5KA5A

Hiv-1 gp41 variant v549e resistance mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
85
structure length
79
Chain Sequence
MQLLSGIEQQQNNLLRAIEAQQHLLQLTVWGIKQLQARGGHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transmembrane glycoprotein gp41
publication title Receptor Activation of HIV-1 Env Leads to Asymmetric Exposure of the gp41 Trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 36
structure length 79
sequence length 85
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ka5A00
4E2LA 1QBZA 5H9CA 1DLBA 2EBOA 4JF3A 2LP7A 3H01A 1JPXA 5CN0A 1Y4MA 3CYOA 1I5YA 1MOFA 4N21A 1I5XA 3MHSC 3M99B 1F23A 1EBOA 1SZTA 1MG1A 4N23A 1QR8A 1QR9A 4FJCC 3P30A 4FIPC 1JQ0A 1QCEA 2EZOA 1K33A 4JPRA 3WFVA 2X7RB 3B8MA 2EZPA 3B8NA 3GWOA 3B77A 5KA6A 5HFMA 1ENVA 2MK3A 1DF5A 3CP1A 1DF4A 4JGSA 3MHHC 3K9AA 1Y66A 4FK5C 1K34A 5KA5A 5HFLA 2OT5A 2M7WA 5CMUA 2P6JA 4G2KA
chains in the Genus database with same CATH superfamily
2BSKB 1Z2GA 4LFCB 1JVMA 5CA0A 4U3JA 3STZC 5JH7A 2M6YA 3CHXA 5H5NA 3CCJV 1SA0B 1N34B 5JVDA 3RYHA 1PV0A 5LP6C 3SPGA 1AR4A 4JZ2A 1H2MA 1SQVH 1G1XB 5EIBD 1BSMA 3VQWA 1F7YA 3CCMV 2H94A 2EIJB 2UUCB 1BGYH 1JR9A 2LP7A 5K1XA 2Q8VA 3P3PA 4I55A 4C7UA 3IC7A 2XUMA 4IYIA 4JI0O 4WFGA 4NTYA 1X59A 3ZRVA 1ZWIC 1CEZA 1VQKV 1V55C 3K03A 2YSUB 4X66B 5H9CA 1SQPH 1X4TA 1TGOA 3DXRB 4MSWC 4JTDB 3OD4A 3OT7A 1EBOA 1SZTA 3CC2V 3JD1A 5AG2A 5LL6Y 1GM7A 1MNGA 1KBHA 4NXNB 3M8AA 4TQDA 1OCCB 2QSAA 5LA6A 1OCOB 2OIEA 3I5DA 3JAWA 5KHKA 3KCXA 1QLNA 4KUMA 5EYPB 4BW5A 3G71V 1VF6C 2G38A 5EC2C 2H8PC 1F23A 3JD4A 2CGNA 1R6KA 3VQXA 1ROPA 2B9ZA 4O2BA 5J9PC 3RYFB 4UFZA 4WFAV 1VQPV 3SPIA 1IBLB 2V4DA 4DR2B 4LF7O 1FAFA 2QGNA 2NR5A 2UU9O 2KB1A 1YVWA 3RN4A 5EK0A 3ZRSA 1FJGB 1Q81W 3JCUZ 4DV4O 3SGIA 2KSDA 3VOUA 3K57A 1S5LZ 4JI1O 3IGAC 5BMVA 2OTJV 4YY3O 4NR1A 2UXXA 4UVAA 3U11A 5A9GA 3K5NA 3WG7B 2YDEA 5D5QA 2ZXWC 1VEWA 5KA5A 3SPCA 4TSFG 1IX9A 3OGIB 4DO2A 3CCUV 3QO8A 4MVMA 3N2GB 4PI2A 4UXNA 3ZN0A 1RM1B 1SF9A 3CB2A 4TV9A 1YF2A 3BVOA 2JS3A 5IJ0B 3B40A 1MG1A 3E22A 2CTWA 3QTCA 4L8JA 4X65B 5KA6A 2P90A 1S5HC 5KAIZ 4I4TB 3AEIA 4H0LB 1K97A 1WNSA 2KG7B 1YI2V 4NTXA 3AK2A 1H8HG 1QHTA 3O65A 2QWQB 1ZL8A 2ZM6O 2XAHA 3FX7A 1XQ8A 3HKEA 4LF9B 1NJIW 1M57B 5D5PA 4FLVA 3JSNA 3K58A 3H1HH 1SQXH 4XBFA 5IYZA 2R9AA 1YJ9V 1WP8A 5LMNB 3E2EA 2E5LB 5EC1C 4B3MB 4O4JA 3CWBH 1QNMA 1GMGA 1Y67A 3HKDA 1WA8A 4X89A 4B08A 2EILB 1MABG 1BE3H 2RJZA 4DV7B 5LP6A 1Z5WA 1OV9A 3J7AU 1FFXB 4LCUC 2QE7G 2UUCO 1S3JA 1OCZB 1N8RW 4YJ2B 1K5QA 1KECA 1RFYA 4J41A 5LHGA 1W59A 2EIJC 2P4VA 2YEVB 3E86A 2UUAB 1SQFA 1QU7A 5KHGA 4CBCA 1WB7A 4X66O 4LWSB 3LSSA 5JJEB 3HB3B 4NKGB 4QPJA 2FMLA 2DYRC 3FFQA 3ABMB 1K73W 1CPYA 3FAVA 5KHHA 5BY1A 2VWJA 2GUZA 2RQ6A 4XDLA 4ZI7A 3G6EV 4WFEA 1XNQB 4RQFA 5CA1B 4NXNO 1VQ8V 2R72A 1MA1A 1JFFB 1PNMA 2F4VB 1Z5VA 2P7TC 2DWDC 5FPRA 1GTOA 3ZHTA 1AR1B 3RGBA 5JWPA 3HKCB 3OW2U 1DTOA 1VF6A 2CTPA 1XHXA 1KUQA 3CXCU 1OCOC 4BIUA 2WLKA 4OPAA 1IBLO 2Q0AA 2ADPA 4DR2O 1FS0G 1QLEC 4GKKB 1VF7A 2P6JA 1FJGO 2JGDA 4QNHB 1K3EA 2HLDG 1ZLZA 2NN4A 2YS8A 3UO2A 3OEHG 4O4LA 5B5EZ 2JRIA 4CH5A 3U0ZA 3MDSA 3CS5A 4I0XB 3W7XA 3CCQV 4F6RA 5IYDO 2XAFA 5GONA 1LR1A 2LW7A 2VS0A 1NU1H 2D2CB 4DK1A 2A79B 4PELA 5BR8O 1E79G 3JARA 1SETA 4DV2B 2B1GA 3K06A 4ZHQA 4LP8A 1BCCH 1QR9A 1AI7A 4X65O 3SYQA 1A32A 1YTFD 1RM1C 4EFBA 4P2ZA 2ILMA 3JD0A 4JI7O 3TXQA 1FXKB 2DYSB 2GTSA 5TISZ 3OMAB 2DOSA 1B3QA 5L3GA 2LGQA 2WLLA 1T5EA 4WFBV 2CH7A 4CH6A 1Y74B 2NNUA 1YDXA 2HVJC 5LMNO 3JSLA 2E5LO 3CJHB 4B3MO 2L6LA 1Q90D 4FLZA 1MSWD 2Q4PA 4LC1A 1M57C 5H2FZ 4Z2WA 1XL4A 1XI1A 3ZMVA 5K1PA 4ZOLA 4WFFA 5C93A 4DV7O 2YXYA 5B1BB 5CBHA 5LXTA 4CS3A 1R3IC 4I50B 2BSKA 2X0LA 2EIKB 1M9NA 5CBGA 1Q86W 1PD3A 5BZBA 2EILC 1I7FA 1SA0A 4BR6A 5KUKA 2A3QA 2QTSA 1D2DA 3RWRD 4I7ZB 2N04A 3MHSC 2OCCB 3ML0A 3SR2C 2EINC 4JI0B 3T1HB 3APOA 3TK1A 1OCZC 2HEPA 2XASA 3CCLV 1QVFU 4JTAB 3AK3A 2GDSA 2IH1C 3D8CA 1Y76B 1QBZA 2Q6AA 1H8EG 3ZBHA 4XDKA 2CDYA 2QM4A 3N2KB 4GT1A 4DV0B 4TUYB 1XNQO 3KZIZ 3NR7A 3E8BA 4CC5A 4UVBA 1PL4A 2VWKA 3DXRA 2F4VO 1IURA 1Y66A 4X1KB 3O9OA 3HR0A 4K8XA 1S77D 4HYOA 4H13B 1NH2D 3QO5A 4GX0A 3ABTA 4D6TH 1M5IA 5FPOA 1KC8W 1AB3A 1W0JG 3OTFA 3CRMA 5EYPA 5B1AB 2F1MA 4PA6A 1N0NA 2H3OA 5IWAB 4LF7B 4KXRA 2LGWA 3RYFA 5C8YB 1P7GA 1B04A 1U96A 1H2GA 5KX5B 3CPWU 4P30A 4D7SA 3E8HA 3WB2A 2ZNIA 3CE2A 1OHHG 3CCSV 1GK9A 2QWOB 4FLTA 3BA8A 4B3TB 3TGUH 4MTGA 1JQ0A 3N2GA 5FLXN 3LSQA 3LNNA 3BAAA 1DF5A 1P84F 3AG2B 5KLVH 4WF9V 2HG5C 1XDCA 2CE4A 3Q4HB 5IJ0A 2KQXA 2VQEB 3OEEG 1UFIA 3ZEDA 2BCCH 4YIOA 4PDMA 5LOVB 1AROP 1MZEA 4WFHA 1S76D 5B66Z 4PHZA 2X6BA 2LJ2A 2WLJA 2P67A 1HNZB 1FXKC 4HAMA 1NVPB 2DYSC 1S5JA 1YEWA 3ZHUA 1V54B 1SZXA 2Q7HA 2OWOA 5F2VO 5L3BA 2K1EA 4MVOA 1OZ0A 4WBNB 4UCTA 5BXZA 1VQ7V 1IBMO 3CX5F 1Q5OA 2AGAA 3OFNG 1R6TA 4MT8A 2IU0A 1GN4A 3G6BA 4FVMA 1IXMA 3WB1A 1YCIA 4DV3B 1N36B 3C90A 5B1BC 4DXWA 1SERA 1HWYA 4X64B 2IJKA 2EIKC 3W7TA 3CCVV 3B2EE 4NVPA 2ZIMA 1SKVA 2XTAA 5A2QN 3X2QB 2ADQB 3AK1A 3T1HO 1KYOF 2P22C 5KHIA 3K5MA 4DK0A 2E74B 4Z1MG 5EZYB 3LSUA 1Q7YW 4YJ2A 5LGTA 4LH6A 4DUYB 5GTIZ 2OCCC 4Z1VA 1H2LA 4PI0A 2FB5A 4UCUA 3BPZA 4ICGA 4MW3A 2ZD9A 2YEVA 1IXBA 3GB7C 3G4SV 4DV0O 2PF4E 1IBKB 1LUVA 4J42A 3GWKC 3AG1B 1U97A 1EFRG 4LWSA 4NXMB 1NTMH 2OT5A 1PPJH 4MVQA 4FFKA 2EULA 3BHPA 1MZFA 4X20B 2P06A 5CA1A 4UCRA 4X8AA 2QDOA 3A0RA 1EZVH 1RSOB 2X7RB 