5KA5A

Hiv-1 gp41 variant v549e resistance mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
85
structure length
79
Chain Sequence
b'MQLLSGIEQQQNNLLRAIEAQQHLLQLTVWGIKQLQARGGHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transmembrane glycoprotein gp41
publication title Receptor Activation of HIV-1 Env Leads to Asymmetric Exposure of the gp41 Trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 36
structure length 79
sequence length 85
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ka5A00
1DF4A 3CYOA 1QR8A 2OT5A 1Y4MA 3CP1A 1I5YA 5CN0A 2LP7A 4JGSA 1QR9A 2X7RB 3MHHC 1Y66A 3M99B 4JPRA 3MHSC 1K34A 1QCEA 2EZOA 4E2LA 1ENVA 4FK5C 4G2KA 4N23A 1F23A 5HFLA 3WFVA 1JQ0A 1MOFA 5KA5A 1I5XA 3K9AA 4FJCC 5HFMA 1DLBA 3B8MA 2MK3A 4JF3A 5KA6A 1MG1A 3H01A 3P30A 3B8NA 1SZTA 2EZPA 1EBOA 1JPXA 1QBZA 2EBOA 2M7WA 2P6JA 4N21A 3GWOA 1K33A 1DF5A 3B77A 4FIPC 5CMUA 5H9CA
chains in the Genus database with same CATH superfamily
4PA3A 1K92A 4RQFA 1TVKB 3BABA 4O4JA 2UUAB 4JTCB 3K0GA 4UCUA 3VBBA 4DV7O 1I94B 4X9QA 2DWEC 4GT1A 3T2MA 1QLNA 4MW8A 2ITCC 5FNVA 5IE9A 2GUZB 4CS2A 2RJZA 1AJPA 3JD4A 3WU2Z 5IYDO 1NTZH 4I4TA 5JJNB 4KFMA 5E79Z 5JJJB 4FLUA 4ZOLA 5B1NA 1JQ0A 4YJ2A 4B3SO 2JGDB 1QNMA 4FJCC 4H13B 4U3FH 4MSWC 3OUSA 1J5EB 2PTMA 3NR7A 5AG2A 1PV0A 4FFBB 4JI3B 1JR9A 5JQGA 4JTAB 2CTQA 2JIZG 4HYOA 5F2VO 1I5YA 2ZE5A 2YXLA 1ZL8B 3OFNG 4MTFA 1XI1A 2HVKC 1NVPD 1CEZA 4PA9A 1AI6A 2WAMA 4DYLA 1VQ7V 4ZI7B 4UVCA 2XAQA 1OCOC 3CE2A 2WLMA 5D5PA 3ASNB 3HB3B 3SYQA 3ETGA 5CN0A 3ABLC 2WLLB 1GTOA 4O4HB 1EN5A 1YDXA 1YTFD 1WAZA 2GV9A 2GUZA 1FXHA 1RFYA 2Q7GA 2QWPB 1L1FA 4LF4B 5LMNB 3BA9A 5LHGA 3DXRB 1IBMB 4PA6A 3SDLA 2Q8VA 4P9PA 2UUBO 1SKVA 5LP6B 5IJ9B 4GX2A 1M56B 1VIBA 2JJ2G 4IIJB 3IC7A 4X62O 4G28B 3OGCC 2EZOA 3M8AA 4LFBB 3BPZA 2YXYA 4PA7A 5EBMC 4MVSA 1ZL8A 1XUQA 1YSCA 4JASA 1VF6A 2Q7HA 4IHJA 2M6YA 5BXZA 4FLVA 1LUVA 5JVDB 1XMQO 2HHHO 2BTQB 1KQSU 4HZ3A 3RFRA 2DWDC 3FD9A 1JA8A 3W7WA 4IYIA 2VS0A 2ILMA 4JI7O 3ZHVA 1Y67A 3SGIA 4TV9B 4WFHA 3BA8A 2OCCC 3D3IA 2CGNA 4O2BB 2R9AA 4CZZA 3DXRA 1G8MA 2XT9A 3T1CA 2RMKB 2A0LA 4L87A 5LP6C 2GBOA 2DYRB 5LP6A 2YDEA 5KLVH 4IIJA 1XREA 4JI1O 4ZKIA 2AZ2A 3EFFK 2V7QG 4CH5A 4H0LB 3CYOA 1O9GA 1ZTEA 4R6ZA 3K59A 4DR6B 5KAFZ 3QTCA 1HNXO 2FMLA 3OD4A 4Z2WA 4O2AB 1SS3A 1BE3H 2K1EA 3RBZA 1EZVH 2ZQMA 5EC2C 3WB0A 2VQEB 3UCSC 1WA8B 1V55B 2X0LA 3L74H 2X6BA 1JVMA 4DR2O 5LGTA 4DV1O 2HLDG 1FXVA 5IY5B 5GTHZ 1JJ2U 3P3NA 4B3RO 4P2ZA 5EIBD 1EN6A 4JI4O 2L6LA 3FX7A 2RDCA 1EZJA 2MK3A 3F5WC 1Q7YW 1FFTB 5DN6G 1G4YB 1MMMA 4K35A 2N04A 3GWOA 1EN4A 1H2MA 3CCQV 2BOBC 1GH6A 4K8XA 3D8CA 2PYLA 3FYEB 1WB8A 4LF9O 5B3SB 4JGSA 4OPHA 4FLWA 1Q86W 3G6EV 5EYPB 2QE7G 3ASOB 4MVQA 1I08A 3K5LA 1G1XB 4P30A 1EBOA 1M57B 3JYCA 2RNBA 3D3QA 4LF6O 3H1IH 4X1KB 2IH3C 4O2AA 3HPLC 1A32A 1SQBH 5IT9N 4DR1B 1KD1W 1WA8A 5FL7G 2D2CB 2EILB 4J9YB 2EJRA 1BCCH 2IW5A 1P4RA 5LXTB 2CTWA 1XOUA 5BMVB 1AR1B 2UXDB 3TETA 5H6QA 2CK3G 5FLXN 3QVNA 3STZC 5LOVA 1JMKC 4I0XB 4JYAO 3JSNA 5BR8O 1W59A 1JFFA 4GZRB 4IYHA 2X6CA 3RGBA 4MVMA 4E4EA 5L3GA 3CCJV 3CCVV 2MW2B 1M1KW 2LGQA 5EYPA 3DSQA 3LDEA 4QIWF 1KBHA 4YJ3B 3ZRWB 3N2GB 2R9RB 1AP5A 1H8EG 1M57C 2NLJC 5C8YA 3ETDA 3IC9A 4R50A 1FKAO 2D3OW 3TK1A 4JI2O 2F1MA 4BIZA 3CCRV 2XUMA 3QO8A 3ZMVA 2VQFB 1SQGA 3G6BA 1ZWIC 1OCRC 3ICXA 5KHKA 3R65A 1Y76A 2YICA 2BE3A 2DN9A 2DMXA 1COWG 2X7RB 5CA0B 5L3FA 3ZBHA 2ZXWC 4LP8A 1MNGA 3ABMB 5HFLA 4BIUA 5BMVA 1F4MA 4O4IB 2ZM6B 4JI3O 3AG1C 3P30A 4KHPB 3PN1A 4GKJO 4I0XA 2P6JA 4X1YB 4CC6A 2EIMC 1PNKA 4FLXA 1GN4A 2WSSG 4NXNB 5B1OA 1B06A 1K3EA 4DV0B 4DUYB 3L73H 3LDCA 4F6RA 1M93A 3N2GA 2ZNIA 4RQEA 2WPDG 2Q4PA 1B6QA 4DV3B 1TAEA 4X88A 3VOUA 5KX5B 1JCHA 2WLIB 1SQPH 4NB5A 3OTOO 3N27A 1Y74B 3OAAG 2EX3A 3CCUV 3JAKB 1WN7A 4LFCB 3E8GA 2HEPA 4NVPA 2Q7EA 2Z3YA 2YI9A 4LF8B 1TUEB 4FVMA 2M7WA 3JD1A 1VQ9V 5CA0A 3TJTA 3RVYA 5GTIZ 1NR1A 3CS5A 3UT5B 2OT5A 2LO1A 1AP6A 3RYHA 4O4IA 2UXBO 2CGOA 2JJ1G 4AHCA 2ZR3A 4DV5B 4X1YA 1OCCB 3I56V 1R1BA 2LGWA 4G2KA 4MVZA 1K73W 5EZYB 2G38A 4OX9O 3ZEDA 3SJAC 4DRXA 1SQFA 3JALB 3CSXA 4EKWA 4I9WA 1SQXH 4FM0A 3B77A 1XL6A 3K5NA 4IT5A 4WBNA 3W7UA 1IXBA 1QVFU 1XHXA 3C3SA 1Y74A 4B3MO 3L71H 3OR6C 5J9PC 3CMEV 1KYOF 5IYZA 3CD6V 3QF7A 2Q73A 5CMUA 1OV9A 5BY1A 2W0FC 2DYSB 4PV1B 4WF9V 4J9ZB 3SPCA 4XDJA 1QHTA 4YIOA 3B40A 3RT3C 2XHBA 1OZ0A 1URFA 2EIJB 4HNAB 1Y66A 1ENVA 2Q0AA 3CCSV 1HR0O 2ZDIC 3AK3A 1AR5A 2ZDIA 4EEQA 4DR3O 5CA3A 2HG5C 4LNUB 4NTWA 2X6AA 1VF7A 3RYFB 1XNQB 5EZYA 1TGOA 4TV8A 4U7OA 1Q6UA 2F23A 5TISZ 1S5HC 1VP7A 4EFBA 2AZ0A 4CH6A 4LFAO 2UU9B 2ZE8A 3NXSA 1F51A 4J11A 4I4TB 1Z5VA 5LGUA 3HKEA 5IWAB 4WFGA 1KECA 2JEUA 3F7YC 4X20B 3QNEA 3JASB 4ZOLB 4XBFA 4JI8O 4JYBA 5GONA 1O9HA 1AI5A 1LUWA 3CWBH 5IDJA 3CXCU 3JD3A 1NKDA 3FB8C 3JD0A 5JQGB 3WB2A 4UB8Z 3OEEG 1XNRB 5IYBO 1N36O 1JJOA 2PI5A 3RYCA 2H3OA 3AG3C 2BCCH 3D36C 3D36A 4MTXA 1H2GA 2OTLV 4LNUA 3KKYA 3LNMB 2KG7B 1OCOB 3RYFA 1F4NA 2BSKA 1Q6HA 4BW5A 3JD2A 4LF5B 3I5DA 3ABLB 4JI6B 3ABKC 3QO7A 4BWAA 3FAVB 4LH7A 5LGNA 1Q6IA 3L75H 1VQMV 4LR3A 3DC6A 5LHHA 1QVGU 2LP7A 1IDSA 3E83A 4JYCA 1HNWO 5KHGA 1R3JC 4X20A 3JASA 1VQ6V 4K0KB 4ZIBA 1W2BU 1H2LA 1VQ5V 1GM7A 3SYAA 3IJ4A 3E22B 1AJQA 3GVMA 4YIPA 2EIKC 3K5OA 4DR4B 4FLYA 4NXMO 3B09A 4IHJB 2F95B 3BEHA 4IGGA 3X2QC 1RM1C 3K79A 3OMNB 1XMOB 2PUSA 1G6UA 4DUZB 2LW1A 2CE4A 3ZHUA 2CTRA 2KG7A 4JZGA 3TXQA 1P84F 