5KA6A

Hiv-1 gp41 variant q552r and l555m resistance mutations
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
83
structure length
79
Chain Sequence
MQLLSGIVQQRNNMLRAIEAQQHLLQLTVWGIKQLQARILGGHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transmembrane protein gp41
publication title Receptor Activation of HIV-1 Env Leads to Asymmetric Exposure of the gp41 Trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Membrane protein
total genus 35
structure length 79
sequence length 83
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ka6A00
1MG1A 1MOFA 3H01A 2LP7A 5KA6A 5HFMA 4FK5C 2X7RB 4FIPC 2OT5A 4N23A 2EZPA 3B77A 5HFLA 1ENVA 5KA5A 1Y4MA 3B8MA 5CMUA 4N21A 1K33A 1F23A 1QR9A 3MHHC 1K34A 2EZOA 3M99B 1I5YA 2EBOA 4JPRA 3MHSC 2M7WA 4G2KA 5H9CA 3B8NA 1DF4A 4FJCC 4JGSA 1DF5A 1Y66A 3WFVA 1QCEA 3P30A 1SZTA 1QBZA 1EBOA 3GWOA 2MK3A 3K9AA 3CYOA 3CP1A 4E2LA 4JF3A 1JQ0A 1DLBA 1QR8A 2P6JA 1I5XA 5CN0A 1JPXA
chains in the Genus database with same CATH superfamily
3ML0A 3SPCA 4GX5A 2Q7HA 1OZ0A 1LR1A 2VQFO 1IBMO 1VQ9V 2CK3G 4YJ2A 1J5EO 3KCXA 2JDIG 2QE7G 2Y4TA 5AG2A 4I0XA 1M90W 3SYOA 2IH1C 4JI5O 4K8ZA 2P4VA 2QM4A 1TVKA 2P90A 2UXNA 3Q4HB 4DRXB 1XMOB 1SERA 3ABUA 3D8CA 4DK0A 1K5QA 3LSQA 4FFBB 4DV1B 3CE2A 5LP6A 1SQXH 3AG4B 2EIKB 3UQ8A 2A3QA 4DK1A 3AG3B 2UU9B 2YXHA 2QWNB 2UXXA 1RM1C 1WAZA 2UXCB 3CCLV 1CP9A 1Q8IA 4IT5A 3B77A 2ZE7A 3F7VC 3CCSV 2ZR2A 2YICA 5HFLA 4UCRA 1JA8A 3CCQV 2A79B 2PI5A 1SQQH 4PI0A 1SKVA 4WCEV 4WBNB 5B1BB 1GH6A 3OEEG 4D6TH 3G6EV 2UXDB 1R73A 3E8FA 2DMXA 4UB8Z 1VQ8V 2O57A 2W6JG 4MTXA 1I94O 4H13B 4LF9B 2Z5UA 2H94A 2B1GA 4R50A 3E8GA 3JD4A 1F4MA 2QM7A 1I7FA 3WB0A 1MZFA 2XAGA 5LBQA 3U0ZA 4Q6GA 4O4HB 2JEXA 3AG2C 4ICGA 1JMKC 1E1QG 3E8BA 5E79Z 4GKKB 3F7YC 4CC5A 1KP3A 2BSKB 3ZBHA 1F7YA 3RT3C 2Q7EA 3R65A 1UFIA 1M4UA 2V4DA 3L9DA 2IJKA 4X1KA 3JALA 1JVMA 4Z1VA 2VQEB 4I9QA 2ZE5A 4GCZA 5B3SC 3K9SA 4J41A 4NTXA 3JAMN 1YJ9V 3W7SA 4DR1B 1KQSU 2CTRA 2IBZH 4BWAA 3CD6V 2F4VO 4MW3A 3ICXA 1GO3F 3GWOA 1ZWIC 4HBNA 4NYKA 4X62O 3FB7C 4X1YA 1HNZO 2BTOA 2YIBD 2DWDC 3FB6C 2K1EA 1Y6XA 4AI8A 1N36O 3OUFA 2R9AA 1IX9A 3RYFA 3B8MA 1DTOA 2DQ3A 5H2FZ 5EYPA 1X59A 3ZN0A 2RNBA 1K34A 2IH3C 1G1XB 1SF9A 1QLEC 4J9ZB 4DV7O 5BR8B 2JJ2G 1S77D 3ZHRA 1H2MA 3HB3B 1S5HC 2CGOA 3OFNG 3QO5A 3A2FA 4LR3A 3QNEA 1XDCA 5IY5C 1VARA 3A0RA 3FD9A 1EN4A 2HHHO 3BPZA 3VQYA 2CDYA 2RJZA 2LW7A 3BA8A 2BCCH 5KMGA 1HR0O 2EULA 4GX0A 2MK3A 1S0VA 4U3FH 1E1RG 3OD4A 3SPGA 3VBBA 3LSUA 