1H2NA 3ZCCA 3ASNB 3HKCA 1S72V 4MVUA 1AI4A 3L72H 4HZ3A 5IWAO 1XOUA 3CSXA 3FB8C 4R6ZA 4NTWA 3ZRXA 2ZT9B 1R6NA 1VMGA 4K35A 2E76B 1JJ2U 5B1AC 4GZRB 3TXSA 4QGPA 1H2SB 3KG2A 5J2UB 1R1BA 1XMOB 1XNRB 1VIBA 1F4NA 1N0JA 2VQFB 4IIJA 5LYJA 1AI5A 1Q6HA 5L3CA 2EBOA 4JTCB 3CRQA 2ATKC 1N33B 3HPLC 4B3TO 3UT5B 3OR7C 5BR8B 3FYEB 4I0XA 3SYCA 2ETNA 3CRRA 4AHCA 1AJNA 3BEHA 3TJTA 2BTQB 3F7YC 3R66A 3C3SA 4IHJB 4PA9A 3ZHQA 2VQEO 4KHPB 5CA3A 2ZDIC 1K8AW 4EEQA 1QVGU 3G67A 2B1IA 4JI7B 5GW7A 2BOBC 3CYOA 1FPOA 4J7ZA 2XAGA 4RUEA 4PV1B 3AG2C 4Q6GA 4FJCC 2E75B 4JYAB 1FYJA 1HNZO 5IJ9B 2UXBB 1NT2B 4DW1A 1M4UA 1FXKA 2AHZA 3CRCA 3K9AA 2X6CA 1B6QA 4RO2A 1K4DC 3RYIB 3E8GA 4MTXA 2R9IA 1Y74A 3JAKB 4W4KA 1CP9A 4U3JB 2WLHA 5JH7B 3CJHA 4HNAB 4X1IB 2AZ2A 1RPOA 2A0LA 5EBWC 4DV3O 2K9PA 1N36O 3RYHB 2IBZH 4FM2A 1PNLA 4QIWF 4JF3A 1AJPA 3ZMSA 3QO7A 4X64O 1JCHA 2ZE6A 3DC6A 4I50A 1XHZA 1KMIZ 1AJQA 1AP5A 1KP2A 1EM1A 3JASB 3THOA 5JCOC 2CUGA 4G27B 2EZOA 3F7VC 4CH4A 4JGSA 3CD6V 4UCOA 5JJNB 5ITZB 2QJ1A 4DUYO 3BY6A 3SJCC 3X2QC 2NLJC 4WCEV 1O9GA 5IYCO 1BS3A 4OPHA 1IBKO 2YC0A 4DRXB 5LHIA 4OX9B 5DM6V 5KUMA 4NYKA 3H1LH 3ZJZA 5HFMA 1Y76A 4NXMO 2VRZA 1FKAO 2UXDB 1TUEB 1PNKA 4D7TA 3I55V 4Q20A 1W2BU 2YI8A 2YI9A 1COWG 1Q6UA 1VQ5V 3K59A 1VQ4V 2BE3A 3AG1C 2ZE5A 4I9WA 3SYAA 5CN0A 1SQBH 1GH6A 1VQNV 1I94B 3HKBA 1AP6A 3E8FA 3H1KH 1OCCC 4X1KA 5JJJB 2JEXA 2WLMA 3RVZA 4PDVA 3RYCB 1YIJV 1GN2A 1SESA 5LHHA 4CH3A 1F4MA 4AI8A 4O2BB 1W0KG 2UUBB 3CEIA 3PJSK 5EIBC 4BWAA 3ZHSA 5GTHZ 2QKAA 1EZJA 2P4KA 2C2AA 4TV8A 3E35A 4UCSA 3JAMN 2JJ1G 1HNWO 4O2AA 1HNXB 2EZPA 4UV9A 3ABLB 1XMOO 1XNRO 3A2FA 3DC5A 3JD2A 5BMVB 2VQFO 2QM8A 5CBFA 4JAUA 3BRCA 3TCUA 3ZRWB 3OAAG 1N33O 4B7KA 5LBQA 3AG3B 1I5YA 2XNDG 4N21A 5KX5A 3WG7C 1PL0A 2ZNJA 4R7CA 2A9HA 1MSDA 3JYCA 4IT5A 4CZZA 4JZGA 3RBZA 4KHPO 4K0KB 2ZDIA 2DW4A 3OTOB 2CK3G 3K0GA 2Y4UA 4ASUG 1KKDA 1JJOA 2Q9LA 4F6EA 4IL6Z 1TVKB 2YIAA 4JYAO 4LR3A 3Q4HA 2UXBO 3OGCC 4O4HB 3EFFK 3H1JH 4BIOA 2F66C 3HKEB 5LOVA 2EJ7A 2PI4A 5EBMC 1R3KC 3A0BZ 2PYLA 4LF4O 1SQQH 1RPRA 4YJ3B 1IBMB 2ODMA 1WAZA 1WA8B 3B8NA 4AILC 3L73H 5IT9N 3SYPA 1PKXA 4JAAA 4J80A 3FKSG 3H1IH 2OTLV 1N4CA 4UUJC 3OMIB 2IH3C 3SPJA 2E3CA 1YTFB 5KMGB 5JCOA 2JJ2G 3CCRV 4DUZO 3GWOA 3ETGA 3DTUB 4OGQB 2DMXA 3UCSC 1KP3A 2DWEC 2WA3A 4PA4A 1D5AA 1TUBB 3CRAA 3C3TA 3CMEV 1V55B 4L87A 4U7NA 1MOFA 4LH7A 4YXWG 4OX9O 4U3FH 1OJHA 5EZYA 2AXTZ 1YXBA 4FZ1A 4DR5B 4HBNA 4FLXA 3ZN1A 2UXDO 4LF8B 3MHHC 4OXSA 3ABMC 2JS5A 3ETEA 2JEUA 1VQ6V 1ZTEA 3SYOA 1GN3A 1Y4MA 1I94O 2BTOA 1WP7A 2LQTA 1XBLA 3K9SA 2DJVA 2WLIB 1JA8A 2ZQMA 1M56B 1HW7A 1ENVA 1M93A 3CP1A 4X20A 1GRJA 5JQGB 2N74A 1MMMA 2Q68A 4JI8B 1BL8A 2LFRA 2UUBO 4LF6B 1JMKC 1M90W 2ITDC 4BIZA 3K5OA 1P7BA 2Z3YA 2RNBA 2Q5ZA 3K3WA 1HNXO 1K33A 4DV6O 1IDSA 3MAQA 1N32B 2WSSG 3ETDA 1XEQA 2RDCA 5B3SB 3EVKA 4DV5B 1KKCA 2X6AA 3QG5A 4X9QA 2DE0X 5IY5B 1LUWA 2WLNA 4PA3A 1YZBA 2QKCA 3BA9A 3ABLC 1WJZA 5J2UA 1BMFG 2HKOA 2XHBA 3E89A 3JATB 1L8DA 3B4SA 3IJ4A 1RP3B 2F43G 3J80N 1P4RA 1D5NA 1NH2B 4K0KO 3AG3C 4B3SB 4PDRA 3T1YB 1L1FA 3UT5A 3OTOO 1R3LC 5EBLC 1JPXA 4DR6B 3F5TA 2OCHA 3ZMTA 2R9RB 3K0DA 2BTQA 4P9PA 4ABMA 1Q8IA 4IHJA 1VQMV 2QM7A 3U10A 1VF5B 2PI5A 4NB5A 4I4TA 5LGUA 1WN7A 3KCYA 2KG7A 4AQYB 4JI6B 4G28B 4W4LA 2YICA 3STLC 4H33A 5IJ9A 1PP9H 1UJWB 1K9MW 2V1DA 1YITV 3RYIA 1G8MA 2QWRB 3JD3A 5E79Z 2GSMB 2W0XA 2IM9A 3JAKA 2GBOA 4MVRA 2CTQA 1WPBA 3DGEA 4HNAA 4X1IA 3ZMZA 1YHQV 3KKYA 4N23A 2XAJA 3WU2Z 1FFXA 1XILA 4FFBB 1K4CC 3FD9A 1ZAUA 2YIDA 1O9HA 3D3QA 4GUNA 4JI2B 4JYBA 2D3OW 3JASA 3F5WC 2EJRA 4DR3O 2ZE7A 2XT9A 4LBEC 5ITZA 4DR5O 4LNUB 1QCEA 3VQYA 3ZMUA 4LF8O 2DYRB 2MW2B 3I56V 3CXHF 4YHHB 2IJIA 2IU3A 4DRXA 2ZE8A 2UXCB 3H01A 3LDCA 3ASOB 1EN4A 2AHYA 3VQVA 3AG7A 2DN9A 3OMNB 2ZINA 3CC4V 2Q69A 1JFFA 2Y0IA 1XREA 3IFXA 4LF5B 4GLXA 1BQ0A 3OE7G 2W0FC 3J81N 4JI8O 2YUAA 1NQTA 4LF6O 2JK5C 1L0NH 2N05A 4UB6Z 1DLBA 1QLEB 3IC9A 3TETA 4B7EA 1ZX3A 1M56C 4ZBMA 4KP4A 4DYLA 3RYCA 4QJFB 4GYCB 3WB0A 1N32O 1HNWB 5H6RA 4CS4A 3UM7A 4DR4B 3EXAA 2RMKB 2KKWA 2QWNB 4RQEA 4DV5O 3B09A 4FK5C 4FLYA 1Q82W 4GX2A 2JVDA 1GKFA 1IVSA 4B3RB 3QF7A 3JALB 1US6A 4EFEA 2Y69B 3QVNA 1K5SA 4X62B 4I9QA 5DEDA 5B3SC 3D36C 1BHAA 5J2TB 4FZ0A 1E1QG 3APQA 2YIBA 5DECA 5FL7G 5IY5C 2B5UA 3ZRWA 4B3SO 5B1OA 1I0HA 5KHJA 3T1YO 1Q3EA 2YXHA 1WB8A 2HVKC 2AZ0A 4FMTA 1NR7A 5L3EA 2A06H 3CCEV 4DR6O 2Y0PA 2Q7EA 2HJFC 5CB4B 1CXZB 3WFVA 4X1YB 4O4IB 4JI4B 2RN9A 3R65A 1BT8A 1J95A 4TT3G 3M7MX 4AQYO 4JI6O 1FXVA 5FNVB 3T2MA 1TVKA 3T4ZA 2HFEC 4PD4F 2PY5A 1SQGA 4DR7B 4O4HA 4EB6B 1FFTB 5DN6G 1Y6XA 2DQ3A 3ABKB 4LF4B 2ZR2A 2WAMA 1NS1A 1AVMA 4JI3B 1EN6A 4RWUA 1V54C 1HP8A 2BOCC 4JPRA 4QE9A 5CA0B 1NTKH 1TAEA 1R73A 5LGNA 4H44B 4X88A 2PGGA 5H6QA 2P5OA 3A8TA 4FLWA 5JVDB 1AILA 4LFCO 4YJ3A 4CC6A 2ZR3A 2Z0AA 3GVMA 2ZCEA 2HHHB 1XMQB 2FKXA 1KQSU 4JI5B 1H38A 4MVZA 1N34O 1OCRB 2QKSA 4FPPA 3LUTB 3ZIAG 3ABUA 3S3XA 4I55B 4PDLA 4DUZB 3UO3A 2EINB 1JOYA 3K04A 4JI2O 2L35A 5IE9A 5KMGA 2DQ0A 4J10A 4H37A 1BQZA 2ITCC 4LFBB 3A0HZ 4BW9A 2QWPB 4QE7A 3W7SA 1FD9A 1TUBA 2Q67A 2JGUA 2Z5UA 3OUSA 4YHHO 3N2KA 2Q73A 1HR0B 1H2KA 2UXCO 3H9VA 4I5SA 2IJHA 4MTFA 1VP7A 4TUYA 2YIBD 5LMUB 5LA6B 1I5XA 3JAWB 5L3DA 4GX1A 2CGOA 4LF5O 4ZIBA 3LDDA 1K92A 1PM9A 4GCZA 3ASOC 2GV9A 1VQ9V 1S0VA 4GX5A 1J5EB 1YJNV 2WLIA 3JCZA 3UKMA 1L0LH 1SS3A 4J9ZB 4J11A 1TA8A 3ASNC 4LFAB 5JQGA 3K79A 4FM0A 4DR4O 1ZUQA 4A5UB 