4MW3A 3M99B 1DK1A 3FAVA 3CRMA 2OCCB 1DLBA 1R6TA 2F93B 2GTSA 4IL6Z 4DR7B 3K9SA 2JDIG 4CC5A 3FB6C 3OR7C 5CA1A 1FJGO 2NNUA 2WWWA 1FPOA 4YY3O 2DQ0A 1JX9A 2W6IG 3OT7A 4WFEA 3BAAA 3E22A 4FM1A 1MSDA 2IH1C 1F7YA 3CRCA 4DV4O 1MZEA 2ZE6A 4DV6B 2VWJA 4DV0O 1PNLA 3GWKC 3MDSA 3CCLV 3T1YB 3ZN1A 4DUYO 1QLEB 4UVAA 4WCEV 2K9PA 1US6A 1I7FA 1K4CC 5CBFA 3BHPA 3J81N 3FB5C 1YXBA 1P49A 1NBMG 3JARA 3K0DA 2AHZA 3ZJZA 3H1JH 2YIDA 5K1XA 5LMUO 1N0NA 4LF8O 3ZMSA 3SJBC 1W0KG 4DR5B 2OIEA 2OCHA 2Q68A 3DGEA 4PJ0Z 4PI2A 3O9OA 3ML0A 1IBKB 3AK1A 3M7MX 4YHHB 1NR7A 2XOKG 1H2SB 4FPPA 4X66B 2CUGA 4UB6Z 5JH7A 3CP1A 3HKCA 1KKCA 4JAVA 1IZ3A 2HR3A 3HKDB 4X64B 3UKMA 3LSSA 2A9HA 1QLEC 1LNQA 1MZFA 2Y48A 1DF5A 4XDKA 2AGAA 4JTDB 3G80A 2PY5A 1IBLO 3G71V 2ARHA 2QM4A 4LBEC 1S77D 2QM7A 4AQYO 3UQ8A 3Q4HA 1XHZA 5B1BC 4JV5O 2ZNJA 1HNZO 1GRJA 4I55A 3CC7V 4B3TB 2GHYA 3AG2C 5LOVB 2IM9A 2P06A 3AEIA 1GM8A 4KXRA 4UFZA 4GKKO 5B66Z 1SQQH 5B5EZ 1JFFB 2IBZH 2DW4A 4JI0O 4D7SA 4DV2O 1S0VA 4X65O 2UUCO 1WNSA 1N32O 5H5NA 2ZT9B 1HW7A 3UM7A 1IVSA 1N33O 4J42A 4QNHB 1IX9A 2E5LB 2UXCB 1K5QA 2F4VB 3OGIB 4YXWG 4LF7O 1AB3A 1H2KA 1HP8A 2EZPA 5C8YB 2FL4A 3FKSG 1E1RG 3VQWA 2IJHA 3WB1A 2PGGA 3K06A 3HKDA 3JATA 3OMAB 1N34B 4KL1A 4MVOA 2XNDG 4D6TH 2FTKA 3ABTA 4MTOA 3MHHC 4H37A 1S72V 1BZKA 1XQ8A 1KU9A 1OCRB 1Y76B 2IU0A 5IWAO 1E1QG 2F43G 1K5SA 4DV7B 2AHYA 5A9GA 4I9QA 4I50A 2YC0A 4FM2A 2ZCEA 4K3AA 3CB2A 4B7EA 2XAFA 1J95A 3T1HO 4PDLA 3JAWA 4JI5O 2ZXWB 5BZBA 1NH2B 5DM6V 1ORQC 1GAXA 1PD3A 1NZ6A 2HP8A 3AG1B 1PNMA 2EIMB 5EC1C 4RWUA 1NS1A 4B3SB 4B7KA 4TQFA 4WFFA 2EBOA 1KUQA 4TT3G 1EFRG 3U10A 2IJIA 2P7TC 3LDDA 2QKCA 4F6RB 3S3XA 1HDJA 1CPYA 4UCRA 2UUAO 1I94O 4RAIA 3OEHG 1R3IC 1YCIA 3LNNA 2Q69A 1R6KA 1EM1A 1PM9A 4WFAV 4BW9A 1KB9F 4FLZA 3ZS8C 2EJ7A 3K58A 1N0JA 4PELA 2ADQB 2JS3A 1Q90D 3OE7G 1MABG 3SYOA 1KP2A 5EK0A 4ICGA 3IGAC 4TOIA 3MHSC 1IURA 1K34A 4Q6GA 4R7CA 2PF4E 1I5XA 1J5EO 4MVRA 4TQDA 4JF3A 1T5EA 1VARA 3RYHB 1Q82W 1GN3A 4P9OA 2UXXA 3BVOA 1NJIW 5LA6A 5DECA 4HAMA 3JCZA 4DRXB 3J80N 2UUBB 1YJNV 4UUJC 2R72A 3L9DA 4X62B 4W4LA 3LSUA 5J2UA 3WG7C 3ZMTA 1F23A 3EXAA 3J7AU 4OPAA 4PA4A 2OYQA 1K9MW 4WBNB 1BS3A 2QSAA 2IJJA 3RN4A 4Q20A 1YZBA 3E35A 1PPJH 3SR2C 1BHBA 1Q81W 1N4CA 1QU7A 1FAFA 2A06H 3CC4V 1LR1A 1XMQB 2HHHB 4C7UA 1VQPV 2DOSA 1KMIZ 4J7KA 5LHIA 5IYZB 1YITV 4R8CA 4LF4O 1P7GA 1YF2A 1WB7A 3ZHQA 4CH3A 5KMGB 5LMNO 1YIJV 2Y0PA 1IBMO 2ZKOA 2NR5A 2LW7A 1ZUQA 1WP8A 4PDMA 4JI7B 3L70H 4GLXA 3P3PA 1NTKH 3BFRA 4G27B 1D5NA 2QA4V 1K4DC 4LFBO 3CPWU 3SJCC 1S5JA 3E86A 4W4KA 4TV8B 3QG5A 1M5IA 4RO2A 5K1PA 1V54C 2QEXV 4JI1B 4LCUC 2P22C 2E3CA 3K03A 5LYJA 4CS4A 2HVJC 3AG7A 4PD4F 3HKEB 4EB6B 3PJSK 1HNXB 2ODMA 5GONB 2P4VA 4QE9A 1ZX3A 4FLTA 3TGUH 5KMGA 1WPXA 3I55V 4DR2B 4DV1B 1U97A 1E79G 4L8JA 1D2DA 4DR5O 3ZMUA 2YS8A 3E8FA 4B3RB 2HJDA 3C3TA 3RYCB 4JI4B 1GM9A 3AG3B 2W0XA 4UCOA 5LBQA 2JS5A 4FIPC 4LWSB 4GX0A 3BY6A 1KC8W 2BSKB 3SPIA 4X1IA 4DR6O 2QKAA 3MAQA 2ETNA 4LF9B 4PI0A 4LC1A 1VEWA 2QWOB 5KHJA 3A0HZ 3ABKB 2VQEO 3IAYA 1SRYA 3H01A 4DXWA 2L35A 1OJHA 1THZA 2GSMB 4EB6A 3ZRXA 4JAAA 2Y69B 3CHXA 3KG2A 3JCUZ 4LF6B 1XBLA 2A79B 4DO2A 5CBHA 4FFKA 4NTYA 2Q5ZA 5B1AC 2QWNB 4N23A 5FPOA 4BR6A 3UO2A 1AILA 2IJKA 5KAIZ 3VQXA 1SZTA 2EIKB 1AR4A 2AXTZ 2WA4A 4HBNA 1SC5B 4QGPA 2E76B 2QKSA 1PP9H 2RCVA 3X2QB 2ATKC 3U0ZA 1RM1B 2Q67A 1XILA 4Z1MG 2EINB 2E5LO 2UXCO 4JYAB 1BGYH 4LWSA 4UV8A 5L3BA 1I0HA 1RP3B 3CRQA 3ZIAG 4UCTA 2Z0AA 5FPRA 1DGSA 3SJQC 3SPJA 2YI8A 2QWQB 4DR1O 3GB7C 4TUYB 4DK0A 5C93A 2BTOA 5DEDA 1YEWA 3IFXA 1ROPA 4A5UB 1YJ9V 1L8DA 2Y69C 2V1DA 1FXKC 1OHHG 4F4LA 1FXKA 3KCXA 4JI2B 5KA5A 5CA1B 5JCOC 3ZRVA 1QBZA 4QPKA 5JCOA 4N21A 2UXDO 3L72H 3VQYA 1GN2A 2QM8A 4U3JB 1R6NA 3C90A 3N2KA 3W7XA 4E2LA 1OCZC 2R9IA 4FK5C 3K5MA 2QJ1A 2WLHA 1JOYA 3CXHF 3RWRD 2EINC 1B04A 2B1IA 1DTOA 4O4LB 2H8PC 4GKJB 4GYCB 5L3DA 5H9CA 1R3LC 4MVUA 1DF4A 2B1GA 2QR4A 2A7WA 3A8TA 1QR9A 1SERA 2ZINA 1YVWA 1TVKA 4TUYA 2VQFO 3CCMV 2HKOA 3JARB 3FFQA 3B8NA 1L0LH 2QTSA 4J7ZA 3CX5F 1YHQV 3OTOB 1SQVH 2ZM6O 1PKXA 5JH7B 4FZ1A 4KHPO 1NH2D 5CBGA 4U3JA 2KSDA 4NXNO 3HKCB 1V9PA 2JGDA 1FFXB 2QTOA 3QO5A 1QR8A 2YUAA 3B2EE 4PDRA 4O4LA 2UXBB 2DQ3A 3KCYA 4JPRA 3SYPA 4FFBA 4ABMA 2Y4TA 4ASUG 1Q3EA 3W7TA 1UFIA 2YIBA 4RUFA 1UPGA 1PL0A 4OX9B 1VF6C 4DV3O 4NKGB 4LH6A 3A2FA 3Q4HB 3W7SA 5JJEB 3E8HA 3K3WA 5B1BB 4ZI7A 5H6RA 1WJZA 4I55B 3K04A 4LFCO 3TCUA 3AG2B 3H9VA 3ASNC 4K8ZA 2VRZA 5A2QN 1N8RW 1GMGA 1W0JG 2GDSA 1TUBB 2PZSA 2WLLA 4O4HA 4B3MB 3OMIB 2IU3A 1BSMA 1NTMH 3FYIB 1RSOB 5ITZB 3FB7C 4DV5O 4CS3A 3OW2U 1VQOV 4PDVA 3WFVA 1M56C 2DE0X 5IJ9A 2H94A 1FFXA 3JATB 1AI4A 5E1AC 2QWRB 1HR0B 1M4UA 4CBCA 2E74B 4DR3B 1CXZB 1VQLV 4DW0A 2W6JG 2C2AA 3H1HH 5KUKA 2XTAA 1U96A 2JVDA 4GX1A 4I5SA 3E2EA 3RVZA 1B3QA 1K97A 1XDCA 4I50B 2AW9A 3JAWB 5JVDA 1VQ8V 4LFAB 3K9AA 5HFMA 1RPOA 3SPGA 1VF5B 3BCCH 1S76D 3TXSA 2BTQA 2CDYA 3K08A 4D7TA 3AG4B 1K33A 1RPRA 2P67A 2OWOA 3CRAA 3VQVA 1TUBA 4JI8B 3RYIB 4J7JA 4TV9A 2LFRA 2O57A 1VQNV 4F6EA 1RSOA 4B08A 5ITZA 4O2BA 2QDOA 4JZ2A 4KUMA 4H33A 1NVPB 1XNQO 1N36B 2DYRC 3HKBB 1IXMA 2XASA 2EULA 2HFEC 2UXNA 4OGQB 2ADPA 2VWKA 1VQ4V 2YEVB 4UCSA 1D5AA 3STLC 2UU9O 1X4TA 4QE7A 1BQ0A 5LL6Y 1NI8A 1BT8A 3DC5A 2YSUB 1UJWB 1YTFB 2PYJA 3AK2A 4FZ0A 3APQA 1Y4MA 1H2NA 1V55C 2QGNA 4ZHQB 1AJNA 2WA3A 3AG4C 5IY5C 1HNWB 2XAGA 5LA6B 1R73A 1MOFA 1XNRO 5J2TB 4OXSA 5EBWC 3RYIA 3ZHSA 