4FLXA 1AR4A 3ASOC 5B5EZ 1PNKA 3SDLA 1ZTEA 3CCMV 5L3GA 3TGUH 1I5YA 3AG1B 4DR4O 1VF5B 2HKOA 4OXSA 1AR5A 4BW9A 1VQPV 4LH6A 1NR1A 3L74H 3CX5F 1IXMA 3R66A 3D3IA 4PDMA 4MSWC 1BZKA 2ZDIA 2HEPA 2B5UA 4I4TA 4JAAA 5KMGB 4MVMA 2E76B 1V9PA 1RPRA 4RUEA 1P7BA 1ORQC 3K9AA 3CP1A 3STZC 2WLIA 5JJJB 4IIJB 3H01A 5EZYA 1KB9F 2GBOA 4DR3O 1GAXA 3DSQA 3JARB 1YZBA 4WFEA 4LF4B 2Q9LA 1CXZB 5C8YA 4ZIBA 5LA6B 2QGNA 1M56B 1LNQA 4KUMA 1EFRG 2LFSA 4KP4A 3RFRA 3K5OA 2E3CA 4O4LA 5FNVB 4JI3B 3FAVB 1FPOA 1JPXA 4IYHA 3PJSK 5BZBA 2ZXWB 4DUYB 4I4TB 1QU7A 4O4JA 5B1OA 4MW8A 2D2CB 1F51A 3X2QB 1XHZA 4B3MB 1WNSA 1OCZC 3FB5C 4MVZA 1FXHA 1YF2A 1AJQA 5JCOC 3K3WA 2P4KA 2ADPA 3OMNB 1PD3A 4WFAV 1Q82W 5C8YB 4CH3A 1MSDA 3BAAA 2N05A 2QEXV 2EZOA 1YCIA 2YC0A 2YIDA 2DWEC 2YXLA 4LFBB 5LMNB 4MVOA 2V1DA 1XMQB 2AHZA 1EZVH 2RMKB 3GB7C 4NXMB 5D5PA 4IHJB 1N33O 4WFBV 1JFFB 3QO8A 5CN0A 4X65B 3JCUZ 3D3QA 5JH7A 2QA4V 1XNRB 4IYIA 4B3TB 1UPGA 2R9IA 2BTQA 1YVWA 1B6QA 2E5LO 4O4JB 3MDSA 5JQGB 1QCEA 4PJ0Z 4JTCB 4X66B 3U10A 1WA8A 2P7TC 4LF5B 4DR5B 3OMAB 4JI0O 5LOVA 4DV2O 4LCUC 2IJIA 3SYAA 5EK0A 2ITDC 3RYIA 3SGIA 1GN4A 4JTAB 2YXYA 3UM7A 1JJ2U 1EN5A 3ZX6A 2Y48A 5LL6Y 3I55V 2ARHA 4MT8A 2JRIA 1RM1B 5JVDA 1TA8A 2CH7A 4H37A 1TAEA 4J10A 1N0NA 3APQA 4BIZA 5LYJA 4XDJA 5KHJA 3OTFA 3S3XA 1PM9A 4MTFA 3H1KH 1PV0A 1P7GA 5LGTA 1PKXA 3JSNA 1NH2B 2QWOB 2UU9O 1NQTA 3L73H 5LGUA 1FJGB 3OR7C 3K5MA 3AG2B 4GKJO 4WFGA 4IGGA 5LOVB 4QE7A 3SPHA 4LF8B 1CPYA 3CMAV 3RYIB 2X6BA 2CGNA 3A0HZ 2A06H 2YSUB 1YITV 4FLUA 3WFVA 4PDRA 3RYCA 4LF9O 1L0NH 1S3JA 1XQ8A 1GRJA 5JVDB 1YEWA 4CH6A 3BRCA 2EILC 4OX9B 2ZIOA 2X7RB 1FFXB 5B3SB 3OAAG 1YJNV 1OCCC 3LDCA 5LYJB 4DV5O 2DJVA 5J2UA 1QVGU 1QHTA 2ZNJA 2B1IA 4BW5A 1VQKV 1K92A 3KKYA 3G6BA 2WLHA 4JI2B 4JPRA 4PDLA 5B66Z 2Y69C 5LHGA 4FK5C 4JZGA 2EJ7A 4ZHQA 2HVKC 3ETEA 4DR1O 4J7JA 1QLEB 1VQOV 4F6RB 4HAMA 2M6YA 3RYCB 3CEIA 2DYRC 1P4RA 4JI6B 1WLEA 4O2AA 3K08A 1Z2GA 2PYLA 3SPIA 4OPHA 3JD3A 5IY5B 1N34B 3CC7V 3ZHTA 4FLWA 1SQGA 2IW5A 4LFCB 1N32O 2PI4A 2XT9A 3RVZA 3L70H 3JD0A 5E1AC 4DV6B 5H9CA 3WG7C 1AVMA 1H2GA 4PI2A 5IJ9A 4UCSA 1H2KA 1BMFG 2BOCC 1R3KC 4ZOLA 4E2LA 4FVMA 2YUAA 2PTMA 2P5OA 5IT9N 3CRCA 2GTAA 4J9YB 4QGPA 2WSSG 2W0FC 1CEZA 2FMLA 4K35A 1FYJA 3TK1A 1BL8A 1UJWB 4UFZA 4XBFA 4O2AB 2RQ6A 2C2AA 4J7KA 4AQYO 1R6NA 4RO2A 5CBFA 5L3CA 4CS4A 2WAMA 3Q4HA 4DRXA 2Q4PA 4YHHO 4WFFA 1PP9H 2QKSA 1SA0A 4RAIA 5GONA 1SQBH 4XDLA 1H8HG 4KFMA 3LSSA 4O4IA 1XUQA 1YIJV 3I5DA 3A0BZ 4LFAB 4P2ZA 1BE3H 3K0DA 5JCOA 