5KA5A

Hiv-1 gp41 variant v549e resistance mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
85
structure length
79
Chain Sequence
MQLLSGIEQQQNNLLRAIEAQQHLLQLTVWGIKQLQARGGHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Receptor Activation of HIV-1 Env Leads to Asymmetric Exposure of the gp41 Trimer.
pubmed doi rcsb
molecule keywords Transmembrane glycoprotein gp41
molecule tags Viral protein
source organism Human immunodeficiency virus type 1
total genus 36
structure length 79
sequence length 85
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ka5A00
1JQ0A 1QR8A 5HFMA 3H01A 1DLBA 2EZPA 2EBOA 3WFVA 5CMUA 3CYOA 5CN0A 1EBOA 4FJCC 2X7RB 1I5YA 3B77A 3B8NA 3K9AA 4N21A 1I5XA 2OT5A 4FK5C 2LP7A 1DF5A 1Y66A 4G2KA 1QBZA 1K33A 2M7WA 4JF3A 3CP1A 1Y4MA 2EZOA 3B8MA 4E2LA 1JPXA 5HFLA 1MG1A 3MHSC 4JPRA 4FIPC 5H9CA 1ENVA 3P30A 3GWOA 3M99B 1DF4A 4JGSA 4N23A 1K34A 5KA5A 1SZTA 2MK3A 1MOFA 1QCEA 2P6JA 5KA6A 1F23A 3MHHC 1QR9A
chains in the Genus database with same CATH superfamily
1R3KC 4FZ0A 3WU2Z 4DR3O 1MA1A 5EIBD 1KKDA 1WP8A 5CMUA 5CA0B 4GX1A 1GM7A 2JS3A 1FXKB 1QBZA 3J81N 1J5EO 3ZS8C 2Q67A 1M90W 3DXRB 2LW7A 3T1YO 2XAHA 2OCCB 3A0BZ 5JQGB 1BCCH 4DR6B 1W59A 2UXCB 1ZUQA 2UXDB 1VQLV 3HKCA 3K3WA 1RM1B 4B3RB 2ZE7A 5DEDA 5B1AB 1M56B 4UCTA 2ZD9A 3OEHG 1QHTA 4JYYA 3UM7A 2R9AA 2EJRA 4LF6O 2AZ0A 4FLYA 1VF5B 2FL4A 1ZAUA 2W0FC 3H01A 4NKGB 4DV0O 4X66O 3HB3B 2LQTA 3HKCB 3BY6A 3DGEA 2Y48A 5K1XA 4DW1A 4I9WA 1GN2A 5B3SC 1AP6A 4JI6B 1HNXB 3QO7A 3A0RA 2F4VB 2QM4A 4B7EA 1FFXA 4P9OA 2OT5A 1VQOV 2O57A 1WP7A 4FM0A 4QE7A 2BE3A 1EN5A 1V9PA 1VIBA 4DV3B 1XHXA 1WLEA 1HNWO 4YHHB 1AJQA 1HNZB 4LF8O 1BE3H 1LR1A 2WLIA 2UUCB 5IJ9A 1VQPV 3E35A 2YXHA 2IJIA 1Y67A 4HBNA 1G8MA 4BW9A 1YJWV 4KHPO 3TXSA 3CCRV 1SZXA 1KECA 3DC5A 2CTRA 4ZKIA 3G6EV 4GLXA 1OCRB 1XILA 5LHHA 2ZE6A 4UVCA 2QWQB 5EYPA 1S5JA 2HLDG 4NYKA 1JOYA 3STZC 2Y4TA 5IJ9B 5B66Z 2Q8VA 3I55V 4FK5C 3R65A 2EINB 2X0LA 1US6A 3KKYA 4U3FH 5IY5C 1GM9A 3CC4V 1NS1A 5LMUB 1D5AA 4MSWC 1CPYA 4DV1O 4F6EA 4FLWA 1DLBA 3CCQV 4DV7B 1VQ5V 2OWOA 3LNMB 3N2KA 3SJAC 1Y4MA 5GONA 3JAKB 3FYEB 1ROPA 2IH1C 2XNDG 3M99B 4LCUC 3FAVA 4DUZO 4DR1O 3CS5A 2F43G 5LOVB 1F23A 4PELA 2BSKA 5B1OA 1Q8IA 4LFAB 1AI7A 5CN0A 1GM8A 4JYBA 4JASA 2A79B 1VP7A 4DUYO 1S5HC 3N2KB 3OTOO 4L87A 3FB8C 3BFRA 5GONB 3OTFA 4GYCB 1K7DA 4DV6O 1Y76A 3FAVB 3ZN0A 5J2UA 4LNUA 2E5LO 1VQKV 4NVPA 1Z2GA 2QR4A 4PA4A 4I55A 4CBCA 2XOKG 1ZTEA 1XDCA 2HJDA 2BOCC 5LA6A 3RYIB 4RAIA 5B3SB 4DV5O 4YY3B 4TQFA 4O4IB 3D8CA 1J95A 5IYBO 1MNGA 4ICGA 1Y76B 5J2UB 4LNUB 2LFSA 1N36O 2V7QG 4I55B 3WB0A 2ADQB 3SR2C 5BY1A 4IHJA 2WWWA 4X64B 4PV1B 5LA6B 4CS4A 5J2TB 1MOFA 4QPJA 1UPGA 4TT3G 4FM1A 5EZYA 4TWKA 1R6KA 1WNSA 5KHGA 1F7YA 2CTWA 4RUEA 1LNQA 2ATKC 4JGSA 1VMGA 3L70H 4LF4B 2LGWA 1BL8A 2PGGA 5KUKA 4X1KB 2K9PA 3ZHUA 1B06A 3IFXA 5EZYB 2H3OA 3B77A 4D6TH 1KB9F 3JARB 4AQYB 5IY5B 4WFAV 5H2FZ 1IBKB 2Z5UA 4WBNA 3CXCU 2IU3A 2XT9A 4H37A 4LFBB 4X88A 3ZHSA 1TA8A 2RNBA 3P3NA 5DM6V 3JCZA 5IYZB 3N2GA 2DJVA 3RYFA 3ZMSA 3IJ4A 3CCSV 4MS2A 1VQ9V 3QTCA 2F95B 1FXHA 1XEQA 4OXSA 3OW2U 4IYIA 2QM8A 1FD9A 4J42A 4UCRA 2XASA 3U0ZA 4DRXA 2UXDO 4KL1A 4FJCC 2YICA 2ZDIA 2E76B 4MVOA 4HNAA 4YJ2A 2ZR2A 2AW9A 3JALA 1SETA 3H1JH 1Q82W 3RYFB 4UXNA 2LJ2A 1QNMA 2P67A 3JSLA 1MZEA 4E4EA 2WLJA 4JI5O 2LW1A 5KA6A 1JQ0A 3CSXA 3S3WA 4J7JA 4PA9A 1NR1A 4J9ZB 4ZBMA 2KG7A 3B8NA 1MMMA 1SF9A 2B9ZA 2QTOA 4X1IA 4DRXB 4X1YA 4JAUA 1KP3A 3FB6C 1F51A 2UXXA 4YJ2B 1QVFU 4HNAB 3MHSC 2ZQMA 4NTWA 3JAMN 4FMTA 5EBLC 1AJNA 4PDMA 1EM1A 3RFRA 3ZX6A 4JI7B 3JD1A 1OV9A 3ETQA 4LH6A 2A06H 2N05A 1KC8W 2GDSA 3U11A 4DV4B 3JD3A 1FYJA 2JDIG 3SYPA 1NH2B 3IAYA 5LP6A 2GUZB 4FLTA 2IW5A 2KG7B 1O9GA 4X1IB 1EZJA 3MAQA 1NVPD 4DR5B 4X1YB 2CDYA 2D2CB 1GH6A 1KU9A 4JTCB 1YTFB 1HWYA 1F4MA 5KA5A 1TUEB 1QQCA 3IGAC 2UUCO 1XQ8A 2EBOA 3SPJA 4DR2B 3A8TA 4O4HB 5L3GA 4MTXA 2IJKA 2LGQA 5DN6G 2HHHB 3BAAA 2ARHA 2FMLA 4GX0A 1NQTA 4FLVA 1SQXH 2QGNA 2UXBB 2EZOA 4P30A 5ITZB 4CZZA 1BT8A 2H94A 2DQ3A 5JVDB 2UUAO 4MT8A 4MTOA 3HKBA 3UKMA 1GK9A 2RDCA 1B3QA 4JZ2A 3G6BA 4FFKA 5JJEB 1P49A 3OFNG 3RT3C 4GZRB 1RPRA 4WCEV 4B3SB 4FLXA 4UUJC 3T1HO 2VQEO 3RGBA 4UV9A 3ZN1A 1SESA 4MVRA 4NXMO 3OMAB 1D2DA 3BRCA 1IBMB 3JASB 4EEQA 3OEEG 2DWDC 4FM2A 1DF5A 4LF5B 3ZHRA 1QVGU 1RP3B 4ABMA 1S0VA 2A3QA 3BA9A 2P6JA 1SQQH 1BQZA 1NJIW 3LDCA 3H9VA 2QKSA 5LMNO 4EKWA 4BW5A 4ASUG 3CCLV 3OR7C 4TV9A 1M93A 4D7SA 2FKXA 4I0XA 4C7UA 3B2EE 4NB5A 5KMGB 1KYOF 1BMFG 4TSFG 2ZXWC 5LBQA 1PM9A 5C8YA 1TGOA 4WFFA 1DK1A 1E1QG 2WLMA 1SRYA 3F5WC 1FXKA 2DMXA 1NZ6A 2LP7A 4DR7B 2QWNB 3JCUZ 4UB8Z 4FLZA 2AGAA 4TV9B 2IJJA 1N33O 4G27B 3W7SA 1URFA 1R6TA 4I0XB 1ENVA 2HFEC 2ILMA 5EK0A 4QJFB 3JYCA 1NR7A 3J7AU 4DR4B 3LDEA 3E89A 3ZRVA 1QR8A 5HFMA 4J80A 1IBLO 5C8YB 2EZPA 2Y0IA 3SPIA 1Y66A 2W6IG 4UB6Z 1S5LZ 1MZFA 1F4NA 1SA0B 2UUBO 4LC1A 1OHHG 3JD4A 1OCCC 4EB6A 2WLNA 4X64O 4X65B 1YIJV 2HVKC 1FXVA 2CGOA 1AI5A 4DV2B 2Y0PA 3I56V 3Q4HB 3K9AA 4Z1VA 4Z1MG 4I4TA 2GSMB 3HPLC 5GTIZ 3I5DA 3CRMA 1I0HA 3QG5A 1K34A 4JV5B 4EB6B 3CP1A 4LFCB 2JRIA 4LF4O 2CUGA 3APQA 2V1DA 3K5MA 1Z5WA 1THZA 3X2QC 2HVJC 2WA3A 5BR8O 1GN6A 4FVMA 2X6CA 3BCCH 3ETDA 2ZT9B 5EBWC 5LGUA 4I4TB 2B1GA 4JYAB 5CBFA 1PP9H 3TJTA 3G4SV 4JAAA 2VWKA 3TETA 2OTLV 3MHHC 4A5UB 2Q7HA 4GKJB 1AVMA 3R66A 2ITCC 3T4ZA 5EC2C 2YSUB 1M1KW 2Q7GA 1GO3F 4UFZA 1N4CA 2R9IA 2X7RB 3RBZA 2F66C 