4QJFB 3SPHA 4RUEA 5J2UB 1M9NA 3ZRSA 1BMFG 3WG7B 2CH7B 2KB1A 2Q0OC 1SA0B 4H44B 4Z1VA 1WLEA 2DJVA 4NXMB 2Q6AA 3HKBA 4XDLA 4UXNA 1ZLZA 5B3SC 4LF5O 3G67A 2NN4A 3H1KH 3U11A 1GO3F 3E89A 5H2FZ 1M90W 4JI6O 2ZD9A 1ZAUA 3P32A 3JAMN 2YEVA 3ASOC 2Q9LA 1YJWV 2PI4A 1PL4A 3UO3A 2N05A 2B5UA 2CTPA 4MT8A 4EFEA 4X89A 1HWYA 5GW7A 3ZN0A 3ZX6A 4X1KA 3CJHB 4K0KO 2HJFC 1AVMA 1TA8A 2E75B 2Z5UA 3B8MA 4J10A 3RW0A 5KA6A 4ZHQA 1X59A 3ETQA 2FYUH 2EILC 4CH4A 1GK9A 3R66A 1VMGA 3ZMZA 5J2TA 4DR4O 1WPBA 3MD0A 1Y6XA 1FJGB 3T4DA 2P90A 4ZBMA 3S3WA 5LXTA 4YY3B 3A0BZ 4TWKA 1V54B 1YI2V 1XMOO 1MA1A 2JEXA 3T4ZA 3EHBB 3JSLA 5LYJB 2CH7A 4DUZO 5IJ0B 5KHHA 2GTAA 1JPXA 1Q8IA 1NQTA 2LJ2A 1R3KC 1SA0A 2CAZC 2JK5C 4GX5A 4DV4B 3E8BA 4JYYA 1GKFA 5CB4B 4FMTA 5KHIA 2V4DA 4UCVA 1QQCA 3CC2V 3OM3B 2OIGA 4YJ3A 3ZHRA 3A0RA 2N74A 3ZRWA 4WFBV 2WLJA 1FS0G 2RN9A 4DR7O 1P7BA 2LQTA 5IYCO 2P5OA 1S3JA 4DK1A 3CJHA 4MTGA 2R70A 4AILC 4AI8A 2OTJV 5LMUB 4UVBA 2F66C 4X8AA 3CMAV 4MS2A 4X1IB 1MG1A 3THOA 2ZIMA 1FD9A 2P4KA 3ABMC 4JAUA 2WLKA 4DV6O 1AROP 3T1YO 2WLNA 5IJ0A 1Z2GA 2JRIA 2ZR2A 2RQ6A 2ZE7A 2YIBD 2Y0IA 3K57A 1NT2B 1SF9A 2XAHA 5CB4A 2YXHA 1XL4A 1SETA 4DW1A 4J80A 5B1AB 3ZCCA 2ITDC 2KKWA 4NTXA 1IBLB 1FYJA 3LSQA 3CRRA 1Q5OA 4QPJA 5EIBC 4TSFG 2Y4UA 1BQZA 1S5LZ 4BIOA 4AQYB 2YIAA 5KX5A 5EBLC 1SZXA 2WLIA 4PHZA 3LUTB 4JV5B 1HNZB 3CEIA 4J41A 1KP3A 1IBKO 4U7NA 4YHHO 1Q43A 3OUFA 4NYKA 3JAKA 3EVKA 5D5QA 4X66O 3G4SV 1K7DA 4I7ZB 4GKKB 5L3CA 1BL8A 4KP4A 2A3QA 4JI0B 4DV2B 2FB5A 4X65B 2UUCB 3O65A 1K8AW 1H38A 1N32B 2LFSA 1H8HG 4X64O 1N33B 3BRCA 3UT5A 1GN6A 1MSWD 1NU1H 1Z5WA 1WP7A 1OCCC 1AI7A 3F7VC 4O4JB 4LF7B 3H1LH 1FXKB 3F5TA 3JALA 3OTFA 1CP9A 3DTUB 1ZSPA 5FNVB 3HR0A 5L3EA 1QCEA 4B3TO 1XEQA 2JGUA 4NR1A 4UV9A 4BAYA 4GUNA 3CCEV 1BHAA 2KQXA 3N2KB 5JWPA 1KKDA 3SYCA 4YJ2B 2B9ZA 1OCZB 3T1HB 3ZHTA 4JI5B 1L0NH 1SESA 2XAJA 1VQKV 2DYSC 2ZIOA 3B4SA 3APOA 2F4VO 2FKXA 2EIJC 5BR8B 3ABUA 2BOCC 4HNAA 4GCZA 3ETEA 5KUMA 3KZIZ 1N34O
chains in the Genus database with same CATH topology
2ZXWB 4PA3A 1K92A 5B1BB 4RQFA 2OT5A 5H6RA 5BZBA 1NH2B 5DM6V 2JJ1G 1ORQC 1PD3A 3K04A 2ZR3A 3TCUA 3AG1B 1OCCB 3I56V 3AG2B 1PNMA 4G2KA 3ASNC 2EIMB 4MVZA 1K73W 4JTCB 5EC1C 3K0GA 3VBBA 1N8RW 1GMGA 1W0JG 2DWEC 4GT1A 4WFFA 3T2MA 2WLLA 4EKWA 1QLNA 2EBOA 4I9WA 3OMIB 2IU3A 2ITCC 4MW8A 3B77A 4TT3G 1AJPA 1XL6A 3FYIB 1EFRG 3JD4A 2IJIA 2P7TC 5IYDO 3FB7C 3LDDA 4KFMA 1CPYA 3W7UA 3OW2U 1VQOV 4PDVA 4RAIA 1QVFU 3OEHG 1M56C 5B1NA 3WFVA 1R3IC 1JQ0A 2H94A 4FJCC 2Q69A 1AI4A 1R6KA 4MSWC 5E1AC 3OUSA 3OR6C 4CBCA 4WFAV 5J9PC 3CMEV 1VQLV 2W6JG 3CD6V 5CMUA 2C2AA 2W0FC 4PELA 2DYSB 4WF9V 5KUKA 4J9ZB 4JTAB 3SPCA 2JIZG 4HYOA 4XDJA 1I5YA 3OE7G 1MABG 4GX1A 4I5SA 1OZ0A 2EIJB 1KP2A 3OFNG 4MTFA 3SYOA 5EK0A 3E2EA 1Y66A 2HVKC 3RVZA 3IGAC 1NVPD 1K97A 3MHSC 1CEZA 1K34A 1ENVA 4R7CA 4PA9A 1VQ8V 3CCSV 1AI6A 2ZDIC 2WAMA 1I5XA 3K9AA 5HFMA 1RPOA 4MVRA 3SPGA 1VQ7V 2ZDIA 1S76D 4JF3A 4UVCA 5CA3A 1Q82W 2HG5C 3K08A 2XAQA 4P9OA 1OCOC 2UXXA 2X6AA 3AG4B 1K33A 1NJIW 2WLMA 1RPRA 2P67A 4HAMA 3ASNB 3HB3B 4U7OA 3SYQA 3JCZA 1YJNV 3ETGA 5CN0A 1S5HC 3ABLC 4UUJC 2WLLB 1GTOA 1YTFD 2LFRA 3WG7C 3ZMTA 1VQNV 1F23A 1FXHA 1L1FA 3NXSA 1F51A 4PA4A 5LHGA 1K9MW 4PA6A 5LGUA 4KUMA 4H33A 1NVPB 4WFGA 1KECA 2JEUA 2DYRC 3F7YC 2IJJA 3QNEA 4P9PA 4Q20A 4XBFA 1IXMA 2XASA 3E35A 1BHBA 4GX2A 1M56B 1Q81W 4JYBA 2HFEC 2JJ2G 2UXNA 3CC4V 3IC7A 1AI5A 1VQ4V 3CXCU 1VQPV 4G28B 5IDJA 5LHIA 3JD3A 1NKDA 2YEVB 3STLC 3FB8C 3OGCC 1YITV 2EZOA 4R8CA 1YIJV 3JD0A 4QE7A 3OEEG 4PA7A 5IYBO 5EBMC 2YSUB 4MVSA 4JASA 1YSCA 4PDMA 1UJWB 1YTFB 2PI5A 3AG3C 1Y4MA 1V55C 1KQSU 3D36A 4MTXA 4G27B 4HZ3A 1H2GA 1AJNA 3AG4C 2QA4V 1K4DC 2OTLV 2DWDC 3LNMB 3CPWU 3E86A 5IY5C 3W7WA 1OCOB 1F4NA 2XAGA 1R73A 1MOFA 4RO2A 4OXSA 4BW5A 3JD2A 5EBWC 1V54C 4QJFB 3ABLB 2QEXV 3SPHA 4RUEA 4LCUC 3ABKC 3QO7A 4WFHA 1M9NA 3K03A 2OCCC 3D3IA 3ZRSA 1BMFG 3WG7B 5LGNA 2HVJC 1VQMV 2KB1A 5LHHA 4CZZA 1QVGU 1G8MA 2LP7A 3E83A 4JYCA 3PJSK 3T1CA 1R3JC 1WLEA 2A0LA 4L87A 2Q6AA 4XDLA 4UXNA 2DYRB 1VQ6V 5B3SC 1W2BU 1GO3F 3E89A 1M90W 1VQ5V 4QE9A 1GM7A 4ZKIA 2ZD9A 3SYAA 3EFFK 3P32A 2YEVA 3ASOC 1YJWV 2V7QG 1AJQA 2PI4A 1WPXA 3I55V 3CYOA 2B5UA 4MT8A 4R6ZA 2EIKC 4X89A 1HWYA 1E79G 5GW7A 3ZN0A 3ZMUA 3E8FA 3BEHA 2HJFC 3X2QC 1RM1C 2K1EA 3K79A 3OMNB 3RBZA 1GM9A 2ZQMA 2Z5UA 3B8MA 5EC2C 3RW0A 5KA6A 3AG3B 5LBQA 1V55B 2X0LA 2X6BA 2EILC 1JVMA 5LGTA 4FIPC 1GK9A 4GX0A 2HLDG 3BY6A 3ZMZA 3SPIA 1KC8W 1FXVA 5IY5B 1JJ2U 3MD0A 4MW3A 3T4DA 2P90A 4ZBMA 3M99B 4P2ZA 4LC1A 4TWKA 1V54B 1YI2V 3ABKB 2JEXA 3T4ZA 3EHBB 2OCCB 1DLBA 1SRYA 1EZJA 2MK3A 3F5WC 1Q7YW 3H01A 4DXWA 1FFTB 5DN6G 1G4YB 1THZA 1JPXA 2GSMB 1NQTA 1R3KC 3ZRXA 3GWOA 2JDIG 2Y69B 3KG2A 2JK5C 4GX5A 3CCQV 2BOBC 3E8BA 1GKFA 3FB6C 2A79B 3OR7C 4DO2A 5CBHA 2NNUA 2WWWA 3FYEB 4FMTA 5B3SB 4JGSA 2DQ0A 1JX9A 2W6IG 1Q86W 5B1AC 3G6EV 4WFEA 2QE7G 3CC2V 4N23A 3OM3B 3ASOB 3A0RA 3ZRWA 4MVQA 4WFBV 2WLJA 1FS0G 2IH1C 1P7BA 4P30A 2IJKA 5IYCO 1SZTA 2EIKB 1EBOA 1M57B 3JYCA 1S3JA 2IH3C 3HPLC 2QKSA 4MTGA 3X2QB 2ATKC 1RM1B 1KD1W 2Q67A 1PNLA 3CCLV 4Z1MG 3ZN1A 5FL7G 2EINB 1QLEB 4UVAA 2OTJV 2EILB 4UV8A 4J9YB 2EJRA 4UVBA 4WCEV 5L3BA 4X8AA 3CMAV 4MS2A 1MG1A 2IW5A 1P4RA 1K4CC 5CBFA 3ZIAG 3ABMC 3SJQC 3FB5C 3SPJA 4JAUA 2WLKA 1AR1B 1AROP 3GB7C 3TETA 5C93A 5H6QA 2CK3G 1NBMG 3K0DA 3IFXA 2AHZA 1ROPA 3STZC 2WLNA 1YJ9V 3ZJZA 2Y69C 2V1DA 1FXKC 1OHHG 3ZMSA 