5KA6A 5EBMC 1HWYA 3K5NA 3BABA 1MNGA 4AHCA 5CA0A 4IL6Z 4X20B 4WBNA 2ATKC 3CCVV 2H8PC 1NTZH 4X64O 2XAQA 5KUMA 1ZL8A 2P22C 4LF6O 3TXSA 4PA9A 2WLLA 4DUZO 1FKAO 3ZRSA 4LF4O 3AK2A 2V7QG 4X8AA 1T5EA 2L6LA 1Q7YW 4X9QA 4O4HA 3CCEV 4QIWF 1TUEB 3KCYA 3CS5A 3FKSG 3LNMB 1SA0B 4HNAB 2ZM6B 5GONB 3HKDA 4PA3A 1Q6IA 4MVUA 3OTOB 3EFFK 4O4IB 2BSKA 3ZN1A 1IXBA 1HDJA 4PA6A 1U97A 1H2LA 1MABG 4BAYA 4TV9A 2UUCO 5K1PA 5CA0B 1JX9A 3QO7A 4X1IA 1M1KW 1Q5OA 3EVKA 2WWWA 2EINC 3STLC 3ZHVA 1NVPD 2UXBB 3T1HO 2M7WA 3J80N 1ZL8B 1L8DA 1DF5A 2ZE8A 4JI1B 4PHZA 2QR4A 5KHKA 2WLLB 3AK3A 4P9OA 1SESA 3OEHG 3B4SA 1AJNA 3DC6A 2Y4UA 1NI8A 4QPKA 5ITZA 4KXRA 1ENVA 2EIJC 3CB2A 3WU2Z 3MHHC 3HKDB 4DR7B 3E8HA 2DE0X 2E74B 4JI4B 2IU3A 4MS2A 5BXZA 4NXMO 4K0KB 1IBKB 4X65O 3IFXA 1XNRO 2WLKA 2X6AA 4TV9B 1R3IC 4JV5B 4X1IB 1L1FA 1AP5A 1MMMA 1FXVA 5BMVB 4CH4A 4X66O 1VP7A 3JD2A 2UUBB 2P6JA 3JATB 4DR5O 2AGAA 1W2BU 5ITZB 4KHPB 4TOIA 3F5TA 3G71V 1ZAUA 1NTKH 5IWAB 1Y4MA 2LJ2A 3LDEA 3W7TA 4N21A 4GUNA 3CRRA 1OCRC 1R3LC 3FYEB 5L3FA 1DF4A 1SRYA 1SZTA 1I0HA 1BS3A 4I50B 1D2DA 3IGAC 3UKMA 2OTJV 4DO2A 1K4CC 2JJ1G 2DOSA 4NXNB 4JYAO 4K3AA 3K59A 3CCUV 4HYOA 2PGGA 3RWRD 1YHQV 1K33A 4NVPA 1IBLB 4DV0O 1XREA 4B3RB 4MTGA 3OW2U 3H9VA 1M93A 2EILB 1SQPH 2QTOA 5TISZ 1OCCB 5J2TB 5B1AC 4IIJA 1XL6A 2GUZA 2EZPA 4TQDA 3JARA 4J42A 2OYQA 1NKDA 1OCOC 3C90A 4DR2O 2IJHA 2ZIMA 1VQMV 4P30A 4FJCC 3H1IH 2JK5C 1L0LH 5LHIA 4BIUA 5LA6A 1AROP 1D5AA 2Y69B 4L87A 3RYHB 2VRZA 5A2QN 2FL4A 5BY1A 3CMEV 1I5XA 1KMIZ 5FNVA 3FAVA 1IZ3A 1IVSA 2L35A 4DV4B 3WB1A 1AI4A 3ZS8C 4UXNA 2DYRB 4X89A 3ZIAG 1FXKC 2HLDG 2YIAA 1S72V 3ABMC 1IDSA 2F95B 1WPBA 2JVDA 2KQXA 2YIBA 3CJHB 5GW7A 1O9GA 2ILMA 4CZZA 2GUZB 3JAKB 3SJCC 4DV3B 1VQ6V 2EJRA 3TCUA 2BE3A 2LFRA 4DR6O 3WG7B 3PN1A 2VQFB 3CWBH 2LGQA 2IM9A 1IBMB 2LO1A 4FM0A 1J5EB 2OCCC 1QVFU 4F4LA 4YXWG 1VF6C 2DN9A 1GKFA 1FS0G 4QJFB 5IDJA 3I56V 4IHJA 1JFFA 3N2KB 4FIPC 3JSLA 1KKDA 1HW7A 1PL4A 4DV6O 4RUFA 4CH5A 4EEQA 3CRAA 4PA4A 2KG7B 3G67A 5JQGA 1PL0A 1DGSA 1JJOA 3J81N 3GWKC 5FL7G 3UO2A 1DK1A 3OMIB 3RBZA 4GX2A 4L8JA 1AB3A 1XILA 5KHIA 1US6A 3UT5A 1BT8A 5FLXN 1K73W 3P30A 3AEIA 3LNNA 1I94B 1Q3EA 3ZHSA 1GN6A 1XNQB 4LP8A 4JAUA 4LF7O 1XBLA 2D3OW 1WPXA 2YS8A 4FFKA 1AP6A 1V54C 1WJZA 1ROPA 4JYYA 3ZMTA 4MVRA 4RQEA 4FLYA 2OCHA 2VWKA 1XEQA 1J95A 3OE7G 3FFQA 1N4CA 1VQ7V 1K4DC 4LFAO 2RCVA 3ETQA 2F1MA 2F43G 2DYSC 1Z5WA 2X0LA 3A8TA 3TJTA 1ZLZA 4LC1A 2LP7A 4TSFG 3JD1A 1GTOA 1SQFA 2PF4E 3S3WA 1G8MA 4JASA 3UT5B 