2W6JG 5KAFZ 2JDIG 4DV6B 4FLUA 2MK3A 3T1CA 2V7QG 3VBBA 3FB5C 4B3RO 4KFMA 2R70A 5CMUA 5C8YA 1I08A 3P3NA 4E4EA 4ZKIA 1GAXA 3S3WA 2EIMB 4F4LA 4IIJB 5LYJB 2XAQA 3PN1A 4CS2A 4X62O 3L74H 2Q0OC 3FYIB 4DR1B 4DV1B 2F93B 3D36A 4TV9B 1LNQA 4JV5B 2LW1A 1DF4A 3ICXA 3E22B 2Y69C 3L75H 2WWWA 2YXLA 3JATA 3FB6C 3RW0A 4MS2A 4GKJB 1QQCA 2JIZG 4RUFA 2O57A 3ZHVA 4JI4O 4TQFA 2PZSA 3E83A 2HJDA 4U7OA 1AR5A 1ZL8B 2EX3A 4TWKA 3AG4B 1GM8A 1SRYA 4BAYA 4G2KA 2PUSA 1P49A 5IYZB 4DR7O 1NR1A 4JASA 1KB9F 1GM9A 4JI3O 2A7WA 4LF9O 4O4JB 1NKDA 2Y48A 2FTKA 3L70H 4KL1A 3B8MA 3HKDB 1ORQC 3DSQA 2Y4TA 3ABKC 1NI8A 3CC7V 4WBNA 2FL4A 2HHHO 2F23A 1XMQO 4YIPA 5LP6B 1M1KW 4JI5O 2W6IG 2QEXV 3K5LA 4J7JA 4PJ0Z 1WLEA 1UPGA 5B1NA 2PTMA 3SJQC 2RCVA 1G4YB 2IJJA 1R3JC 5E1AC 3ZS8C 3T4DA 1KD1W 1OCRC 2CTRA 4JYCA 4PA7A 2OYQA 4JAVA 3OR6C 4FFBA 1SC5B 4LFBO 4MW8A 3SPHA 4DR3B 1VQOV 4IYHA 4RAIA 3P30A 3ETQA 1XL6A 4UB8Z 2QR4A 4R50A 2HR3A 2UUAO 2IW5A 4JYYA 1XUQA 4MVSA 4FM1A 1AI6A 3FAVB 1HR0O 2WPDG 2GUZB 4ZI7B 1DGSA 2AW9A 1EN5A 4IGGA 1BHBA 3P32A 5IYBO 4LNUA 5LMUO 1Q6IA 1KU9A 4UVCA 3ZHRA 1E1RG 4DW0A 1HDJA 2PYJA 4FIPC 4K3AA 3L9DA 2WA4A 4UV8A 3HKBB 2ZKOA 3EHBB 1G6UA 2M7WA 5IDJA 1J5EO 3RVYA 1FXHA 1RSOA 4UCVA 2GHYA 3QNEA 4LFAO 1VQLV 1IZ3A 3W7UA 2JGDB 1QR8A 4K8ZA 3SDLA 1NZ6A 3SJAC 4TV8B 4P9OA 2ZIOA 3BFRA 4GKKO 1BZKA 4O2AB 4O4LB 1URFA 4EKWA 1K34A 1YJWV 2UU9B 2CAZC 2UXNA 3ZX6A 1NVPD 3IAYA 1K7DA 3L71H 3RT3C 5L3FA 4F6RB 3CMAV 2ZXWB 3BABA 4TOIA 3D3IA 5GONB 4DR1O 1THZA 4DV1O 4DV4B 4MTOA 4JI1B 1VARA 4JV5O 4YY3B 3JARB 3LNMB 2EIMC 2LFSA 3JALA 4ZHQB 3W7WA 3K08A 4QPKA 1YSCA 2F95B 3OUFA 1JX9A 3UQ8A 2QA4V 4DV2O 2LO1A 3G80A 5J2TA 1NTZH 4GKJO 4J7KA 2GTAA 2XOKG 4J9YB 1GO3F 1Q43A 3MD0A 3B77A 3N27A 1NBMG 2HP8A 2FYUH 5HFLA 4R8CA 2WLLB 5CB4A 3OM3B 1DK1A 4E2LA 2CH7B 2ARHA 2QTOA 2Q7GA 3RFRA 3SJBC 4X1YA 4O4IA 3M99B 1WPXA 1B06A 1V9PA 2OIGA 3AG4C 1GN6A 4XDJA 2ZM6B 1ZSPA 3NXSA 3BCCH 5FNVA 3LDEA 3FB7C 4ZOLB 4EB6A 1F51A 5LXTB
chains in the Genus database with same CATH topology
1QBZA 2Q6AA 1H8EG 5L3EA 3CCEV 3PJSK 4XDKA 1JVMA 3STZC 1EZJA 4GT1A 2C2AA 2HJFC 3E35A 3CCJV 2JJ1G 3WFVA 3E8BA 2EZPA 3SPGA 4UV9A 4UVBA 3ABLB 3JD2A 3R65A 1Y66A 2QM8A 5CBFA 4JAUA 1J95A 4TT3G 3CCMV 1S77D 3TCUA 1FXVA 4HYOA 3T2MA 2H94A 2EIJB 1NH2D 3ZRWB 3OAAG 2LP7A 3T4ZA 2HFEC 3QO5A 4GX0A 3AG3B 5LBQA 1FFTB 1I5YA 5DN6G 2XNDG 4N21A 2DQ3A 3IC7A 3ABTA 3ABKB 2ZR2A 2WAMA 3WG7C 1PL0A 1V54C 1KC8W 2BOCC 4JPRA 4WFGA 4QE9A 4R7CA 1R73A 2A9HA 3ZRVA 1W0JG 5LGNA 1ZWIC 4X88A 3JYCA 4CZZA 5H6QA 3RBZA 5B1AB 4PA6A 1CEZA 1VQKV 1V55C 2ZDIA 2YSUB 2DW4A 3K03A 2ZR3A 5H9CA 2CK3G 3K0GA 4ASUG 1KQSU 1KKDA 4MSWC 1H38A 4MVZA 4JTDB 1OCRB 2QKSA 4FPPA 1EBOA 1SZTA 3LUTB 3CC2V 3JD1A 3ZIAG 3ABUA 1GM7A 3OGCC 4PDLA 3EFFK 1H2GA 2EINB 1OCCB 3CPWU 4P30A 1JOYA 3K04A 1OCOB 3E8HA 2PI4A 5EBMC 2DQ0A 1R3KC 4H37A 2ITCC 1OHHG 4KUMA 1QLNA 4BW5A 3CCSV 1GK9A 3G71V 5EC2C 1RPRA 2H8PC 1F23A 4MTGA 3JD4A 4QE7A 1JQ0A 1R6KA 3W7SA 1ROPA 3B8NA 5J9PC 2Q67A 3LSQA 4WFAV 1VQPV 1DF5A 2Z5UA 3SPIA 3OUSA 3SYPA 3AG2B 4WF9V 1PKXA 2HG5C 2KB1A 3FKSG 4I5SA 2IJHA 3OEEG 5EK0A 4MTFA 3ZRSA 2OTLV 4UUJC 1Q81W 3OMIB 2IH3C 3SPJA 4PDMA 1I5XA 1AROP 1YTFB 3VOUA 5L3DA 4GX1A 4WFHA 3IGAC 2OTJV 1S76D 2JJ2G 3CCRV 2UXXA 2X6BA 4UVAA 2WLJA 3GWOA 2P67A 3ETGA 3LDDA 1K92A 4GCZA 1FXKC 4HAMA 3ASOC 1NVPB 2DYSC 3WG7B 3DTUB 1V54B 2ZXWC 5KA5A 3SPCA 1KP3A 4TSFG 2DWEC 1VQ9V 4PA4A 4DO2A 3CCUV 5L3BA 3QO8A 4MVMA 1S0VA 4GX5A 2K1EA 4UXNA 3ZN0A 4MVOA 2WLIA 1RM1B 3JCZA 1YJNV 3UKMA 1NR7A 3CMEV 1V55B 1OZ0A 4J9ZB 1MOFA 4L87A 4U7NA 4YXWG 1VQ7V 3ASNC 1MG1A 3K79A 3OFNG 2W6JG 2JDIG 5KA6A 3ZN1A 4MT8A 2MK3A 2P90A 3T1CA 2IU0A 3MHHC 1S5HC 2V7QG 3VBBA 1IXMA 3FB5C 4OXSA 4KFMA 5CMUA 3AEIA 3ABMC 3ETEA 2JEUA 1K97A 4ZKIA 1VQ6V 2EIMB 4F4LA 5B1BC 4DXWA 3SYOA 1YI2V 1SERA 1Y4MA 2XAQA 1HWYA 2IJKA 2EIKC 1H8HG 3W7TA 3CCVV 3FYIB 2XAHA 2WLIB 3D36A 3X2QB 1LNQA 1NJIW 1M57B 2ZQMA 1M56B 1ENVA 3CP1A 1DF4A 4Z1MG 4XBFA 2Y69C 1Q7YW 2Q68A 5LGTA 1BL8A 2LFRA 2WWWA 2OCCC 1YJ9V 3E2EA 5EC1C 3FB6C 3RW0A 1M90W 2ITDC 4MS2A 1GMGA 4BIZA 4MW3A 4X89A 1P7BA 2YEVA 2ZD9A 2Z3YA 2EILB 3GB7C 3G4SV 2JIZG 1MABG 4RUFA 3K3WA 1K33A 3AG1B 1EFRG 2WSSG 3ETDA 3E83A 4U7OA 4TWKA 5B3SB 3AG4B 1GM8A 2OT5A 4MVQA 4LCUC 2QE7G 2X6AA 1SRYA 4BAYA 4G2KA 1S3JA 5IY5B 2WLNA 1OCZB 1N8RW 4PA3A 1NR1A 4JASA 3ABLC 1K5QA 1KECA 1BMFG 1GM9A 2HKOA 3E89A 4X8AA 1NKDA 3A0RA 5LHGA 2Y48A 2FTKA 2X7RB 3B8MA 2F43G 2EIJC 1P4RA 3ZCCA 1ORQC 2YEVB 3E86A 3ASNB 1S72V 1NH2B 3AG3C 4MVUA 1AI4A 4HZ3A 4PDRA 4CBCA 1L1FA 3ABKC 3CC7V 3FB8C 4R6ZA 1R3LC 3ZRXA 1M1KW 3LSSA 5EBLC 2W6IG 1JPXA 2QEXV 3HB3B 1R6NA 3ZMTA 2R9RB 3K0DA 4QPJA 1WLEA 4P9PA 2DYRC 3ABMB 1VQMV 1JJ2U 5B1AC 1K73W 5B1NA 2QM7A 1CPYA 4XDLA 2PI5A 3SJQC 4WFEA 3G6EV 3KG2A 4RQFA 5LGUA 1VQ8V 1G4YB 2IJJA 1R3JC 5E1AC 3T4DA 1KD1W 1F4NA 1PNMA 1OCRC 2P7TC 4JYCA 4PA7A 1AI5A 2DWDC 1GTOA 1AR1B 4JAVA 5L3CA 2EBOA 3OR6C 4G28B 4JTCB 3STLC 2ATKC 3OW2U 3HPLC 4H33A 4MW8A 1DTOA 3OR7C 3SPHA 1UJWB 3FYEB 1K9MW 1VQOV 3CXCU 3SYCA 4RAIA 1OCOC 3P30A 2V1DA 2WLKA 1AJNA 4BIUA 1YITV 3BEHA 1XL6A 1G8MA 4R50A 2HR3A 3F7YC 2IW5A 4PA9A 4MVSA 1FS0G 3JD3A 1QLEC 1AI6A 2WPDG 2GSMB 5CA3A 2ZDIC 2P6JA 1K8AW 1BHBA 3P32A 5IYBO 1K3EA 2HLDG 4MVRA 4QNHB 1QVGU 2B1IA 5GW7A 2BOBC 3CYOA 3DGEA 3ZMZA 4UVCA 2XAGA 1E1RG 4RUEA 3OEHG 3AG2C 1YHQV 4N23A 2XAJA 4FJCC 4FIPC 1K4CC 4UV8A 3EHBB 1FXKA 2AHZA 3K9AA 3W7XA 