4F4LA 1W0KG 2ZR2A 1FXKA 2Q68A 5KA5A 3DGEA 2X6CA 5L3GA 4MVMA 2XAHA 3ZRVA 3CCJV 1QBZA 1XL4A 3ML0A 4QPKA 1SETA 4N21A 3CCVV 1M1KW 1NR7A 2XOKG 3LDEA 4FPPA 5B1AB 4QIWF 3ZCCA 2ITDC 3ZRWB 2QM8A 3CP1A 2R9RB 1H8EG 3LSQA 1M57C 2NLJC 4QPJA 3ETDA 1R6NA 4R50A 4TSFG 2D3OW 3W7XA 3TK1A 4BIZA 3CCRV 4E2LA 1OCZC 2R9IA 4FK5C 2HR3A 4JAVA 5EBLC 2WLIA 3LUTB 2WLHA 1JOYA 3UKMA 3QO8A 1KP3A 3LSSA 3ZMVA 2EINC 2A9HA 2B1IA 4U7NA 1DTOA 1QLEC 3OUFA 1ZWIC 1LNQA 2H8PC 2Y48A 1OCRC 1DF5A 4XDKA 4JTDB 5L3DA 5H9CA 1K7DA 3R65A 1R3LC 4MVUA 3G4SV 1DF4A 3G71V 2B1GA 5L3CA 1BL8A 4KP4A 4LBEC 1S77D 2QM7A 1COWG 1QR9A 2X7RB 1K8AW 1H38A 5L3FA 1SERA 2LFSA 1H8HG 2ZXWC 4LP8A 5B1BC 3ABMB 5HFLA 4BIUA 1MSWD 1F4MA 3CCMV 2HKOA 3CC7V 3AG1C 2GHYA 1OCCC 3B8NA 1AI7A 3AG2C 3F7VC 3P30A 2P6JA 2EIMC 1PNKA 3AEIA 1GM8A 2WSSG 1FXKB 2DW4A 1S0VA 5B1OA 1YHQV 1CP9A 3DTUB 3UM7A 1K3EA 5L3EA 4QNHB 1QCEA 1PKXA 1K5QA 3LDCA 1NH2D 4YXWG 4UV9A 5CBGA 4BAYA 4RQEA 2EZPA 2WPDG 3CCEV 1B6QA 3FKSG 1BHAA 1E1RG 1KKDA 3SYCA 2IJHA 4X88A 3VOUA 1JCHA 3K06A 2WLIB 2QTOA 3OMAB 1OCZB 3QO5A 1QR8A 4MVOA 2XNDG 2FTKA 3ABTA 1SESA 3OAAG 4MTOA 3MHHC 4PDRA 2DQ3A 4JPRA 3SYPA 3CCUV 2XAJA 1VQKV 4H37A 1S72V 2DYSC 3K3WA 4ASUG 3W7TA 3E8GA 1OCRB 4RUFA 2Z3YA 2IU0A 1TUEB 1E1QG 1PL0A 2EIJC 2F43G 1K5SA 3ABUA 2BOCC 2AHYA 4GCZA 3ETEA 2M7WA 5KUMA 3JD1A 1VQ9V 2XAFA 3RVYA 1J95A 4PDLA 3W7SA 1NR1A 3E8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF4 A;  3CYO A;  1QR8 A;  2OT5 A;  1Y4M A;  3CP1 A;  1I5Y A;  5CN0 A;  2LP7 A;  4JGS A;  1QR9 A;  2X7R B;  3MHH C;  1Y66 A;  3M99 B;  4JPR A;  3MHS C;  1K34 A;  1QCE A;  2EZO A;  4E2L A;  1ENV A;  4FK5 C;  4G2K A;  4N23 A;  1F23 A;  5HFL A;  3WFV A;  1JQ0 A;  1MOF A;  5KA5 A;  1I5X A;  3K9A A;  4FJC C;  5HFM A;  1DLB A;  3B8M A;  2MK3 A;  4JF3 A;  5KA6 A;  1MG1 A;  3H01 A;  3P30 A;  3B8N A;  1SZT A;  2EZP A;  1EBO A;  1JPX A;  1QBZ A;  2EBO A;  2M7W A;  2P6J A;  4N21 A;  3GWO A;  1K33 A;  1DF5 A;  3B77 A;  4FIP C;  5CMU A;  5H9C A; 
#chains in the Genus database with same CATH topology
 4PA3 A;  1K92 A;  4RQF A;  1TVK B;  3BAB A;  4O4J A;  2UUA B;  4JTC B;  3K0G A;  4UCU A;  3VBB A;  4DV7 O;  1I94 B;  4X9Q A;  2DWE C;  4GT1 A;  3T2M A;  1QLN A;  4MW8 A;  2ITC C;  5FNV A;  5IE9 A;  2GUZ B;  4CS2 A;  2RJZ A;  1AJP A;  3JD4 A;  3WU2 Z;  5IYD O;  1NTZ H;  4I4T A;  5JJN B;  4KFM A;  5E79 Z;  5JJJ B;  4FLU A;  4ZOL A;  5B1N A;  1JQ0 A;  4YJ2 A;  4B3S O;  2JGD B;  1QNM A;  4FJC C;  4H13 B;  4U3F H;  4MSW C;  3OUS A;  1J5E B;  2PTM A;  3NR7 A;  5AG2 A;  1PV0 A;  4FFB B;  4JI3 B;  1JR9 A;  5JQG A;  4JTA B;  2CTQ A;  2JIZ G;  4HYO A;  5F2V O;  1I5Y A;  2ZE5 A;  2YXL A;  1ZL8 B;  3OFN G;  4MTF A;  1XI1 A;  2HVK C;  1NVP D;  1CEZ A;  4PA9 A;  1AI6 A;  2WAM A;  4DYL A;  1VQ7 V;  4ZI7 B;  4UVC A;  2XAQ A;  1OCO C;  3CE2 A;  2WLM A;  5D5P A;  3ASN B;  3HB3 B;  3SYQ A;  3ETG A;  5CN0 A;  3ABL C;  2WLL B;  1GTO A;  4O4H B;  1EN5 A;  1YDX A;  1YTF D;  1WAZ A;  2GV9 A;  2GUZ A;  1FXH A;  1RFY A;  2Q7G A;  2QWP B;  1L1F A;  4LF4 B;  5LMN B;  3BA9 A;  5LHG A;  3DXR B;  1IBM B;  4PA6 A;  3SDL A;  2Q8V A;  4P9P A;  2UUB O;  1SKV A;  5LP6 B;  5IJ9 B;  4GX2 A;  1M56 B;  1VIB A;  2JJ2 G;  4IIJ B;  3IC7 A;  4X62 O;  4G28 B;  3OGC C;  2EZO A;  3M8A A;  4LFB B;  3BPZ A;  2YXY A;  4PA7 A;  5EBM C;  4MVS A;  1ZL8 A;  1XUQ A;  1YSC A;  4JAS A;  1VF6 A;  2Q7H A;  4IHJ A;  2M6Y A;  5BXZ A;  4FLV A;  1LUV A;  5JVD B;  1XMQ O;  2HHH O;  2BTQ B;  1KQS U;  4HZ3 A;  3RFR A;  2DWD C;  3FD9 A;  1JA8 A;  3W7W A;  4IYI A;  2VS0 A;  2ILM A;  4JI7 O;  3ZHV A;  1Y67 A;  3SGI A;  4TV9 B;  4WFH A;  3BA8 A;  2OCC C;  3D3I A;  2CGN A;  4O2B B;  2R9A A;  4CZZ A;  3DXR A;  1G8M A;  2XT9 A;  3T1C A;  2RMK B;  2A0L A;  4L87 A;  5LP6 C;  2GBO A;  2DYR B;  5LP6 A;  2YDE A;  5KLV H;  4IIJ A;  1XRE A;  4JI1 O;  4ZKI A;  2AZ2 A;  3EFF K;  2V7Q G;  4CH5 A;  4H0L B;  3CYO A;  1O9G A;  1ZTE A;  4R6Z A;  3K59 A;  4DR6 B;  5KAF Z;  3QTC A;  1HNX O;  2FML A;  3OD4 A;  4Z2W A;  4O2A B;  1SS3 A;  1BE3 H;  2K1E A;  3RBZ A;  1EZV H;  2ZQM A;  5EC2 C;  3WB0 A;  2VQE B;  3UCS C;  1WA8 B;  1V55 B;  2X0L A;  3L74 H;  2X6B A;  1JVM A;  4DR2 O;  5LGT A;  4DV1 O;  2HLD G;  1FXV A;  5IY5 B;  5GTH Z;  1JJ2 U;  3P3N A;  4B3R O;  4P2Z A;  5EIB D;  1EN6 A;  4JI4 O;  2L6L A;  3FX7 A;  2RDC A;  1EZJ A;  2MK3 A;  3F5W C;  1Q7Y W;  1FFT B;  5DN6 G;  1G4Y B;  1MMM A;  4K35 A;  2N04 A;  3GWO A;  1EN4 A;  1H2M A;  3CCQ V;  2BOB C;  1GH6 A;  4K8X A;  3D8C A;  2PYL A;  3FYE B;  1WB8 A;  4LF9 O;  5B3S B;  4JGS A;  4OPH A;  4FLW A;  1Q86 W;  3G6E V;  5EYP B;  2QE7 G;  3ASO B;  4MVQ A;  1I08 A;  3K5L A;  1G1X B;  4P30 A;  1EBO A;  1M57 B;  3JYC A;  2RNB A;  3D3Q A;  4LF6 O;  3H1I H;  4X1K B;  2IH3 C;  4O2A A;  3HPL C;  1A32 A;  1SQB H;  5IT9 N;  4DR1 B;  1KD1 W;  1WA8 A;  5FL7 G;  2D2C B;  2EIL B;  4J9Y B;  2EJR A;  1BCC H;  2IW5 A;  1P4R A;  5LXT B;  2CTW A;  1XOU A;  5BMV B;  1AR1 B;  2UXD B;  3TET A;  5H6Q A;  2CK3 G;  5FLX N;  3QVN A;  3STZ C;  5LOV A;  1JMK C;  4I0X B;  4JYA O;  3JSN A;  5BR8 O;  1W59 A;  1JFF A;  4GZR B;  4IYH A;  2X6C A;  3RGB A;  4MVM A;  4E4E A;  5L3G A;  3CCJ V;  3CCV V;  2MW2 B;  1M1K W;  2LGQ A;  5EYP A;  3DSQ A;  3LDE A;  4QIW F;  1KBH A;  4YJ3 B;  3ZRW B;  3N2G B;  2R9R B;  1AP5 A;  1H8E G;  