2QJ1A 4JI2B 3DSQA 3ZBHA 2A9HA 3JAWA 5IWAO 4H13B 1GKFA 5D5QA 1U97A 4KP4A 5H6QA 1XMOO 4JI3B 1I94B 5A2QN 2Q7EA 2XAJA 4J10A 1RPOA 5KLVH 5LGNA 3OM3B 3CRCA 2WPDG 1VQNV 1MSDA 2ZXWB 1K8AW 5EC1C 3AEIA 2DWEC 2RJZA 4UV8A 2FTKA 1YHQV 3JAWB 3H1HH 4B3MB 3OMNB 2Q5ZA 5B5EZ 1KMIZ 4NXNB 1N0JA 3AG1C 1K92A 2X6BA 1SERA 1H2MA 4NR1A 4PI2A 3P3PA 5CA3A 1Z5VA 4JAVA 2XTAA 3JAKA 4MVQA 2JGDB 1SQFA 3CE2A 4JI0B 4JZGA 2AHZA 1D5NA 1TUBA 5LOVA 3LDDA 2ADPA 2ZM6O 4OPAA 1NTMH 4YXWG 5GW7A 4UCVA 1IX9A 1P7BA 1XNRB 3VBBA 3BEHA 1K33A 4WFEA 3CB2A 1N34B 1M57C 1JCHA 1OCCB 2VQFB 1H8HG 3H1IH 3J80N 4DR5O 4OX9O 3L75H 1TUBB 4TQDA 1COWG 1Q90D 1MABG 3UT5B 2JJ2G 3E8BA 4GUNA 3ZMVA 3CJHA 4KFMA 1PL4A 4AI8A 1E1RG 2BOBC 1JMKC 1TAEA 3MD0A 1JJ2U 4ZOLA 2B1IA 1WPXA 3OUFA 3RYIA 1ORQC 1VARA 1K73W 3K04A 4LF9B 2UXBO 4JI8B 4O4IA 3AG7A 2CGNA 2Q68A 1SS3A 3GWKC 4B7KA 5D5PA 5DECA 3L74H 1DGSA 3AG4C 2OIEA 1YVWA 4H0LB 5CA1A 1EFRG 4WFBV 3X2QB 1XUQA 3CCMV 1FPOA 3AK1A 2UU9O 2NNUA 4GKKB 3CJHB 4BIUA 3F7YC 3ABLC 4ZOLB 5J2TA 1XHZA 3D36C 1GN4A 1Y74B 4BR6A 3TGUH 1SC5B 4K0KB 2K1EA 3SYAA 3WG7C 1WA8A 4XDJA 4GCZA 5CA1B 2HJFC 1CP9A 4EFBA 4IL6Z 4U7NA 4JI4B 4X20A 4B3TB 4R50A 1Q7YW 4I7ZB 2YIBA 5LL6Y 2OYQA 4DR3B 2DYSC 2M6YA 1OJHA 2QDOA 3APOA 4FFBA 1B04A 4X1KA 3SGIA 1Q6IA 4U3JA 3D3IA 1V54C 2V4DA 4PA6A 1AR1B 4DK0A 1J5EB 1N0NA 1WA8B 2YUAA 2ZCEA 1FJGB 3OGIB 4O4LA 4RQEA 4ZHQA 3JARA 3T1YB 4JI1O 2YEVA 3K9SA 1NT2B 3RN4A 3QVNA 4X20B 1LUVA 1X59A 4PD4F 1FS0G 2L6LA 4FFBB 1YF2A 3KCXA 1AR5A 2Y4UA 5FPOA 5JH7A 4U3JB 5IYZA 1PL0A 1PD3A 4N21A 2HEPA 4L8JA 4G2KA 5EIBC 3CRAA 1YI2V 1JPXA 4O4LB 4DR7O 4ZHQB 1XMQO 2YEVB 1W2BU 2DOSA 4DV0B 4X66B 5IJ0A 1K3EA 3L71H 1YCIA 3ZCCA 4J11A 4UCUA 4LP8A 3TCUA 2DE0X 3ZHVA 5JH7B 2Z0AA 1AJPA 3S3XA 1M57B 1K9MW 1PPJH 4CH4A 1H2NA 3RYHA 3THOA 3ASNC 1DF4A 2HKOA 5IJ0B 4BAYA 3WB1A 2CH7A 4DR6O 4MVZA 2UXCO 1AP5A 4F6RB 3LUTB 4GX2A 1HNWB 4CC6A 3D36A 4CS2A 3K0GA 4LF8B 4B3RO 3K5NA 2PUSA 2AHYA 3CD6V 1ZX3A 3QF7A 4K3AA 4LBEC 3RYHB 1KUQA 4KXRA 2KKWA 2WAMA 3K03A 3AG4B 1YJNV 1H8EG 1RSOA 4LR3A 2CTQA 4CH6A 4OPHA 4LFCO 3KZIZ 1YDXA 4KHPB 3ETEA 2GUZA 2CH7B 2YDEA 3RW0A 3ABLB 2ZNJA 3SYOA 1G6UA 2JGUA 4PA3A 4MVUA 3BVOA 4MTFA 3WG7B 3DC6A 3CEIA 2YC0A 3SPHA 3SPGA 4O4HA 1RSOB 4JI6O 1P84F 3BABA 1HNXO 2EJ7A 2F4VO 5ITZA 3EXAA 5IYCO 1ZL8A 2CK3G 3E2EA 5JVDA 4MTGA 4D7TA 2DYSB 5JWPA 3OUSA 3SYCA 5KAFZ 3AG2C 2PZSA 4DV3O 5BXZA 4YHHO 1HNZO 1V54B 2JJ1G 3LSQA 1XNQB 3PJSK 4H33A 2MW2B 2DYRC 3ASOC 1I94O 3B8MA 3RVZA 4DR1B 1DTOA 4DUZB 4W4KA 2JVDA 3VQYA 1ZL8B 1EZVH 4TOIA 2IJHA 2XHBA 2E75B 3E8HA 3JASA 3KG2A 3E83A 1N32B 3C3SA 4DUYB 2ODMA 3M7MX 3ZMUA 4JTAB 4QNHB 4CH5A 3OTOB 2EILC 4R8CA 1UFIA 2CTPA 4PHZA 4LWSA 1L0LH 1AILA 1Q43A 3CHXA 4DV6B 2NLJC 3SDLA 2AZ2A 5CB4A 2E5LB 5FL7G 2E3CA 1L0NH 5LMUO 2NN4A 1BHBA 3CYOA 2WSSG 4RUFA 4DV7O 4DV5B 1BQ0A 5KMGA 1M4UA 3ZMZA 3ASNB 4J41A 1W0JG 4LWSB 3ABKC 5KHKA 5TISZ 2VQFO 1QLEC 2R72A 1BHAA 3W7XA 1S72V 5CB4B 1N36B 4CC5A 4FLUA 1NTKH 2JEXA 1A32A 2VRZA 3FB5C 4LFAO 5H5NA 4E2LA 3LNNA 1AROP 4FIPC 5FNVA 3HKDA 3AK3A 3LSSA 2CAZC 4JI8O 3NXSA 1NH2D 1HP8A 3QNEA 3LSUA 2QWPB 4PDVA 4MW3A 2XUMA 4XDKA 2FB5A 1KD1W 3GVMA 4BIOA 1NKDA 2ZIMA 3ML0A 4IYHA 1SA0A 5L3EA 5KX5A 2HG5C 2H8PC 3CRRA 1YTFD 3CC2V 2P90A 3ZEDA 1H2SB 2Y69C 1ZSPA 4GKKO 1VF6C 3OR6C 3FFQA 3A0HZ 5FNVB 3B40A 3HKDB 1R73A 2QEXV 3ABTA 2VWJA 2Q9LA 5BMVA 3ZHTA 4YY3O 1PNKA 1SQBH 3Q4HA 5IDJA 1O9HA 5LXTB 4MVSA 2EIMC 4JF3A 3OD4A 4X9QA 1KBHA 4P9PA 1JX9A 3CRQA 5KX5B 2GTSA 5FPRA 3AG2B 1WB7A 1YJ9V 1Q86W 2QA4V 2A7WA 2MK3A 2LO1A 5CBGA 4ZIBA 1TVKA 4I5SA 1CEZA 1OZ0A 2ETNA 2P4KA 1XI1A 5BMVB 2DYRB 3ASOB 3K0DA 2UXNA 4NTXA 1FJGO 1R3LC 4JPRA 3RWRD 2JEUA 5KHJA 4J7ZA 3K06A 2GV9A 5LYJA 4IT5A 2YIAA 4DK1A 4O2AB 1IXBA 3N27A 1TVKB 5JJNB 1HW7A 2EILB 3HKEA 3L73H 2BTQA 5KHHA 2IBZH 3RVYA 3UQ8A 4J7KA 4JI5B 2OCHA 1Y6XA 1XL6A 1UJWB 4AQYO 1SKVA 1ZLZA 1IBKO 2LFRA 3WB2A 5LYJB 3CCEV 4I9QA 1GRJA 4LFBO 1HDJA 4B08A 1EBOA 2EIJC 3IC7A 2ZR3A 3AK2A 1WAZA 3HKEB 3ABKB 2BTQB 1B6QA 3BA8A 1VQ4V 1QLEB 2EULA 1BS3A 1S76D 1YEWA 4RWUA 2G38A 1L1FA 3VQVA 1K4CC 1E79G 5IE9A 5H6RA 1NTZH 4UVBA 3SJCC 2KB1A 3UO3A 2GHYA 3RYCA 1VQ7V 2QE7G 1VF6A 3H1KH 2JGDA 4X62B 4MW8A 1XL4A 1H2LA 4UCOA 3E86A 2ITDC 3SPCA 3SJQC 1WB8A 2JK5C 5L3FA 3JD2A 5C93A 2EX3A 1JA8A 2C2AA 2QKCA 4H44B 3ETGA 4AHCA 2DN9A 5F2VO 1FFXB 5B1BC 1HR0B 2P5OA 3M8AA 2R70A 2Y69B 2Q6AA 1GTOA 2UUAB 3RYCB 1OCZC 3CCJV 2P7TC 4XBFA 2PYLA 3KCYA 3UT5A 2WLIB 2PI5A 3CWBH 4K35A 5J9PC 4JI7O 3T1HB 2EIMB 2PF4E 5EBMC 4I50A 2VQEB 2F1MA 1GAXA 1WJZA 4PA7A 4K8ZA 3ZRWA 4DV4O 3OGCC 4NXMB 4U7OA 1W0KG 2FYUH 3A2FA 1LUWA 2B5UA 4ZI7A 2PYJA 5LGTA 5EYPB 4G28B 4X8AA 2HP8A 3FKSG 1XNQO 1NU1H 4DR2O 2GBOA 4I50B 4XDLA 5LHIA 1AI6A 1YSCA 3T1CA 2HHHO 4WFGA 3ZRWB 1Y74A 2IH3C 4TUYA 1PNMA 1IVSA 2GTAA 3D3QA 3W7WA 5LMNB 1JFFA 1FAFA 3ZHQA 5IT9N 4ZI7B 4PJ0Z 1K4DC 4FZ1A 1KQSU 1VQMV 4F4LA 4GT1A 3VQXA 1N32O 5K1PA 1YITV 1SQPH 1BGYH 3OAAG 4B3SO 2X6AA 2P22C 1AB3A 2BCCH 4TUYB 3K08A 5KHIA 1OCOC 1JFFB 2JS5A 2BSKB 1EN6A 3QO8A 4PDLA 2ZNIA 2EIJB 3CC7V 2E74B 2RQ6A 1IBMO 3K5LA 1N33B 2ZINA 2A0LA 1PV0A 4YIOA 2EIKC 4LF7B 2Q4PA 5L3CA 2HR3A 2YXLA 2ZDIC 4HZ3A 5H9CA 2IM9A 1S3JA 4LF5O 1IBLB 5IYDO 1SZTA 1PNLA 3PN1A 4JYCA 3T2MA 1P7GA 3FYIB 1NI8A 1K5QA 2UUBB 3H1LH 4QE9A 1I7FA 5FLXN 1H2KA 5B1NA 2PY5A 1YZBA 5KUMA 4N23A 2P4VA 2PTMA 4IGGA 3BHPA 4R6ZA 3U10A 3AG1B 1IURA 3JATA 1VEWA 3ZJZA 5B1BB 4Q6GA 3ZIAG 2QWOB 