1ZX3A 5LMUB 3ZMSA 3SR2C 2WLNA 3E83A 3T4ZA 2JS3A 1NJIW 4KL1A 5H6RA 3K79A 5LP6C 2F4VB 5IYCO 2HJFC 1HNZB 1XMOO 1MOFA 2YI9A 3FYIB 1Q90D 2Q0OC 4G27B 2DW4A 2H3OA 1FFXA 2EINB 4B7EA 1Q86W 1N36B 2XAFA 5KUKA 1KUQA 2IU0A 5JWPA 4DV1O 4UV8A 1SETA 2CUGA 5JJNB 1BSMA 3RN4A 2UXCO 3B40A 3JYCA 2R70A 1NU1H 5LGNA 2EIJB 1P49A 4EB6B 3BCCH 2CTQA 1Z5VA 2XNDG 2HHHB 2UXBO 2UXDO 2QWQB 4F6RA 4YY3B 2YDEA 2KB1A 1ZUQA 2YEVB 3VOUA 2Z0AA 1HNXB 1HR0B 5EIBC 4J7ZA 2ZQMA 2BOBC 5H6QA 1M5IA 4PDVA 3ZMVA 4TV8B 3UCSC 1XL4A 1P84F 4B3SB 2OIGA 4GKKO 1NZ6A 4DR7O 2FB5A 1VQLV 4JI4O 1NTMH 2P67A 1QLNA 3FB8C 4CBCA 4K0KO 2F23A 1ZSPA 1OJHA 2PZSA 1Q6UA 1X4TA 4F6EA 3ABKC 1QR8A 4O2BB 3ZHUA 3K04A 4UB6Z 4RWUA 1K7DA 2QKAA 1RSOB 2VQEO 4UCVA 2Y0PA 5KHGA 1OCRB 2NNUA 2GV9A 4JI7B 4DYLA 3B2EE 3M99B 4I7ZB 3P3PA 3W7XA 3SPJA 5L3EA 4GYCB 3NR7A 4JGSA 5IJ0B 3AG1C 1YDXA 4MVSA 5J9PC 2FYUH 2WA4A 5KLVH 4W4LA 2A0LA 2JGUA 1XI1A 4KHPO 3JASB 4PV1B 5IWAO 3ASNC 4I9WA 1MSWD 4DR3B 4J80A 2KKWA 4WFHA 2Q69A 2ZCEA 4I55A 4FLTA 4P9PA 4JI8B 2GHYA 2ZT9B 1FXKA 5BR8O 1BQZA 5KAIZ 1EN6A 1Y66A 2CTWA 3EXAA 1JCHA 2UUAB 1JQ0A 3ASOB 1OCOB 1VEWA 4FLVA 3O9OA 3G4SV 3TXQA 4JYBA 2ZKOA 4B3RO 3ZEDA 5K1XA 1WP7A 5IYZA 2WA3A 1S5LZ 4OPAA 2Q67A 3OR6C 3BFRA 2MW2B 4X20A 1VF6A 1QQCA 2XTAA 5EC1C 4UCUA 1G4YB 2ETNA 2R72A 1TUBA 1AI7A 5IE9A 4Q20A 1WN7A 4I55B 3OT7A 4RQFA 2FTKA 2ZDIC 1FXKB 5KX5B 3E22B 4HNAA 1B06A 5CA3A 3K57A 2WLJA 2QWRB 1NT2B 1N8RW 3CYOA 3P3NA 2VWJA 4UCOA 4K8XA 4H44B 3JCZA 1H2SB 2NLJC 3L72H 1Q43A 1TGOA 1PNLA 2HJDA 2N04A 3AG7A 4WF9V 4DXWA 4JYCA 5IYZB 2QM8A 1K3EA 4DW1A 3JAWB 1K5SA 4ZBMA 2HVJC 5EIBD 2QSAA 3SYQA 3MD0A 4GLXA 1TUBB 4OGQB 3LDDA 4ABMA 5HFMA 5IYDO 3CPWU 4NKGB 1BCCH 5KA5A 3LUTB 4JI0B 4DV2B 4EFEA 1U96A 1PPJH 1OCZB 2QTSA 4JI3O 3HKEA 2Q73A 4PELA 4UCTA 3CRQA 1VIBA 3C3SA 2W6IG 2K9PA 4DUYO 3IAYA 1HP8A 2F66C 3ZCCA 1NBMG 5BMVA 5KHHA 1M9NA 3KG2A 4B3MO 3HKBA 4B7KA 3T1YB 3L71H 4ZI7B 1SZXA 1YSCA 1RFYA 2AXTZ 1V54B 2Z3YA 2Q8VA 3JATA 3VQVA 4NB5A 2WLMA 3D36C 4GKJB 4YJ2B 4LH7A 1KYOF 5DM6V 4G28B 4LFBO 2Q0AA 5LMNO 3T2MA 4I0XB 2Y0IA 1XMQO 2DYSB 3HKEB 1XNQO 1TVKB 3VQWA 3QG5A 4I50A 3QTCA 4B3TO 2OT5A 5CMUA 4FMTA 4DV5B 4FM2A 1LUVA 2GDSA 3WB2A 5LP6B 3HKBB 3C3TA 2QKCA 1S5JA 2WPDG 4LF5O 1GK9A 4I5SA 3T4DA 1COWG 3N27A 5CB4A 5J2TA 5LMUO 1HNWB 2XAJA 1LUWA 2FKXA 4J11A 1URFA 3B8NA 3K0GA 1FFTB 2GTSA 4YIOA 3RVYA 2CAZC 3RYHA 1H8EG 3NXSA 3ZMUA 4NR1A 5DN6G 2N74A 1N32B 1V55C 2PYJA 1IURA 5EC2C 1FAFA 2NR5A 1M57C 5FPRA 3ABTA 2B9ZA 1FJGO 3CXHF 3SJBC 