1M57 C;  2NLJ C;  5C8Y A;  3ETD A;  3IC9 A;  4R50 A;  1FKA O;  2D3O W;  3TK1 A;  4JI2 O;  2F1M A;  4BIZ A;  3CCR V;  2XUM A;  3QO8 A;  3ZMV A;  2VQF B;  1SQG A;  3G6B A;  1ZWI C;  1OCR C;  3ICX A;  5KHK A;  3R65 A;  1Y76 A;  2YIC A;  2BE3 A;  2DN9 A;  2DMX A;  1COW G;  2X7R B;  5CA0 B;  5L3F A;  3ZBH A;  2ZXW C;  4LP8 A;  1MNG A;  3ABM B;  5HFL A;  4BIU A;  5BMV A;  1F4M A;  4O4I B;  2ZM6 B;  4JI3 O;  3AG1 C;  3P30 A;  4KHP B;  3PN1 A;  4GKJ O;  4I0X A;  2P6J A;  4X1Y B;  4CC6 A;  2EIM C;  1PNK A;  4FLX A;  1GN4 A;  2WSS G;  4NXN B;  5B1O A;  1B06 A;  1K3E A;  4DV0 B;  4DUY B;  3L73 H;  3LDC A;  4F6R A;  1M93 A;  3N2G A;  2ZNI A;  4RQE A;  2WPD G;  2Q4P A;  1B6Q A;  4DV3 B;  1TAE A;  4X88 A;  3VOU A;  5KX5 B;  1JCH A;  2WLI B;  1SQP H;  4NB5 A;  3OTO O;  3N27 A;  1Y74 B;  3OAA G;  2EX3 A;  3CCU V;  3JAK B;  1WN7 A;  4LFC B;  3E8G A;  2HEP A;  4NVP A;  2Q7E A;  2Z3Y A;  2YI9 A;  4LF8 B;  1TUE B;  4FVM A;  2M7W A;  3JD1 A;  1VQ9 V;  5CA0 A;  3TJT A;  3RVY A;  5GTI Z;  1NR1 A;  3CS5 A;  3UT5 B;  2OT5 A;  2LO1 A;  1AP6 A;  3RYH A;  4O4I A;  2UXB O;  2CGO A;  2JJ1 G;  4AHC A;  2ZR3 A;  4DV5 B;  4X1Y A;  1OCC B;  3I56 V;  1R1B A;  2LGW A;  4G2K A;  4MVZ A;  1K73 W;  5EZY B;  2G38 A;  4OX9 O;  3ZED A;  3SJA C;  4DRX A;  1SQF A;  3JAL B;  3CSX A;  4EKW A;  4I9W A;  1SQX H;  4FM0 A;  3B77 A;  1XL6 A;  3K5N A;  4IT5 A;  4WBN A;  3W7U A;  1IXB A;  1QVF U;  1XHX A;  3C3S A;  1Y74 A;  4B3M O;  3L71 H;  3OR6 C;  5J9P C;  3CME V;  1KYO F;  5IYZ A;  3CD6 V;  3QF7 A;  2Q73 A;  5CMU A;  1OV9 A;  5BY1 A;  2W0F C;  2DYS B;  4PV1 B;  4WF9 V;  4J9Z B;  3SPC A;  4XDJ A;  1QHT A;  4YIO A;  3B40 A;  3RT3 C;  2XHB A;  1OZ0 A;  1URF A;  2EIJ B;  4HNA B;  1Y66 A;  1ENV A;  2Q0A A;  3CCS V;  1HR0 O;  2ZDI C;  3AK3 A;  1AR5 A;  2ZDI A;  4EEQ A;  4DR3 O;  5CA3 A;  2HG5 C;  4LNU B;  4NTW A;  2X6A A;  1VF7 A;  3RYF B;  1XNQ B;  5EZY A;  1TGO A;  4TV8 A;  4U7O A;  1Q6U A;  2F23 A;  5TIS Z;  1S5H C;  1VP7 A;  4EFB A;  2AZ0 A;  4CH6 A;  4LFA O;  2UU9 B;  2ZE8 A;  3NXS A;  1F51 A;  4J11 A;  4I4T B;  1Z5V A;  5LGU A;  3HKE A;  5IWA B;  4WFG A;  1KEC A;  2JEU A;  3F7Y C;  4X20 B;  3QNE A;  3JAS B;  4ZOL B;  4XBF A;  4JI8 O;  4JYB A;  5GON A;  1O9H A;  1AI5 A;  1LUW A;  3CWB H;  5IDJ A;  3CXC U;  3JD3 A;  1NKD A;  3FB8 C;  3JD0 A;  5JQG B;  3WB2 A;  4UB8 Z;  3OEE G;  1XNR B;  5IYB O;  1N36 O;  1JJO A;  2PI5 A;  3RYC A;  2H3O A;  3AG3 C;  2BCC H;  3D36 C;  3D36 A;  4MTX A;  1H2G A;  2OTL V;  4LNU A;  3KKY A;  3LNM B;  2KG7 B;  1OCO B;  3RYF A;  1F4N A;  2BSK A;  1Q6H A;  4BW5 A;  3JD2 A;  4LF5 B;  3I5D A;  3ABL B;  4JI6 B;  3ABK C;  3QO7 A;  4BWA A;  3FAV B;  4LH7 A;  5LGN A;  1Q6I A;  3L75 H;  1VQM V;  4LR3 A;  3DC6 A;  5LHH A;  1QVG U;  2LP7 A;  1IDS A;  3E83 A;  4JYC A;  1HNW O;  5KHG A;  1R3J C;  4X20 A;  3JAS A;  1VQ6 V;  4K0K B;  4ZIB A;  1W2B U;  1H2L A;  1VQ5 V;  1GM7 A;  3SYA A;  3IJ4 A;  3E22 B;  1AJQ A;  3GVM A;  4YIP A;  2EIK C;  3K5O A;  4DR4 B;  4FLY A;  4NXM O;  3B09 A;  4IHJ B;  2F95 B;  3BEH A;  4IGG A;  3X2Q C;  1RM1 C;  3K79 A;  3OMN B;  1XMO B;  2PUS A;  1G6U A;  4DUZ B;  2LW1 A;  2CE4 A;  3ZHU A;  2CTR A;  2KG7 A;  4JZG A;  3TXQ A;  1P84 F;  4MW3 A;  3M99 B;  1DK1 A;  3FAV A;  3CRM A;  2OCC B;  1DLB A;  1R6T A;  2F93 B;  2GTS A;  4IL6 Z;  4DR7 B;  3K9S A;  2JDI G;  4CC5 A;  3FB6 C;  3OR7 C;  5CA1 A;  1FJG O;  2NNU A;  2WWW A;  1FPO A;  4YY3 O;  2DQ0 A;  1JX9 A;  2W6I G;  3OT7 A;  4WFE A;  3BAA A;  3E22 A;  4FM1 A;  1MSD A;  2IH1 C;  1F7Y A;  3CRC A;  4DV4 O;  1MZE A;  2ZE6 A;  4DV6 B;  2VWJ A;  4DV0 O;  1PNL A;  3GWK C;  3MDS A;  3CCL V;  3T1Y B;  3ZN1 A;  4DUY O;  1QLE B;  4UVA A;  4WCE V;  2K9P A;  1US6 A;  1I7F A;  1K4C C;  5CBF A;  3BHP A;  3J81 N;  3FB5 C;  1YXB A;  1P49 A;  1NBM G;  3JAR A;  3K0D A;  2AHZ A;  3ZJZ A;  3H1J H;  2YID A;  5K1X A;  5LMU O;  1N0N A;  4LF8 O;  3ZMS A;  3SJB C;  1W0K G;  4DR5 B;  2OIE A;  2OCH A;  2Q68 A;  3DGE A;  4PJ0 Z;  4PI2 A;  3O9O A;  3ML0 A;  1IBK B;  3AK1 A;  3M7M X;  4YHH B;  1NR7 A;  2XOK G;  1H2S B;  4FPP A;  4X66 B;  2CUG A;  4UB6 Z;  5JH7 A;  3CP1 A;  3HKC A;  1KKC A;  4JAV A;  1IZ3 A;  2HR3 A;  3HKD B;  4X64 B;  3UKM A;  3LSS A;  2A9H A;  1QLE C;  1LNQ A;  1MZF A;  2Y48 A;  1DF5 A;  4XDK A;  2AGA A;  4JTD B;  3G80 A;  2PY5 A;  1IBL O;  3G71 V;  2ARH A;  2QM4 A;  4LBE C;  1S77 D;  2QM7 A;  4AQY O;  3UQ8 A;  3Q4H A;  1XHZ A;  5B1B C;  4JV5 O;  2ZNJ A;  1HNZ O;  1GRJ A;  4I55 A;  3CC7 V;  4B3T B;  2GHY A;  3AG2 C;  5LOV B;  2IM9 A;  2P06 A;  3AEI A;  1GM8 A;  4KXR A;  4UFZ A;  4GKK O;  5B66 Z;  1SQQ H;  5B5E Z;  1JFF B;  2IBZ H;  2DW4 A;  4JI0 O;  4D7S A;  4DV2 O;  1S0V A;  4X65 O;  2UUC O;  1WNS A;  1N32 O;  5H5N A;  2ZT9 B;  1HW7 A;  3UM7 A;  1IVS A;  1N33 O;  4J42 A;  4QNH B;  1IX9 A;  2E5L B;  2UXC B;  1K5Q A;  2F4V B;  3OGI B;  4YXW G;  4LF7 O;  1AB3 A;  1H2K A;  1HP8 A;  2EZP A;  5C8Y B;  2FL4 A;  3FKS G;  1E1R G;  3VQW A;  2IJH A;  3WB1 A;  2PGG A;  3K06 A;  3HKD A;  3JAT A;  3OMA B;  1N34 B;  4KL1 A;  4MVO A;  2XND G;  4D6T H;  2FTK A;  3ABT A;  4MTO A;  3MHH C;  4H37 A;  1S72 V;  1BZK A;  1XQ8 A;  1KU9 A;  1OCR B;  1Y76 B;  2IU0 A;  5IWA O;  1E1Q G;  2F43 G;  1K5S A;  4DV7 B;  2AHY A;  5A9G A;  4I9Q A;  4I50 A;  2YC0 A;  4FM2 