1VMGA 1YF2A 1YHQV 3JD0A 5GONA 4PDVA 1KB9F 1DF5A 2Q6AA 4F6RB 4DR6O 4BW5A 4JTDB 1LUVA 2V7QG 4AILC 2EILC 2GDSA 1EZJA 2HFEC 4O4HA 4JI2B 1TUEB 4LP8A 2DN9A 3K04A 4DV0B 2EIKC 4UV8A 1VF5B 3OW2U 3W7WA 3A0HZ 4GX0A 3RYIB 3ZN1A 1YSCA 3C3TA 3G6EV 4GKJB 2CTQA 2UXXA 3OTOO 2PY5A 1MZFA 1US6A 2KG7B 3CX5F 3HB3B 4OPHA 4JI1O 3D3IA 4FZ1A 3AK3A 1YXBA 1DF4A 2IBZH 3L74H 3UQ8A 2MW2B 1NBMG 2R9AA 2IJKA 2ZNJA 1H2NA 1FXKA 4MVUA 5D5QA 5KX5A 1HNZB 4RUFA 3K0DA 5JJNB 1FXKC 4LF9B 1M90W 5GTHZ 1H8HG 4BW9A 3K9AA 5ITZB 3MD0A 3DGEA 4JI4B 4UB6Z 3LNMB 4X66O 2W6JG 1VQ6V 1MZEA 2YUAA 3W7SA 5FPRA 4LF6O 1TUBB 1K4DC 4O4JB 4NTYA 3F7VC 1ZSPA 1O9HA 4GKJO 1IXMA 3APQA 1PL4A 4CC5A 1GAXA 2E3CA 1ZL8A 5EYPA 4TOIA 1FJGO 4KFMA 1KU9A 5E1AC 1VQNV 3RYFA 4B3SB 3SYCA 3C3SA 3TJTA 4JI0O 2WLLB 4LF5B 2HP8A 2ITCC 4ZOLA 2UXCO 2ZE8A 3K08A 3WB1A 4O2BA 1TUBA 3CHXA 1SERA 1S5JA 5A2QN 1N0NA 5B1AB 2ZT9B 1L0LH 3ZIAG 4FM1A 1DK1A 3WG7C 2DWEC 4JI3B 4GZRB 3B09A 1BCCH 3CYOA 4MVRA 3FB8C 1FPOA 1SQBH 3KZIZ 4E2LA 4E4EA 4D6TH 1MOFA 4TQFA 2CH7A 4I9WA 1NI8A 3ICXA 5JH7A 3K5MA 5KHJA 1L1FA 3HKBB 4O2BB 4DRXA 4DV5B 4DR3O 4K8ZA 1K97A 2EJRA 3UKMA 1JPXA 1AJNA 5FNVB 1YTFD 3BABA 3W7UA 3FAVA 2WAMA 5K1XA 2QA4V 2R9RB 2DJVA 2ZQMA 3QO5A 2R72A 4NXMO 2ITDC 3W7TA 4U3FH 1PNLA 4O2AB 1YITV 2XHBA 4JI3O 1K73W 3RBZA 1G4YB 3T4DA 2JRIA 3WG7B 2IJIA 3STZC 4X64O 4IYIA 4GX5A 4MTOA 1OCZC 1NH2D 2C2AA 1XDCA 4RAIA 3P30A 3QVNA 3CB2A 2K9PA 1L8DA 1UPGA 4JI1B 3ZMVA 1F4MA 2F43G 2YICA 1KUQA 1E1QG 4LFCO 4UV9A 2GTSA 3CCEV 4DV5O 4LF4B 2Q0AA 2RN9A 3OFNG 3SJQC 5F2VO 3STLC 3AG3B 1K5SA 3JASA 4BIOA 4LF9O 4DUZB 4QPJA 4BR6A 3T1HB 2Q67A 1JA8A 2PZSA 2ZXWB 3WB2A 1NZ6A 4B3MO 1Q6IA 3N2GA 3T4ZA 4PELA 1B06A 4EKWA 3CPWU 4XDLA 1P7BA 1K9MW 1IDSA 2E76B 5LHHA 1BHBA 3U10A 3KCXA 3BAAA 4DR2B 4TV9B 3THOA 2CGNA 1LNQA 2OCHA 2P4KA 3HKCB 2IU0A 1GM8A 3H1LH 1U96A 3JD1A 2UUBB 3RGBA 3LSUA 5KA5A 3DC5A 1UJWB 4IIJB 3MHHC 2KG7A 2JVDA 4JI0B 3ASOB 3ABUA 4LF5O 2WA3A 4FZ0A 2E75B 1SA0B 1VF6A 1F7YA 3QTCA 1OHHG 4GT1A 1I5YA 4DV0O 3ML0A 1DGSA 1Q5OA 4FIPC 2WA4A 3SYOA 4WFBV 1Y4MA 2M6YA 2ZDIC 1VQ8V 5IT9N 3SPJA 3JCUZ 1H2KA 1EN5A 2GTAA 4LFAO 1WB7A 2JGDA 4DV4O 1NTMH 3FYIB 4X1IB 2WLIA 2Z0AA 1SESA 3JD4A 1WPBA 4B08A 3HPLC 2RCVA 1SQPH 2WSSG 2JJ2G 4UCRA 1HNXB 3LSQA 2UU9B 5EIBC 3G80A 1QLEC 4X1YB 2PYJA 4O4IA 3UO3A 2YS8A 3J80N 2HG5C 4YJ3A 3JSLA 3DSQA 1HNZO 1RPRA 1EBOA 4QNHB 1IBKO 3FB6C 4UXNA 3CCVV 4DR1O 1PNMA 1G8MA 1PV0A 5IJ9B 4K0KB 1WP7A 1AP5A 1L0NH 1URFA 1NTZH 4I0XA 1WA8A 1WN7A 1HW7A 1XL4A 2CGOA 4O4LA 5EIBD 1BQ0A 3H1IH 4LF6B 3ASNB 4U7OA 1VEWA 1P49A 1S0VA 3D8CA 4XBFA 1W0JG 2X7RB 2DQ3A 3GWKC 1R3IC 2XAJA 2YXYA 1XMOO 1SQFA 4O4HB 1AI7A 3GB7C 2X6AA 3BEHA 4P30A 1Q8IA 2OWOA 4KHPB 1QR8A 2PI4A 3JD2A 1WA8B 2DWDC 1PM9A 1WLEA 2BTOA 3E8FA 3X2QB 2YXLA 3LSSA 2FYUH 1I7FA 2IM9A 4FMTA 3RYHA 2HVKC 2ATKC 4R7CA 4JV5O 2DW4A 3A0BZ 1Q7YW 4J7KA 4J10A 3CEIA 3E22A 2HJDA 3E89A 5EC2C 3RYCB 3CMAV 2QM8A 2YSUB 3ETDA 2WPDG 2AXTZ 4JF3A 4DR2O 1FAFA 1R6TA 1K33A 5LYJA 2Q7HA 2JJ1G 1WAZA 2ILMA 1KKCA 3AK1A 4H37A 3DC6A 3CJHA 3RYHB 4DUYB 1Y6XA 4LWSA 3H9VA 1XNQB 2P7TC 2P06A 3VQXA 4PA3A 4X9QA 5LMUO 3W7XA 5H2FZ 5LP6A 2N04A 3E8HA 5LMNO 4LH6A 4WFEA 5JCOC 3SYQA 4PI0A 4FVMA 4JYAO 3JALB 1GM7A 4PI2A 1AROP 2EIMC 2A7WA 3ZEDA 2ZD9A 3T1CA 3CJHB 1OCRB 1N34O 1COWG 3CCLV 5BMVA 1N8RW 4HYOA 3OD4A 3D36C 1K3EA 4ZI7A 4HZ3A 3ZS8C 2VWJA 3P32A 2ZE7A 4FLWA 5LMUB 3LDDA 1NVPB 4JI2O 4LR3A 1TA8A 1S5LZ 4B3TO 3T1HO 1IBMO 1QHTA 3HKDB 5IWAO 1N33B 3K03A 4YHHO 2VWKA 4I4TA 4Z1VA 2NLJC 5CA0B 4UUJC 3CP1A 5LOVB 1SKVA 5KLVH 5FL7G 4DK0A 2AZ0A 4Z1MG 3G67A 1M57B 1ZUQA 2KSDA 1RM1B 1T5EA 1N4CA 4JI8O 3BY6A 5LBQA 1QLEB 4WCEV 3WU2Z 1XEQA 4J41A 1FXVA 3K9SA 5JQGB 3B77A 2JEUA 1GK9A 2WLIB 5FNVA 1J5EO 2QWRB 3CSXA 3AG2B 2EBOA 1AILA 1HDJA 1MMMA 4FLTA 1P7GA 3DTUB 3ZJZA 4JYYA 2VS0A 5L3BA 2W0XA 2LJ2A 3BA9A 1ZAUA 2V4DA 2V1DA 4F6RA 5B5EZ 1K8AW 1M5IA 1S5HC 1XILA 2A0LA 2Q5ZA 1HR0B 1UFIA 3CWBH 3JYCA 2VQEB 1XMQO 3IC7A 2QWPB 4QE7A 2JDIG 3FKSG 2ETNA 3K5LA 1QNMA 4FPPA 3O9OA 3TGUH 1N0JA 4X1KA 2YIDA 2QSAA 1KP3A 1RP3B 2X0LA 4P2ZA 2D3OW 2ZM6B 4WFGA 2JGDB 1IVSA 1NTKH 1XHXA 3C90A 2XASA 5LMNB 2WLLA 4DR1B 2B1GA 1M9NA 4D7SA 5BR8B 4K35A 4DYLA 2GV9A 4IL6Z 1YTFB 5KX5B 1HR0O 2DQ0A 2RQ6A 4H13B 4EFEA 2P90A 1SQQH 5B1BC 5IE9A 3TCUA 3RN4A 4B3RO 5ITZA 3B4SA 3NR7A 3E8BA 2QWNB 1KYOF 4PA4A 2OCCC 4W4KA 4R8CA 4MTFA 3LDCA 5DECA 4MTGA 1Y74A 5KHGA 2OT5A 4HNAB 2B9ZA 2WLJA 1BS3A 1NVPD 4CH3A 3M8AA 3RYIA 3A2FA 2EIKB 5BR8O 3EVKA 1PD3A 1BT8A 3T1YB 1MABG 4P9PA 1GH6A 3SPCA 2ZXWC 3RVZA 4JYBA 2NNUA 4WBNB 2NN4A 3QG5A 4JI7B 2EJ7A 5H5NA 3QNEA 4HNAA 1B3QA 2H8PC 4WFFA 2EINB 4J7ZA 4LNUB 2ADPA 5FPOA 2XNDG 4EB6A 2R70A 2PYLA 2UUAO 3A0RA 2BCCH 4DR6B 2F95B 2OCCB 2LFRA 