3E86A 3DXRA 4X1KB 2HFEC 3JALB 3CJHA 4D7SA 5CB4B 4LF8O 4N23A 4MVQA 3JAKA 4QPJA 3IC9A 2HG5C 3P32A 4YY3O 2ZE6A 1PNMA 2QJ1A 1VMGA 1RPOA 2Q68A 1HNXO 4D7TA 3ABLC 1KD1W 4U3JA 4X1YB 3ABKB 2KSDA 3CCRV 2CE4A 1OV9A 1R3JC 3CRMA 2YI8A 1W0KG 3E35A 3KZIZ 4CS3A 5CBGA 4OX9O 4B3SO 3APOA 4AQYB 4G2KA 3DTUB 3G80A 5GTHZ 1QNMA 3BHPA 4B08A 4FM1A 3RYFB 2XHBA 3N2KA 3VQXA 5H5NA 1GN3A 5EYPB 1NVPB 2DQ0A 3HR0A 3CXCU 4YHHB 1JR9A 1G6UA 1S76D 1VQNV 3BY6A 4NTWA 2ODMA 3FX7A 4JI2O 3DXRB 2KG7A 3ZHQA 3BA9A 5FPOA 2ZINA 3ASNB 1Q6HA 4ZKIA 4H33A 3ETDA 4JI7O 3ZMZA 2X6CA 3HPLC 5EBLC 4Z2WA 5KAFZ 3H1JH 4PA7A 1SQVH 3MHSC 3ZJZA 4U3JB 2XOKG 4JI6O 3U11A 1EBOA 4X64B 2ZNIA 2EIMC 1N34O 2QDOA 1NH2D 3CHXA 4AILC 4LF6B 4TWKA 4JI5B 3E2EA 4LFCO 5CA1A 4JI8O 4DUZB 1KC8W 1I08A 5L3BA 4NTYA 2RN9A 4U7OA 3IJ4A 4UVAA 1EM1A 1AILA 3M8AA 4UUJC 3F5WC 2UUAO 2HP8A 3OUSA 3CC2V 3OGIB 2PY5A 1R1BA 3THOA 3OM3B 5LHHA 1VQ5V 1W59A 2AZ0A 4JTDB 1JOYA 1B04A 2UUCB 3K06A 3SJAC 4U7NA 3T1HB 4FZ0A 2WLIB 1K9MW 4UV9A 4DW0A 5EZYB 1E79G 3N2GA 2JS5A 1AI6A 2LW1A 2EBOA 3AG4C 2EIKC 1NR7A 5CA1B 3BVOA 3AG3C 3TETA 2AW9A 1KKCA 4FLZA 2ADQB 2JIZG 1YTFD 4Z1MG 1R6TA 4PD4F 1F23A 5B1NA 2Q6AA 4LWSA 1VQ4V 1KU9A 2JEUA 3O65A 5B1BC 2CTPA 1FD9A 3L75H 3IC7A 4O4LB 4CS2A 3QVNA 1N0JA 5DECA 1O9HA 3RGBA 3D36A 4E4EA 1RP3B 1BQ0A 4YIPA 4EB6A 3ZRVA 2W0XA 1H2NA 2NN4A 3DGEA 2YEVA 1EZJA 1F4NA 3N2GB 4CC6A 4EFBA 4X62B 2E75B 1NS1A 1WB8A 1BHAA 1Y76A 1AR1B 4TV8A 5F2VO 2OTLV 3CSXA 3BEHA 1MZEA 2ZM6O 4LWSB 3OTOO 5C93A 2Q5ZA 1XHXA 4DV7B 2OWOA 2XASA 5DEDA 2ZD9A 1DLBA 3SYCA 5JH7B 3CCJV 1MG1A 2XAHA 3M7MX 4O2BA 1SC5B 2BTQB 4QE9A 3T1CA 1RSOA 2LGWA 1GM8A 1W0JG 4JYAB 4X88A 3ZRXA 3J7AU 4H0LB 1KP2A 5CBHA 1GN2A 2IJJA 3T1YO 3H1HH 4JI1O 4DV0B 5EBWC 2A7WA 1QBZA 1B3QA 5IJ0A 1WA8B 1D5NA 2R9RB 1Y76B 2RDCA 2ZR3A 3JASA 1YJWV 4R8CA 4UVBA 4ASUG 3HKCA 4DR2B 4LBEC 5JJEB 2Q7GA 1IBKO 3E89A 4TT3G 4DR4B 1K97A 4JF3A 4JZ2A 1AI5A 4GT1A 2CH7B 1MA1A 4JV5O 3W7UA 4MTOA 3SJQC 4YJ3A 4R6ZA 1YXBA 1BHBA 4LNUA 2P06A 2AHYA 2F93B 4BIOA 3SYPA 1KBHA 5LXTA 3QF7A 1GMGA 2UUBO 1H38A 4TUYA 4EKWA 3ETGA 1BGYH 1WB7A 2A9HA 3B09A 1YTFB 1HNWO 1V55B 3UO3A 3K5LA 4JAVA 3EHBB 5D5QA 3K03A 1M57B 4DR6B 3HKCB 3H1LH 5KX5A 2JGDA 3E22A 1AJPA 2HR3A 4TQFA 3GVMA 5B1AB 3RW0A 4NXNO 3W7WA 1Y74A 1GM7A 3AK1A 4YJ3B 5J2UB 1IBLO 5GTIZ 3OGCC 1SS3A 3ABLB 2PUSA 4LNUB 1A32A 5LXTB 4GX1A 2QWPB 4TUYB 2ITCC 3JAWA 1VF7A 2G38A 1M56C 1XOUA 3ZRWA 4ZHQB 4BR6A 4GZRB 4R7CA 4UVCA 4W4KA 1YI2V 2XUMA 2ZXWC 2JGDB 3ABMB 2AZ2A 2EX3A 4QNHB 1KECA 2VS0A 4FPPA 1R6KA 1Y74B 3X2QC 1THZA 5A9GA 1N33B 4LF7B 4DV4O 1Q81W 1Y67A 4A5UB 4C7UA 2LQTA 4HZ3A 4FZ1A 1QR9A 5IYBO 1GM9A 3MAQA 1K8AW 3DC5A 3CC4V 5IJ9B 2OCCB 2E5LB 2EIMB 3K58A 1WP8A 2OIEA 4FFBA 5L3DA 4ZOLB 1OHHG 4ZI7A 4XDKA 3ZRWB 2GSMB 4DV3O