5L3DA 4UCSA 1Q3EA 4QPKA 2M7WA 4BIZA 1OCZB 4LF6B 2R9RB 3AG3C 1L8DA 3ZMTA 5HFLA 2YI8A 5LP6C 1MG1A 4IHJB 3F7VC 3CX5F 3GWOA 2Q69A 2Q73A 3NR7A 5GTHZ 4WF9V 4UVAA 1NVPB 2WLHA 1EN4A 3UO2A 5CBHA 4IIJA 1XBLA 3HR0A 3JD0A 3G71V 5BR8B 4DR4O 4F6RA 5JCOC 3JATB 1T5EA 3JSNA 4YIPA 2W0XA 3K58A 3CXHF 3CMAV 3ABMC 5L3BA 4YJ3A 3CPWU 1X4TA 1M5IA 2YI9A 4PDRA 2QTSA 4O2BA 4DXWA 4X65O 4IIJB 1XOUA 3E8GA 1ZWIC 1P4RA 2DQ0A 2VS0A 4RQFA 4DV2O 1G1XB 4Q20A 2RN9A 4DYLA 4HYOA 5IWAB 5LHGA 1PKXA 3L9DA 1Q6UA 4O4JA 4R7CA 1N8RW 1VF7A 4YJ3B 4WBNB 4FPPA 1XMOB 1V55C 1Q6HA 2YS8A 4JV5O 5AG2A 4QGPA 4O2BB 1R1BA 2N74A 4JTDB 4LH7A 5E79Z 1BZKA 1I5YA 2QKAA 3C90A 3N2GB 3K79A 1GN3A 2OTJV 1G4YB 3VQWA 3B4SA 3T4DA 1XREA 4O4JB 3O65A 1RFYA 1OCOB 2OIGA 3ZRSA 4JYAO 2AXTZ 1KKCA 2P06A 1JR9A 4GKJO 2EIKB 2YXYA 2PI4A 2JIZG 2YIBD 3E8FA 5E1AC 3JALB 4DW0A 1VQ6V 3BPZA 3TK1A 1H38A 4OGQB 2ZM6B 3VOUA 4CS3A 4DV1B 4JI2O 3K59A 2QSAA 4BWAA 5KAIZ 3WFVA 1JJOA 2XAGA 2N04A 4K8XA 3FX7A 3ICXA 1IDSA 4HAMA 4JI3O 1R3JC 1FXKC 3OE7G 4OX9B 2IU0A 4X62O 3E22A 2ZE5A 1I08A 3CCUV 1CXZB 2WLLA 1Q81W 2OCCC 3W7UA 5JCOA 2D3OW 1S77D 1K5SA 4RO2A 1SQGA 4B3MO 4GX5A 3P32A 1RM1C 3AG3B 4NXNO 5LP6B 1AI4A 5B1AC 1M56C 1HR0O 3F5TA 3TXQA 1WN7A 2Z3YA 1M9NA 1WPBA 4J9YB 3STLC 1SQVH 4KUMA 1U96A 3E22B 3EFFK 2F93B 4X89A 3SJBC 4JI0O 3EHBB 1YXBA 4WFHA 4W4LA 2L35A 2WLLB 2QM7A 2UU9B 1IZ3A 1K97A 2Q0AA 2ZE8A 3OT7A 4EFEA 1QU7A 4AILC 3ABMB 1XNRO 1QLNA 1R6NA 3K57A 2BTOA 1N34O 2KQXA 2Q0OC 1QR9A 1H2GA 3HKBB 3DTUB 3OMIB 1Q5OA 4CH3A 1AR4A 1GMGA 3IC9A 3K5OA 5BZBA 3MDSA 2KSDA 1JVMA 1NBMG 3FB7C 2DW4A 3P30A 4TV8A 1V55B 3GB7C 3G80A 3ABUA 4LF9O 1VQ8V 3CCVV 3FD9A 4NTYA 2RMKB 2QWRB 3C3TA 3UCSC 1IXMA 4JI1B 2RCVA 1BSMA 5LXTA 4MVMA 2ZKOA 3QO5A 2WLKA 2XAFA 3EVKA 3SYQA 2WA4A 4QIWF 3O9OA 1QCEA 2YIDA 1OCRC 2ZIOA 4DO2A 4TV8B 3ZRXA 5CA0A 3CMEV 1MSWD 4K0KO 3W7TA 1R3IC 4PI0A 5A9GA 1I5XA 1XMQB 4P2ZA 5JJJB 2NR5A 1FKAO 2CE4A 3DXRA 2EINC 4Z2WA 2W6JG 1KP2A 4LF7O 3B09A 2F23A 5JQGA 4JI4O 4B3TO 1FFTB 2XAQA 3L72H 4O2AA 3G67A
chains in the Genus database with same CATH topology
1R3KC 2WLIB 2PI5A 3IGAC 5J9PC 1KKDA 2EBOA 3SPJA 5CMUA 5L3GA 4MTXA 4GX1A 1PL0A 2EIMB 2IJKA 5EBMC 1PD3A 5DN6G 4N21A 1GM7A 1FXKB 4G2KA 1QBZA 1NQTA 4GX0A 4PA7A 2EZOA 4P30A 3ZRWA 1YI2V 2Q67A 1JPXA 1M90W 3OGCC 4CZZA 2H94A 2DQ3A 4U7OA 1W0KG 2YEVB 1W2BU 2B5UA 2XAHA 2OCCB 4MT8A 4MTOA 3UKMA 1GK9A 1K3EA 5LGTA 3ZCCA 4G28B 4X8AA 1VQLV 3OFNG 4LP8A 3K3WA 3TCUA 3FKSG 1RM1B 1RPRA 4WCEV 5B1AB 1AJPA 1M56B 1M57B 4UUJC 1K9MW 2ZD9A 3OEHG 4XDLA 5LHIA 3UM7A 1AI6A 1YSCA 4UV9A 3T1CA 4WFGA 3ZRWB 2EJRA 3ZN1A 1SESA 2IH3C 3ASNC 1PNMA 1DF4A 4MVRA 3W7WA 3OMAB 2W0FC 3H01A 2HKOA 1K4DC 1KQSU 3HB3B 4BAYA 1VQMV 4F4LA 4GT1A 4MVZA 3OEEG 2DWDC 3LUTB 4GX2A 1YITV 1DF5A 3BY6A 3DGEA 3D36A 2Y48A 3K0GA 3OAAG 1QVGU 2AHYA 3CD6V 4I9WA 2X6AA 4LBEC 1S0VA 5B3SC 2WAMA 3K03A 3AG4B 2P6JA 1YJNV 1H8EG 3K08A 1NJIW 3LDCA 1OCOC 2QKSA 3QO7A 3A0RA 3QO8A 4PDLA 4EKWA 2EIJB 4P9OA 4BW5A 3CC7V 4ASUG 3ETEA 3CCLV 2A0LA 3OR7C 2OT5A 1VQOV 3RW0A 2EIKC 4QE7A 5L3CA 3ABLB 2HR3A 4HZ3A 2ZDIC 1WLEA 1BMFG 4TSFG 3SYOA 5H9CA 2ZXWC 1AJQA 5LBQA 1S3JA 4PA3A 4MVUA 5IYDO 1SZTA 2WLIA 1PNLA 4MTFA 3WG7B 4WFFA 1E1QG 2WLMA 1VQPV 3E35A 3SPHA 3SPGA 4JYCA 3T2MA 3FYIB 1K5QA 1SRYA 2IJIA 3F5WC 1FXKA 1G8MA 4QE9A 1YJWV 2LP7A 3CCRV 5B1NA 2IJJA 5IYCO 1KECA 4G27B 2CK3G 3W7SA 3E2EA 4MTGA 2DYSB 3OUSA 1ENVA 3SYCA 4ZKIA 3G6EV 2HFEC 1OCRB 3AG2C 4N23A 5EK0A 5KUMA 4QJFB 3JYCA 4R6ZA 1NR7A 5LHHA 3LDEA 4UVCA 3E89A 3ZRVA 1QR8A 5HFMA 1V54B 2HLDG 2JJ1G 3LSQA 1JOYA 3AG1B 2EZPA 3STZC 3PJSK 5B1BB 3ZJZA 3ZIAG 4H33A 3SPIA 5L3DA 2DYRC 3I55V 4FK5C 3R65A 3ASOC 1Y66A 4QPKA 2EINB 2M7WA 2W6IG 2X0LA 4BIZA 1OCZB 1F4NA 2R9RB 3AG3C 3B8MA 3ZMTA 5HFLA 3RVZA 1DTOA 1MG1A 4LC1A 1OHHG 3JD4A 1OCCC 3F7VC 3GWOA 2Q69A 2IJHA 5IY5C 1GM9A 3CC4V 4WF9V 1NVPB 4UVAA 2WLNA 3E8HA 2WLHA 3KG2A 4MSWC 5CBHA 1YIJV 1CPYA 2HVKC 3E83A 1FXVA 1DLBA 1AI5A 3JD0A 3G71V 3CCQV 3I56V 1VQ5V 3ZMUA 3K9AA 3LNMB 4JTAB 4QNHB 2EILC 4R8CA 4Z1MG 2GSMB 1Y4MA 3HPLC 3CMAV 3ABMC 3FYEB 5L3BA 2NLJC 3CPWU 1ROPA 2IH1C 2XNDG 3M99B 4LCUC 1K34A 4PDRA 2F43G 5FL7G 1F23A 3CP1A 4PELA 5B1OA 4DXWA 1BHBA 3CYOA 3E8GA 2V1DA 1AI7A 1GM8A 1ZWIC 4JYBA 5CN0A 1P4RA 4JASA 2WSSG 1THZA 2DQ0A 2A79B 3X2QC 4RQFA 2HVJC 4RUFA 4Q20A 1S5HC 2X6CA 4HYOA 3ETDA 5EBWC 5LGUA 3ZMZA 1PKXA 5LHGA 3ASNB 1W0JG 2B1GA 4L87A 3ABKC 3FB8C 1N8RW 4R7CA 5CBFA 1QLEC 4FPPA 3G4SV 3TETA 1BHAA 1K7DA 3W7XA 1V55C 3MHHC 1S72V 2OTLV 3ZN0A 2ITCC 3T4ZA 2YSUB 5EC2C 1VQKV 1M1KW 1GO3F 4JTDB 2R9IA 4PA4A 2JEXA 2X7RB 1I5YA 4CBCA 2XOKG 3FB5C 3RBZA 3K79A 4E2LA 2OTJV 1G4YB 2BOCC 4RAIA 3T4DA 1AROP 4FIPC 2A9HA 5B3SB 3LSSA 1OCOB 5IYBO 1J95A 3NXSA 3ZRSA 1GKFA 1NH2D 3QNEA 4PDVA 4KP4A 4MW3A 5H6QA 4XDKA 1KD1W 1NKDA 2EIKB 2LFSA 2XAJA 3ML0A 2V7QG 1RPOA 5LGNA 3OM3B 5L3EA 2HG5C 2H8PC 1YTFD 3CC2V 2PI4A 2JIZG 2P90A 2WPDG 2Y69C 1VQNV 3E8FA 5E1AC 2ZXWB 2WWWA 1VQ6V 1K8AW 5EC1C 3AEIA 3TK1A 1H38A 2DWEC 3VOUA 3OR6C 4UV8A 2FTKA 1MOFA 1R73A 1YHQV 4QPJA 2QEXV 3ABTA 4TT3G 3OMNB 1PNKA 4TWKA 3AG1C 3WFVA 1K92A 2X6BA 1SERA 2XAGA 5IDJA 1R6KA 4MVSA 2EIMC 4JF3A 5CA3A 4HAMA 4JAVA 1R3JC 1FXKC 4MVQA 4P9PA 1JX9A 3OE7G 4RUEA 2IU0A 3AG2B 1LNQA 3CCUV 2AHZA 1YJ9V 1Q86W 2ATKC 4JGSA 2QA4V 3LDDA 2MK3A 1BL8A 2WLLA 5CBGA 5KUKA 1Q81W 2OCCC 3W7UA 2D3OW 4I5SA 1CEZA 1S77D 1OZ0A 4YXWG 1K5SA 4RO2A 2DYRB 5GW7A 3IFXA 3ASOB 1P7BA 3B77A 3K0DA 