3CCQV 5IYDO 2XAFA 2X6CA 1B6QA 2M7WA 4RO2A 1K4DC 4JYBA 5IDJA 2D3OW 2A79B 3F5WC 3E8GA 4PELA 3RVYA 2EJRA 1E79G 1FXHA 1SETA 2GHYA 3QNEA 2B1GA 4MTXA 3K06A 1VQLV 3W7UA 2R9IA 4LBEC 4LP8A 1QR8A 1QR9A 1QCEA 1AI7A 1CP9A 2WLHA 3SYQA 3ZMUA 1YTFD 4P9OA 1RM1C 2DYRB 1RPOA 4P2ZA 2A0LA 5EBWC 4EKWA 3I56V 1K34A 2IJIA 2IU3A 1YJWV 2UXNA 3JD0A 1NVPD 1PNLA 4QIWF 1K7DA 4JF3A 1AJPA 3H01A 3LDCA 1FXKB 3ASOB 3ZMSA 2DYSB 2AHYA 3QO7A 5L3FA 3CMAV 2ZXWB 1JCHA 3D3IA 1AJQA 3OMAB 3OMNB 1KP2A 1THZA 4MTOA 3CC4V 4G27B 2Q69A 2EZOA 5L3GA 3IFXA 2WLLA 3LNMB 3OE7G 2EIMC 2W0FC 3F7VC 4WFBV 2LFSA 4JGSA 3CD6V 2NNUA 3W7WA 3K08A 4QPKA 1NQTA 2HVJC 1YSCA 3BY6A 3OUFA 2JK5C 1JX9A 2QA4V 1DLBA 3X2QC 2NLJC 1QLEB 1MSWD 4WCEV 4LC1A 3TETA 1M57C 1M56C 2XOKG 4J9YB 5IYCO 4ZBMA 1GO3F 1XL4A 4KP4A 3ZMVA 5LHIA 4WFFA 5DM6V 4QJFB 5C93A 5KUMA 3MD0A 5B1BB 5H6RA 5CBHA 3UM7A 3B77A 3ZJZA 1R3IC 5HFMA 2X0LA 2EIKB 1M9NA 1NBMG 5CBGA 4RQEA 1TUEB 1PNKA 1Q86W 4FK5C 1PD3A 1Q82W 5HFLA 3I55V 5BZBA 4Q20A 4GX2A 1W2BU 2EILC 1GKFA 4R8CA 2WLLB 1COWG 3OM3B 1VQ5V 4E2LA 5KUKA 1VQ4V 2QTOA 3AG1C 3SYAA 4I9WA 5CN0A 2Y69B 1VQNV 3MHSC 3M99B 1WPXA 2OCCB 3E8FA 1K5SA 3ML0A 2EINC 5B3SC 1OCCC 3AG4C 1BHAA 4XDJA 2JEXA 1E1QG 3NXSA 5FL7G 2WLMA 5IY5C 3RVZA 2B5UA 3FB7C 3LDEA 1OCZC 4PDVA 3TK1A 3ZRWA 2XASA 3CCLV 1QVFU 4JTAB 1YIJV 5B1OA 1SESA 5LHHA 2IH1C 1F4MA 1F51A 2HVKC 4FMTA 1W0KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E2L A;  1QBZ A;  5H9C A;  1DLB A;  2EBO A;  4JF3 A;  2LP7 A;  3H01 A;  1JPX A;  5CN0 A;  1Y4M A;  3CYO A;  1I5Y A;  1MOF A;  4N21 A;  1I5X A;  3MHS C;  3M99 B;  1F23 A;  1EBO A;  1SZT A;  1MG1 A;  4N23 A;  1QR8 A;  1QR9 A;  4FJC C;  3P30 A;  4FIP C;  1JQ0 A;  1QCE A;  2EZO A;  1K33 A;  4JPR A;  3WFV A;  2X7R B;  3B8M A;  2EZP A;  3B8N A;  3GWO A;  3B77 A;  5KA6 A;  5HFM A;  1ENV A;  2MK3 A;  1DF5 A;  3CP1 A;  1DF4 A;  4JGS A;  3MHH C;  3K9A A;  1Y66 A;  4FK5 C;  1K34 A;  5KA5 A;  5HFL A;  2OT5 A;  2M7W A;  5CMU A;  2P6J A;  4G2K A; 
#chains in the Genus database with same CATH topology
 2BSK B;  1Z2G A;  4LFC B;  1JVM A;  5CA0 A;  4U3J A;  3STZ C;  5JH7 A;  2M6Y A;  3CHX A;  5H5N A;  3CCJ V;  1SA0 B;  1N34 B;  5JVD A;  3RYH A;  1PV0 A;  5LP6 C;  3SPG A;  1AR4 A;  4JZ2 A;  1H2M A;  1SQV H;  1G1X B;  5EIB D;  1BSM A;  3VQW A;  1F7Y A;  3CCM V;  2H94 A;  2EIJ B;  2UUC B;  1BGY H;  1JR9 A;  2LP7 A;  5K1X A;  2Q8V A;  3P3P A;  4I55 A;  4C7U A;  3IC7 A;  2XUM A;  4IYI A;  4JI0 O;  4WFG A;  4NTY A;  1X59 A;  3ZRV A;  1ZWI C;  1CEZ A;  1VQK V;  1V55 C;  3K03 A;  2YSU B;  4X66 B;  5H9C A;  1SQP H;  1X4T A;  1TGO A;  3DXR B;  4MSW C;  4JTD B;  3OD4 A;  3OT7 A;  1EBO A;  1SZT A;  3CC2 V;  3JD1 A;  5AG2 A;  5LL6 Y;  1GM7 A;  1MNG A;  1KBH A;  4NXN B;  3M8A A;  4TQD A;  1OCC B;  2QSA A;  5LA6 A;  1OCO B;  2OIE A;  3I5D A;  3JAW A;  5KHK A;  3KCX A;  1QLN A;  4KUM A;  5EYP B;  4BW5 A;  3G71 V;  1VF6 C;  2G38 A;  5EC2 C;  2H8P C;  1F23 A;  3JD4 A;  2CGN A;  1R6K A;  3VQX A;  1ROP A;  2B9Z A;  4O2B A;  5J9P C;  3RYF B;  4UFZ A;  4WFA V;  1VQP V;  3SPI A;  1IBL B;  2V4D A;  4DR2 B;  4LF7 O;  1FAF A;  2QGN A;  2NR5 A;  2UU9 O;  2KB1 A;  1YVW A;  3RN4 A;  5EK0 A;  3ZRS A;  1FJG B;  1Q81 W;  3JCU Z;  4DV4 O;  3SGI A;  2KSD A;  3VOU A;  3K57 A;  1S5L Z;  4JI1 O;  3IGA C;  5BMV A;  2OTJ V;  4YY3 O;  4NR1 A;  2UXX A;  4UVA A;  3U11 A;  5A9G A;  3K5N A;  3WG7 B;  2YDE A;  5D5Q A;  2ZXW C;  1VEW A;  5KA5 A;  3SPC A;  4TSF G;  1IX9 A;  3OGI B;  4DO2 A;  3CCU V;  3QO8 A;  4MVM A;  3N2G B;  4PI2 A;  4UXN A;  3ZN0 A;  1RM1 B;  1SF9 A;  3CB2 A;  4TV9 A;  1YF2 A;  3BVO A;  2JS3 A;  5IJ0 B;  3B40 A;  1MG1 A;  3E22 A;  2CTW A;  3QTC A;  4L8J A;  4X65 B;  5KA6 A;  2P90 A;  1S5H C;  5KAI Z;  4I4T B;  3AEI A;  4H0L B;  1K97 A;  1WNS A;  2KG7 B;  1YI2 V;  4NTX A;  3AK2 A;  1H8H G;  1QHT A;  3O65 A;  2QWQ B;  1ZL8 A;  2ZM6 O;  2XAH A;  3FX7 A;  1XQ8 A;  3HKE A;  4LF9 B;  1NJI W;  1M57 B;  5D5P A;  4FLV A;  3JSN A;  3K58 A;  3H1H H;  1SQX H;  4XBF A;  5IYZ A;  2R9A A;  1YJ9 V;  1WP8 A;  5LMN B;  3E2E A;  2E5L B;  5EC1 C;  4B3M B;  4O4J A;  3CWB H;  1QNM A;  1GMG A;  1Y67 A;  3HKD A;  1WA8 A;  4X89 A;  4B08 A;  2EIL B;  1MAB G;  1BE3 H;  2RJZ A;  4DV7 B;  5LP6 A;  1Z5W A;  1OV9 A;  3J7A U;  1FFX B;  4LCU C;  2QE7 G;  2UUC O;  1S3J A;  1OCZ B;  1N8R W;  4YJ2 B;  1K5Q A;  1KEC A;  1RFY A;  4J41 A;  5LHG A;  1W59 A;  2EIJ C;  2P4V A;  2YEV B;  3E86 A;  2UUA B;  1SQF A;  1QU7 A;  5KHG A;  4CBC A;  1WB7 A;  4X66 O;  4LWS B;  3LSS A;  5JJE B;  3HB3 B;  4NKG B;  4QPJ A;  2FML A;  2DYR C;  3FFQ A;  3ABM B;  1K73 W;  1CPY A;  3FAV A;  5KHH A;  5BY1 A;  2VWJ A;  2GUZ A;  2RQ6 A;  4XDL A;  4ZI7 A;  3G6E V;  4WFE A;  1XNQ B;  4RQF A;  5CA1 B;  4NXN O;  1VQ8 V;  2R72 A;  1MA1 A;  1JFF B;  1PNM A;  2F4V B;  1Z5V A;  2P7T C;  2DWD C;  5FPR A;  1GTO A;  3ZHT A;  1AR1 B;  3RGB A;  5JWP A;  3HKC B;  3OW2 U;  1DTO A;  1VF6 A;  2CTP A;  1XHX A;  1KUQ A;  3CXC U;  1OCO C;  4BIU A;  2WLK A;  4OPA A;  1IBL O;  2Q0A A;  2ADP A;  4DR2 O;  1FS0 G;  1QLE C;  4GKK B;  1VF7 A;  2P6J A;  1FJG O;  2JGD A;  4QNH B;  1K3E A;  2HLD G;  1ZLZ A;  2NN4 A;  2YS8 A;  3UO2 A;  3OEH G;  4O4L A;  5B5E Z;  2JRI A;  4CH5 A;  3U0Z A;  3MDS A;  3CS5 A;  4I0X B;  3W7X A;  3CCQ V;  4F6R A;  5IYD O;  2XAF A;  5GON A;  