chains in the Genus database with same CATH topology
5FL7G 3ML0A 1H8EG 3NXSA 2EILC 3SPCA 3ZMUA 4GX5A 2X7RB 5B3SB 5DN6G 3OAAG 1YJNV 3OMIB 1OZ0A 1OCCC 3RBZA 3LDCA 4GX2A 1V55C 1VQ9V 2CK3G 1QVGU 5EC2C 2B1IA 4BW5A 1M57C 2JDIG 2QE7G 1K73W 3P30A 3AEIA 1VQKV 1M90W 3ABTA 3SYOA 2IH1C 1K92A 3E86A 2WLHA 2HFEC 4LP8A 4JAUA 4JPRA 4PDLA 2Y69C 2P90A 5LHGA 2D3OW 4FK5C 2UXNA 1WPXA 4N23A 1V54C 4MVQA 2HVKC 1SERA 1ROPA 4QPJA 3ETEA 3ABUA 2HG5C 3ZMTA 1QLEB 3P32A 1VQOV 4MVRA 4RQEA 1PNMA 4HAMA 1RPOA 2Q68A 1J95A 1K5QA 3LSQA 3OE7G 3ABLC 1KD1W 2DYRC 3ABKB 1P4RA 1VQ7V 3CCRV 1WLEA 1R3JC 1K4DC 2EIKB 3AG4B 3K08A 3SPIA 1W0KG 3E35A 2F43G 3JD3A 5IY5B 2DYSC 5CBGA 2X0LA 3AG3B 4G2KA 3DTUB 4LC1A 2LP7A 4TSFG 3CC7V 3JD1A 2UXXA 1RM1C 2IW5A 3CCLV 1CP9A 3B77A 3F7VC 3CCSV 1GTOA 2ZR2A 5HFLA 3CCQV 2PI4A 2A79B 1G8MA 3RVZA 1NVPB 2PI5A 4JASA 4WCEV 5B1BB 2DQ0A 3JD0A 5E1AC 3OEEG 3ZMSA 3CXCU 3G6EV 1R73A 5H9CA 3E8FA 1S76D 2WLNA 3E83A 3WG7C 3T4ZA 3BY6A 1VQNV 1NJIW 1H2GA 1VQ8V 2W6JG 5H6RA 4MTXA 3K79A 1BMFG 2BOCC 1R3KC 5IYCO 4E2LA 2Z5UA 2H94A 2B1GA 4R50A 2HJFC 3ASNB 3E8GA 3JD4A 1F4MA 4ZKIA 2QM7A 1MOFA 4H33A 2XAGA 3FYIB 5LBQA 4G27B 2DW4A 3ETDA 4J9YB 2JEXA 2W0FC 2EINB 2WSSG 3AG2C 3ZMZA 2X6CA 1Q86W 2XAFA 3HPLC 1E1QG 3E8BA 5KUKA 1CEZA 3F7YC 5EBLC 2IU0A 3TK1A 4PA7A 1BL8A 3MHSC 3ZJZA 1UJWB 1KP3A 2XOKG 4UV8A 4XBFA 1SETA 1EBOA 2C2AA 3R65A 2EIMC 1NH2D 1R6NA 4RO2A 4TWKA 5CBFA 2IJKA 3JYCA 3E2EA 5L3CA 1JVMA 5LGNA 2EIJB 1KC8W 2WAMA 5L3BA 4GCZA 4U7OA 2XNDG 5B3SC 4WFFA 4UVAA 1YJ9V 2QKSA 3W7SA 1KQSU 4UUJC 4RAIA 2KB1A 4XDLA 2YEVB 3VOUA 3CD6V 1H8HG 3F5WC 4KFMA 4MW3A 3LSSA 3OUSA 1GO3F 3GWOA 1ZWIC 3CC2V 3FB7C 2ZQMA 2BOBC 3OM3B 5H6QA 1YIJV 2DWDC 4PDVA 3ZMVA 3FB6C 2K1EA 4P2ZA 3K0DA 5KA6A 5LHHA 1XL4A 1VQ5V 5EBMC 3OUFA 1HWYA 1VQLV 4JTDB 1JOYA 3B8MA 1DTOA 2P67A 3K06A 2DQ3A 1QLNA 3ZN0A 3FB8C 1K34A 2IH3C 4CBCA 2ATKC 3CCVV 4U7NA 1QLEC 4J9ZB 2H8PC 2JJ2G 1S77D 2XAQA 5KUMA 2WLIB 1K9MW 4UV9A 3HB3B 1S5HC 3QO5A 3OFNG 3ABKC 4PA9A 1E79G 1QR8A 1AI6A 2EBOA 2WLLA 3AG4C 2EIKC 1NR7A 3K04A 1K7DA 3QNEA 5IY5C 3AG3C 3A0RA 3ZRSA 3TETA 2V7QG 4X8AA 1OCRB 2JIZG 2NNUA 1Q7YW 1YTFD 4Z1MG 3CCEV 4QIWF 1TUEB 1F23A 3FKSG 3LNMB 2Q6AA 5B1NA 3M99B 3W7XA 1VQ4V 4PA3A 3SPJA 2JEUA 4MVUA 