3EXAA 1X59A 4YJ2A 2UXBO 1BE3H 5L3FA 2CH7B 5LHGA 5CN0A 5BY1A 5LXTB 2GBOA 4AHCA 4DO2A 1NQTA 2Q8VA 3HKBA 3E83A 5H6RA 1AR1B 1Q86W 4B3MB 4L87A 2ZR3A 2QM7A 2BE3A 2EIMB 1GKFA 4MSWC 5HFLA 1XI1A 1WB8A 1N36B 1XHZA 4BIZA 3K3WA 1XMQB 3JAKB 4FLXA 5CA0A 2XAHA 3ZHSA 1TVKB 4YY3O 2Y0PA 4ZOLB 2UUAB 4FK5C 3RVYA 2QJ1A 3CRRA 4H33A 4K3AA 4L8JA 3CC4V 3IAYA 1H2GA 3PJSK 2UXDB 2ZDIA 3J7AU 3ABLB 5KHIA 1NKDA 4MW3A 4CH6A 2Q7GA 1SQXH 3SJBC 4JV5B 4I50A 3JCZA 3JSNA 4TUYB 1WJZA 4JTCB 1VQ4V 3ABLC 1Z5VA 5IY5B 4DV6O 3JATA 3ABKC 1IXBA 2XAGA 2Q7EA 4CZZA 5EK0A 3DXRB 1FD9A 4X20A 1SF9A 4I55B 5JJEB 3AG4B 2RMKB 1JJ2U 1B6QA 3JD3A 4MW8A 2UU9O 4LBEC 4R6ZA 2B5UA 1YCIA 1VQMV 5JVDA 2QWQB 1R73A 4CS3A 4P9OA 5LGNA 4X65O 4YJ3B 2ZNIA 5KUMA 1BQZA 2LFSA 4K0KO 3SDLA 5IY5C 4FJCC 4A5UB 2ARHA 4LFBO 4ASUG 4TWKA 2Q68A 3OMAB 1HP8A 3FYEB 2BOBC 1QR9A 1FS0G 1FFTB 4J9ZB 5BMVB 3ZHTA 3HR0A 4F6EA 2EIJC 1WPXA 2Y69B 4FFBA 2WLMA 4OGQB 3AG7A 2G38A 4PA6A 1XMOB 5LGUA 2EINC 3JAWA 4ZIBA 4J9YB 1Y67A 2PTMA 4KHPO 2P6JA 3SYPA 1TGOA 3KCYA 2QKCA 1JVMA 3HKDA 3VQVA 4CC6A 4UVAA 2OTLV 5JCOA 1GRJA 5TISZ 2Z3YA 2YIAA 2GUZB 4JI4O 1K4CC 2RDCA 4PA9A 5B1AC 5L3CA 3BHPA 4LFBB 4FFBB 2XUMA 1YIJV 2YIBA 1AI5A 3L73H 2QDOA 1VARA 5H9CA 3FFQA 1S72V 2JIZG 1V55B 5C8YB 3AG3C 5J2UB 2X6BA 2W6IG 5KAIZ 3UM7A 5JQGA 2YI8A 4PDRA 1G6UA 3IFXA 3M99B 3JAMN 4HBNA 1FJGB 3RFRA 1GTOA 3UT5B 3LNNA 4AQYO 3BFRA 3IJ4A 4QJFB 4G28B 2N74A 3KG2A 2Z5UA 3N2KA 4LNUA 1KMIZ 3VQYA 2N05A 2UXNA 4G27B 1FKAO 1VQ5V 3BCCH 1NS1A 4R50A 2LW1A 2KQXA 4Q20A 4U3JA 1FYJA 1IBKB 3CRMA 4UFZA 2HLDG 5KMGB 4N23A 3CC7V 3CRQA 5LP6C 3UCSC 5LP6B 2QE7G 2DMXA 3OTFA 2LGWA 3ZBHA 1QVFU 3NXSA 4H0LB 1GO3F 2YEVA 2L35A 1MA1A 4WFHA 1GM9A 1AR5A 1IBLO 4O4IB 4FLZA 2IJJA 3K57A 1IX9A 1ORQC 3H01A 4QE9A 4NVPA 5JH7B 4DR7B 4MVZA 2FKXA 5KA6A 2Q69A 5J2TB 4I0XB 3K58A 1HNWB 5J9PC 4KP4A 1SQGA 5LYJB 1E79G 1JCHA 3MHSC 1YEWA 1QLNA 4FLVA 4PHZA 4GCZA 4N21A 5EBWC 3ZRWA 4PD4F 1D5NA 2HVJC 4MVOA 3TETA 1RSOB 1EFRG 5IYDO 2HEPA 4B7KA 5BZBA 2ZKOA 1MSWD 3CCQV 4GKKB 4I7ZB 3J81N 3CRCA 1N32O 3FD9A 4IYHA 3E8GA 2QTSA 3CC2V 2AGAA 4NYKA 4F4LA 1EN4A 4NXNB 3OT7A 3SPGA 1MSDA 3UO2A 1SETA 1SZXA 5L3GA 1BGYH 2JS5A 5B66Z 4MTXA 1B04A 2IJHA 1XNQO 2UXDO 2HKOA 2CK3G 4DR7O 2Y69C 2UXCB 1K92A 3JAKA 3GVMA 3I55V 4NKGB 1NH2B 3E22B 4KUMA 4FLYA 3RYCA 2A79B 2CE4A 3CCJV 2CAZC 5L3DA 1XUQA 1EN6A 2ODMA 2WLNA 1RFYA 4TSFG 2HHHB 1NJIW 1E1RG 4JZ2A 3M7MX 1JFFA 1I08A 2CDYA 1H38A 1H2SB 4DV6B 5FLXN 3X2QC 5E79Z 2H3OA 1N32B 1K7DA 3H1HH 2F4VO 3K59A 1R3JC 3L70H 4JASA 4CS4A 3U0ZA 3H1KH 5EBMC 5LOVA 2X6CA 1AR4A 1GN2A 3CXCU 1R3LC 4TV8B 4TT3G
chains in the Genus database with same CATH topology
4R8CA 2YEVB 4MTFA 3LDCA 5EC1C 4MTGA 1Y66A 2PI5A 3OFNG 3SJQC 2OT5A 3STLC 1OCRC 3AG3B 3ABKB 4YXWG 2WLJA 1K5SA 1OZ0A 3ABTA 1DTOA 1BL8A 4OXSA 4QPJA 4X8AA 5KUKA 1VQOV 2Y48A 1OCCC 4LCUC 1NVPD 2Q67A 5B1OA 1JQ0A 2ZXWB 4JAUA 2WLHA 3QO8A 3SPHA 2EIKB 3T4ZA 1PD3A 1V54B 4PELA 1YJ9V 1H8EG 3QO7A 5C93A 4EKWA 1V54C 3CPWU 3OR6C 4XDLA 1XL6A 5DN6G 1P7BA 4MVMA 1K9MW 1MABG 4P9PA 5LHIA 3SPCA 2ZXWC 5CBHA 3RVZA 4JYBA 2NNUA 5LHHA 1BHBA 2P67A 3QNEA 4UVBA 1K5QA 1LNQA 2K1EA 2H8PC 4WFFA 2EINB 1FXKB 2QEXV 2IU0A 1GM8A 2XNDG 1HWYA 3OUSA 3ZRWB 2XOKG 3JD1A 2FTKA 2JEXA 3OEHG 3A0RA 5KA5A 2OCCB 1UJWB 2W0FC 2LFRA 3EFFK 3MHHC 3ASOB 3RW0A 1MG1A 3ABUA 4XDJA 2WWWA 4X89A 3OAAG 5L3FA 5LHGA 5CN0A 2B1IA 4DO2A 1NQTA 1S77D 3ZRSA 5CA3A 1CEZA 1OHHG 2AHZA 1I5YA 4GT1A 5B1BB 5H6RA 3E83A 5CBGA 3ML0A 1AR1B 4RQFA 4FIPC 4U7NA 1Q86W 4UV9A 3SYOA 3F5WC 4L87A 2ZR3A 4WFBV 1Y4MA 1S76D 2QM7A 2XAQA 2EIMB 1GKFA 4MSWC 5HFLA 3OR7C 3TK1A 2ZDIC 1VQ8V 1M1KW 3AG1C 2OTJV 3SPJA 4ZKIA 5HFMA 4BIZA 3EHBB 3K3WA 3FYIB 3K79A 3OM3B 1PKXA 2WLIA 2HJFC 2XAHA 1KKDA 1SESA 3JD4A 2IH1C 3HPLC 1KQSU 2WSSG 2JJ2G 1AJPA 2EILB 5DM6V 3LSQA 4FK5C 1QBZA 3RVYA 4DXWA 5B1NA 1QLEC 2IH3C 4H33A 2DYSB 1I5XA 3CC4V 1H2GA 3PJSK 2HG5C 1ZWIC 2ZDIA 1M57C 3GWOA 1THZA 3OGCC 3ASNC 1RPRA 1EBOA 2EIJB 2R9IA 3ABLB 4QNHB 3I56V 1NKDA 2H94A 4RUEA 3FB6C 4MW3A 4UXNA 4RO2A 3CCVV 1QCEA 1PNMA 1G8MA 3G71V 4PDLA 4PDMA 1GMGA 1QVGU 3JCZA 1XL4A 4CBCA 1DLBA 4JTCB 1NR7A 1VQ4V 4MT8A 3ABLC 3ABMC 5IY5B 3ASNB 4JTAB 4U7OA 3ABKC 2XAGA 3K06A 1OCCB 3AEIA 3OMIB 4G2KA 1S0VA 3VOUA 4CZZA 1F23A 5EK0A 4XBFA 4WFAV 4MS2A 3ETGA 1W2BU 1W0JG 2GSMB 1P4RA 2DQ3A 2X7RB 5B3SC 3FB7C 4JAVA 5IYCO 1R3IC 2XAJA 1PL0A 1KECA 3E86A 3AG4B 1JJ2U 1B6QA 3JD3A 1ENVA 4MW8A 4LBEC 4BIUA 1AI7A 3GB7C 4MVQA 2X6AA 3BEHA 2ZR2A 4P30A 4R6ZA 3ZRVA 1S3JA 2B5UA 3ZN0A 1SZTA 2EZOA 1QR8A 2PI4A 3JD2A 1VQMV 2DWDC 1AI6A 1R73A 3ZCCA 1SRYA 2WLKA 4P9OA 3CCSV 3IGAC 1WLEA 3B8NA 3VBBA 1M56C 5LGNA 4GX2A 4JPRA 1RM1C 3E8FA 1OCZB 3X2QB 3LSSA 5LGTA 4JYCA 1YJWV 5KUMA 2LFSA 1V55C 4FMTA 