1LR1 A;  2LW7 A;  2VS0 A;  1NU1 H;  2D2C B;  4DK1 A;  2A79 B;  4PEL A;  5BR8 O;  1E79 G;  3JAR A;  1SET A;  4DV2 B;  2B1G A;  3K06 A;  4ZHQ A;  4LP8 A;  1BCC H;  1QR9 A;  1AI7 A;  4X65 O;  3SYQ A;  1A32 A;  1YTF D;  1RM1 C;  4EFB A;  4P2Z A;  2ILM A;  3JD0 A;  4JI7 O;  3TXQ A;  1FXK B;  2DYS B;  2GTS A;  5TIS Z;  3OMA B;  2DOS A;  1B3Q A;  5L3G A;  2LGQ A;  2WLL A;  1T5E A;  4WFB V;  2CH7 A;  4CH6 A;  1Y74 B;  2NNU A;  1YDX A;  2HVJ C;  5LMN O;  3JSL A;  2E5L O;  3CJH B;  4B3M O;  2L6L A;  1Q90 D;  4FLZ A;  1MSW D;  2Q4P A;  4LC1 A;  1M57 C;  5H2F Z;  4Z2W A;  1XL4 A;  1XI1 A;  3ZMV A;  5K1P A;  4ZOL A;  4WFF A;  5C93 A;  4DV7 O;  2YXY A;  5B1B B;  5CBH A;  5LXT A;  4CS3 A;  1R3I C;  4I50 B;  2BSK A;  2X0L A;  2EIK B;  1M9N A;  5CBG A;  1Q86 W;  1PD3 A;  5BZB A;  2EIL C;  1I7F A;  1SA0 A;  4BR6 A;  5KUK A;  2A3Q A;  2QTS A;  1D2D A;  3RWR D;  4I7Z B;  2N04 A;  3MHS C;  2OCC B;  3ML0 A;  3SR2 C;  2EIN C;  4JI0 B;  3T1H B;  3APO A;  3TK1 A;  1OCZ C;  2HEP A;  2XAS A;  3CCL V;  1QVF U;  4JTA B;  3AK3 A;  2GDS A;  2IH1 C;  3D8C A;  1Y76 B;  1QBZ A;  2Q6A A;  1H8E G;  3ZBH A;  4XDK A;  2CDY A;  2QM4 A;  3N2K B;  4GT1 A;  4DV0 B;  4TUY B;  1XNQ O;  3KZI Z;  3NR7 A;  3E8B A;  4CC5 A;  4UVB A;  1PL4 A;  2VWK A;  3DXR A;  2F4V O;  1IUR A;  1Y66 A;  4X1K B;  3O9O A;  3HR0 A;  4K8X A;  1S77 D;  4HYO A;  4H13 B;  1NH2 D;  3QO5 A;  4GX0 A;  3ABT A;  4D6T H;  1M5I A;  5FPO A;  1KC8 W;  1AB3 A;  1W0J G;  3OTF A;  3CRM A;  5EYP A;  5B1A B;  2F1M A;  4PA6 A;  1N0N A;  2H3O A;  5IWA B;  4LF7 B;  4KXR A;  2LGW A;  3RYF A;  5C8Y B;  1P7G A;  1B04 A;  1U96 A;  1H2G A;  5KX5 B;  3CPW U;  4P30 A;  4D7S A;  3E8H A;  3WB2 A;  2ZNI A;  3CE2 A;  1OHH G;  3CCS V;  1GK9 A;  2QWO B;  4FLT A;  3BA8 A;  4B3T B;  3TGU H;  4MTG A;  1JQ0 A;  3N2G A;  5FLX N;  3LSQ A;  3LNN A;  3BAA A;  1DF5 A;  1P84 F;  3AG2 B;  5KLV H;  4WF9 V;  2HG5 C;  1XDC A;  2CE4 A;  3Q4H B;  5IJ0 A;  2KQX A;  2VQE B;  3OEE G;  1UFI A;  3ZED A;  2BCC H;  4YIO A;  4PDM A;  5LOV B;  1ARO P;  1MZE A;  4WFH A;  1S76 D;  5B66 Z;  4PHZ A;  2X6B A;  2LJ2 A;  2WLJ A;  2P67 A;  1HNZ B;  1FXK C;  4HAM A;  1NVP B;  2DYS C;  1S5J A;  1YEW A;  3ZHU A;  1V54 B;  1SZX A;  2Q7H A;  2OWO A;  5F2V O;  5L3B A;  2K1E A;  4MVO A;  1OZ0 A;  4WBN B;  4UCT A;  5BXZ A;  1VQ7 V;  1IBM O;  3CX5 F;  1Q5O A;  2AGA A;  3OFN G;  1R6T A;  4MT8 A;  2IU0 A;  1GN4 A;  3G6B A;  4FVM A;  1IXM A;  3WB1 A;  1YCI A;  4DV3 B;  1N36 B;  3C90 A;  5B1B C;  4DXW A;  1SER A;  1HWY A;  4X64 B;  2IJK A;  2EIK C;  3W7T A;  3CCV V;  3B2E E;  4NVP A;  2ZIM A;  1SKV A;  2XTA A;  5A2Q N;  3X2Q B;  2ADQ B;  3AK1 A;  3T1H O;  1KYO F;  2P22 C;  5KHI A;  3K5M A;  4DK0 A;  2E74 B;  4Z1M G;  5EZY B;  3LSU A;  1Q7Y W;  4YJ2 A;  5LGT A;  4LH6 A;  4DUY B;  5GTI Z;  2OCC C;  4Z1V A;  1H2L A;  4PI0 A;  2FB5 A;  4UCU A;  3BPZ A;  4ICG A;  4MW3 A;  2ZD9 A;  2YEV A;  1IXB A;  3GB7 C;  3G4S V;  4DV0 O;  2PF4 E;  1IBK B;  1LUV A;  4J42 A;  3GWK C;  3AG1 B;  1U97 A;  1EFR G;  4LWS A;  4NXM B;  1NTM H;  2OT5 A;  1PPJ H;  4MVQ A;  4FFK A;  2EUL A;  3BHP A;  1MZF A;  4X20 B;  2P06 A;  5CA1 A;  4UCR A;  4X8A A;  2QDO A;  3A0R A;  1EZV H;  1RSO B;  2X7R B;  1H2N A;  3ZCC A;  3ASN B;  3HKC A;  1S72 V;  4MVU A;  1AI4 A;  3L72 H;  4HZ3 A;  5IWA O;  1XOU A;  3CSX A;  3FB8 C;  4R6Z A;  4NTW A;  3ZRX A;  2ZT9 B;  1R6N A;  1VMG A;  4K35 A;  2E76 B;  1JJ2 U;  5B1A C;  4GZR B;  3TXS A;  4QGP A;  1H2S B;  3KG2 A;  5J2U B;  1R1B A;  1XMO B;  1XNR B;  1VIB A;  1F4N A;  1N0J A;  2VQF B;  4IIJ A;  5LYJ A;  1AI5 A;  1Q6H A;  5L3C A;  2EBO A;  4JTC B;  3CRQ A;  2ATK C;  1N33 B;  3HPL C;  4B3T O;  3UT5 B;  3OR7 C;  5BR8 B;  3FYE B;  4I0X A;  3SYC A;  2ETN A;  3CRR A;  4AHC A;  1AJN A;  3BEH A;  3TJT A;  2BTQ B;  3F7Y C;  3R66 A;  3C3S A;  4IHJ B;  4PA9 A;  3ZHQ A;  2VQE O;  4KHP B;  5CA3 A;  2ZDI C;  1K8A W;  4EEQ A;  1QVG U;  3G67 A;  2B1I A;  4JI7 B;  5GW7 A;  2BOB C;  3CYO A;  1FPO A;  4J7Z A;  2XAG A;  4RUE A;  4PV1 B;  3AG2 C;  4Q6G A;  4FJC C;  2E75 B;  4JYA B;  1FYJ A;  1HNZ O;  5IJ9 B;  2UXB B;  1NT2 B;  4DW1 A;  1M4U A;  1FXK A;  2AHZ A;  3CRC A;  3K9A A;  2X6C A;  1B6Q A;  4RO2 A;  1K4D C;  3RYI B;  3E8G A;  4MTX A;  2R9I A;  1Y74 A;  3JAK B;  4W4K A;  1CP9 A;  4U3J B;  2WLH A;  5JH7 B;  3CJH A;  4HNA B;  4X1I B;  2AZ2 A;  1RPO A;  2A0L A;  5EBW C;  4DV3 O;  2K9P A;  1N36 O;  3RYH B;  2IBZ H;  4FM2 A;  1PNL A;  4QIW F;  4JF3 A;  1AJP A;  3ZMS A;  3QO7 A;  4X64 O;  1JCH A;  2ZE6 A;  3DC6 A;  4I50 A;  1XHZ A;  1KMI Z;  1AJQ A;  1AP5 A;  1KP2 A;  1EM1 A;  3JAS B;  3THO A;  5JCO C;  2CUG A;  4G27 B;  2EZO A;  3F7V C;  4CH4 A;  4JGS A;  3CD6 V;  4UCO A;  5JJN B;  5ITZ B;  2QJ1 A;  4DUY O;  3BY6 A;  3SJC C;  3X2Q C;  2NLJ C;  4WCE V;  1O9G A;  5IYC O;  1BS3 A;  4OPH A;  1IBK O;  2YC0 A;  4DRX B;  5LHI A;  4OX9 B;  5DM6 V;  5KUM A;  4NYK A;  3H1L H;  3ZJZ A;  5HFM A;  1Y76 A;  4NXM O;  2VRZ A;  1FKA O;  2UXD B;  1TUE B;  1PNK A;  4D7T A;  3I55 V;  4Q20 A;  1W2B U;  2YI8 A;  2YI9 A;  1COW G;  1Q6U A;  1VQ5 V;  3K59 A;  1VQ4 V;  2BE3 A;  3AG1 C;  2ZE5 A;  4I9W A;  3SYA A;  5CN0 A;  1SQB H;  1GH6 A;  1VQN V;  1I94 B;  3HKB A;  1AP6 A;  3E8F A;  3H1K H;  1OCC C;  4X1K A;  5JJJ B;  2JEX A;  2WLM A;  3RVZ A;  4PDV