5B1BC 5L3EA 4JGSA 3EFFK 3AG1C 4MVSA 3IC7A 5J9PC 4GX0A 2MK3A 1S0VA 3ZN1A 1E1RG 2A0LA 3SPGA 3VBBA 4PA6A 3D36A 3ASOC 3ASNC 4I9WA 1MSWD 1MABG 4BAYA 1PNKA 2Q69A 4WFHA 3CCMV 1M1KW 1JX9A 3QO7A 4P9PA 2GHYA 5L3GA 2WWWA 1FXKA 2EINC 3STLC 3ZRVA 1NVPD 1I5YA 2M7WA 3AG1B 2HKOA 4OXSA 1DF5A 1Y66A 3DGEA 2YEVA 1JCHA 1VQPV 1EZJA 1F4NA 1NR1A 2WLLB 1JQ0A 4P9OA 3ASOB 1SESA 3OEHG 1IXMA 3D3IA 1BHAA 1AJNA 1AR1B 1OCOB 4PDMA 4QPKA 4MSWC 3G4SV 2OTLV 2ZDIA 4JYBA 1ENVA 3BEHA 2EIJC 3MHHC 3E8HA 2B5UA 2IU3A 2Q67A 4MS2A 4MVMA 3OR6C 5C93A 1RPRA 4RUEA 1P7BA 1ORQC 2XASA 3K9AA 3CP1A 5EC1C 3STZC 1G4YB 2WLIA 2ZD9A 1DLBA 3SYCA 3IFXA 1AI7A 3CCJV 1MG1A 3H01A 4Q20A 2WLKA 2XAHA 2X6AA 1R3IC 4QE9A 3T1CA 4RQFA 4WFEA 2FTKA 1GM8A 1W0JG 1L1FA 4X88A 2ZDIC 3ZRXA 1FXKB 1KP2A 5CBHA 1FXVA 2IJJA 5CA3A 2WLJA 5EBWC 1M56B 1LNQA 4KUMA 1QBZA 1EFRG 2LFSA 4KP4A 3JD2A 1N8RW 3CYOA 2P6JA 1JPXA 2R9RB 3JCZA 2ZR3A 2NLJC 3PJSK 1W2BU 1YJWV 1PNLA 4R8CA 4UVBA 3G71V 5BZBA 4WF9V 2ZXWB 1Y4MA 3LDEA 4ASUG 4DXWA 4N21A 3W7TA 4JYCA 1OCRC 1R3LC 2QM8A 4LBEC 5B1OA 3FYEB 5L3FA 1K3EA 1DF4A 4MW8A 1SRYA 1K5SA 1SZTA 3E89A 1F51A 4TT3G 2HVJC 4ZBMA 3X2QB 3SYQA 1K97A 3MD0A 1OCZC 3FB5C 4JF3A 1AI5A 4GT1A 3IGAC 3UKMA 2OTJV 4DO2A 4MVZA 1K4CC 1FXHA 2JJ1G 3LDDA 5HFMA 1AJQA 3W7UA 5IYDO 4MTOA 3CPWU 3CCUV 3K3WA 4HYOA 3SJQC 3OMNB 4R6ZA 5KA5A 3LUTB 1PD3A 1YHQV 1K33A 4WFAV 1Q82W 2QEXV 1BHBA 2EZOA 2DWEC 2AHYA 4MTGA 3OW2U 3SYPA 4MVOA 1GMGA 1OCZB 2V1DA 1H38A 2AHZA 2EILB 2QTOA 3GB7C 4PELA 4EKWA 4WFBV 3QO8A 5CN0A 3ETGA 1OCCB 2A9HA 1YTFB 5B1AC 1XL6A 2W6IG 2QA4V 1V55B 2EZPA 1NKDA 1OCOC 2R9IA 4JAVA 3EHBB 3K03A 1B6QA 1M57B 2IJHA 1VQMV 3ZCCA 1NBMG 4P30A 4FJCC 1M9NA 3KG2A 1QCEA 1AJPA 2JK5C 5LHIA 2HR3A 4BIUA 1AROP 2Y69B 4L87A 1YSCA 4JTCB 3CMEV 5B1AB 3RW0A 1I5XA 1V54B 2Z3YA 3W7WA 1GM7A 2P7TC 2WLMA 3OMAB 1AI4A 4LCUC 2IJIA 3OGCC 3SYAA 5DM6V 3ABLB 4UXNA 5EK0A 2ITDC 2DYRB 4X89A 4G28B 4JTAB 3ZIAG 3UM7A 1JJ2U 1FXKC 3T2MA 2HLDG 4GX1A 1S72V 2DYSB 3ABMC 2Y48A 3I55V 2ITCC 4MT8A 1M56C 1RM1B 5GW7A 3ZRWA 4CZZA 4H37A 1VQ6V 2OT5A 2EJRA 3TCUA 2LFRA 4R7CA 4BIZA 4UVCA 1YI2V 5CMUA 4XDJA 3WG7B 4FMTA 4MTFA 2ZXWC 3ABMB 5LGTA 1PKXA 2OCCC 1QVFU 4F4LA 4QNHB 1NH2B 4YXWG 1KECA 2WPDG 1NQTA 5LGUA 1GKFA 1FS0G 4FPPA 1R6KA 4QJFB 3X2QC 5IDJA 3I56V 1GK9A 1THZA 3OR7C 4I5SA 3AG2B 3T4DA 1COWG 4FIPC 4WFGA 1Q81W 1KKDA 4QE7A 3SPHA 2XAJA 4RUFA 1CPYA 3CMAV 4HZ3A 1QR9A 5IYBO 1GM9A 2X6BA 1K8AW 3CC4V 2OCCB 2YSUB 3B8NA 2EIMB 3K0GA 1YITV 3WFVA 4PDRA 4PA4A 5L3DA 1FFTB 1OHHG 