A;  2ZCE A;  4K3A A;  3CB2 A;  4B7E A;  2XAF A;  1J95 A;  3T1H O;  4PDL A;  3JAW A;  4JI5 O;  2ZXW B;  5BZB A;  1NH2 B;  5DM6 V;  1ORQ C;  1GAX A;  1PD3 A;  1NZ6 A;  2HP8 A;  3AG1 B;  1PNM A;  2EIM B;  5EC1 C;  4RWU A;  1NS1 A;  4B3S B;  4B7K A;  4TQF A;  4WFF A;  2EBO A;  1KUQ A;  4TT3 G;  1EFR G;  3U10 A;  2IJI A;  2P7T C;  3LDD A;  2QKC A;  4F6R B;  3S3X A;  1HDJ A;  1CPY A;  4UCR A;  2UUA O;  1I94 O;  4RAI A;  3OEH G;  1R3I C;  1YCI A;  3LNN A;  2Q69 A;  1R6K A;  1EM1 A;  1PM9 A;  4WFA V;  4BW9 A;  1KB9 F;  4FLZ A;  3ZS8 C;  2EJ7 A;  3K58 A;  1N0J A;  4PEL A;  2ADQ B;  2JS3 A;  1Q90 D;  3OE7 G;  1MAB G;  3SYO A;  1KP2 A;  5EK0 A;  4ICG A;  3IGA C;  4TOI A;  3MHS C;  1IUR A;  1K34 A;  4Q6G A;  4R7C A;  2PF4 E;  1I5X A;  1J5E O;  4MVR A;  4TQD A;  4JF3 A;  1T5E A;  1VAR A;  3RYH B;  1Q82 W;  1GN3 A;  4P9O A;  2UXX A;  3BVO A;  1NJI W;  5LA6 A;  5DEC A;  4HAM A;  3JCZ A;  4DRX B;  3J80 N;  2UUB B;  1YJN V;  4UUJ C;  2R72 A;  3L9D A;  4X62 B;  4W4L A;  3LSU A;  5J2U A;  3WG7 C;  3ZMT A;  1F23 A;  3EXA A;  3J7A U;  4OPA A;  4PA4 A;  2OYQ A;  1K9M W;  4WBN B;  1BS3 A;  2QSA A;  2IJJ A;  3RN4 A;  4Q20 A;  1YZB A;  3E35 A;  1PPJ H;  3SR2 C;  1BHB A;  1Q81 W;  1N4C A;  1QU7 A;  1FAF A;  2A06 H;  3CC4 V;  1LR1 A;  1XMQ B;  2HHH B;  4C7U A;  1VQP V;  2DOS A;  1KMI Z;  4J7K A;  5LHI A;  5IYZ B;  1YIT V;  4R8C A;  4LF4 O;  1P7G A;  1YF2 A;  1WB7 A;  3ZHQ A;  4CH3 A;  5KMG B;  5LMN O;  1YIJ V;  2Y0P A;  1IBM O;  2ZKO A;  2NR5 A;  2LW7 A;  1ZUQ A;  1WP8 A;  4PDM A;  4JI7 B;  3L70 H;  4GLX A;  3P3P A;  1NTK H;  3BFR A;  4G27 B;  1D5N A;  2QA4 V;  1K4D C;  4LFB O;  3CPW U;  3SJC C;  1S5J A;  3E86 A;  4W4K A;  4TV8 B;  3QG5 A;  1M5I A;  4RO2 A;  5K1P A;  1V54 C;  2QEX V;  4JI1 B;  4LCU C;  2P22 C;  2E3C A;  3K03 A;  5LYJ A;  4CS4 A;  2HVJ C;  3AG7 A;  4PD4 F;  3HKE B;  4EB6 B;  3PJS K;  1HNX B;  2ODM A;  5GON B;  2P4V A;  4QE9 A;  1ZX3 A;  4FLT A;  3TGU H;  5KMG A;  1WPX A;  3I55 V;  4DR2 B;  4DV1 B;  1U97 A;  1E79 G;  4L8J A;  1D2D A;  4DR5 O;  3ZMU A;  2YS8 A;  3E8F A;  4B3R B;  2HJD A;  3C3T A;  3RYC B;  4JI4 B;  1GM9 A;  3AG3 B;  2W0X A;  4UCO A;  5LBQ A;  2JS5 A;  4FIP C;  4LWS B;  4GX0 A;  3BY6 A;  1KC8 W;  2BSK B;  3SPI A;  4X1I A;  4DR6 O;  2QKA A;  3MAQ A;  2ETN A;  4LF9 B;  4PI0 A;  4LC1 A;  1VEW A;  2QWO B;  5KHJ A;  3A0H Z;  3ABK B;  2VQE O;  3IAY A;  1SRY A;  3H01 A;  4DXW A;  2L35 A;  1OJH A;  1THZ A;  2GSM B;  4EB6 A;  3ZRX A;  4JAA A;  2Y69 B;  3CHX A;  3KG2 A;  3JCU Z;  4LF6 B;  1XBL A;  2A79 B;  4DO2 A;  5CBH A;  4FFK A;  4NTY A;  2Q5Z A;  5B1A C;  2QWN B;  4N23 A;  5FPO A;  4BR6 A;  3UO2 A;  1AIL A;  2IJK A;  5KAI Z;  3VQX A;  1SZT A;  2EIK B;  1AR4 A;  2AXT Z;  2WA4 A;  4HBN A;  1SC5 B;  4QGP A;  2E76 B;  2QKS A;  1PP9 H;  2RCV A;  3X2Q B;  2ATK C;  3U0Z A;  1RM1 B;  2Q67 A;  1XIL A;  4Z1M G;  2EIN B;  2E5L O;  2UXC O;  4JYA B;  1BGY H;  4LWS A;  4UV8 A;  5L3B A;  1I0H A;  1RP3 B;  3CRQ A;  3ZIA G;  4UCT A;  2Z0A A;  5FPR A;  1DGS A;  3SJQ C;  3SPJ A;  2YI8 A;  2QWQ B;  4DR1 O;  3GB7 C;  4TUY B;  4DK0 A;  5C93 A;  2BTO A;  5DED A;  1YEW A;  3IFX A;  1ROP A;  4A5U B;  1YJ9 V;  1L8D A;  2Y69 C;  2V1D A;  1FXK C;  1OHH G;  4F4L A;  1FXK A;  3KCX A;  4JI2 B;  5KA5 A;  5CA1 B;  5JCO C;  3ZRV A;  1QBZ A;  4QPK A;  5JCO A;  4N21 A;  2UXD O;  3L72 H;  3VQY A;  1GN2 A;  2QM8 A;  4U3J B;  1R6N A;  3C90 A;  3N2K A;  3W7X A;  4E2L A;  1OCZ C;  2R9I A;  4FK5 C;  3K5M A;  2QJ1 A;  2WLH A;  1JOY A;  3CXH F;  3RWR D;  2EIN C;  1B04 A;  2B1I A;  1DTO A;  4O4L B;  2H8P C;  4GKJ B;  4GYC B;  5L3D A;  5H9C A;  1R3L C;  4MVU A;  1DF4 A;  2B1G A;  2QR4 A;  2A7W A;  3A8T A;  1QR9 A;  1SER A;  2ZIN A;  1YVW A;  1TVK A;  4TUY A;  2VQF O;  3CCM V;  2HKO A;  3JAR B;  3FFQ A;  3B8N A;  1L0L H;  2QTS A;  4J7Z A;  3CX5 F;  1YHQ V;  3OTO B;  1SQV H;  2ZM6 O;  1PKX A;  5JH7 B;  4FZ1 A;  4KHP O;  1NH2 D;  5CBG A;  4U3J A;  2KSD A;  4NXN O;  3HKC B;  1V9P A;  2JGD A;  1FFX B;  2QTO A;  3QO5 A;  1QR8 A;  2YUA A;  3B2E E;  4PDR A;  4O4L A;  2UXB B;  2DQ3 A;  3KCY A;  4JPR A;  3SYP A;  4FFB A;  4ABM A;  2Y4T A;  4ASU G;  1Q3E A;  3W7T A;  1UFI A;  2YIB A;  4RUF A;  1UPG A;  1PL0 A;  4OX9 B;  1VF6 C;  4DV3 O;  4NKG B;  4LH6 A;  3A2F A;  3Q4H B;  3W7S A;  5JJE B;  3E8H A;  3K3W A;  5B1B B;  4ZI7 A;  5H6R A;  1WJZ A;  4I55 B;  3K04 A;  4LFC O;  3TCU A;  3AG2 B;  3H9V A;  3ASN C;  4K8Z A;  2VRZ A;  5A2Q N;  1N8R W;  1GMG A;  1W0J G;  2GDS A;  1TUB B;  2PZS A;  2WLL A;  4O4H A;  4B3M B;  3OMI B;  2IU3 A;  1BSM A;  1NTM H;  3FYI B;  1RSO B;  5ITZ B;  3FB7 C;  4DV5 O;  4CS3 A;  3OW2 U;  1VQO V;  4PDV A;  3WFV A;  1M56 C;  2DE0 X;  5IJ9 A;  2H94 A;  1FFX A;  3JAT B;  1AI4 A;  5E1A C;  2QWR B;  1HR0 B;  1M4U A;  4CBC A;  2E74 B;  4DR3 B;  1CXZ B;  1VQL V;  4DW0 A;  2W6J G;  2C2A A;  3H1H H;  5KUK A;  2XTA A;  1U96 A;  2JVD A;  4GX1 A;  4I5S A;  3E2E A;  3RVZ A;  1B3Q A;  1K97 A;  1XDC A;  4I50 B;  2AW9 A;  3JAW B;  5JVD A;  1VQ8 V;  4LFA B;  3K9A A;  5HFM A;  1RPO A;  3SPG A;  1VF5 B;  3BCC H;  1S76 D;  3TXS A;  2BTQ A;  2CDY A;  3K08 A;  4D7T A;  3AG4 B;  1K33 A;  1RPR A;  2P67 A;  2OWO A;  3CRA A;  3VQV A;  1TUB A;  4JI8 B;  3RYI B;  4J7J A;  4TV9 A;  2LFR A;  2O57 A;  1VQN V;  4F6E A;  1RSO