4GX5A 3P32A 2UXNA 3AG3B 1RM1C 3VBBA 3BEHA 1K33A 1AI4A 4WFEA 5B1AC 1M56C 1M57C 1R3LC 1JCHA 1OCCB 4JPRA 2JEUA 1H8HG 5IY5B 4WFAV 2Z3YA 1M9NA 3STLC 4J9YB 3K06A 2Z5UA 3CXCU 4KUMA 2IU3A 3EFFK 4X89A 4H37A 1COWG 3EHBB 4X88A 4WFHA 1MABG 2WLLB 2QM7A 2JJ2G 3E8BA 1K97A 5DM6V 3JCZA 3ZMVA 4KFMA 2EILB 1E1RG 2BOBC 3MD0A 1JJ2U 3ZMSA 3CCSV 2B1IA 3ABMB 3RVYA 1WPXA 3OUFA 4MS2A 1VQ9V 1ORQC 1QLNA 1R6NA 1K73W 3K04A 1FXHA 4OXSA 3OW2U 2Q68A 1XL6A 1UJWB 2QM8A 1QR9A 1H2GA 2LFRA 3AG4C 3DTUB 3CCEV 3OMIB 2XASA 1EFRG 4WFBV 3X2QB 3CCMV 1GMGA 1EBOA 2EIJC 3IC7A 4FJCC 2ZR3A 5BZBA 2NNUA 2ZDIA 4MVOA 4BIUA 1JVMA 2ZR2A 1NBMG 3FB7C 3ABKB 1SETA 2DW4A 1Q82W 3F7YC 1B6QA 3ABLC 4UXNA 1VQ4V 1QLEB 3P30A 2P67A 1S76D 1V55B 3GB7C 2WLJA 3ABUA 1L1FA 5KA6A 1VQ8V 1JQ0A 3CCVV 2K1EA 1K4CC 3SYAA 1E79G 3WG7C 5H6RA 4XDJA 4PA9A 1NR1A 1IXMA 4UVBA 4GCZA 4J9ZB 2KB1A 4ZBMA 3B8NA 2HJFC 4MVMA 2QTOA 2GHYA 1CP9A 1VQ7V 3QO5A 2QE7G 2WLKA 1KP3A 2XAFA 3FB6C 1F51A 4JAUA 3SYQA 2UXXA 4MW8A 4U7NA 1XL4A 1QVFU 3E86A 4R50A 3MHSC 2ITDC 2ZQMA 1Q7YW 3SPCA 4FMTA 4QIWF 5EBLC 1AJNA 3SJQC 2JK5C 4PDMA 2DYSC 3JD2A 5L3FA 5C93A 1QCEA 1OCRC 4DO2A 2C2AA 3JD1A 3ZRXA 3ETGA 3D3IA 3CMEV 1MSWD 1V54C 1AR1B 4PA6A 1KC8W 3W7TA 1R3IC 3JD3A 5B1BC 2JDIG 3SYPA 1NH2B 1I5XA 4P2ZA 2IW5A 2Y69B 4RQEA 2Q6AA 1GTOA 1EZJA 1NVPD 2EINC 2YEVA 1OCZC 3CCJV 2W6JG 1KP2A 2P7TC 4JTCB 1YTFB 1HWYA 4XBFA 1F4MA 5KA5A 1FFTB 1FS0G 2XAQA 1TUEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQ0 A;  1QR8 A;  5HFM A;  3H01 A;  1DLB A;  2EZP A;  2EBO A;  3WFV A;  5CMU A;  3CYO A;  5CN0 A;  1EBO A;  4FJC C;  2X7R B;  1I5Y A;  3B77 A;  3B8N A;  3K9A A;  4N21 A;  1I5X A;  2OT5 A;  4FK5 C;  2LP7 A;  1DF5 A;  1Y66 A;  4G2K A;  1QBZ A;  1K33 A;  2M7W A;  4JF3 A;  3CP1 A;  1Y4M A;  2EZO A;  3B8M A;  4E2L A;  1JPX A;  5HFL A;  1MG1 A;  3MHS C;  4JPR A;  4FIP C;  5H9C A;  1ENV A;  3P30 A;  3GWO A;  3M99 B;  1DF4 A;  4JGS A;  4N23 A;  1K34 A;  5KA5 A;  1SZT A;  2MK3 A;  1MOF A;  1QCE A;  2P6J A;  5KA6 A;  1F23 A;  3MHH C;  1QR9 A; 
#chains in the Genus database with same CATH topology
 1R3K C;  4FZ0 A;  3WU2 Z;  4DR3 O;  1MA1 A;  5EIB D;  1KKD A;  1WP8 A;  5CMU A;  5CA0 B;  4GX1 A;  1GM7 A;  2JS3 A;  1FXK B;  1QBZ A;  3J81 N;  1J5E O;  3ZS8 C;  2Q67 A;  1M90 W;  3DXR B;  2LW7 A;  3T1Y O;  2XAH A;  2OCC B;  3A0B Z;  5JQG B;  1BCC H;  4DR6 B;  1W59 A;  2UXC B;  1ZUQ A;  2UXD B;  1VQL V;  3HKC A;  3K3W A;  1RM1 B;  4B3R B;  2ZE7 A;  5DED A;  5B1A B;  1M56 B;  4UCT A;  2ZD9 A;  3OEH G;  1QHT A;  4JYY A;  3UM7 A;  2R9A A;  2EJR A;  4LF6 O;  2AZ0 A;  4FLY A;  1VF5 B;  2FL4 A;  1ZAU A;  2W0F C;  3H01 A;  4NKG B;  4DV0 O;  4X66 O;  3HB3 B;  2LQT A;  3HKC B;  3BY6 A;  3DGE A;  2Y48 A;  5K1X A;  4DW1 A;  4I9W A;  1GN2 A;  5B3S C;  1AP6 A;  4JI6 B;  1HNX B;  3QO7 A;  3A0R A;  2F4V B;  2QM4 A;  4B7E A;  1FFX A;  4P9O A;  2OT5 A;  1VQO V;  2O57 A;  1WP7 A;  4FM0 A;  4QE7 A;  2BE3 A;  1EN5 A;  1V9P A;  1VIB A;  4DV3 B;  1XHX A;  1WLE A;  1HNW O;  4YHH B;  1AJQ A;  1HNZ B;  4LF8 O;  1BE3 H;  1LR1 A;  2WLI A;  2UUC B;  5IJ9 A;  1VQP V;  3E35 A;  2YXH A;  2IJI A;  1Y67 A;  4HBN A;  1G8M A;  4BW9 A;  1YJW V;  4KHP O;  3TXS A;  3CCR V;  1SZX A;  1KEC A;  3DC5 A;  2CTR A;  4ZKI A;  3G6E V;  4GLX A;  1OCR B;  1XIL A;  5LHH A;  2ZE6 A;  4UVC A;  2QWQ B;  5EYP A;  1S5J A;  2HLD G;  4NYK A;  1JOY A;  3STZ C;  2Y4T A;  5IJ9 B;  5B66 Z;  2Q8V A;  3I55 V;  4FK5 C;  3R65 A;  2EIN B;  2X0L A;  1US6 A;  3KKY A;  4U3F H;  5IY5 C;  1GM9 A;  3CC4 V;  1NS1 A;  5LMU B;  1D5A A;  4MSW C;  1CPY A;  4DV1 O;  4F6E A;  4FLW A;  1DLB A;  3CCQ V;  4DV7 B;  1VQ5 V;  2OWO A;  3LNM B;  3N2K A;  3SJA C;  1Y4M A;  5GON A;  3JAK B;  3FYE B;  1ROP A;  2IH1 C;  2XND G;  3M99 B;  4LCU C;  3FAV A;  4DUZ O;  4DR1 O;  3CS5 A;  2F43 G;  5LOV B;  1F23 A;  4PEL A;  2BSK A;  5B1O A;  1Q8I A;  4LFA B;  1AI7 A;  5CN0 A;  1GM8 A;  4JYB A;  4JAS A;  2A79 B;  1VP7 A;  4DUY O;  1S5H C;  3N2K B;  3OTO O;  4L87 A;  3FB8 C;  3BFR A;  5GON B;  3OTF A;  4GYC B;  1K7D A;  4DV6 O;  1Y76 A;  3FAV B;  3ZN0 A;  5J2U A;  4LNU A;  2E5L O;  1VQK V;  4NVP A;  1Z2G A;  2QR4 A;  4PA4 A;  4I55 A;  4CBC A;  2XOK G;  1ZTE A;  1XDC A;  2HJD A;  2BOC C;  5LA6 A;  3RYI B;  4RAI A;  5B3S B;  4DV5 O;  4YY3 B;  4TQF A;  4O4I B;  3D8C A;  1J95 A;  5IYB O;  1MNG A;  4ICG A;  1Y76 B;  5J2U B;  4LNU B;  2LFS A;  1N36 O;  2V7Q G;  4I55 B;  3WB0 A;  2ADQ B;  3SR2 C;  5BY1 A;  4IHJ A;  2WWW A;  4X64 B;  4PV1 B;  5LA6 B;  4CS4 A;  5J2T B;  1MOF A;  4QPJ A;  1UPG A;  4TT3 G;  4FM1 A;  5EZY A;  4TWK A;  1R6K A;  1WNS A;  5KHG A;  1F7Y A;  2CTW A;  4RUE A;  1LNQ A;  2ATK C;  4JGS A;  1VMG A;  3L70 H;  4LF4 B;  2LGW A;  1BL8 A;  2PGG A;  5KUK A;  4X1K B;  2K9P A;  3ZHU A;  1B06 A;  3IFX A;  5EZY B;  2H3O A;  3B77 A;  4D6T H;  1KB9 F;  3JAR B;  4AQY B;  5IY5 B;  4WFA V;  5H2F Z;  1IBK B;  2Z5U A;  4WBN A;  3CXC U;  2IU3 A;  2XT9 A;  4H37 A;  4LFB B;  4X88 A;  3ZHS A;  1TA8 A;  2RNB A;  3P3N A;  5DM6 V;  3JCZ A;  5IYZ B;  3N2G A;  2DJV A;  3RYF A;  3ZMS A;  3IJ4 A;  3CCS V;  4MS2 A;  1VQ9 V;  3QTC A;  2F95 B;  1FXH A;  1XEQ A;  4OXS A;  3OW2 U;  4IYI A;  2QM8 A;  1FD9 A;  4J42 A;  4UCR A;  2XAS A;  3U0Z A;  4DRX A;  2UXD O;  4KL1 A;  4FJC C;  2YIC A;  2ZDI A;  2E76 B;  4MVO A;  4HNA A;  4YJ2 A;  2ZR2 A;  