A;  3RYC B;  1YIJ V;  1GN2 A;  1SES A;  5LHH A;  4CH3 A;  1F4M A;  4AI8 A;  4O2B B;  1W0K G;  2UUB B;  3CEI A;  3PJS K;  5EIB C;  4BWA A;  3ZHS A;  5GTH Z;  2QKA A;  1EZJ A;  2P4K A;  2C2A A;  4TV8 A;  3E35 A;  4UCS A;  3JAM N;  2JJ1 G;  1HNW O;  4O2A A;  1HNX B;  2EZP A;  4UV9 A;  3ABL B;  1XMO O;  1XNR O;  3A2F A;  3DC5 A;  3JD2 A;  5BMV B;  2VQF O;  2QM8 A;  5CBF A;  4JAU A;  3BRC A;  3TCU A;  3ZRW B;  3OAA G;  1N33 O;  4B7K A;  5LBQ A;  3AG3 B;  1I5Y A;  2XND G;  4N21 A;  5KX5 A;  3WG7 C;  1PL0 A;  2ZNJ A;  4R7C A;  2A9H A;  1MSD A;  3JYC A;  4IT5 A;  4CZZ A;  4JZG A;  3RBZ A;  4KHP O;  4K0K B;  2ZDI A;  2DW4 A;  3OTO B;  2CK3 G;  3K0G A;  2Y4U A;  4ASU G;  1KKD A;  1JJO A;  2Q9L A;  4F6E A;  4IL6 Z;  1TVK B;  2YIA A;  4JYA O;  4LR3 A;  3Q4H A;  2UXB O;  3OGC C;  4O4H B;  3EFF K;  3H1J H;  4BIO A;  2F66 C;  3HKE B;  5LOV A;  2EJ7 A;  2PI4 A;  5EBM C;  1R3K C;  3A0B Z;  2PYL A;  4LF4 O;  1SQQ H;  1RPR A;  4YJ3 B;  1IBM B;  2ODM A;  1WAZ A;  1WA8 B;  3B8N A;  4AIL C;  3L73 H;  5IT9 N;  3SYP A;  1PKX A;  4JAA A;  4J80 A;  3FKS G;  3H1I H;  2OTL V;  1N4C A;  4UUJ C;  3OMI B;  2IH3 C;  3SPJ A;  2E3C A;  1YTF B;  5KMG B;  5JCO A;  2JJ2 G;  3CCR V;  4DUZ O;  3GWO A;  3ETG A;  3DTU B;  4OGQ B;  2DMX A;  3UCS C;  1KP3 A;  2DWE C;  2WA3 A;  4PA4 A;  1D5A A;  1TUB B;  3CRA A;  3C3T A;  3CME V;  1V55 B;  4L87 A;  4U7N A;  1MOF A;  4LH7 A;  4YXW G;  4OX9 O;  4U3F H;  1OJH A;  5EZY A;  2AXT Z;  1YXB A;  4FZ1 A;  4DR5 B;  4HBN A;  4FLX A;  3ZN1 A;  2UXD O;  4LF8 B;  3MHH C;  4OXS A;  3ABM C;  2JS5 A;  3ETE A;  2JEU A;  1VQ6 V;  1ZTE A;  3SYO A;  1GN3 A;  1Y4M A;  1I94 O;  2BTO A;  1WP7 A;  2LQT A;  1XBL A;  3K9S A;  2DJV A;  2WLI B;  1JA8 A;  2ZQM A;  1M56 B;  1HW7 A;  1ENV A;  1M93 A;  3CP1 A;  4X20 A;  1GRJ A;  5JQG B;  2N74 A;  1MMM A;  2Q68 A;  4JI8 B;  1BL8 A;  2LFR A;  2UUB O;  4LF6 B;  1JMK C;  1M90 W;  2ITD C;  4BIZ A;  3K5O A;  1P7B A;  2Z3Y A;  2RNB A;  2Q5Z A;  3K3W A;  1HNX O;  1K33 A;  4DV6 O;  1IDS A;  3MAQ A;  1N32 B;  2WSS G;  3ETD A;  1XEQ A;  2RDC A;  5B3S B;  3EVK A;  4DV5 B;  1KKC A;  2X6A A;  3QG5 A;  4X9Q A;  2DE0 X;  5IY5 B;  1LUW A;  2WLN A;  4PA3 A;  1YZB A;  2QKC A;  3BA9 A;  3ABL C;  1WJZ A;  5J2U A;  1BMF G;  2HKO A;  2XHB A;  3E89 A;  3JAT B;  1L8D A;  3B4S A;  3IJ4 A;  1RP3 B;  2F43 G;  3J80 N;  1P4R A;  1D5N A;  1NH2 B;  4K0K O;  3AG3 C;  4B3S B;  4PDR A;  3T1Y B;  1L1F A;  3UT5 A;  3OTO O;  1R3L C;  5EBL C;  1JPX A;  4DR6 B;  3F5T A;  2OCH A;  3ZMT A;  2R9R B;  3K0D A;  2BTQ A;  4P9P A;  4ABM A;  1Q8I A;  4IHJ A;  1VQM V;  2QM7 A;  3U10 A;  1VF5 B;  2PI5 A;  4NB5 A;  4I4T A;  5LGU A;  1WN7 A;  3KCY A;  2KG7 A;  4AQY B;  4JI6 B;  4G28 B;  4W4L A;  2YIC A;  3STL C;  4H33 A;  5IJ9 A;  1PP9 H;  1UJW B;  1K9M W;  2V1D A;  1YIT V;  3RYI A;  1G8M A;  2QWR B;  3JD3 A;  5E79 Z;  2GSM B;  2W0X A;  2IM9 A;  3JAK A;  2GBO A;  4MVR A;  2CTQ A;  1WPB A;  3DGE A;  4HNA A;  4X1I A;  3ZMZ A;  1YHQ V;  3KKY A;  4N23 A;  2XAJ A;  3WU2 Z;  1FFX A;  1XIL A;  4FFB B;  1K4C C;  3FD9 A;  1ZAU A;  2YID A;  1O9H A;  3D3Q A;  4GUN A;  4JI2 B;  4JYB A;  2D3O W;  3JAS A;  3F5W C;  2EJR A;  4DR3 O;  2ZE7 A;  2XT9 A;  4LBE C;  5ITZ A;  4DR5 O;  4LNU B;  1QCE A;  3VQY A;  3ZMU A;  4LF8 O;  2DYR B;  2MW2 B;  3I56 V;  3CXH F;  4YHH B;  2IJI A;  2IU3 A;  4DRX A;  2ZE8 A;  2UXC B;  3H01 A;  3LDC A;  3ASO B;  1EN4 A;  2AHY A;  3VQV A;  3AG7 A;  2DN9 A;  3OMN B;  2ZIN A;  3CC4 V;  2Q69 A;  1JFF A;  2Y0I A;  1XRE A;  3IFX A;  4LF5 B;  4GLX A;  1BQ0 A;  3OE7 G;  2W0F C;  3J81 N;  4JI8 O;  2YUA A;  1NQT A;  4LF6 O;  2JK5 C;  1L0N H;  2N05 A;  4UB6 Z;  1DLB A;  1QLE B;  3IC9 A;  3TET A;  4B7E A;  1ZX3 A;  1M56 C;  4ZBM A;  4KP4 A;  4DYL A;  3RYC A;  4QJF B;  4GYC B;  3WB0 A;  1N32 O;  1HNW B;  5H6R A;  4CS4 A;  3UM7 A;  4DR4 B;  3EXA A;  2RMK B;  2KKW A;  2QWN B;  4RQE A;  4DV5 O;  3B09 A;  4FK5 C;  4FLY A;  1Q82 W;  4GX2 A;  2JVD A;  1GKF A;  1IVS A;  4B3R B;  3QF7 A;  3JAL B;  1US6 A;  4EFE A;  2Y69 B;  3QVN A;  1K5S A;  4X62 B;  4I9Q A;  5DED A;  5B3S C;  3D36 C;  1BHA A;  5J2T B;  4FZ0 A;  1E1Q G;  3APQ A;  2YIB A;  5DEC A;  5FL7 G;  5IY5 C;  2B5U A;  3ZRW A;  4B3S O;  5B1O A;  1I0H A;  5KHJ A;  3T1Y O;  1Q3E A;  2YXH A;  1WB8 A;  2HVK C;  2AZ0 A;  4FMT A;  1NR7 A;  5L3E A;  2A06 H;  3CCE V;  4DR6 O;  2Y0P A;  2Q7E A;  2HJF C;  5CB4 B;  1CXZ B;  3WFV A;  4X1Y B;  4O4I B;  4JI4 B;  2RN9 A;  3R65 A;  1BT8 A;  1J95 A;  4TT3 G;  3M7M X;  4AQY O;  4JI6 O;  1FXV A;  5FNV B;  3T2M A;  1TVK A;  3T4Z A;  2HFE C;  4PD4 F;  2PY5 A;  1SQG A;  4DR7 B;  4O4H A;  4EB6 B;  1FFT B;  5DN6 G;  1Y6X A;  2DQ3 A;  3ABK B;  4LF4 B;  2ZR2 A;  2WAM A;  1NS1 A;  1AVM A;  4JI3 B;  1EN6 A;  4RWU A;  1V54 C;  1HP8 A;  2BOC C;  4JPR A;  4QE9 A;  5CA0 B;  1NTK H;  1TAE A;  1R73 A;  5LGN A;  4H44 B;  4X88 A;  2PGG A;  5H6Q A;  2P5O A;  3A8T A;  4FLW A;  5JVD B;  1AIL A;  4LFC O;  4YJ3 A;  4CC6 A;  2ZR3 A;  2Z0A A;  3GVM A;  2ZCE A;  2HHH B;  1XMQ B;  2FKX A;  1KQS U;  4JI5 B;  1H38 A;  4MVZ A;  1N34 O;  1OCR B;  2QKS A;  4FPP A;  3LUT B;  3ZIA G;  3ABU A;  3S3X A;  4I55 B;  4PDL A;  4DUZ B;  3UO3 A;  2EIN B;  1JOY A;  3K04 A;  4JI2 O;  2L35 A;  5IE9 A;  5KMG A;  2DQ0 A;  4J10 A;  4H37 A;  1BQZ A;  2ITC