A;  4B08 A;  5ITZ A;  4O2B A;  2QDO A;  4JZ2 A;  4KUM A;  4H33 A;  1NVP B;  1XNQ O;  1N36 B;  2DYR C;  3HKB B;  1IXM A;  2XAS A;  2EUL A;  2HFE C;  2UXN A;  4OGQ B;  2ADP A;  2VWK A;  1VQ4 V;  2YEV B;  4UCS A;  1D5A A;  3STL C;  2UU9 O;  1X4T A;  4QE7 A;  1BQ0 A;  5LL6 Y;  1NI8 A;  1BT8 A;  3DC5 A;  2YSU B;  1UJW B;  1YTF B;  2PYJ A;  3AK2 A;  4FZ0 A;  3APQ A;  1Y4M A;  1H2N A;  1V55 C;  2QGN A;  4ZHQ B;  1AJN A;  2WA3 A;  3AG4 C;  5IY5 C;  1HNW B;  2XAG A;  5LA6 B;  1R73 A;  1MOF A;  1XNR O;  5J2T B;  4OXS A;  5EBW C;  3RYI A;  3ZHS A;  4QJF B;  3SPH A;  4RUE A;  5J2U B;  1M9N A;  3ZRS A;  1BMF G;  3WG7 B;  2CH7 B;  2KB1 A;  2Q0O C;  1SA0 B;  4H44 B;  4Z1V A;  1WLE A;  2DJV A;  4NXM B;  2Q6A A;  3HKB A;  4XDL A;  4UXN A;  1ZLZ A;  5B3S C;  4LF5 O;  3G67 A;  2NN4 A;  3H1K H;  3U11 A;  1GO3 F;  3E89 A;  5H2F Z;  1M90 W;  4JI6 O;  2ZD9 A;  1ZAU A;  3P32 A;  3JAM N;  2YEV A;  3ASO C;  2Q9L A;  1YJW V;  2PI4 A;  1PL4 A;  3UO3 A;  2N05 A;  2B5U A;  2CTP A;  4MT8 A;  4EFE A;  4X89 A;  1HWY A;  5GW7 A;  3ZN0 A;  3ZX6 A;  4X1K A;  3CJH B;  4K0K O;  2HJF C;  1AVM A;  1TA8 A;  2E75 B;  2Z5U A;  3B8M A;  4J10 A;  3RW0 A;  5KA6 A;  4ZHQ A;  1X59 A;  3ETQ A;  2FYU H;  2EIL C;  4CH4 A;  1GK9 A;  3R66 A;  1VMG A;  3ZMZ A;  5J2T A;  4DR4 O;  1WPB A;  3MD0 A;  1Y6X A;  1FJG B;  3T4D A;  2P90 A;  4ZBM A;  3S3W A;  5LXT A;  4YY3 B;  3A0B Z;  4TWK A;  1V54 B;  1YI2 V;  1XMO O;  1MA1 A;  2JEX A;  3T4Z A;  3EHB B;  3JSL A;  5LYJ B;  2CH7 A;  4DUZ O;  5IJ0 B;  5KHH A;  2GTA A;  1JPX A;  1Q8I A;  1NQT A;  2LJ2 A;  1R3K C;  1SA0 A;  2CAZ C;  2JK5 C;  4GX5 A;  4DV4 B;  3E8B A;  4JYY A;  1GKF A;  5CB4 B;  4FMT A;  5KHI A;  2V4D A;  4UCV A;  1QQC A;  3CC2 V;  3OM3 B;  2OIG A;  4YJ3 A;  3ZHR A;  3A0R A;  2N74 A;  3ZRW A;  4WFB V;  2WLJ A;  1FS0 G;  2RN9 A;  4DR7 O;  1P7B A;  2LQT A;  5IYC O;  2P5O A;  1S3J A;  4DK1 A;  3CJH A;  4MTG A;  2R70 A;  4AIL C;  4AI8 A;  2OTJ V;  5LMU B;  4UVB A;  2F66 C;  4X8A A;  3CMA V;  4MS2 A;  4X1I B;  1MG1 A;  3THO A;  2ZIM A;  1FD9 A;  2P4K A;  3ABM C;  4JAU A;  2WLK A;  4DV6 O;  1ARO P;  3T1Y O;  2WLN A;  5IJ0 A;  1Z2G A;  2JRI A;  2ZR2 A;  2RQ6 A;  2ZE7 A;  2YIB D;  2Y0I A;  3K57 A;  1NT2 B;  1SF9 A;  2XAH A;  5CB4 A;  2YXH A;  1XL4 A;  1SET A;  4DW1 A;  4J80 A;  5B1A B;  3ZCC A;  2ITD C;  2KKW A;  4NTX A;  1IBL B;  1FYJ A;  3LSQ A;  3CRR A;  1Q5O A;  4QPJ A;  5EIB C;  4TSF G;  2Y4U A;  1BQZ A;  1S5L Z;  4BIO A;  4AQY B;  2YIA A;  5KX5 A;  5EBL C;  1SZX A;  2WLI A;  4PHZ A;  3LUT B;  4JV5 B;  1HNZ B;  3CEI A;  4J41 A;  1KP3 A;  1IBK O;  4U7N A;  4YHH O;  1Q43 A;  3OUF A;  4NYK A;  3JAK A;  3EVK A;  5D5Q A;  4X66 O;  3G4S V;  1K7D A;  4I7Z B;  4GKK B;  5L3C A;  1BL8 A;  4KP4 A;  2A3Q A;  4JI0 B;  4DV2 B;  2FB5 A;  4X65 B;  2UUC B;  3O65 A;  1K8A W;  1H38 A;  1N32 B;  2LFS A;  1H8H G;  4X64 O;  1N33 B;  3BRC A;  3UT5 A;  1GN6 A;  1MSW D;  1NU1 H;  1Z5W A;  1WP7 A;  1OCC C;  1AI7 A;  3F7V C;  4O4J B;  4LF7 B;  3H1L H;  1FXK B;  3F5T A;  3JAL A;  3OTF A;  1CP9 A;  3DTU B;  1ZSP A;  5FNV B;  3HR0 A;  5L3E A;  1QCE A;  4B3T O;  1XEQ A;  2JGU A;  4NR1 A;  4UV9 A;  4BAY A;  4GUN A;  3CCE V;  1BHA A;  2KQX A;  3N2K B;  5JWP A;  1KKD A;  3SYC A;  4YJ2 B;  2B9Z A;  1OCZ B;  3T1H B;  3ZHT A;  4JI5 B;  1L0N H;  1SES A;  2XAJ A;  1VQK V;  2DYS C;  2ZIO A;  3B4S A;  3APO A;  2F4V O;  2FKX A;  2EIJ C;  5BR8 B;  3ABU A;  2BOC C;  4HNA A;  4GCZ A;  3ETE A;  5KUM A;  3KZI Z;  1N34 O; 
#chains in the Genus database with same CATH homology
 2ZXW B;  4PA3 A;  1K92 A;  5B1B B;  4RQF A;  2OT5 A;  5H6R A;  5BZB A;  1NH2 B;  5DM6 V;  2JJ1 G;  1ORQ C;  1PD3 A;  3K04 A;  2ZR3 A;  3TCU A;  3AG1 B;  1OCC B;  3I56 V;  3AG2 B;  1PNM A;  4G2K A;  3ASN C;  2EIM B;  4MVZ A;  1K73 W;  4JTC B;  5EC1 C;  3K0G A;  3VBB A;  1N8R W;  1GMG A;  1W0J G;  2DWE C;  4GT1 A;  4WFF A;  3T2M A;  2WLL A;  4EKW A;  1QLN A;  2EBO A;  4I9W A;  3OMI B;  2IU3 A;  2ITC C;  4MW8 A;  3B77 A;  4TT3 G;  1AJP A;  1XL6 A;  3FYI B;  1EFR G;  3JD4 A;  2IJI A;  2P7T C;  5IYD O;  3FB7 C;  3LDD A;  4KFM A;  1CPY A;  3W7U A;  3OW2 U;  1VQO V;  4PDV A;  4RAI A;  1QVF U;  3OEH G;  1M56 C;  5B1N A;  3WFV A;  1R3I C;  1JQ0 A;  2H94 A;  4FJC C;  2Q69 A;  1AI4 A;  1R6K A;  4MSW C;  5E1A C;  3OUS A;  3OR6 C;  4CBC A;  4WFA V;  5J9P C;  3CME V;  1VQL V;  2W6J G;  3CD6 V;  5CMU A;  2C2A A;  2W0F C;  4PEL A;  2DYS B;  4WF9 V;  5KUK A;  4J9Z B;  4JTA B;  3SPC A;  2JIZ G;  4HYO A;  4XDJ A;  1I5Y A;  3OE7 G;  1MAB G;  4GX1 A;  4I5S A;  1OZ0 A;  2EIJ B;  1KP2 A;  3OFN G;  4MTF A;  3SYO A;  5EK0 A;  3E2E A;  1Y66 A;  2HVK C;  3RVZ A;  3IGA C;  1NVP D;  1K97 A;  3MHS C;  1CEZ A;  1K34 A;  1ENV A;  4R7C A;  4PA9 A;  1VQ8 V;  3CCS V;  1AI6 A;  2ZDI C;  2WAM A;  1I5X A;  3K9A A;  5HFM A;  1RPO A;  4MVR A;  3SPG A;  1VQ7 V;  2ZDI A;  1S76 D;  4JF3 A;  4UVC A;  5CA3 A;  1Q82 W;  2HG5 C;  3K08 A;  2XAQ A;  4P9O A;  1OCO C;  2UXX A;  2X6A A;  3AG4 B;  1K33 A;  1NJI W;  2WLM A;  1RPR A;  2P67 A;  4HAM A;  3ASN B;  3HB3 B;  4U7O A;  3SYQ A;  3JCZ A;  1YJN V;  3ETG A;  5CN0 A;  1S5H C;  3ABL C;  4UUJ C;  2WLL B;  1GTO A;  1YTF D;  2LFR A;  3WG7 C;  3ZMT A;  1VQN V;  1F23 A;  1FXH A;  1L1F A;  3NXS A;  1F51 A;  4PA4 A;  5LHG A;  1K9M W;  4PA6 