3ABMB 2HVKC 5IY5C 2ATKC 2A9HA 4R7CA 3E2EA 4FJCC 2DW4A 4ZBMA 1Q7YW 2IW5A 3ZMUA 3OMNB 4ASUG 2DYRC 4TWKA 2Q68A 3OMAB 4QPKA 2JK5C 3FYEB 4MVSA 3ZMZA 2BOBC 1QR9A 1FS0G 1FFTB 1OCOC 3E89A 4J9ZB 5EC2C 4RQEA 1VQPV 3CMAV 2QM8A 2YSUB 3ETDA 2WPDG 3OUFA 5GW7A 3D36A 5CMUA 4JF3A 2EIJC 4JGSA 5EBLC 1YHQV 3JD0A 1K33A 1WPXA 4PDVA 2Y69B 2JJ1G 2GHYA 2WLMA 1DF5A 2Q6AA 4PA6A 4H37A 2IU3A 2EINC 5LGUA 4J9YB 4BW5A 4JTDB 2XAFA 1KC8W 2V7QG 2EILC 2P7TC 2P6JA 3SYPA 4PA3A 1JVMA 1EZJA 2HFEC 1KD1W 2AHYA 4UVAA 2OTLV 4I5SA 1TUEB 4LP8A 3W7XA 1VQ7V 3E8HA 1VQKV 3OE7G 3K04A 4WFEA 2Z3YA 3SYQA 1OCOB 2EIKC 1K4CC 4HAMA 4UV8A 3G4SV 1GM7A 4PA9A 3OW2U 5B1AC 5L3CA 1AROP 3W7WA 1YIJV 2EIMC 1AI5A 4GX0A 3ZN1A 1YSCA 2ZD9A 5H9CA 1S72V 2JIZG 1V55B 3T1CA 3G6EV 1OCRB 3AG3C 2X6BA 2W6IG 3UM7A 1COWG 3LUTB 2UXXA 3CCLV 1K34A 3FB5C 4PDRA 1N8RW 3HB3B 3IFXA 3M99B 1JOYA 3D3IA 3AG2C 4HYOA 1J95A 4XDKA 1K3EA 1GTOA 2EZPA 2KB1A 5B3SB 1DF4A 4HZ3A 2MK3A 4QJFB 1NBMG 3P32A 4G28B 3KG2A 2Z5UA 2IJKA 1BMFG 1FXKA 1F51A 4MVUA 2UXNA 4G27B 4RUFA 3K0DA 1VQ5V 3LDDA 1FXKC 4R50A 1NVPB 4Q20A 2QKSA 1M90W 5L3EA 1H8HG 1R3KC 3K9AA 1Q82W 2HLDG 3K03A 3MD0A 4N23A 4QIWF 3DGEA 3CC7V 2NLJC 2QE7G 3LNMB 4UUJC 3CP1A 2W6JG 1VQ6V 1QVFU 3NXSA 5FL7G 1GO3F 2YEVA 3W7SA 3CCUV 4X88A 4Z1MG 2M7WA 1YJNV 1K4DC 1M57B 3F7VC 2BOCC 1VQ9V 1RM1B 1IXMA 3BY6A 4WFHA 5LBQA 1GM9A 1QLEB 5CBFA 4UVCA 4WCEV 3R65A 4GX1A 2IJJA 1ORQC 1FXVA 3H01A 4KFMA 5IDJA 3B77A 2JEUA 3B8MA 5E1AC 5IYBO 1VQNV 4QE9A 1GK9A 1CP9A 2WLIB 3CCRV 3SYCA 2HR3A 2WLLB 3AG2B 4MVZA 1AJQA 2EBOA 2ITCC 5KA6A 2Q69A 4PA7A 3LDEA 3K08A 3ETEA 3CCMV 5J9PC 3DTUB 1SERA 4KP4A 3ZMSA 3ZJZA 3K0GA 1E79G 5L3BA 1JCHA 3MHSC 1R6NA 5B1AB 1QLNA 3ZIAG 3WG7C 4GCZA 2V1DA 2DWEC 4N21A 5EBWC 1BHAA 3ZRWA 2LP7A 1K8AW 4LC1A 3CYOA 2HVJC 1S5HC 1M56B 1NR1A 4MVRA 1EFRG 4MVOA 2A0LA 3FB8C 3TETA 5IYDO 3JYCA 5BZBA 1YI2V 1MSWD 3CCQV 4E2LA 3IC7A 4WF9V 1MOFA 1KP2A 3ASOC 4QE7A 3T2MA 4I9WA 1ROPA 2JDIG 3E8GA 3FKSG 1L1FA 3CC2V 1JX9A 4F4LA 3F7YC 4FPPA 3SPGA 1SETA 3AG4C 5L3GA 2DYSC 1AI4A 4MTXA 1KP3A 2IJHA 3WFVA 2X0LA 4P2ZA 1K97A 2D3OW 3SYAA 2HKOA 4WFGA 2EJRA 3UKMA 2CK3G 1RPOA 1JPXA 1AJNA 2Y69C 1YTFD 3ZMTA 3W7UA 1K92A 2WAMA 2QA4V 1VQLV 2R9RB 2XASA 2ZQMA 3I55V 3QO5A 1NH2B 2WLLA 1Q81W 2ITDC 1PNKA 4KUMA 3W7TA 2B1GA 2A79B 3OEEG 1PNLA 3CCJV 1YITV 5L3DA 1M9NA 2WLNA 4BAYA 3CD6V 1F4NA 2DYRB 1K73W 4TSFG 3RBZA 1NJIW 3AG1B 1R6KA 1G4YB 1E1RG 3T4DA 1YTFB 3WG7B 2IJIA 3STZC 2DQ0A 3SPIA 1H38A 4GX5A 4MTOA 2P90A 1OCZC 3X2QC 1NH2D 5B1BC 1FXHA 2C2AA 3TCUA 1K7DA 1W0KG 4RAIA 3P30A 1R3JC 3E35A 4JASA 1F4MA 3E8BA 2F43G 2QTOA 3ZMVA 3ZRXA 5EBMC 1CPYA 1E1QG 2X6CA 4PA4A 3CMEV 3CXCU 2OCCC 1R3LC 3CCEV 5H6QA 4TT3G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DLB A;  3MHH C;  1I5X A;  1QR9 A;  1SZT A;  1Y66 A;  2P6J A;  5HFM A;  2EZO A;  1MG1 A;  1QR8 A;  2M7W A;  2OT5 A;  5H9C A;  1JPX A;  4E2L A;  2EBO A;  3GWO A;  1MOF A;  5KA6 A;  5CN0 A;  4G2K A;  1EBO A;  3B8N A;  5CMU A;  1F23 A;  4JF3 A;  1K34 A;  3P30 A;  4JGS A;  4JPR A;  2X7R B;  1I5Y A;  3MHS C;  1K33 A;  1QCE A;  3K9A A;  3M99 B;  1JQ0 A;  4FIP C;  4N23 A;  3H01 A;  1DF5 A;  1Y4M A;  3B77 A;  4N21 A;  3B8M A;  1ENV A;  2EZP A;  5HFL A;  4FJC C;  2LP7 A;  3CP1 A;  5KA5 A;  1DF4 A;  4FK5 C;  1QBZ A;  3CYO A;  2MK3 A;  3WFV A; 
#chains in the Genus database with same CATH topology
 2YC0 A;  3MAQ A;  2PI5 A;  1Y66 A;  3ABK B;  2ZE6 A;  2QWO B;  3SR2 C;  1OZ0 A;  3ABT A;  4OXS A;  3TXQ A;  4X8A A;  5KUK A;  2Y48 A;  3TXS A;  5IWA B;  1OCC C;  1O9G A;  1W59 A;  1OJH A;  2E5L B;  1JQ0 A;  4JAU A;  2WLH A;  1V54 B;  1H8E G;  2HHH O;  3QO7 A;  2YIB D;  5C93 A;  3OR6 C;  1XL6 A;  1JMK C;  1I94 B;  3AK2 A;  4MVM A;  2ZE5 A;  5LHI A;  2PF4 E;  4DV1 O;  4IHJ A;  4OX9 O;  2OYQ A;  1QU7 A;  1K5Q A;  2K1E A;  1IBL B;  4W4L A;  1Q6H A;  2QEX V;  1ZLZ A;  2CTR A;  1A32 A;  1HWY A;  1NT2 B;  1AB3 A;  4LFC B;  3D3Q A;  4B3S O;  1Y76 B;  4D7T A;  4FM0 A;  2W0F C;  4LF4 O;  3EFF K;  3RW0 A;  1MG1 A;  2WWW A;  4GYC B;  4DV7 B;  1FFX B;  1HNW O;  4GLX A;  4DUZ O;  3ZRS A;  2AHZ A;  5B1B B;  4ZHQ A;  4DV3 O;  4RQF A;  3L71 H;  4QGP A;  3F5W C;  3JAR A;  1S76 D;  3ZX6 A;  3TK1 A;  3OR7 C;  2OTJ V;  3JAT B;  4Z2W A;  4ZKI A;  5HFM A;  1Y76 A;  4IIJ A;  4NB5 A;  4GKK O;  1PKX A;  2HJF C;  2YXH A;  4JZG A;  4IT5 A;  4JI7 O;  3B2E E;  4LF8 B;  1KKD A;  1P84 F;  2IH1 C;  1AVM A;  1KQS U;  2UUC O;  3HKE A;  5KHH A;  1M93 A;  3ZHR A;  4LH7 A;  5JVD B;  4KXR A;  4LF7 O;  4DXW A;  4DR3 B;  5B1N A;  4EB6 B;  1ZL8 B;  1Z2G A;  5EYP B;  3VQW A;  5LA6 A;  1M57 C;  3OGC C;  3RYF B;  5J2U A;  2EIJ B;  3I56 V;  2H94 A;  1IBM B;  4RO2 A;  4YJ2 