2AW9 A;  3JAL A;  1SET A;  3H1J H;  1Q82 W;  3RYF B;  4UXN A;  2LJ2 A;  1QNM A;  2P67 A;  3JSL A;  1MZE A;  4E4E A;  2WLJ A;  4JI5 O;  2LW1 A;  5KA6 A;  1JQ0 A;  3CSX A;  3S3W A;  4J7J A;  4PA9 A;  1NR1 A;  4J9Z B;  4ZBM A;  2KG7 A;  3B8N A;  1MMM A;  1SF9 A;  2B9Z A;  2QTO A;  4X1I A;  4DRX B;  4X1Y A;  4JAU A;  1KP3 A;  3FB6 C;  1F51 A;  2UXX A;  4YJ2 B;  1QVF U;  4HNA B;  3MHS C;  2ZQM A;  4NTW A;  3JAM N;  4FMT A;  5EBL C;  1AJN A;  4PDM A;  1EM1 A;  3RFR A;  3ZX6 A;  4JI7 B;  3JD1 A;  1OV9 A;  3ETQ A;  4LH6 A;  2A06 H;  2N05 A;  1KC8 W;  2GDS A;  3U11 A;  4DV4 B;  3JD3 A;  1FYJ A;  2JDI G;  3SYP A;  1NH2 B;  3IAY A;  5LP6 A;  2GUZ B;  4FLT A;  2IW5 A;  2KG7 B;  1O9G A;  4X1I B;  1EZJ A;  3MAQ A;  1NVP D;  4DR5 B;  4X1Y B;  2CDY A;  2D2C B;  1GH6 A;  1KU9 A;  4JTC B;  1YTF B;  1HWY A;  1F4M A;  5KA5 A;  1TUE B;  1QQC A;  3IGA C;  2UUC O;  1XQ8 A;  2EBO A;  3SPJ A;  4DR2 B;  3A8T A;  4O4H B;  5L3G A;  4MTX A;  2IJK A;  2LGQ A;  5DN6 G;  2HHH B;  3BAA A;  2ARH A;  2FML A;  4GX0 A;  1NQT A;  4FLV A;  1SQX H;  2QGN A;  2UXB B;  2EZO A;  4P30 A;  5ITZ B;  4CZZ A;  1BT8 A;  2H94 A;  2DQ3 A;  5JVD B;  2UUA O;  4MT8 A;  4MTO A;  3HKB A;  3UKM A;  1GK9 A;  2RDC A;  1B3Q A;  4JZ2 A;  3G6B A;  4FFK A;  5JJE B;  1P49 A;  3OFN G;  3RT3 C;  4GZR B;  1RPR A;  4WCE V;  4B3S B;  4FLX A;  4UUJ C;  3T1H O;  2VQE O;  3RGB A;  4UV9 A;  3ZN1 A;  1SES A;  4MVR A;  4NXM O;  3OMA B;  1D2D A;  3BRC A;  1IBM B;  3JAS B;  4EEQ A;  3OEE G;  2DWD C;  4FM2 A;  1DF5 A;  4LF5 B;  3ZHR A;  1QVG U;  1RP3 B;  4ABM A;  1S0V A;  2A3Q A;  3BA9 A;  2P6J A;  1SQQ H;  1BQZ A;  1NJI W;  3LDC A;  3H9V A;  2QKS A;  5LMN O;  4EKW A;  4BW5 A;  4ASU G;  3CCL V;  3OR7 C;  4TV9 A;  1M93 A;  4D7S A;  2FKX A;  4I0X A;  4C7U A;  3B2E E;  4NB5 A;  5KMG B;  1KYO F;  1BMF G;  4TSF G;  2ZXW C;  5LBQ A;  1PM9 A;  5C8Y A;  1TGO A;  4WFF A;  1DK1 A;  1E1Q G;  2WLM A;  1SRY A;  3F5W C;  1FXK A;  2DMX A;  1NZ6 A;  2LP7 A;  4DR7 B;  2QWN B;  3JCU Z;  4UB8 Z;  4FLZ A;  2AGA A;  4TV9 B;  2IJJ A;  1N33 O;  4G27 B;  3W7S A;  1URF A;  1R6T A;  4I0X B;  1ENV A;  2HFE C;  2ILM A;  5EK0 A;  4QJF B;  3JYC A;  1NR7 A;  3J7A U;  4DR4 B;  3LDE A;  3E89 A;  3ZRV A;  1QR8 A;  5HFM A;  4J80 A;  1IBL O;  5C8Y B;  2EZP A;  2Y0I A;  3SPI A;  1Y66 A;  2W6I G;  4UB6 Z;  1S5L Z;  1MZF A;  1F4N A;  1SA0 B;  2UUB O;  4LC1 A;  1OHH G;  3JD4 A;  1OCC C;  4EB6 A;  2WLN A;  4X64 O;  4X65 B;  1YIJ V;  2HVK C;  1FXV A;  2CGO A;  1AI5 A;  4DV2 B;  2Y0P A;  3I56 V;  3Q4H B;  3K9A A;  4Z1V A;  4Z1M G;  4I4T A;  2GSM B;  3HPL C;  5GTI Z;  3I5D A;  3CRM A;  1I0H A;  3QG5 A;  1K34 A;  4JV5 B;  4EB6 B;  3CP1 A;  4LFC B;  2JRI A;  4LF4 O;  2CUG A;  3APQ A;  2V1D A;  3K5M A;  1Z5W A;  1THZ A;  3X2Q C;  2HVJ C;  2WA3 A;  5BR8 O;  1GN6 A;  4FVM A;  2X6C A;  3BCC H;  3ETD A;  2ZT9 B;  5EBW C;  5LGU A;  4I4T B;  2B1G A;  4JYA B;  5CBF A;  1PP9 H;  3TJT A;  3G4S V;  4JAA A;  2VWK A;  3TET A;  2OTL V;  3MHH C;  4A5U B;  2Q7H A;  4GKJ B;  1AVM A;  3R66 A;  2ITC C;  3T4Z A;  5EC2 C;  2YSU B;  1M1K W;  2Q7G A;  1GO3 F;  4UFZ A;  1N4C A;  2R9I A;  2X7R B;  3RBZ A;  2F66 C;  2QJ1 A;  4JI2 B;  3DSQ A;  3ZBH A;  2A9H A;  3JAW A;  5IWA O;  4H13 B;  1GKF A;  5D5Q A;  1U97 A;  4KP4 A;  5H6Q A;  1XMO O;  4JI3 B;  1I94 B;  5A2Q N;  2Q7E A;  2XAJ A;  4J10 A;  1RPO A;  5KLV H;  5LGN A;  3OM3 B;  3CRC A;  2WPD G;  1VQN V;  1MSD A;  2ZXW B;  1K8A W;  5EC1 C;  3AEI A;  2DWE C;  2RJZ A;  4UV8 A;  2FTK A;  1YHQ V;  3JAW B;  3H1H H;  4B3M B;  3OMN B;  2Q5Z A;  5B5E Z;  1KMI Z;  4NXN B;  1N0J A;  3AG1 C;  1K92 A;  2X6B A;  1SER A;  1H2M A;  4NR1 A;  4PI2 A;  3P3P A;  5CA3 A;  1Z5V A;  4JAV A;  2XTA A;  3JAK A;  4MVQ A;  2JGD B;  1SQF A;  3CE2 A;  4JI0 B;  4JZG A;  2AHZ A;  1D5N A;  1TUB A;  5LOV A;  3LDD A;  2ADP A;  2ZM6 O;  4OPA A;  1NTM H;  4YXW G;  5GW7 A;  4UCV A;  1IX9 A;  1P7B A;  1XNR B;  3VBB A;  3BEH A;  1K33 A;  4WFE A;  3CB2 A;  1N34 B;  1M57 C;  1JCH A;  1OCC B;  2VQF B;  1H8H G;  3H1I H;  3J80 N;  4DR5 O;  4OX9 O;  3L75 H;  1TUB B;  4TQD A;  1COW G;  1Q90 D;  1MAB G;  3UT5 B;  2JJ2 G;  3E8B A;  4GUN A;  3ZMV A;  3CJH A;  4KFM A;  1PL4 A;  4AI8 A;  1E1R G;  2BOB C;  1JMK C;  1TAE A;  3MD0 A;  1JJ2 U;  4ZOL A;  2B1I A;  1WPX A;  3OUF A;  3RYI A;  1ORQ C;  1VAR A;  1K73 W;  3K04 A;  4LF9 B;  2UXB O;  4JI8 B;  4O4I A;  3AG7 A;  2CGN A;  2Q68 A;  1SS3 A;  3GWK C;  4B7K A;  5D5P A;  5DEC A;  3L74 H;  1DGS A;  3AG4 C;  2OIE A;  1YVW A;  4H0L B;  5CA1 A;  1EFR G;  4WFB V;  3X2Q B;  1XUQ A;  3CCM V;  1FPO A;  3AK1 A;  2UU9 O;  2NNU A;  4GKK B;  3CJH B;  4BIU A;  3F7Y C;  3ABL C;  4ZOL B;  5J2T A;  1XHZ A;  3D36 C;  1GN4 A;  1Y74 B;  4BR6 A;  3TGU H;  1SC5 B;  4K0K B;  2K1E A;  3SYA A;  3WG7 C;  1WA8 A;  4XDJ A;  4GCZ A;  5CA1 B;  2HJF C;  1CP9 A;  4EFB A;  4IL6 Z;  4U7N A;  4JI4 B;  4X20 A;  4B3T B;  4R50 A;  1Q7Y W;  4I7Z B;  2YIB A;  5LL6 Y;  2OYQ A;  4DR3 B;  2DYS C;  2M6Y A;  1OJH A;  2QDO A;  3APO A;  4FFB A;  1B04 A;  4X1K A;  3SGI A;  1Q6I A;  4U3J A;  3D3I A;  1V54 C;  2V4D A;  4PA6 A;  1AR1 B;  4DK0 A;  1J5E B;  1N0N A;  1WA8 B;  2YUA A;  2ZCE A;  1FJG B;  3OGI B;  4O4L A;  4RQE A;  4ZHQ A;  3JAR A;  3T1Y B;  4JI1 O;  2YEV A;  3K9S A;  1NT2 B;  3RN4 A;  3QVN A;  4X20 B;  