A;  5LGU A;  4KUM A;  4H33 A;  1NVP B;  4WFG A;  1KEC A;  2JEU A;  2DYR C;  3F7Y C;  2IJJ A;  3QNE A;  4P9P A;  4Q20 A;  4XBF A;  1IXM A;  2XAS A;  3E35 A;  1BHB A;  4GX2 A;  1M56 B;  1Q81 W;  4JYB A;  2HFE C;  2JJ2 G;  2UXN A;  3CC4 V;  3IC7 A;  1AI5 A;  1VQ4 V;  3CXC U;  1VQP V;  4G28 B;  5IDJ A;  5LHI A;  3JD3 A;  1NKD A;  2YEV B;  3STL C;  3FB8 C;  3OGC C;  1YIT V;  2EZO A;  4R8C A;  1YIJ V;  3JD0 A;  4QE7 A;  3OEE G;  4PA7 A;  5IYB O;  5EBM C;  2YSU B;  4MVS A;  4JAS A;  1YSC A;  4PDM A;  1UJW B;  1YTF B;  2PI5 A;  3AG3 C;  1Y4M A;  1V55 C;  1KQS U;  3D36 A;  4MTX A;  4G27 B;  4HZ3 A;  1H2G A;  1AJN A;  3AG4 C;  2QA4 V;  1K4D C;  2OTL V;  2DWD C;  3LNM B;  3CPW U;  3E86 A;  5IY5 C;  3W7W A;  1OCO B;  1F4N A;  2XAG A;  1R73 A;  1MOF A;  4RO2 A;  4OXS A;  4BW5 A;  3JD2 A;  5EBW C;  1V54 C;  4QJF B;  3ABL B;  2QEX V;  3SPH A;  4RUE A;  4LCU C;  3ABK C;  3QO7 A;  4WFH A;  1M9N A;  3K03 A;  2OCC C;  3D3I A;  3ZRS A;  1BMF G;  3WG7 B;  5LGN A;  2HVJ C;  1VQM V;  2KB1 A;  5LHH A;  4CZZ A;  1QVG U;  1G8M A;  2LP7 A;  3E83 A;  4JYC A;  3PJS K;  3T1C A;  1R3J C;  1WLE A;  2A0L A;  4L87 A;  2Q6A A;  4XDL A;  4UXN A;  2DYR B;  1VQ6 V;  5B3S C;  1W2B U;  1GO3 F;  3E89 A;  1M90 W;  1VQ5 V;  4QE9 A;  1GM7 A;  4ZKI A;  2ZD9 A;  3SYA A;  3EFF K;  3P32 A;  2YEV A;  3ASO C;  1YJW V;  2V7Q G;  1AJQ A;  2PI4 A;  1WPX A;  3I55 V;  3CYO A;  2B5U A;  4MT8 A;  4R6Z A;  2EIK C;  4X89 A;  1HWY A;  1E79 G;  5GW7 A;  3ZN0 A;  3ZMU A;  3E8F A;  3BEH A;  2HJF C;  3X2Q C;  1RM1 C;  2K1E A;  3K79 A;  3OMN B;  3RBZ A;  1GM9 A;  2ZQM A;  2Z5U A;  3B8M A;  5EC2 C;  3RW0 A;  5KA6 A;  3AG3 B;  5LBQ A;  1V55 B;  2X0L A;  2X6B A;  2EIL C;  1JVM A;  5LGT A;  4FIP C;  1GK9 A;  4GX0 A;  2HLD G;  3BY6 A;  3ZMZ A;  3SPI A;  1KC8 W;  1FXV A;  5IY5 B;  1JJ2 U;  3MD0 A;  4MW3 A;  3T4D A;  2P90 A;  4ZBM A;  3M99 B;  4P2Z A;  4LC1 A;  4TWK A;  1V54 B;  1YI2 V;  3ABK B;  2JEX A;  3T4Z A;  3EHB B;  2OCC B;  1DLB A;  1SRY A;  1EZJ A;  2MK3 A;  3F5W C;  1Q7Y W;  3H01 A;  4DXW A;  1FFT B;  5DN6 G;  1G4Y B;  1THZ A;  1JPX A;  2GSM B;  1NQT A;  1R3K C;  3ZRX A;  3GWO A;  2JDI G;  2Y69 B;  3KG2 A;  2JK5 C;  4GX5 A;  3CCQ V;  2BOB C;  3E8B A;  1GKF A;  3FB6 C;  2A79 B;  3OR7 C;  4DO2 A;  5CBH A;  2NNU A;  2WWW A;  3FYE B;  4FMT A;  5B3S B;  4JGS A;  2DQ0 A;  1JX9 A;  2W6I G;  1Q86 W;  5B1A C;  3G6E V;  4WFE A;  2QE7 G;  3CC2 V;  4N23 A;  3OM3 B;  3ASO B;  3A0R A;  3ZRW A;  4MVQ A;  4WFB V;  2WLJ A;  1FS0 G;  2IH1 C;  1P7B A;  4P30 A;  2IJK A;  5IYC O;  1SZT A;  2EIK B;  1EBO A;  1M57 B;  3JYC A;  1S3J A;  2IH3 C;  3HPL C;  2QKS A;  4MTG A;  3X2Q B;  2ATK C;  1RM1 B;  1KD1 W;  2Q67 A;  1PNL A;  3CCL V;  4Z1M G;  3ZN1 A;  5FL7 G;  2EIN B;  1QLE B;  4UVA A;  2OTJ V;  2EIL B;  4UV8 A;  4J9Y B;  2EJR A;  4UVB A;  4WCE V;  5L3B A;  4X8A A;  3CMA V;  4MS2 A;  1MG1 A;  2IW5 A;  1P4R A;  1K4C C;  5CBF A;  3ZIA G;  3ABM C;  3SJQ C;  3FB5 C;  3SPJ A;  4JAU A;  2WLK A;  1AR1 B;  1ARO P;  3GB7 C;  3TET A;  5C93 A;  5H6Q A;  2CK3 G;  1NBM G;  3K0D A;  3IFX A;  2AHZ A;  1ROP A;  3STZ C;  2WLN A;  1YJ9 V;  3ZJZ A;  2Y69 C;  2V1D A;  1FXK C;  1OHH G;  3ZMS A;  4F4L A;  1W0K G;  2ZR2 A;  1FXK A;  2Q68 A;  5KA5 A;  3DGE A;  2X6C A;  5L3G A;  4MVM A;  2XAH A;  3ZRV A;  3CCJ V;  1QBZ A;  1XL4 A;  3ML0 A;  4QPK A;  1SET A;  4N21 A;  3CCV V;  1M1K W;  1NR7 A;  2XOK G;  3LDE A;  4FPP A;  5B1A B;  4QIW F;  3ZCC A;  2ITD C;  3ZRW B;  2QM8 A;  3CP1 A;  2R9R B;  1H8E G;  3LSQ A;  1M57 C;  2NLJ C;  4QPJ A;  3ETD A;  1R6N A;  4R50 A;  4TSF G;  2D3O W;  3W7X A;  3TK1 A;  4BIZ A;  3CCR V;  4E2L A;  1OCZ C;  2R9I A;  4FK5 C;  2HR3 A;  4JAV A;  5EBL C;  2WLI A;  3LUT B;  2WLH A;  1JOY A;  3UKM A;  3QO8 A;  1KP3 A;  3LSS A;  3ZMV A;  2EIN C;  2A9H A;  2B1I A;  4U7N A;  1DTO A;  1QLE C;  3OUF A;  1ZWI C;  1LNQ A;  2H8P C;  2Y48 A;  1OCR C;  1DF5 A;  4XDK A;  4JTD B;  5L3D A;  5H9C A;  1K7D A;  3R65 A;  1R3L C;  4MVU A;  3G4S V;  1DF4 A;  3G71 V;  2B1G A;  5L3C A;  1BL8 A;  4KP4 A;  4LBE C;  1S77 D;  2QM7 A;  1COW G;  1QR9 A;  2X7R B;  1K8A W;  1H38 A;  5L3F A;  1SER A;  2LFS A;  1H8H G;  2ZXW C;  4LP8 A;  5B1B C;  3ABM B;  5HFL A;  4BIU A;  1MSW D;  1F4M A;  3CCM V;  2HKO A;  3CC7 V;  3AG1 C;  2GHY A;  1OCC C;  3B8N A;  1AI7 A;  3AG2 C;  3F7V C;  3P30 A;  2P6J A;  2EIM C;  1PNK A;  3AEI A;  1GM8 A;  2WSS G;  1FXK B;  2DW4 A;  1S0V A;  5B1O A;  1YHQ V;  1CP9 A;  3DTU B;  3UM7 A;  1K3E A;  5L3E A;  4QNH B;  1QCE A;  1PKX A;  1K5Q A;  3LDC A;  1NH2 D;  4YXW G;  4UV9 A;  5CBG A;  4BAY A;  4RQE A;  2EZP A;  2WPD G;  3CCE V;  1B6Q A;  3FKS G;  1BHA A;  1E1R G;  1KKD A;  3SYC A;  2IJH A;  4X88 A;  3VOU A;  1JCH A;  3K06 A;  2WLI B;  2QTO A;  3OMA B;  1OCZ B;  3QO5 A;  1QR8 A;  4MVO A;  2XND G;  2FTK A;  3ABT A;  1SES A;  3OAA G;  4MTO A;  3MHH C;  4PDR A;  2DQ3 A;  4JPR A;  3SYP A;  3CCU V;  2XAJ A;  1VQK V;  4H37 A;  1S72 V;  2DYS C;  3K3W A;  4ASU G;  3W7T A;  3E8G A;  1OCR B;  4RUF A;  2Z3Y A;  2IU0 A;  1TUE B;  1E1Q G;  1PL0 A;  2EIJ C;  2F43 G;  1K5S A;  3ABU A;  2BOC C;  2AHY A;  4GCZ A;  3ETE A;  2M7W A;  5KUM A;  3JD1 A;  1VQ9 V;  2XAF A;  3RVY A;  1J95 A;  4PDL A;  3W7S A;  1NR1 A;  3E8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...