B;  1QCE A;  4JI5 O;  4CS2 A;  3G71 V;  1KBH A;  2A3Q A;  4PDL A;  1GMG A;  4J11 A;  1Y74 B;  1NR7 A;  4NTX A;  4BWA A;  4MT8 A;  3ABM C;  4X64 B;  5A9G A;  4JTA B;  1I0H A;  3K06 A;  3AEI A;  4G2K A;  3S3W A;  2O57 A;  4WFA V;  4MS2 A;  1W2B U;  2GSM B;  3L9D A;  1RSO A;  5B3S C;  4Q6G A;  1PL0 A;  1KEC A;  5JWP A;  1J5E B;  4BIU A;  2AW9 A;  4MVQ A;  4UCU A;  5IJ9 A;  2ZR2 A;  3ZHU A;  1SZT A;  4OPA A;  2EZO A;  1X4T A;  2WLK A;  3K5O A;  3CCS V;  4H44 B;  1YVW A;  2GUZ A;  3IGA C;  2Q0O C;  1M56 C;  3P3N A;  1YJW V;  1OCZ B;  1H2M A;  4JI6 O;  4JYC A;  4CH4 A;  4YIP A;  4JI5 B;  4JYA B;  2BSK B;  3ABM B;  2A9H A;  2FML A;  3FAV B;  5LL6 Y;  2IW5 A;  5C8Y A;  3ZMU A;  3OMN B;  2DYR C;  1AP6 A;  2JK5 C;  4MVS A;  1CXZ B;  1VQP V;  1OCO C;  4RQE A;  3Q4H A;  5GW7 A;  5LXT A;  4FM2 A;  5AG2 A;  4DV1 B;  2FL4 A;  4OX9 B;  5EBL C;  3U11 A;  2QKA A;  3P3P A;  2Y4T A;  2GHY A;  2UUB O;  2ZCE A;  2IU3 A;  4TQD A;  2XAF A;  1KC8 W;  2QGN A;  2BSK A;  1BSM A;  2UXB B;  2LO1 A;  3MDS A;  2AHY A;  1KD1 W;  4I5S A;  4DV2 B;  1VQ7 V;  1VQK V;  3OE7 G;  4NXM B;  2NR5 A;  2YDE A;  1D2D A;  1OCO B;  3K5N A;  4HAM A;  1ZTE A;  4WBN A;  3G4S V;  1VP7 A;  4X66 B;  3BVO A;  2P5O A;  5IJ0 B;  1N36 O;  3B40 A;  1LUW A;  3N2G B;  3A8T A;  1R1B A;  3LUT B;  4LF8 O;  1K34 A;  1V9P A;  3FB5 C;  3KKY A;  4YY3 B;  4UCO A;  2UUC B;  4PJ0 Z;  2A06 H;  2CTP A;  1JOY A;  3AG2 C;  1J95 A;  2ZIM A;  4I50 B;  2BTQ B;  4XDK A;  2EZP A;  2KB1 A;  5B3S B;  3BRC A;  2MK3 A;  4FLU A;  1BMF G;  4DW0 A;  1F51 A;  4NTW A;  5IJ0 A;  1EM1 A;  2ZIO A;  4DR4 B;  1JJO A;  2QKS A;  1WNS A;  5L3E A;  3ZHQ A;  1R3K C;  3ZHV A;  1Q82 W;  1SS3 A;  2E5L O;  4QIW F;  1Q43 A;  1FFX A;  2Y4U A;  1Z5W A;  2Q4P A;  2RJZ A;  3RT3 C;  4KL1 A;  3RWR D;  3CCU V;  4X88 A;  1YJN V;  2M7W A;  2VQE O;  2ZIN A;  2BOC C;  1VQ9 V;  1XQ8 A;  5D5P A;  2OIE A;  3JAS B;  3OTO B;  5CBF A;  4UVC A;  3R65 A;  4GX1 A;  2PUS A;  5IDJ A;  2ADQ B;  3B8M A;  4UCT A;  5IYB O;  4ICG A;  1CP9 A;  3CCR V;  3FX7 A;  2Y0I A;  5CB4 A;  4I4T B;  2HR3 A;  2D2C B;  4J80 A;  1AJQ A;  4DR4 O;  4PA7 A;  2VRZ A;  3LDE A;  2P22 C;  3ETE A;  3CCM V;  4B3T B;  4X65 B;  3N2K B;  3ZMS A;  1SC5 B;  3K0G A;  3BA8 A;  2FB5 A;  4JI6 B;  1R6N A;  5EZY A;  4YHH B;  5GTI Z;  2XTA A;  5IYZ B;  4CH5 A;  3JAW B;  1BHA A;  2LP7 A;  4LC1 A;  5K1P A;  4UB8 Z;  4X20 B;  1M56 B;  1NR1 A;  5CA1 B;  4DV4 B;  4I55 A;  4ABM A;  1YI2 V;  1M4U A;  5CB4 B;  1IZ3 A;  4WF9 V;  3CS5 A;  1LR1 A;  3T2M A;  1KP2 A;  3ASO C;  4C7U A;  1ROP A;  4JI8 B;  1EZV H;  1XOU A;  4O4J A;  1JX9 A;  2F66 C;  3F7Y C;  2XT9 A;  4TV8 A;  2JGU A;  3N27 A;  3AG4 C;  2DYS C;  3H1J H;  1AI4 A;  4LF7 B;  3WFV A;  4X62 B;  4RWU A;  4DUY O;  1XNR O;  3L72 H;  1G1X B;  3SYA A;  1RPO A;  4J7J A;  3ZMT A;  1VQL V;  2VQF B;  2KKW A;  2F1M A;  1Q81 W;  1PNK A;  3OEE G;  3O65 A;  1NU1 H;  3I5D A;  4BAY A;  3CD6 V;  1F4N A;  2DYR B;  3R66 A;  3AG1 B;  1R6K A;  4EEQ A;  5GON B;  2LQT A;  4TV9 A;  3SPI A;  3ETQ A;  1VF7 A;  4U3J B;  3SJA C;  1FXH A;  1W0K G;  1BZK A;  4EFB A;  3E35 A;  4NXN O;  2QTO A;  1GN6 A;  3ZRX A;  4FFK A;  1CPY A;  3OGI B;  2QM4 A;  3CME V;  4AQY B;  1SA0 A;  1VF6 C;  5H6Q A;  1S77 D;  2YEV B;  5EC1 C;  2ZM6 O;  1IUR A;  1QQC A;  4ZHQ B;  1OCR C;  4YXW G;  4DRX B;  3BPZ A;  3JAR B;  1DTO A;  1BL8 A;  2VQF O;  1VQO V;  4LCU C;  1N33 O;  5B1O A;  3QO8 A;  3SPH A;  2DOS A;  1YJ9 V;  4X1I A;  3S3X A;  1V54 C;  5DN6 G;  2LW7 A;  4O2A A;  1H2L A;  5JJJ B;  1MNG A;  5CBH A;  2LGQ A;  5J2T A;  3UT5 A;  2DE0 X;  5KHK A;  2F23 A;  2F4V B;  2P67 A;  4B7E A;  4UVB A;  1FXK B;  1PPJ H;  4X1Y A;  2QR4 A;  3OUS A;  3ZRW B;  2XOK G;  3QF7 A;  1U97 A;  2FTK A;  2JEX A;  3OEH G;  5LA6 B;  5KAF Z;  3SGI A;  5BXZ A;  1YZB A;  5KMG A;  2JS3 A;  4XDJ A;  4X89 A;  2YI9 A;  3OAA G;  2BTQ A;  4IGG A;  2B1I A;  5CA3 A;  1CEZ A;  5DED A;  3APO A;  5CBG A;  4U7N A;  4O4L B;  1OV9 A;  1Q90 D;  2XAQ A;  1M1K W;  3AG1 C;  4YIO A;  4LWS B;  2Q9L A;  3CE2 A;  3EHB B;  3K79 A;  4DW1 A;  3OM3 B;  4K8X A;  4PV1 B;  2CUG A;  3WB0 A;  1AJP A;  1XBL A;  1D5A A;  4TUY A;  4DR5 O;  1TAE A;  4UCS A;  2EUL A;  4IHJ B;  2EIL B;  2L6L A;  3JAL A;  4JAA A;  2Q73 A;  5DM6 V;  1QBZ A;  4X62 O;  3IC9 A;  3SJC C;  2IH3 C;  1XNR B;  1Q6U A;  2DYS B;  1I5X A;  1ZWI C;  3DXR A;  4NR1 A;  3L75 H;  3GWO A;  4DV7 O;  1THZ A;  2EX3 A;  3ASN C;  2R9I A;  3PN1 A;  1GN3 A;  4RUE A;  1SQV H;  2E74 B;  4DV3 B;  4UCV A;  3CRA A;  1TVK A;  1VIB A;  4PDM A;  4I9Q A;  1QVG U;  3Q4H B;  4ZI7 B;  4CBC A;  4AI8 A;  1DLB A;  4LFA