C;  4LFB B;  3A0H Z;  4BW9 A;  2QWP B;  4QE7 A;  3W7S A;  1FD9 A;  1TUB A;  2Q67 A;  2JGU A;  2Z5U A;  3OUS A;  4YHH O;  3N2K A;  2Q73 A;  1HR0 B;  1H2K A;  2UXC O;  3H9V A;  4I5S A;  2IJH A;  4MTF A;  1VP7 A;  4TUY A;  2YIB D;  5LMU B;  5LA6 B;  1I5X A;  3JAW B;  5L3D A;  4GX1 A;  2CGO A;  4LF5 O;  4ZIB A;  3LDD A;  1K92 A;  1PM9 A;  4GCZ A;  3ASO C;  2GV9 A;  1VQ9 V;  1S0V A;  4GX5 A;  1J5E B;  1YJN V;  2WLI A;  3JCZ A;  3UKM A;  1L0L H;  1SS3 A;  4J9Z B;  4J11 A;  1TA8 A;  3ASN C;  4LFA B;  5JQG A;  3K79 A;  4FM0 A;  4DR4 O;  1ZUQ A;  4A5U B;  2W6J G;  5KAF Z;  2JDI G;  4DV6 B;  4FLU A;  2MK3 A;  3T1C A;  2V7Q G;  3VBB A;  3FB5 C;  4B3R O;  4KFM A;  2R70 A;  5CMU A;  5C8Y A;  1I08 A;  3P3N A;  4E4E A;  4ZKI A;  1GAX A;  3S3W A;  2EIM B;  4F4L A;  4IIJ B;  5LYJ B;  2XAQ A;  3PN1 A;  4CS2 A;  4X62 O;  3L74 H;  2Q0O C;  3FYI B;  4DR1 B;  4DV1 B;  2F93 B;  3D36 A;  4TV9 B;  1LNQ A;  4JV5 B;  2LW1 A;  1DF4 A;  3ICX A;  3E22 B;  2Y69 C;  3L75 H;  2WWW A;  2YXL A;  3JAT A;  3FB6 C;  3RW0 A;  4MS2 A;  4GKJ B;  1QQC A;  2JIZ G;  4RUF A;  2O57 A;  3ZHV A;  4JI4 O;  4TQF A;  2PZS A;  3E83 A;  2HJD A;  4U7O A;  1AR5 A;  1ZL8 B;  2EX3 A;  4TWK A;  3AG4 B;  1GM8 A;  1SRY A;  4BAY A;  4G2K A;  2PUS A;  1P49 A;  5IYZ B;  4DR7 O;  1NR1 A;  4JAS A;  1KB9 F;  1GM9 A;  4JI3 O;  2A7W A;  4LF9 O;  4O4J B;  1NKD A;  2Y48 A;  2FTK A;  3L70 H;  4KL1 A;  3B8M A;  3HKD B;  1ORQ C;  3DSQ A;  2Y4T A;  3ABK C;  1NI8 A;  3CC7 V;  4WBN A;  2FL4 A;  2HHH O;  2F23 A;  1XMQ O;  4YIP A;  5LP6 B;  1M1K W;  4JI5 O;  2W6I G;  2QEX V;  3K5L A;  4J7J A;  4PJ0 Z;  1WLE A;  1UPG A;  5B1N A;  2PTM A;  3SJQ C;  2RCV A;  1G4Y B;  2IJJ A;  1R3J C;  5E1A C;  3ZS8 C;  3T4D A;  1KD1 W;  1OCR C;  2CTR A;  4JYC A;  4PA7 A;  2OYQ A;  4JAV A;  3OR6 C;  4FFB A;  1SC5 B;  4LFB O;  4MW8 A;  3SPH A;  4DR3 B;  1VQO V;  4IYH A;  4RAI A;  3P30 A;  3ETQ A;  1XL6 A;  4UB8 Z;  2QR4 A;  4R50 A;  2HR3 A;  2UUA O;  2IW5 A;  4JYY A;  1XUQ A;  4MVS A;  4FM1 A;  1AI6 A;  3FAV B;  1HR0 O;  2WPD G;  2GUZ B;  4ZI7 B;  1DGS A;  2AW9 A;  1EN5 A;  4IGG A;  1BHB A;  3P32 A;  5IYB O;  4LNU A;  5LMU O;  1Q6I A;  1KU9 A;  4UVC A;  3ZHR A;  1E1R G;  4DW0 A;  1HDJ A;  2PYJ A;  4FIP C;  4K3A A;  3L9D A;  2WA4 A;  4UV8 A;  3HKB B;  2ZKO A;  3EHB B;  1G6U A;  2M7W A;  5IDJ A;  1J5E O;  3RVY A;  1FXH A;  1RSO A;  4UCV A;  2GHY A;  3QNE A;  4LFA O;  1VQL V;  1IZ3 A;  3W7U A;  2JGD B;  1QR8 A;  4K8Z A;  3SDL A;  1NZ6 A;  3SJA C;  4TV8 B;  4P9O A;  2ZIO A;  3BFR A;  4GKK O;  1BZK A;  4O2A B;  4O4L B;  1URF A;  4EKW A;  1K34 A;  1YJW V;  2UU9 B;  2CAZ C;  2UXN A;  3ZX6 A;  1NVP D;  3IAY A;  1K7D A;  3L71 H;  3RT3 C;  5L3F A;  4F6R B;  3CMA V;  2ZXW B;  3BAB A;  4TOI A;  3D3I A;  5GON B;  4DR1 O;  1THZ A;  4DV1 O;  4DV4 B;  4MTO A;  4JI1 B;  1VAR A;  4JV5 O;  4YY3 B;  3JAR B;  3LNM B;  2EIM C;  2LFS A;  3JAL A;  4ZHQ B;  3W7W A;  3K08 A;  4QPK A;  1YSC A;  2F95 B;  3OUF A;  1JX9 A;  3UQ8 A;  2QA4 V;  4DV2 O;  2LO1 A;  3G80 A;  5J2T A;  1NTZ H;  4GKJ O;  4J7K A;  2GTA A;  2XOK G;  4J9Y B;  1GO3 F;  1Q43 A;  3MD0 A;  3B77 A;  3N27 A;  1NBM G;  2HP8 A;  2FYU H;  5HFL A;  4R8C A;  2WLL B;  5CB4 A;  3OM3 B;  1DK1 A;  4E2L A;  2CH7 B;  2ARH A;  2QTO A;  2Q7G A;  3RFR A;  3SJB C;  4X1Y A;  4O4I A;  3M99 B;  1WPX A;  1B06 A;  1V9P A;  2OIG A;  3AG4 C;  1GN6 A;  4XDJ A;  2ZM6 B;  1ZSP A;  3NXS A;  3BCC H;  5FNV A;  3LDE A;  3FB7 C;  4ZOL B;  4EB6 A;  1F51 A;  5LXT B; 
#chains in the Genus database with same CATH homology
 1QBZ A;  2Q6A A;  1H8E G;  5L3E A;  3CCE V;  3PJS K;  4XDK A;  1JVM A;  3STZ C;  1EZJ A;  4GT1 A;  2C2A A;  2HJF C;  3E35 A;  3CCJ V;  2JJ1 G;  3WFV A;  3E8B A;  2EZP A;  3SPG A;  4UV9 A;  4UVB A;  3ABL B;  3JD2 A;  3R65 A;  1Y66 A;  2QM8 A;  5CBF A;  4JAU A;  1J95 A;  4TT3 G;  3CCM V;  1S77 D;  3TCU A;  1FXV A;  4HYO A;  3T2M A;  2H94 A;  2EIJ B;  1NH2 D;  3ZRW B;  3OAA G;  2LP7 A;  3T4Z A;  2HFE C;  3QO5 A;  4GX0 A;  3AG3 B;  5LBQ A;  1FFT B;  1I5Y A;  5DN6 G;  2XND G;  4N21 A;  2DQ3 A;  3IC7 A;  3ABT A;  3ABK B;  2ZR2 A;  2WAM A;  3WG7 C;  1PL0 A;  1V54 C;  1KC8 W;  2BOC C;  4JPR A;  4WFG A;  4QE9 A;  4R7C A;  1R73 A;  2A9H A;  3ZRV A;  1W0J G;  5LGN A;  1ZWI C;  4X88 A;  3JYC A;  4CZZ A;  5H6Q A;  3RBZ A;  5B1A B;  4PA6 A;  1CEZ A;  1VQK V;  1V55 C;  2ZDI A;  2YSU B;  2DW4 A;  3K03 A;  2ZR3 A;  5H9C A;  2CK3 G;  3K0G A;  4ASU G;  1KQS U;  1KKD A;  4MSW C;  1H38 A;  4MVZ A;  4JTD B;  1OCR B;  2QKS A;  4FPP A;  1EBO A;  1SZT A;  3LUT B;  3CC2 V;  3JD1 A;  3ZIA G;  3ABU A;  1GM7 A;  3OGC C;  4PDL A;  3EFF K;  1H2G A;  2EIN B;  1OCC B;  3CPW U;  4P30 A;  1JOY A;  3K04 A;  1OCO B;  3E8H A;  2PI4 A;  5EBM C;  2DQ0 A;  1R3K C;  4H37 A;  2ITC C;  1OHH G;  4KUM A;  1QLN A;  4BW5 A;  3CCS V;  1GK9 A;  3G71 V;  5EC2 C;  1RPR A;  2H8P C;  1F23 A;  4MTG A;  3JD4 A;  4QE7 A;  1JQ0 A;  1R6K A;  3W7S A;  1ROP A;  3B8N A;  5J9P C;  2Q67 A;  3LSQ A;  4WFA V;  1VQP V;  1DF5 A;  2Z5U A;  3SPI A;  3OUS A;  3SYP A;  3AG2 B;  4WF9 V;  1PKX A;  2HG5 C;  2KB1 A;  3FKS G;  4I5S A;  2IJH A;  3OEE G;  5EK0 A;  4MTF A;  3ZRS A;  2OTL V;  4UUJ C;  1Q81 W;  3OMI B;  2IH3 C;  3SPJ A;  4PDM A;  1I5X A;  1ARO P;  1YTF B;  3VOU A;  5L3D A;  4GX1 A;  4WFH A;  3IGA