1LUV A;  1X59 A;  4PD4 F;  1FS0 G;  2L6L A;  4FFB B;  1YF2 A;  3KCX A;  1AR5 A;  2Y4U A;  5FPO A;  5JH7 A;  4U3J B;  5IYZ A;  1PL0 A;  1PD3 A;  4N21 A;  2HEP A;  4L8J A;  4G2K A;  5EIB C;  3CRA A;  1YI2 V;  1JPX A;  4O4L B;  4DR7 O;  4ZHQ B;  1XMQ O;  2YEV B;  1W2B U;  2DOS A;  4DV0 B;  4X66 B;  5IJ0 A;  1K3E A;  3L71 H;  1YCI A;  3ZCC A;  4J11 A;  4UCU A;  4LP8 A;  3TCU A;  2DE0 X;  3ZHV A;  5JH7 B;  2Z0A A;  1AJP A;  3S3X A;  1M57 B;  1K9M W;  1PPJ H;  4CH4 A;  1H2N A;  3RYH A;  3THO A;  3ASN C;  1DF4 A;  2HKO A;  5IJ0 B;  4BAY A;  3WB1 A;  2CH7 A;  4DR6 O;  4MVZ A;  2UXC O;  1AP5 A;  4F6R B;  3LUT B;  4GX2 A;  1HNW B;  4CC6 A;  3D36 A;  4CS2 A;  3K0G A;  4LF8 B;  4B3R O;  3K5N A;  2PUS A;  2AHY A;  3CD6 V;  1ZX3 A;  3QF7 A;  4K3A A;  4LBE C;  3RYH B;  1KUQ A;  4KXR A;  2KKW A;  2WAM A;  3K03 A;  3AG4 B;  1YJN V;  1H8E G;  1RSO A;  4LR3 A;  2CTQ A;  4CH6 A;  4OPH A;  4LFC O;  3KZI Z;  1YDX A;  4KHP B;  3ETE A;  2GUZ A;  2CH7 B;  2YDE A;  3RW0 A;  3ABL B;  2ZNJ A;  3SYO A;  1G6U A;  2JGU A;  4PA3 A;  4MVU A;  3BVO A;  4MTF A;  3WG7 B;  3DC6 A;  3CEI A;  2YC0 A;  3SPH A;  3SPG A;  4O4H A;  1RSO B;  4JI6 O;  1P84 F;  3BAB A;  1HNX O;  2EJ7 A;  2F4V O;  5ITZ A;  3EXA A;  5IYC O;  1ZL8 A;  2CK3 G;  3E2E A;  5JVD A;  4MTG A;  4D7T A;  2DYS B;  5JWP A;  3OUS A;  3SYC A;  5KAF Z;  3AG2 C;  2PZS A;  4DV3 O;  5BXZ A;  4YHH O;  1HNZ O;  1V54 B;  2JJ1 G;  3LSQ A;  1XNQ B;  3PJS K;  4H33 A;  2MW2 B;  2DYR C;  3ASO C;  1I94 O;  3B8M A;  3RVZ A;  4DR1 B;  1DTO A;  4DUZ B;  4W4K A;  2JVD A;  3VQY A;  1ZL8 B;  1EZV H;  4TOI A;  2IJH A;  2XHB A;  2E75 B;  3E8H A;  3JAS A;  3KG2 A;  3E83 A;  1N32 B;  3C3S A;  4DUY B;  2ODM A;  3M7M X;  3ZMU A;  4JTA B;  4QNH B;  4CH5 A;  3OTO B;  2EIL C;  4R8C A;  1UFI A;  2CTP A;  4PHZ A;  4LWS A;  1L0L H;  1AIL A;  1Q43 A;  3CHX A;  4DV6 B;  2NLJ C;  3SDL A;  2AZ2 A;  5CB4 A;  2E5L B;  5FL7 G;  2E3C A;  1L0N H;  5LMU O;  2NN4 A;  1BHB A;  3CYO A;  2WSS G;  4RUF A;  4DV7 O;  4DV5 B;  1BQ0 A;  5KMG A;  1M4U A;  3ZMZ A;  3ASN B;  4J41 A;  1W0J G;  4LWS B;  3ABK C;  5KHK A;  5TIS Z;  2VQF O;  1QLE C;  2R72 A;  1BHA A;  3W7X A;  1S72 V;  5CB4 B;  1N36 B;  4CC5 A;  4FLU A;  1NTK H;  2JEX A;  1A32 A;  2VRZ A;  3FB5 C;  4LFA O;  5H5N A;  4E2L A;  3LNN A;  1ARO P;  4FIP C;  5FNV A;  3HKD A;  3AK3 A;  3LSS A;  2CAZ C;  4JI8 O;  3NXS A;  1NH2 D;  1HP8 A;  3QNE A;  3LSU A;  2QWP B;  4PDV A;  4MW3 A;  2XUM A;  4XDK A;  2FB5 A;  1KD1 W;  3GVM A;  4BIO A;  1NKD A;  2ZIM A;  3ML0 A;  4IYH A;  1SA0 A;  5L3E A;  5KX5 A;  2HG5 C;  2H8P C;  3CRR A;  1YTF D;  3CC2 V;  2P90 A;  3ZED A;  1H2S B;  2Y69 C;  1ZSP A;  4GKK O;  1VF6 C;  3OR6 C;  3FFQ A;  3A0H Z;  5FNV B;  3B40 A;  3HKD B;  1R73 A;  2QEX V;  3ABT A;  2VWJ A;  2Q9L A;  5BMV A;  3ZHT A;  4YY3 O;  1PNK A;  1SQB H;  3Q4H A;  5IDJ A;  1O9H A;  5LXT B;  4MVS A;  2EIM C;  4JF3 A;  3OD4 A;  4X9Q A;  1KBH A;  4P9P A;  1JX9 A;  3CRQ A;  5KX5 B;  2GTS A;  5FPR A;  3AG2 B;  1WB7 A;  1YJ9 V;  1Q86 W;  2QA4 V;  2A7W A;  2MK3 A;  2LO1 A;  5CBG A;  4ZIB A;  1TVK A;  4I5S A;  1CEZ A;  1OZ0 A;  2ETN A;  2P4K A;  1XI1 A;  5BMV B;  2DYR B;  3ASO B;  3K0D A;  2UXN A;  4NTX A;  1FJG O;  1R3L C;  4JPR A;  3RWR D;  2JEU A;  5KHJ A;  4J7Z A;  3K06 A;  2GV9 A;  5LYJ A;  4IT5 A;  2YIA A;  4DK1 A;  4O2A B;  1IXB A;  3N27 A;  1TVK B;  5JJN B;  1HW7 A;  2EIL B;  3HKE A;  3L73 H;  2BTQ A;  5KHH A;  2IBZ H;  3RVY A;  3UQ8 A;  4J7K A;  4JI5 B;  2OCH A;  1Y6X A;  1XL6 A;  1UJW B;  4AQY O;  1SKV A;  1ZLZ A;  1IBK O;  2LFR A;  3WB2 A;  5LYJ B;  3CCE V;  4I9Q A;  1GRJ A;  4LFB O;  1HDJ A;  4B08 A;  1EBO A;  2EIJ C;  3IC7 A;  2ZR3 A;  3AK2 A;  1WAZ A;  3HKE B;  3ABK B;  2BTQ B;  1B6Q A;  3BA8 A;  1VQ4 V;  1QLE B;  2EUL A;  1BS3 A;  1S76 D;  1YEW A;  4RWU A;  2G38 A;  1L1F A;  3VQV A;  1K4C C;  1E79 G;  5IE9 A;  5H6R A;  1NTZ H;  4UVB A;  3SJC C;  2KB1 A;  3UO3 A;  2GHY A;  3RYC A;  1VQ7 V;  2QE7 G;  1VF6 A;  3H1K H;  2JGD A;  4X62 B;  4MW8 A;  1XL4 A;  1H2L A;  4UCO A;  3E86 A;  2ITD C;  3SPC A;  3SJQ C;  1WB8 A;  2JK5 C;  5L3F A;  3JD2 A;  5C93 A;  2EX3 A;  1JA8 A;  2C2A A;  2QKC A;  4H44 B;  3ETG A;  4AHC A;  2DN9 A;  5F2V O;  1FFX B;  5B1B C;  1HR0 B;  2P5O A;  3M8A A;  2R70 A;  2Y69 B;  2Q6A A;  1GTO A;  2UUA B;  3RYC B;  1OCZ C;  3CCJ V;  2P7T C;  4XBF A;  2PYL A;  3KCY A;  3UT5 A;  2WLI B;  2PI5 A;  3CWB H;  4K35 A;  5J9P C;  4JI7 O;  3T1H B;  2EIM B;  2PF4 E;  5EBM C;  4I50 A;  2VQE B;  2F1M A;  1GAX A;  1WJZ A;  4PA7 A;  4K8Z A;  3ZRW A;  4DV4 O;  3OGC C;  4NXM B;  4U7O A;  1W0K G;  2FYU H;  3A2F A;  1LUW A;  2B5U A;  4ZI7 A;  2PYJ A;  5LGT A;  5EYP B;  4G28 B;  4X8A A;  2HP8 A;  3FKS G;  1XNQ O;  1NU1 H;  4DR2 O;  2GBO A;  4I50 B;  4XDL A;  5LHI A;  1AI6 A;  1YSC A;  3T1C A;  2HHH O;  4WFG A;  3ZRW B;  1Y74 A;  2IH3 C;  4TUY A;  1PNM A;  1IVS A;  2GTA A;  3D3Q A;  3W7W A;  5LMN B;  1JFF A;  1FAF A;  3ZHQ A;  5IT9 N;  4ZI7 B;  4PJ0 Z;  1K4D C;  4FZ1 A;  1KQS U;  1VQM V;  4F4L A;  4GT1 A;  3VQX A;  1N32 O;  5K1P A;  1YIT V;  1SQP H;  1BGY H;  3OAA G;  4B3S O;  2X6A A;  2P22 C;  1AB3 A;  2BCC H;  4TUY B;  3K08 A;  5KHI A;  1OCO C;  1JFF B;  2JS5 A;  2BSK B;  1EN6 A;  3QO8 A;  4PDL A;  2ZNI A;  2EIJ B;  3CC7 V;  2E74 B;  2RQ6 A;  1IBM O;  