B;  5EZY B;  5IYZ A;  1OCC B;  3OMI B;  3VOU A;  1F23 A;  4B3R B;  3ETG A;  1P4R A;  5CA1 A;  3FB7 C;  4JAV A;  5IYC O;  4DR5 B;  3E86 A;  1XRE A;  4DK1 A;  1Q3E A;  1ENV A;  2RNB A;  1HNX O;  3HKE B;  3ZRV A;  2AZ2 A;  1S3J A;  3ZN0 A;  1JR9 A;  1YDX A;  1ZX3 A;  2P4V A;  1AI6 A;  4GUN A;  3ZCC A;  1SRY A;  4X1K B;  3B8N A;  2PGG A;  3VBB A;  4DV2 O;  4GX2 A;  3HKC A;  4JPR A;  1RM1 C;  1JFF B;  5LGT A;  1V55 C;  3CXH F;  4J42 A;  2F93 B;  1GN4 A;  1WP8 A;  3G6B A;  4ZBM A;  3E2E A;  2OIG A;  1PP9 H;  4QPK A;  3T1Y O;  1I94 O;  3ZMZ A;  2CTW A;  3F5T A;  3OUF A;  1N34 B;  3D36 A;  5CMU A;  4JGS A;  1VMG A;  1YF2 A;  1YHQ V;  3JD0 A;  5GON A;  4PDV A;  1KB9 F;  1DF5 A;  2Q6A A;  4F6R B;  4DR6 O;  4BW5 A;  4JTD B;  1LUV A;  2V7Q G;  4AIL C;  2EIL C;  2GDS A;  1EZJ A;  2HFE C;  4O4H A;  4JI2 B;  1TUE B;  4LP8 A;  2DN9 A;  3K04 A;  4DV0 B;  2EIK C;  4UV8 A;  1VF5 B;  3OW2 U;  3W7W A;  3A0H Z;  4GX0 A;  3RYI B;  3ZN1 A;  1YSC A;  3C3T A;  3G6E V;  4GKJ B;  2CTQ A;  2UXX A;  3OTO O;  2PY5 A;  1MZF A;  1US6 A;  2KG7 B;  3CX5 F;  3HB3 B;  4OPH A;  4JI1 O;  3D3I A;  4FZ1 A;  3AK3 A;  1YXB A;  1DF4 A;  2IBZ H;  3L74 H;  3UQ8 A;  2MW2 B;  1NBM G;  2R9A A;  2IJK A;  2ZNJ A;  1H2N A;  1FXK A;  4MVU A;  5D5Q A;  5KX5 A;  1HNZ B;  4RUF A;  3K0D A;  5JJN B;  1FXK C;  4LF9 B;  1M90 W;  5GTH Z;  1H8H G;  4BW9 A;  3K9A A;  5ITZ B;  3MD0 A;  3DGE A;  4JI4 B;  4UB6 Z;  3LNM B;  4X66 O;  2W6J G;  1VQ6 V;  1MZE A;  2YUA A;  3W7S A;  5FPR A;  4LF6 O;  1TUB B;  1K4D C;  4O4J B;  4NTY A;  3F7V C;  1ZSP A;  1O9H A;  4GKJ O;  1IXM A;  3APQ A;  1PL4 A;  4CC5 A;  1GAX A;  2E3C A;  1ZL8 A;  5EYP A;  4TOI A;  1FJG O;  4KFM A;  1KU9 A;  5E1A C;  1VQN V;  3RYF A;  4B3S B;  3SYC A;  3C3S A;  3TJT A;  4JI0 O;  2WLL B;  4LF5 B;  2HP8 A;  2ITC C;  4ZOL A;  2UXC O;  2ZE8 A;  3K08 A;  3WB1 A;  4O2B A;  1TUB A;  3CHX A;  1SER A;  1S5J A;  5A2Q N;  1N0N A;  5B1A B;  2ZT9 B;  1L0L H;  3ZIA G;  4FM1 A;  1DK1 A;  3WG7 C;  2DWE C;  4JI3 B;  4GZR B;  3B09 A;  1BCC H;  3CYO A;  4MVR A;  3FB8 C;  1FPO A;  1SQB H;  3KZI Z;  4E2L A;  4E4E A;  4D6T H;  1MOF A;  4TQF A;  2CH7 A;  4I9W A;  1NI8 A;  3ICX A;  5JH7 A;  3K5M A;  5KHJ A;  1L1F A;  3HKB B;  4O2B B;  4DRX A;  4DV5 B;  4DR3 O;  4K8Z A;  1K97 A;  2EJR A;  3UKM A;  1JPX A;  1AJN A;  5FNV B;  1YTF D;  3BAB A;  3W7U A;  3FAV A;  2WAM A;  5K1X A;  2QA4 V;  2R9R B;  2DJV A;  2ZQM A;  3QO5 A;  2R72 A;  4NXM O;  2ITD C;  3W7T A;  4U3F H;  1PNL A;  4O2A B;  1YIT V;  2XHB A;  4JI3 O;  1K73 W;  3RBZ A;  1G4Y B;  3T4D A;  2JRI A;  3WG7 B;  2IJI A;  3STZ C;  4X64 O;  4IYI A;  4GX5 A;  4MTO A;  1OCZ C;  1NH2 D;  2C2A A;  1XDC A;  4RAI A;  3P30 A;  3QVN A;  3CB2 A;  2K9P A;  1L8D A;  1UPG A;  4JI1 B;  3ZMV A;  1F4M A;  2F43 G;  2YIC A;  1KUQ A;  1E1Q G;  4LFC O;  4UV9 A;  2GTS A;  3CCE V;  4DV5 O;  4LF4 B;  2Q0A A;  2RN9 A;  3OFN G;  3SJQ C;  5F2V O;  3STL C;  3AG3 B;  1K5S A;  3JAS A;  4BIO A;  4LF9 O;  4DUZ B;  4QPJ A;  4BR6 A;  3T1H B;  2Q67 A;  1JA8 A;  2PZS A;  2ZXW B;  3WB2 A;  1NZ6 A;  4B3M O;  1Q6I A;  3N2G A;  3T4Z A;  4PEL A;  1B06 A;  4EKW A;  3CPW U;  4XDL A;  1P7B A;  1K9M W;  1IDS A;  2E76 B;  5LHH A;  1BHB A;  3U10 A;  3KCX A;  3BAA A;  4DR2 B;  4TV9 B;  3THO A;  2CGN A;  1LNQ A;  2OCH A;  2P4K A;  3HKC B;  2IU0 A;  1GM8 A;  3H1L H;  1U96 A;  3JD1 A;  2UUB B;  3RGB A;  3LSU A;  5KA5 A;  3DC5 A;  1UJW B;  4IIJ B;  3MHH C;  2KG7 A;  2JVD A;  4JI0 B;  3ASO B;  3ABU A;  4LF5 O;  2WA3 A;  4FZ0 A;  2E75 B;  1SA0 B;  1VF6 A;  1F7Y A;  3QTC A;  1OHH G;  4GT1 A;  1I5Y A;  4DV0 O;  3ML0 A;  1DGS A;  1Q5O A;  4FIP C;  2WA4 A;  3SYO A;  4WFB V;  1Y4M A;  2M6Y A;  2ZDI C;  1VQ8 V;  5IT9 N;  3SPJ A;  3JCU Z;  1H2K A;  1EN5 A;  2GTA A;  4LFA O;  1WB7 A;  2JGD A;  4DV4 O;  1NTM H;  3FYI B;  4X1I B;  2WLI A;  2Z0A A;  1SES A;  3JD4 A;  1WPB A;  4B08 A;  3HPL C;  2RCV A;  1SQP H;  2WSS G;  2JJ2 G;  4UCR A;  1HNX B;  3LSQ A;  2UU9 B;  5EIB C;  3G80 A;  1QLE C;  4X1Y B;  2PYJ A;  4O4I A;  3UO3 A;  2YS8 A;  3J80 N;  2HG5 C;  4YJ3 A;  3JSL A;  3DSQ A;  1HNZ O;  1RPR A;  1EBO A;  4QNH B;  1IBK O;  3FB6 C;  4UXN A;  3CCV V;  4DR1 O;  1PNM A;  1G8M A;  1PV0 A;  5IJ9 B;  4K0K B;  1WP7 A;  1AP5 A;  1L0N H;  1URF A;  1NTZ H;  4I0X A;  1WA8 A;  1WN7 A;  1HW7 A;  1XL4 A;  2CGO A;  4O4L A;  5EIB D;  1BQ0 A;  3H1I H;  4LF6 B;  3ASN B;  4U7O A;  1VEW A;  1P49 A;  1S0V A;  3D8C A;  4XBF A;  1W0J G;  2X7R B;  2DQ3 A;  3GWK C;  1R3I C;  2XAJ A;  2YXY A;  1XMO O;  1SQF A;  4O4H B;  1AI7 A;  3GB7 C;  2X6A A;  3BEH A;  4P30 A;  1Q8I A;  2OWO A;  4KHP B;  1QR8 A;  