C;  2OTJ V;  1S76 D;  2JJ2 G;  3CCR V;  2UXX A;  2X6B A;  4UVA A;  2WLJ A;  3GWO A;  2P67 A;  3ETG A;  3LDD A;  1K92 A;  4GCZ A;  1FXK C;  4HAM A;  3ASO C;  1NVP B;  2DYS C;  3WG7 B;  3DTU B;  1V54 B;  2ZXW C;  5KA5 A;  3SPC A;  1KP3 A;  4TSF G;  2DWE C;  1VQ9 V;  4PA4 A;  4DO2 A;  3CCU V;  5L3B A;  3QO8 A;  4MVM A;  1S0V A;  4GX5 A;  2K1E A;  4UXN A;  3ZN0 A;  4MVO A;  2WLI A;  1RM1 B;  3JCZ A;  1YJN V;  3UKM A;  1NR7 A;  3CME V;  1V55 B;  1OZ0 A;  4J9Z B;  1MOF A;  4L87 A;  4U7N A;  4YXW G;  1VQ7 V;  3ASN C;  1MG1 A;  3K79 A;  3OFN G;  2W6J G;  2JDI G;  5KA6 A;  3ZN1 A;  4MT8 A;  2MK3 A;  2P90 A;  3T1C A;  2IU0 A;  3MHH C;  1S5H C;  2V7Q G;  3VBB A;  1IXM A;  3FB5 C;  4OXS A;  4KFM A;  5CMU A;  3AEI A;  3ABM C;  3ETE A;  2JEU A;  1K97 A;  4ZKI A;  1VQ6 V;  2EIM B;  4F4L A;  5B1B C;  4DXW A;  3SYO A;  1YI2 V;  1SER A;  1Y4M A;  2XAQ A;  1HWY A;  2IJK A;  2EIK C;  1H8H G;  3W7T A;  3CCV V;  3FYI B;  2XAH A;  2WLI B;  3D36 A;  3X2Q B;  1LNQ A;  1NJI W;  1M57 B;  2ZQM A;  1M56 B;  1ENV A;  3CP1 A;  1DF4 A;  4Z1M G;  4XBF A;  2Y69 C;  1Q7Y W;  2Q68 A;  5LGT A;  1BL8 A;  2LFR A;  2WWW A;  2OCC C;  1YJ9 V;  3E2E A;  5EC1 C;  3FB6 C;  3RW0 A;  1M90 W;  2ITD C;  4MS2 A;  1GMG A;  4BIZ A;  4MW3 A;  4X89 A;  1P7B A;  2YEV A;  2ZD9 A;  2Z3Y A;  2EIL B;  3GB7 C;  3G4S V;  2JIZ G;  1MAB G;  4RUF A;  3K3W A;  1K33 A;  3AG1 B;  1EFR G;  2WSS G;  3ETD A;  3E83 A;  4U7O A;  4TWK A;  5B3S B;  3AG4 B;  1GM8 A;  2OT5 A;  4MVQ A;  4LCU C;  2QE7 G;  2X6A A;  1SRY A;  4BAY A;  4G2K A;  1S3J A;  5IY5 B;  2WLN A;  1OCZ B;  1N8R W;  4PA3 A;  1NR1 A;  4JAS A;  3ABL C;  1K5Q A;  1KEC A;  1BMF G;  1GM9 A;  2HKO A;  3E89 A;  4X8A A;  1NKD A;  3A0R A;  5LHG A;  2Y48 A;  2FTK A;  2X7R B;  3B8M A;  2F43 G;  2EIJ C;  1P4R A;  3ZCC A;  1ORQ C;  2YEV B;  3E86 A;  3ASN B;  1S72 V;  1NH2 B;  3AG3 C;  4MVU A;  1AI4 A;  4HZ3 A;  4PDR A;  4CBC A;  1L1F A;  3ABK C;  3CC7 V;  3FB8 C;  4R6Z A;  1R3L C;  3ZRX A;  1M1K W;  3LSS A;  5EBL C;  2W6I G;  1JPX A;  2QEX V;  3HB3 B;  1R6N A;  3ZMT A;  2R9R B;  3K0D A;  4QPJ A;  1WLE A;  4P9P A;  2DYR C;  3ABM B;  1VQM V;  1JJ2 U;  5B1A C;  1K73 W;  5B1N A;  2QM7 A;  1CPY A;  4XDL A;  2PI5 A;  3SJQ C;  4WFE A;  3G6E V;  3KG2 A;  4RQF A;  5LGU A;  1VQ8 V;  1G4Y B;  2IJJ A;  1R3J C;  5E1A C;  3T4D A;  1KD1 W;  1F4N A;  1PNM A;  1OCR C;  2P7T C;  4JYC A;  4PA7 A;  1AI5 A;  2DWD C;  1GTO A;  1AR1 B;  4JAV A;  5L3C A;  2EBO A;  3OR6 C;  4G28 B;  4JTC B;  3STL C;  2ATK C;  3OW2 U;  3HPL C;  4H33 A;  4MW8 A;  1DTO A;  3OR7 C;  3SPH A;  1UJW B;  3FYE B;  1K9M W;  1VQO V;  3CXC U;  3SYC A;  4RAI A;  1OCO C;  3P30 A;  2V1D A;  2WLK A;  1AJN A;  4BIU A;  1YIT V;  3BEH A;  1XL6 A;  1G8M A;  4R50 A;  2HR3 A;  3F7Y C;  2IW5 A;  4PA9 A;  4MVS A;  1FS0 G;  3JD3 A;  1QLE C;  1AI6 A;  2WPD G;  2GSM B;  5CA3 A;  2ZDI C;  2P6J A;  1K8A W;  1BHB A;  3P32 A;  5IYB O;  1K3E A;  2HLD G;  4MVR A;  4QNH B;  1QVG U;  2B1I A;  5GW7 A;  2BOB C;  3CYO A;  3DGE A;  3ZMZ A;  4UVC A;  2XAG A;  1E1R G;  4RUE A;  3OEH G;  3AG2 C;  1YHQ V;  4N23 A;  2XAJ A;  4FJC C;  4FIP C;  1K4C C;  4UV8 A;  3EHB B;  1FXK A;  2AHZ A;  3K9A A;  3W7X A;  3CCQ V;  5IYD O;  2XAF A;  2X6C A;  1B6Q A;  2M7W A;  4RO2 A;  1K4D C;  4JYB A;  5IDJ A;  2D3O W;  2A79 B;  3F5W C;  3E8G A;  4PEL A;  3RVY A;  2EJR A;  1E79 G;  1FXH A;  1SET A;  2GHY A;  3QNE A;  2B1G A;  4MTX A;  3K06 A;  1VQL V;  3W7U A;  2R9I A;  4LBE C;  4LP8 A;  1QR8 A;  1QR9 A;  1QCE A;  1AI7 A;  1CP9 A;  2WLH A;  3SYQ A;  3ZMU A;  1YTF D;  4P9O A;  1RM1 C;  2DYR B;  1RPO A;  4P2Z A;  2A0L A;  5EBW C;  4EKW A;  3I56 V;  1K34 A;  2IJI A;  2IU3 A;  1YJW V;  2UXN A;  3JD0 A;  1NVP D;  1PNL A;  4QIW F;  1K7D A;  4JF3 A;  1AJP A;  3H01 A;  3LDC A;  1FXK B;  3ASO B;  3ZMS A;  2DYS B;  2AHY A;  3QO7 A;  5L3F A;  3CMA V;  2ZXW B;  1JCH A;  3D3I A;  1AJQ A;  3OMA B;  3OMN B;  1KP2 A;  1THZ A;  4MTO A;  3CC4 V;  4G27 B;  2Q69 A;  2EZO A;  5L3G A;  3IFX A;  2WLL A;  3LNM B;  3OE7 G;  2EIM C;  2W0F C;  3F7V C;  4WFB V;  2LFS A;  4JGS A;  3CD6 V;  2NNU A;  3W7W A;  3K08 A;  4QPK A;  1NQT A;  2HVJ C;  1YSC A;  3BY6 A;  3OUF A;  2JK5 C;  1JX9 A;  2QA4 V;  1DLB A;  3X2Q C;  2NLJ C;  1QLE B;  1MSW D;  4WCE V;  4LC1 A;  3TET A;  1M57 C;  1M56 C;  2XOK G;  4J9Y B;  5IYC O;  4ZBM A;  1GO3 F;  1XL4 A;  4KP4 A;  3ZMV A;  5LHI A;  4WFF A;  5DM6 V;  4QJF B;  5C93 A;  5KUM A;  3MD0 A;  5B1B B;  5H6R A;  5CBH A;  3UM7 A;  3B77 A;  3ZJZ A;  1R3I C;  5HFM A;  2X0L A;  2EIK B;  1M9N A;  1NBM G;  5CBG A;  4RQE A;  1TUE B;  1PNK A;  1Q86 W;  4FK5 C;  1PD3 A;  1Q82 W;  5HFL A;  3I55 V;  5BZB A;  4Q20 A;  4GX2 A;  1W2B U;  2EIL C;  1GKF A;  4R8C A;  2WLL B;  1COW G;  3OM3 B;  1VQ5 V;  4E2L A;  5KUK A;  1VQ4 V;  2QTO A;  3AG1 C;  3SYA A;  4I9W A;  5CN0 A;  2Y69 B;  1VQN V;  3MHS C;  3M99 B;  1WPX A;  2OCC B;  3E8F A;  1K5S A;  3ML0 A;  2EIN C;  5B3S C;  1OCC C;  3AG4 C;  1BHA A;  4XDJ A;  2JEX A;  1E1Q G;  3NXS A;  5FL7 G;  2WLM A;  5IY5 C;  3RVZ A;  2B5U A;  3FB7 C;  3LDE A;  1OCZ C;  4PDV A;  3TK1 A;  3ZRW A;  2XAS A;  3CCL V;  1QVF U;  4JTA B;  1YIJ V;  5B1O A;  1SES A;  5LHH A;  2IH1 C;  1F4M A;  1F51 A;  2HVK C;  4FMT A;  1W0K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...