3K5L A;  1N33 B;  2ZIN A;  2A0L A;  1PV0 A;  4YIO A;  2EIK C;  4LF7 B;  2Q4P A;  5L3C A;  2HR3 A;  2YXL A;  2ZDI C;  4HZ3 A;  5H9C A;  2IM9 A;  1S3J A;  4LF5 O;  1IBL B;  5IYD O;  1SZT A;  1PNL A;  3PN1 A;  4JYC A;  3T2M A;  1P7G A;  3FYI B;  1NI8 A;  1K5Q A;  2UUB B;  3H1L H;  4QE9 A;  1I7F A;  5FLX N;  1H2K A;  5B1N A;  2PY5 A;  1YZB A;  5KUM A;  4N23 A;  2P4V A;  2PTM A;  4IGG A;  3BHP A;  4R6Z A;  3U10 A;  3AG1 B;  1IUR A;  3JAT A;  1VEW A;  3ZJZ A;  5B1B B;  4Q6G A;  3ZIA G;  2QWO B;  5L3D A;  4UCS A;  1Q3E A;  4QPK A;  2M7W A;  4BIZ A;  1OCZ B;  4LF6 B;  2R9R B;  3AG3 C;  1L8D A;  3ZMT A;  5HFL A;  2YI8 A;  5LP6 C;  1MG1 A;  4IHJ B;  3F7V C;  3CX5 F;  3GWO A;  2Q69 A;  2Q73 A;  3NR7 A;  5GTH Z;  4WF9 V;  4UVA A;  1NVP B;  2WLH A;  1EN4 A;  3UO2 A;  5CBH A;  4IIJ A;  1XBL A;  3HR0 A;  3JD0 A;  3G71 V;  5BR8 B;  4DR4 O;  4F6R A;  5JCO C;  3JAT B;  1T5E A;  3JSN A;  4YIP A;  2W0X A;  3K58 A;  3CXH F;  3CMA V;  3ABM C;  5L3B A;  4YJ3 A;  3CPW U;  1X4T A;  1M5I A;  2YI9 A;  4PDR A;  2QTS A;  4O2B A;  4DXW A;  4X65 O;  4IIJ B;  1XOU A;  3E8G A;  1ZWI C;  1P4R A;  2DQ0 A;  2VS0 A;  4RQF A;  4DV2 O;  1G1X B;  4Q20 A;  2RN9 A;  4DYL A;  4HYO A;  5IWA B;  5LHG A;  1PKX A;  3L9D A;  1Q6U A;  4O4J A;  4R7C A;  1N8R W;  1VF7 A;  4YJ3 B;  4WBN B;  4FPP A;  1XMO B;  1V55 C;  1Q6H A;  2YS8 A;  4JV5 O;  5AG2 A;  4QGP A;  4O2B B;  1R1B A;  2N74 A;  4JTD B;  4LH7 A;  5E79 Z;  1BZK A;  1I5Y A;  2QKA A;  3C90 A;  3N2G B;  3K79 A;  1GN3 A;  2OTJ V;  1G4Y B;  3VQW A;  3B4S A;  3T4D A;  1XRE A;  4O4J B;  3O65 A;  1RFY A;  1OCO B;  2OIG A;  3ZRS A;  4JYA O;  2AXT Z;  1KKC A;  2P06 A;  1JR9 A;  4GKJ O;  2EIK B;  2YXY A;  2PI4 A;  2JIZ G;  2YIB D;  3E8F A;  5E1A C;  3JAL B;  4DW0 A;  1VQ6 V;  3BPZ A;  3TK1 A;  1H38 A;  4OGQ B;  2ZM6 B;  3VOU A;  4CS3 A;  4DV1 B;  4JI2 O;  3K59 A;  2QSA A;  4BWA A;  5KAI Z;  3WFV A;  1JJO A;  2XAG A;  2N04 A;  4K8X A;  3FX7 A;  3ICX A;  1IDS A;  4HAM A;  4JI3 O;  1R3J C;  1FXK C;  3OE7 G;  4OX9 B;  2IU0 A;  4X62 O;  3E22 A;  2ZE5 A;  1I08 A;  3CCU V;  1CXZ B;  2WLL A;  1Q81 W;  2OCC C;  3W7U A;  5JCO A;  2D3O W;  1S77 D;  1K5S A;  4RO2 A;  1SQG A;  4B3M O;  4GX5 A;  3P32 A;  1RM1 C;  3AG3 B;  4NXN O;  5LP6 B;  1AI4 A;  5B1A C;  1M56 C;  1HR0 O;  3F5T A;  3TXQ A;  1WN7 A;  2Z3Y A;  1M9N A;  1WPB A;  4J9Y B;  3STL C;  1SQV H;  4KUM A;  1U96 A;  3E22 B;  3EFF K;  2F93 B;  4X89 A;  3SJB C;  4JI0 O;  3EHB B;  1YXB A;  4WFH A;  4W4L A;  2L35 A;  2WLL B;  2QM7 A;  2UU9 B;  1IZ3 A;  1K97 A;  2Q0A A;  2ZE8 A;  3OT7 A;  4EFE A;  1QU7 A;  4AIL C;  3ABM B;  1XNR O;  1QLN A;  1R6N A;  3K57 A;  2BTO A;  1N34 O;  2KQX A;  2Q0O C;  1QR9 A;  1H2G A;  3HKB B;  3DTU B;  3OMI B;  1Q5O A;  4CH3 A;  1AR4 A;  1GMG A;  3IC9 A;  3K5O A;  5BZB A;  3MDS A;  2KSD A;  1JVM A;  1NBM G;  3FB7 C;  2DW4 A;  3P30 A;  4TV8 A;  1V55 B;  3GB7 C;  3G80 A;  3ABU A;  4LF9 O;  1VQ8 V;  3CCV V;  3FD9 A;  4NTY A;  2RMK B;  2QWR B;  3C3T A;  3UCS C;  1IXM A;  4JI1 B;  2RCV A;  1BSM A;  5LXT A;  4MVM A;  2ZKO A;  3QO5 A;  2WLK A;  2XAF A;  3EVK A;  3SYQ A;  2WA4 A;  4QIW F;  3O9O A;  1QCE A;  2YID A;  1OCR C;  2ZIO A;  4DO2 A;  4TV8 B;  3ZRX A;  5CA0 A;  3CME V;  1MSW D;  4K0K O;  3W7T A;  1R3I C;  4PI0 A;  5A9G A;  1I5X A;  1XMQ B;  4P2Z A;  5JJJ B;  2NR5 A;  1FKA O;  2CE4 A;  3DXR A;  2EIN C;  4Z2W A;  2W6J G;  1KP2 A;  4LF7 O;  3B09 A;  2F23 A;  5JQG A;  4JI4 O;  4B3T O;  1FFT B;  2XAQ A;  3L72 H;  4O2A A;  3G67 A; 
#chains in the Genus database with same CATH homology
 1R3K C;  2WLI B;  2PI5 A;  3IGA C;  5J9P C;  1KKD A;  2EBO A;  3SPJ A;  5CMU A;  5L3G A;  4MTX A;  4GX1 A;  1PL0 A;  2EIM B;  2IJK A;  5EBM C;  1PD3 A;  5DN6 G;  4N21 A;  1GM7 A;  1FXK B;  4G2K A;  1QBZ A;  1NQT A;  4GX0 A;  4PA7 A;  2EZO A;  4P30 A;  3ZRW A;  1YI2 V;  2Q67 A;  1JPX A;  1M90 W;  3OGC C;  4CZZ A;  2H94 A;  2DQ3 A;  4U7O A;  1W0K G;  2YEV B;  1W2B U;  2B5U A;  2XAH A;  2OCC B;  4MT8 A;  4MTO A;  3UKM A;  1GK9 A;  1K3E A;  5LGT A;  3ZCC A;  4G28 B;  4X8A A;  1VQL V;  3OFN G;  4LP8 A;  3K3W A;  3TCU A;  3FKS G;  1RM1 B;  1RPR A;  4WCE V;  5B1A B;  1AJP A;  1M56 B;  1M57 B;  4UUJ C;  1K9M W;  2ZD9 A;  3OEH G;  4XDL A;  5LHI A;  3UM7 A;  1AI6 A;  1YSC A;  4UV9 A;  3T1C A;  4WFG A;  3ZRW B;  2EJR A;  3ZN1 A;  1SES A;  2IH3 C;  3ASN C;  1PNM A;  1DF4 A;  4MVR A;  3W7W A;  3OMA B;  2W0F C;  3H01 A;  2HKO A;  1K4D C;  1KQS U;  3HB3 B;  4BAY A;  1VQM V;  4F4L A;  4GT1 A;  4MVZ A;  3OEE G;  2DWD C;  3LUT B;  4GX2 A;  1YIT V;  1DF5 A;  3BY6 A;  3DGE A;  3D36 A;  2Y48 A;  3K0G A;  3OAA G;  1QVG U;  2AHY A;  3CD6 V;  4I9W A;  2X6A A;  4LBE C;  1S0V A;  5B3S C;  2WAM A;  3K03 A;  3AG4 B;  2P6J A;  1YJN V;  1H8E G;  3K08 A;  1NJI W;  3LDC A;  1OCO C;  2QKS A;  3QO7 A;  3A0R A;  3QO8 A;  4PDL A;  4EKW A;  2EIJ B;  4P9O A;  4BW5 A;  3CC7 V;  4ASU G;  3ETE A;  3CCL V;  2A0L A;  3OR7 C;  2OT5 A;  1VQO V;  3RW0 A;  2EIK C;  4QE7 A;  5L3C A;  3ABL B;  2HR3 A;  4HZ3 A;  2ZDI C;  1WLE A;  1BMF G;  4TSF G;  3SYO A;  5H9C A;  2ZXW C;  1AJQ A;  5LBQ A;  1S3J A;  4PA3 A;  4MVU A;  5IYD O;  1SZT A;  2WLI A;  1PNL A;  4MTF A;  3WG7 B;  4WFF A;  1E1Q G;  2WLM A;  1VQP V;  3E35 A;  3SPH A;  3SPG A;  4JYC A;  3T2M A;  3FYI B;  1K5Q A;  1SRY