2PI4 A;  3JD2 A;  1WA8 B;  2DWD C;  1PM9 A;  1WLE A;  2BTO A;  3E8F A;  3X2Q B;  2YXL A;  3LSS A;  2FYU H;  1I7F A;  2IM9 A;  4FMT A;  3RYH A;  2HVK C;  2ATK C;  4R7C A;  4JV5 O;  2DW4 A;  3A0B Z;  1Q7Y W;  4J7K A;  4J10 A;  3CEI A;  3E22 A;  2HJD A;  3E89 A;  5EC2 C;  3RYC B;  3CMA V;  2QM8 A;  2YSU B;  3ETD A;  2WPD G;  2AXT Z;  4JF3 A;  4DR2 O;  1FAF A;  1R6T A;  1K33 A;  5LYJ A;  2Q7H A;  2JJ1 G;  1WAZ A;  2ILM A;  1KKC A;  3AK1 A;  4H37 A;  3DC6 A;  3CJH A;  3RYH B;  4DUY B;  1Y6X A;  4LWS A;  3H9V A;  1XNQ B;  2P7T C;  2P06 A;  3VQX A;  4PA3 A;  4X9Q A;  5LMU O;  3W7X A;  5H2F Z;  5LP6 A;  2N04 A;  3E8H A;  5LMN O;  4LH6 A;  4WFE A;  5JCO C;  3SYQ A;  4PI0 A;  4FVM A;  4JYA O;  3JAL B;  1GM7 A;  4PI2 A;  1ARO P;  2EIM C;  2A7W A;  3ZED A;  2ZD9 A;  3T1C A;  3CJH B;  1OCR B;  1N34 O;  1COW G;  3CCL V;  5BMV A;  1N8R W;  4HYO A;  3OD4 A;  3D36 C;  1K3E A;  4ZI7 A;  4HZ3 A;  3ZS8 C;  2VWJ A;  3P32 A;  2ZE7 A;  4FLW A;  5LMU B;  3LDD A;  1NVP B;  4JI2 O;  4LR3 A;  1TA8 A;  1S5L Z;  4B3T O;  3T1H O;  1IBM O;  1QHT A;  3HKD B;  5IWA O;  1N33 B;  3K03 A;  4YHH O;  2VWK A;  4I4T A;  4Z1V A;  2NLJ C;  5CA0 B;  4UUJ C;  3CP1 A;  5LOV B;  1SKV A;  5KLV H;  5FL7 G;  4DK0 A;  2AZ0 A;  4Z1M G;  3G67 A;  1M57 B;  1ZUQ A;  2KSD A;  1RM1 B;  1T5E A;  1N4C A;  4JI8 O;  3BY6 A;  5LBQ A;  1QLE B;  4WCE V;  3WU2 Z;  1XEQ A;  4J41 A;  1FXV A;  3K9S A;  5JQG B;  3B77 A;  2JEU A;  1GK9 A;  2WLI B;  5FNV A;  1J5E O;  2QWR B;  3CSX A;  3AG2 B;  2EBO A;  1AIL A;  1HDJ A;  1MMM A;  4FLT A;  1P7G A;  3DTU B;  3ZJZ A;  4JYY A;  2VS0 A;  5L3B A;  2W0X A;  2LJ2 A;  3BA9 A;  1ZAU A;  2V4D A;  2V1D A;  4F6R A;  5B5E Z;  1K8A W;  1M5I A;  1S5H C;  1XIL A;  2A0L A;  2Q5Z A;  1HR0 B;  1UFI A;  3CWB H;  3JYC A;  2VQE B;  1XMQ O;  3IC7 A;  2QWP B;  4QE7 A;  2JDI G;  3FKS G;  2ETN A;  3K5L A;  1QNM A;  4FPP A;  3O9O A;  3TGU H;  1N0J A;  4X1K A;  2YID A;  2QSA A;  1KP3 A;  1RP3 B;  2X0L A;  4P2Z A;  2D3O W;  2ZM6 B;  4WFG A;  2JGD B;  1IVS A;  1NTK H;  1XHX A;  3C90 A;  2XAS A;  5LMN B;  2WLL A;  4DR1 B;  2B1G A;  1M9N A;  4D7S A;  5BR8 B;  4K35 A;  4DYL A;  2GV9 A;  4IL6 Z;  1YTF B;  5KX5 B;  1HR0 O;  2DQ0 A;  2RQ6 A;  4H13 B;  4EFE A;  2P90 A;  1SQQ H;  5B1B C;  5IE9 A;  3TCU A;  3RN4 A;  4B3R O;  5ITZ A;  3B4S A;  3NR7 A;  3E8B A;  2QWN B;  1KYO F;  4PA4 A;  2OCC C;  4W4K A;  4R8C A;  4MTF A;  3LDC A;  5DEC A;  4MTG A;  1Y74 A;  5KHG A;  2OT5 A;  4HNA B;  2B9Z A;  2WLJ A;  1BS3 A;  1NVP D;  4CH3 A;  3M8A A;  3RYI A;  3A2F A;  2EIK B;  5BR8 O;  3EVK A;  1PD3 A;  1BT8 A;  3T1Y B;  1MAB G;  4P9P A;  1GH6 A;  3SPC A;  2ZXW C;  3RVZ A;  4JYB A;  2NNU A;  4WBN B;  2NN4 A;  3QG5 A;  4JI7 B;  2EJ7 A;  5H5N A;  3QNE A;  4HNA A;  1B3Q A;  2H8P C;  4WFF A;  2EIN B;  4J7Z A;  4LNU B;  2ADP A;  5FPO A;  2XND G;  4EB6 A;  2R70 A;  2PYL A;  2UUA O;  3A0R A;  2BCC H;  4DR6 B;  2F95 B;  2OCC B;  2LFR A;  3EXA A;  1X59 A;  4YJ2 A;  2UXB O;  1BE3 H;  5L3F A;  2CH7 B;  5LHG A;  5CN0 A;  5BY1 A;  5LXT B;  2GBO A;  4AHC A;  4DO2 A;  1NQT A;  2Q8V A;  3HKB A;  3E83 A;  5H6R A;  1AR1 B;  1Q86 W;  4B3M B;  4L87 A;  2ZR3 A;  2QM7 A;  2BE3 A;  2EIM B;  1GKF A;  4MSW C;  5HFL A;  1XI1 A;  1WB8 A;  1N36 B;  1XHZ A;  4BIZ A;  3K3W A;  1XMQ B;  3JAK B;  4FLX A;  5CA0 A;  2XAH A;  3ZHS A;  1TVK B;  4YY3 O;  2Y0P A;  4ZOL B;  2UUA B;  4FK5 C;  3RVY A;  2QJ1 A;  3CRR A;  4H33 A;  4K3A A;  4L8J A;  3CC4 V;  3IAY A;  1H2G A;  3PJS K;  2UXD B;  2ZDI A;  3J7A U;  3ABL B;  5KHI A;  1NKD A;  4MW3 A;  4CH6 A;  2Q7G A;  1SQX H;  3SJB C;  4JV5 B;  4I50 A;  3JCZ A;  3JSN A;  4TUY B;  1WJZ A;  4JTC B;  1VQ4 V;  3ABL C;  1Z5V A;  5IY5 B;  4DV6 O;  3JAT A;  3ABK C;  1IXB A;  2XAG A;  2Q7E A;  4CZZ A;  5EK0 A;  3DXR B;  1FD9 A;  4X20 A;  1SF9 A;  4I55 B;  5JJE B;  3AG4 B;  2RMK B;  1JJ2 U;  1B6Q A;  3JD3 A;  4MW8 A;  2UU9 O;  4LBE C;  4R6Z A;  2B5U A;  1YCI A;  1VQM V;  5JVD A;  2QWQ B;  1R73 A;  4CS3 A;  4P9O A;  5LGN A;  4X65 O;  4YJ3 B;  2ZNI A;  5KUM A;  1BQZ A;  2LFS A;  4K0K O;  3SDL A;  5IY5 C;  4FJC C;  4A5U B;  2ARH A;  4LFB O;  4ASU G;  4TWK A;  2Q68 A;  3OMA B;  1HP8 A;  3FYE B;  2BOB C;  1QR9 A;  1FS0 G;  1FFT B;  4J9Z B;  5BMV B;  3ZHT A;  3HR0 A;  4F6E A;  2EIJ C;  1WPX A;  2Y69 B;  4FFB A;  2WLM A;  4OGQ B;  3AG7 A;  2G38 A;  4PA6 A;  1XMO B;  5LGU A;  2EIN C;  3JAW A;  4ZIB A;  4J9Y B;  1Y67 A;  2PTM A;  4KHP O;  2P6J A;  3SYP A;  1TGO A;  3KCY A;  2QKC A;  1JVM A;  3HKD A;  3VQV A;  4CC6 A;  4UVA A;  2OTL V;  5JCO A;  1GRJ A;  5TIS Z;  2Z3Y A;  2YIA A;  2GUZ B;  4JI4 O;  1K4C C;  2RDC A;  4PA9 A;  5B1A C;  5L3C A;  3BHP A;  4LFB B;  4FFB B;  2XUM A;  1YIJ V;  2YIB A;  1AI5 A;  3L73 H;  2QDO A;  1VAR A;  5H9C A;  3FFQ A;  1S72 V;  2JIZ G;  1V55 B;  5C8Y B;  3AG3 C;  5J2U B;  2X6B A;  2W6I G;  5KAI Z;  3UM7 A;  5JQG A;  2YI8 A;  4PDR A;  1G6U A;  3IFX A;  3M99 B;  3JAM N;  4HBN A;  1FJG B;  3RFR A;  1GTO A;  3UT5 B;  3LNN A;  4AQY O;  3BFR A;  3IJ4 A;  4QJF B;  4G28 B;  2N74 A;  3KG2 A;  2Z5U A;  3N2K A;  4LNU A;  1KMI Z;  3VQY A;  2N05 A;  2UXN A;  4G27 B;  1FKA O;  1VQ5 V;  3BCC H;  1NS1 A;  4R50 A;  2LW1 A;  2KQX A;  4Q20 A;  4U3J A;  1FYJ A;  1IBK B;  3CRM A;  4UFZ A;  2HLD G;  5KMG B;  4N23 A;  3CC7 V;  3CRQ A;  5LP6 C;  3UCS C;  5LP6 B;  2QE7 G;  2DMX A;  3OTF A;  2LGW A;  3ZBH A;  1QVF U;  3NXS A;  4H0L B;  1GO3 F;  2YEV A;  2L35 A;  1MA1 A;  4WFH A;  1GM9 A;  1AR5 A;  1IBL O;  4O4I B;  4FLZ A;  2IJJ A;  3K57 A;  1IX9 A;  1ORQ C;  3H01 A;  4QE9 A;  4NVP A;  5JH7 B;  4DR7 B;  4MVZ A;  2FKX A;  5KA6 A;  2Q69 A;  5J2T B;  4I0X B;  3K58 A;  1HNW B;  5J9P C;  4KP4 A;  1SQG A;  5LYJ B;  1E79 G;  1JCH A;  3MHS C;  1YEW A;  1QLN A;  4FLV A;  4PHZ A;  4GCZ A;  4N21 A;  5EBW C;  3ZRW A;  4PD4 F;  1D5N A;  2HVJ C;  4MVO A;  3TET A;  1RSO B;  1EFR G;  5IYD O;  2HEP A;  4B7K A;  5BZB A;  2ZKO A;  1MSW D;  3CCQ V;  4GKK B;  4I7Z B;  3J81 N;  3CRC A;  1N32 O;  3FD9 A;  4IYH A;  3E8G A;  2QTS A;  3CC2 V;  2AGA A;  4NYK A;  4F4L A;  1EN4 A;  4NXN B;  3OT7 A;  3SPG A;  1MSD A;  3UO2 A;  1SET A;  1SZX A;  5L3G A;  1BGY H;  2JS5 A;  5B66 Z;  4MTX A;  1B04 A;  2IJH A;  1XNQ O;  2UXD O;  2HKO A;  2CK3 G;  4DR7 O;  2Y69 C;  2UXC B;  1K92 A;  3JAK A;  3GVM A;  3I55 V;  4NKG B;  1NH2 B;  3E22 B;  4KUM A;  4FLY A;  3RYC A;  2A79 B;  2CE4 A;  3CCJ V;  2CAZ C;  5L3D A;  1XUQ A;  1EN6 A;  2ODM A;  2WLN A;  1RFY A;  4TSF G;  2HHH B;  1NJI W;  1E1R G;  4JZ2 A;  3M7M X;  1JFF A;  1I08 A;  2CDY A;  1H38 A;  1H2S B;  4DV6 B;  5FLX N;  3X2Q C;  5E79 Z;  2H3O A;  1N32 B;  1K7D A;  3H1H H;  2F4V O;  3K59 A;  1R3J C;  3L70 H;  4JAS A;  4CS4 A;  3U0Z A;  3H1K H;  5EBM C;  5LOV A;  2X6C A;  1AR4 A;  1GN2 A;  3CXC U;  1R3L C;  4TV8 B;  4TT3 G; 
#chains in the Genus database with same CATH homology
 4R8C A;  2YEV B;  4MTF A;  3LDC A;  5EC1 C;  4MTG A;  1Y66 A;  2PI5 A;  3OFN G;  3SJQ C;  2OT5 A;  3STL C;  1OCR C;  3AG3 B;  3ABK B;  4YXW G;  2WLJ A;  1K5S A;  1OZ0 A;  3ABT A;  1DTO A;  1BL8 A;  4OXS A;  4QPJ A;  4X8A A;  5KUK A;  1VQO V;  2Y48 A;  1OCC C;  4LCU C;  1NVP D;  2Q67 A;  5B1O A;  1JQ0 A;  2ZXW B;  4JAU A;  2WLH A;  3QO8 A;  3SPH A;  2EIK B;  3T4Z A;  1PD3 A;  1V54 B;  4PEL A;  1YJ9 V;  1H8E G;  3QO7 A;  5C93 A;  4EKW A;  1V54 C;  3CPW U;  3OR6 C;  4XDL A;  1XL6 A;  5DN6 G;  1P7B A;  4MVM A;  1K9M W;  1MAB G;  4P9P A;  5LHI A;  3SPC A;  2ZXW C;  5CBH A;  3RVZ A;  4JYB A;  2NNU A;  5LHH A;  1BHB A;  2P67 A;  3QNE A;  4UVB A;  1K5Q A;  1LNQ A;  2K1E A;  2H8P C;  4WFF A;  2EIN B;  1FXK B;  2QEX V;  2IU0 A;  1GM8 A;  2XND G;  1HWY A;  3OUS A;  3ZRW B;  2XOK G;  3JD1 A;  2FTK A;  2JEX A;  3OEH G;  3A0R A;  5KA5 A;  2OCC B;  1UJW B;  2W0F C;  2LFR A;  3EFF K;  3MHH C;  3ASO B;  3RW0 A;  1MG1 A;  3ABU A;  4XDJ A;  2WWW A;  4X89 A;  3OAA G;  5L3F A;  5LHG A;  5CN0 A;  2B1I A;  4DO2 A;  1NQT A;  1S77 D;  3ZRS A;  5CA3 A;  1CEZ A;  1OHH G;  2AHZ A;  1I5Y A;  4GT1 A;  5B1B B;  5H6R A;  3E83 A;  5CBG A;  3ML0 A;  1AR1 B;  4RQF A;  4FIP C;  4U7N A;  1Q86 W;  4UV9 A;  3SYO A;  3F5W C;  4L87 A;  2ZR3 A;  4WFB V;  1Y4M A;  1S76 D;  2QM7 A;  2XAQ A;  2EIM B;  1GKF A;  4MSW C;  5HFL A;  3OR7 C;  3TK1 A;  2ZDI C;  1VQ8 V;  1M1K W;  3AG1 C;  2OTJ V;  3SPJ A;  4ZKI A;  5HFM A;  4BIZ A;  3EHB B;  3K3W A;  3FYI B;  3K79 A;  3OM3 B;  1PKX A;  2WLI A;  2HJF C;  2XAH A;  1KKD A;  1SES A;  3JD4 A;  2IH1 C;  3HPL C;  1KQS U;  2WSS G;  2JJ2 G;  1AJP A;  2EIL B;  5DM6 V;  3LSQ A;  4FK5 C;  1QBZ A;  3RVY A;  4DXW A;  5B1N A;  1QLE C;  2IH3 C;  4H33 A;  2DYS B;  1I5X A;  3CC4 V;  1H2G A;  3PJS K;  2HG5 C;  1ZWI C;  2ZDI A;  1M57 C;  3GWO A;  1THZ A;  3OGC C;  3ASN C;  1RPR A;  1EBO A;  2EIJ B;  2R9I A;  3ABL B;  4QNH B;  3I56 V;  1NKD A;  2H94 A;  4RUE A;  3FB6 C;  4MW3 A;  4UXN A;  4RO2 A;  3CCV V;  1QCE A;  1PNM A;  1G8M A;  3G71 V;  4PDL A;  4PDM A;  1GMG A;  1QVG U;  3JCZ A;  1XL4 A;  4CBC A;  1DLB A;  4JTC B;  1NR7 A;  1VQ4 V;  4MT8 A;  3ABL C;  3ABM C;  5IY5 B;  3ASN B;  4JTA B;  4U7O A;  3ABK C;  2XAG A;  3K06 A;  1OCC B;  3AEI A;  3OMI B;  4G2K A;  1S0V A;  3VOU A;  4CZZ A;  1F23 A;  5EK0 A;  4XBF A;  4WFA V;  4MS2 A;  3ETG A;  1W2B U;  1W0J G;  2GSM B;  1P4R A;  2DQ3 