A;  2IJI A;  3F5W C;  1FXK A;  1G8M A;  4QE9 A;  1YJW V;  2LP7 A;  3CCR V;  5B1N A;  2IJJ A;  5IYC O;  1KEC A;  4G27 B;  2CK3 G;  3W7S A;  3E2E A;  4MTG A;  2DYS B;  3OUS A;  1ENV A;  3SYC A;  4ZKI A;  3G6E V;  2HFE C;  1OCR B;  3AG2 C;  4N23 A;  5EK0 A;  5KUM A;  4QJF B;  3JYC A;  4R6Z A;  1NR7 A;  5LHH A;  3LDE A;  4UVC A;  3E89 A;  3ZRV A;  1QR8 A;  5HFM A;  1V54 B;  2HLD G;  2JJ1 G;  3LSQ A;  1JOY A;  3AG1 B;  2EZP A;  3STZ C;  3PJS K;  5B1B B;  3ZJZ A;  3ZIA G;  4H33 A;  3SPI A;  5L3D A;  2DYR C;  3I55 V;  4FK5 C;  3R65 A;  3ASO C;  1Y66 A;  4QPK A;  2EIN B;  2M7W A;  2W6I G;  2X0L A;  4BIZ A;  1OCZ B;  1F4N A;  2R9R B;  3AG3 C;  3B8M A;  3ZMT A;  5HFL A;  3RVZ A;  1DTO A;  1MG1 A;  4LC1 A;  1OHH G;  3JD4 A;  1OCC C;  3F7V C;  3GWO A;  2Q69 A;  2IJH A;  5IY5 C;  1GM9 A;  3CC4 V;  4WF9 V;  1NVP B;  4UVA A;  2WLN A;  3E8H A;  2WLH A;  3KG2 A;  4MSW C;  5CBH A;  1YIJ V;  1CPY A;  2HVK C;  3E83 A;  1FXV A;  1DLB A;  1AI5 A;  3JD0 A;  3G71 V;  3CCQ V;  3I56 V;  1VQ5 V;  3ZMU A;  3K9A A;  3LNM B;  4JTA B;  4QNH B;  2EIL C;  4R8C A;  4Z1M G;  2GSM B;  1Y4M A;  3HPL C;  3CMA V;  3ABM C;  3FYE B;  5L3B A;  2NLJ C;  3CPW U;  1ROP A;  2IH1 C;  2XND G;  3M99 B;  4LCU C;  1K34 A;  4PDR A;  2F43 G;  5FL7 G;  1F23 A;  3CP1 A;  4PEL A;  5B1O A;  4DXW A;  1BHB A;  3CYO A;  3E8G A;  2V1D A;  1AI7 A;  1GM8 A;  1ZWI C;  4JYB A;  5CN0 A;  1P4R A;  4JAS A;  2WSS G;  1THZ A;  2DQ0 A;  2A79 B;  3X2Q C;  4RQF A;  2HVJ C;  4RUF A;  4Q20 A;  1S5H C;  2X6C A;  4HYO A;  3ETD A;  5EBW C;  5LGU A;  3ZMZ A;  1PKX A;  5LHG A;  3ASN B;  1W0J G;  2B1G A;  4L87 A;  3ABK C;  3FB8 C;  1N8R W;  4R7C A;  5CBF A;  1QLE C;  4FPP A;  3G4S V;  3TET A;  1BHA A;  1K7D A;  3W7X A;  1V55 C;  3MHH C;  1S72 V;  2OTL V;  3ZN0 A;  2ITC C;  3T4Z A;  2YSU B;  5EC2 C;  1VQK V;  1M1K W;  1GO3 F;  4JTD B;  2R9I A;  4PA4 A;  2JEX A;  2X7R B;  1I5Y A;  4CBC A;  2XOK G;  3FB5 C;  3RBZ A;  3K79 A;  4E2L A;  2OTJ V;  1G4Y B;  2BOC C;  4RAI A;  3T4D A;  1ARO P;  4FIP C;  2A9H A;  5B3S B;  3LSS A;  1OCO B;  5IYB O;  1J95 A;  3NXS A;  3ZRS A;  1GKF A;  1NH2 D;  3QNE A;  4PDV A;  4KP4 A;  4MW3 A;  5H6Q A;  4XDK A;  1KD1 W;  1NKD A;  2EIK B;  2LFS A;  2XAJ A;  3ML0 A;  2V7Q G;  1RPO A;  5LGN A;  3OM3 B;  5L3E A;  2HG5 C;  2H8P C;  1YTF D;  3CC2 V;  2PI4 A;  2JIZ G;  2P90 A;  2WPD G;  2Y69 C;  1VQN V;  3E8F A;  5E1A C;  2ZXW B;  2WWW A;  1VQ6 V;  1K8A W;  5EC1 C;  3AEI A;  3TK1 A;  1H38 A;  2DWE C;  3VOU A;  3OR6 C;  4UV8 A;  2FTK A;  1MOF A;  1R73 A;  1YHQ V;  4QPJ A;  2QEX V;  3ABT A;  4TT3 G;  3OMN B;  1PNK A;  4TWK A;  3AG1 C;  3WFV A;  1K92 A;  2X6B A;  1SER A;  2XAG A;  5IDJ A;  1R6K A;  4MVS A;  2EIM C;  4JF3 A;  5CA3 A;  4HAM A;  4JAV A;  1R3J C;  1FXK C;  4MVQ A;  4P9P A;  1JX9 A;  3OE7 G;  4RUE A;  2IU0 A;  3AG2 B;  1LNQ A;  3CCU V;  2AHZ A;  1YJ9 V;  1Q86 W;  2ATK C;  4JGS A;  2QA4 V;  3LDD A;  2MK3 A;  1BL8 A;  2WLL A;  5CBG A;  5KUK A;  1Q81 W;  2OCC C;  3W7U A;  2D3O W;  4I5S A;  1CEZ A;  1S77 D;  1OZ0 A;  4YXW G;  1K5S A;  4RO2 A;  2DYR B;  5GW7 A;  3IFX A;  3ASO B;  1P7B A;  3B77 A;  3K0D A;  4GX5 A;  3P32 A;  2UXN A;  3AG3 B;  1RM1 C;  3VBB A;  3BEH A;  1K33 A;  1AI4 A;  4WFE A;  5B1A C;  1M56 C;  1M57 C;  1R3L C;  1JCH A;  1OCC B;  4JPR A;  2JEU A;  1H8H G;  5IY5 B;  4WFA V;  2Z3Y A;  1M9N A;  3STL C;  4J9Y B;  3K06 A;  2Z5U A;  3CXC U;  4KUM A;  2IU3 A;  3EFF K;  4X89 A;  4H37 A;  1COW G;  3EHB B;  4X88 A;  4WFH A;  1MAB G;  2WLL B;  2QM7 A;  2JJ2 G;  3E8B A;  1K97 A;  5DM6 V;  3JCZ A;  3ZMV A;  4KFM A;  2EIL B;  1E1R G;  2BOB C;  3MD0 A;  1JJ2 U;  3ZMS A;  3CCS V;  2B1I A;  3ABM B;  3RVY A;  1WPX A;  3OUF A;  4MS2 A;  1VQ9 V;  1ORQ C;  1QLN A;  1R6N A;  1K73 W;  3K04 A;  1FXH A;  4OXS A;  3OW2 U;  2Q68 A;  1XL6 A;  1UJW B;  2QM8 A;  1QR9 A;  1H2G A;  2LFR A;  3AG4 C;  3DTU B;  3CCE V;  3OMI B;  2XAS A;  1EFR G;  4WFB V;  3X2Q B;  3CCM V;  1GMG A;  1EBO A;  2EIJ C;  3IC7 A;  4FJC C;  2ZR3 A;  5BZB A;  2NNU A;  2ZDI A;  4MVO A;  4BIU A;  1JVM A;  2ZR2 A;  1NBM G;  3FB7 C;  3ABK B;  1SET A;  2DW4 A;  1Q82 W;  3F7Y C;  1B6Q A;  3ABL C;  4UXN A;  1VQ4 V;  1QLE B;  3P30 A;  2P67 A;  1S76 D;  1V55 B;  3GB7 C;  2WLJ A;  3ABU A;  1L1F A;  5KA6 A;  1VQ8 V;  1JQ0 A;  3CCV V;  2K1E A;  1K4C C;  3SYA A;  1E79 G;  3WG7 C;  5H6R A;  4XDJ A;  4PA9 A;  1NR1 A;  1IXM A;  4UVB A;  4GCZ A;  4J9Z B;  2KB1 A;  4ZBM A;  3B8N A;  2HJF C;  4MVM A;  2QTO A;  2GHY A;  1CP9 A;  1VQ7 V;  3QO5 A;  2QE7 G;  2WLK A;  1KP3 A;  2XAF A;  3FB6 C;  1F51 A;  4JAU A;  3SYQ A;  2UXX A;  4MW8 A;  4U7N A;  1XL4 A;  1QVF U;  3E86 A;  4R50 A;  3MHS C;  2ITD C;  2ZQM A;  1Q7Y W;  3SPC A;  4FMT A;  4QIW F;  5EBL C;  1AJN A;  3SJQ C;  2JK5 C;  4PDM A;  2DYS C;  3JD2 A;  5L3F A;  5C93 A;  1QCE A;  1OCR C;  4DO2 A;  2C2A A;  3JD1 A;  3ZRX A;  3ETG A;  3D3I A;  3CME V;  1MSW D;  1V54 C;  1AR1 B;  4PA6 A;  1KC8 W;  3W7T A;  1R3I C;  3JD3 A;  5B1B C;  2JDI G;  3SYP A;  1NH2 B;  1I5X A;  4P2Z A;  2IW5 A;  2Y69 B;  4RQE A;  2Q6A A;  1GTO A;  1EZJ A;  1NVP D;  2EIN C;  2YEV A;  1OCZ C;  3CCJ V;  2W6J G;  1KP2 A;  2P7T C;  4JTC B;  1YTF B;  1HWY A;  4XBF A;  1F4M A;  5KA5 A;  1FFT B;  1FS0 G;  2XAQ A;  1TUE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...