A;  2X7R B;  5B3S C;  3FB7 C;  4JAV A;  5IYC O;  1R3I C;  2XAJ A;  1PL0 A;  1KEC A;  3E86 A;  3AG4 B;  1JJ2 U;  1B6Q A;  3JD3 A;  1ENV A;  4MW8 A;  4LBE C;  4BIU A;  1AI7 A;  3GB7 C;  4MVQ A;  2X6A A;  3BEH A;  2ZR2 A;  4P30 A;  4R6Z A;  3ZRV A;  1S3J A;  2B5U A;  3ZN0 A;  1SZT A;  2EZO A;  1QR8 A;  2PI4 A;  3JD2 A;  1VQM V;  2DWD C;  1AI6 A;  1R73 A;  3ZCC A;  1SRY A;  2WLK A;  4P9O A;  3CCS V;  3IGA C;  1WLE A;  3B8N A;  3VBB A;  1M56 C;  5LGN A;  4GX2 A;  4JPR A;  1RM1 C;  3E8F A;  1OCZ B;  3X2Q B;  3LSS A;  5LGT A;  4JYC A;  1YJW V;  5KUM A;  2LFS A;  1V55 C;  4FMT A;  3ABM B;  2HVK C;  5IY5 C;  2ATK C;  2A9H A;  4R7C A;  3E2E A;  4FJC C;  2DW4 A;  4ZBM A;  1Q7Y W;  2IW5 A;  3ZMU A;  3OMN B;  4ASU G;  2DYR C;  4TWK A;  2Q68 A;  3OMA B;  4QPK A;  2JK5 C;  3FYE B;  4MVS A;  3ZMZ A;  2BOB C;  1QR9 A;  1FS0 G;  1FFT B;  1OCO C;  3E89 A;  4J9Z B;  5EC2 C;  4RQE A;  1VQP V;  3CMA V;  2QM8 A;  2YSU B;  3ETD A;  2WPD G;  3OUF A;  5GW7 A;  3D36 A;  5CMU A;  4JF3 A;  2EIJ C;  4JGS A;  5EBL C;  1YHQ V;  3JD0 A;  1K33 A;  1WPX A;  4PDV A;  2Y69 B;  2JJ1 G;  2GHY A;  2WLM A;  1DF5 A;  2Q6A A;  4PA6 A;  4H37 A;  2IU3 A;  2EIN C;  5LGU A;  4J9Y B;  4BW5 A;  4JTD B;  2XAF A;  1KC8 W;  2V7Q G;  2EIL C;  2P7T C;  2P6J A;  3SYP A;  4PA3 A;  1JVM A;  1EZJ A;  2HFE C;  1KD1 W;  2AHY A;  4UVA A;  2OTL V;  4I5S A;  1TUE B;  4LP8 A;  3W7X A;  1VQ7 V;  3E8H A;  1VQK V;  3OE7 G;  3K04 A;  4WFE A;  2Z3Y A;  3SYQ A;  1OCO B;  2EIK C;  1K4C C;  4HAM A;  4UV8 A;  3G4S V;  1GM7 A;  4PA9 A;  3OW2 U;  5B1A C;  5L3C A;  1ARO P;  3W7W A;  1YIJ V;  2EIM C;  1AI5 A;  4GX0 A;  3ZN1 A;  1YSC A;  2ZD9 A;  5H9C A;  1S72 V;  2JIZ G;  1V55 B;  3T1C A;  3G6E V;  1OCR B;  3AG3 C;  2X6B A;  2W6I G;  3UM7 A;  1COW G;  3LUT B;  2UXX A;  3CCL V;  1K34 A;  3FB5 C;  4PDR A;  1N8R W;  3HB3 B;  3IFX A;  3M99 B;  1JOY A;  3D3I A;  3AG2 C;  4HYO A;  1J95 A;  4XDK A;  1K3E A;  1GTO A;  2EZP A;  2KB1 A;  5B3S B;  1DF4 A;  4HZ3 A;  2MK3 A;  4QJF B;  1NBM G;  3P32 A;  4G28 B;  3KG2 A;  2Z5U A;  2IJK A;  1BMF G;  1FXK A;  1F51 A;  4MVU A;  2UXN A;  4G27 B;  4RUF A;  3K0D A;  1VQ5 V;  3LDD A;  1FXK C;  4R50 A;  1NVP B;  4Q20 A;  2QKS A;  1M90 W;  5L3E A;  1H8H G;  1R3K C;  3K9A A;  1Q82 W;  2HLD G;  3K03 A;  3MD0 A;  4N23 A;  4QIW F;  3DGE A;  3CC7 V;  2NLJ C;  2QE7 G;  3LNM B;  4UUJ C;  3CP1 A;  2W6J G;  1VQ6 V;  1QVF U;  3NXS A;  5FL7 G;  1GO3 F;  2YEV A;  3W7S A;  3CCU V;  4X88 A;  4Z1M G;  2M7W A;  1YJN V;  1K4D C;  1M57 B;  3F7V C;  2BOC C;  1VQ9 V;  1RM1 B;  1IXM A;  3BY6 A;  4WFH A;  5LBQ A;  1GM9 A;  1QLE B;  5CBF A;  4UVC A;  4WCE V;  3R65 A;  4GX1 A;  2IJJ A;  1ORQ C;  1FXV A;  3H01 A;  4KFM A;  5IDJ A;  3B77 A;  2JEU A;  3B8M A;  5E1A C;  5IYB O;  1VQN V;  4QE9 A;  1GK9 A;  1CP9 A;  2WLI B;  3CCR V;  3SYC A;  2HR3 A;  2WLL B;  3AG2 B;  4MVZ A;  1AJQ A;  2EBO A;  2ITC C;  5KA6 A;  2Q69 A;  4PA7 A;  3LDE A;  3K08 A;  3ETE A;  3CCM V;  5J9P C;  3DTU B;  1SER A;  4KP4 A;  3ZMS A;  3ZJZ A;  3K0G A;  1E79 G;  5L3B A;  1JCH A;  3MHS C;  1R6N A;  5B1A B;  1QLN A;  3ZIA G;  3WG7 C;  4GCZ A;  2V1D A;  2DWE C;  4N21 A;  5EBW C;  1BHA A;  3ZRW A;  2LP7 A;  1K8A W;  4LC1 A;  3CYO A;  2HVJ C;  1S5H C;  1M56 B;  1NR1 A;  4MVR A;  1EFR G;  4MVO A;  2A0L A;  3FB8 C;  3TET A;  5IYD O;  3JYC A;  5BZB A;  1YI2 V;  1MSW D;  3CCQ V;  4E2L A;  3IC7 A;  4WF9 V;  1MOF A;  1KP2 A;  3ASO C;  4QE7 A;  3T2M A;  4I9W A;  1ROP A;  2JDI G;  3E8G A;  3FKS G;  1L1F A;  3CC2 V;  1JX9 A;  4F4L A;  3F7Y C;  4FPP A;  3SPG A;  1SET A;  3AG4 C;  5L3G A;  2DYS C;  1AI4 A;  4MTX A;  1KP3 A;  2IJH A;  3WFV A;  2X0L A;  4P2Z A;  1K97 A;  2D3O W;  3SYA A;  2HKO A;  4WFG A;  2EJR A;  3UKM A;  2CK3 G;  1RPO A;  1JPX A;  1AJN A;  2Y69 C;  1YTF D;  3ZMT A;  3W7U A;  1K92 A;  2WAM A;  2QA4 V;  1VQL V;  2R9R B;  2XAS A;  2ZQM A;  3I55 V;  3QO5 A;  1NH2 B;  2WLL A;  1Q81 W;  2ITD C;  1PNK A;  4KUM A;  3W7T A;  2B1G A;  2A79 B;  3OEE G;  1PNL A;  3CCJ V;  1YIT V;  5L3D A;  1M9N A;  2WLN A;  4BAY A;  3CD6 V;  1F4N A;  2DYR B;  1K73 W;  4TSF G;  3RBZ A;  1NJI W;  3AG1 B;  1R6K A;  1G4Y B;  1E1R G;  3T4D A;  1YTF B;  3WG7 B;  2IJI A;  3STZ C;  2DQ0 A;  3SPI A;  1H38 A;  4GX5 A;  4MTO A;  2P90 A;  1OCZ C;  3X2Q C;  1NH2 D;  5B1B C;  1FXH A;  2C2A A;  3TCU A;  1K7D A;  1W0K G;  4RAI A;  3P30 A;  1R3J C;  3E35 A;  4JAS A;  1F4M A;  3E8B A;  2F43 G;  2QTO A;  3ZMV A;  3ZRX A;  5EBM C;  1CPY A;  1E1Q G;  2X6C A;  4PA4 A;  3CME V;  3CXC U;  2OCC C;  1R3L C;  3CCE V;  5H6Q A;  4TT3 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...