1S3JA 3RVYA 1PL0A 4XDKA 3ZRWB 2GSMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG1 A;  1MOF A;  3H01 A;  2LP7 A;  5KA6 A;  5HFM A;  4FK5 C;  2X7R B;  4FIP C;  2OT5 A;  4N23 A;  2EZP A;  3B77 A;  5HFL A;  1ENV A;  5KA5 A;  1Y4M A;  3B8M A;  5CMU A;  4N21 A;  1K33 A;  1F23 A;  1QR9 A;  3MHH C;  1K34 A;  2EZO A;  3M99 B;  1I5Y A;  2EBO A;  4JPR A;  3MHS C;  2M7W A;  4G2K A;  5H9C A;  3B8N A;  1DF4 A;  4FJC C;  4JGS A;  1DF5 A;  1Y66 A;  3WFV A;  1QCE A;  3P30 A;  1SZT A;  1QBZ A;  1EBO A;  3GWO A;  2MK3 A;  3K9A A;  3CYO A;  3CP1 A;  4E2L A;  4JF3 A;  1JQ0 A;  1DLB A;  1QR8 A;  2P6J A;  1I5X A;  5CN0 A;  1JPX A; 
#chains in the Genus database with same CATH topology
 3ML0 A;  3SPC A;  4GX5 A;  2Q7H A;  1OZ0 A;  1LR1 A;  2VQF O;  1IBM O;  1VQ9 V;  2CK3 G;  4YJ2 A;  1J5E O;  3KCX A;  2JDI G;  2QE7 G;  2Y4T A;  5AG2 A;  4I0X A;  1M90 W;  3SYO A;  2IH1 C;  4JI5 O;  4K8Z A;  2P4V A;  2QM4 A;  1TVK A;  2P90 A;  2UXN A;  3Q4H B;  4DRX B;  1XMO B;  1SER A;  3ABU A;  3D8C A;  4DK0 A;  1K5Q A;  3LSQ A;  4FFB B;  4DV1 B;  3CE2 A;  5LP6 A;  1SQX H;  3AG4 B;  2EIK B;  3UQ8 A;  2A3Q A;  4DK1 A;  3AG3 B;  2UU9 B;  2YXH A;  2QWN B;  2UXX A;  1RM1 C;  1WAZ A;  2UXC B;  3CCL V;  1CP9 A;  1Q8I A;  4IT5 A;  3B77 A;  2ZE7 A;  3F7V C;  3CCS V;  2ZR2 A;  2YIC A;  5HFL A;  4UCR A;  1JA8 A;  3CCQ V;  2A79 B;  2PI5 A;  1SQQ H;  4PI0 A;  1SKV A;  4WCE V;  4WBN B;  5B1B B;  1GH6 A;  3OEE G;  4D6T H;  3G6E V;  2UXD B;  1R73 A;  3E8F A;  2DMX A;  4UB8 Z;  1VQ8 V;  2O57 A;  2W6J G;  4MTX A;  1I94 O;  4H13 B;  4LF9 B;  2Z5U A;  2H94 A;  2B1G A;  4R50 A;  3E8G A;  3JD4 A;  1F4M A;  2QM7 A;  1I7F A;  3WB0 A;  1MZF A;  2XAG A;  5LBQ A;  3U0Z A;  4Q6G A;  4O4H B;  2JEX A;  3AG2 C;  4ICG A;  1JMK C;  1E1Q G;  3E8B A;  5E79 Z;  4GKK B;  3F7Y C;  4CC5 A;  1KP3 A;  2BSK B;  3ZBH A;  1F7Y A;  3RT3 C;  2Q7E A;  3R65 A;  1UFI A;  1M4U A;  2V4D A;  3L9D A;  2IJK A;  4X1K A;  3JAL A;  1JVM A;  4Z1V A;  2VQE B;  4I9Q A;  2ZE5 A;  4GCZ A;  5B3S C;  3K9S A;  4J41 A;  4NTX A;  3JAM N;  1YJ9 V;  3W7S A;  4DR1 B;  1KQS U;  2CTR A;  2IBZ H;  4BWA A;  3CD6 V;  2F4V O;  4MW3 A;  3ICX A;  1GO3 F;  3GWO A;  1ZWI C;  4HBN A;  4NYK A;  4X62 O;  3FB7 C;  4X1Y A;  1HNZ O;  2BTO A;  2YIB D;  2DWD C;  3FB6 C;  2K1E A;  1Y6X A;  4AI8 A;  1N36 O;  3OUF A;  2R9A A;  1IX9 A;  3RYF A;  3B8M A;  1DTO A;  2DQ3 A;  5H2F Z;  5EYP A;  1X59 A;  3ZN0 A;  2RNB A;  1K34 A;  2IH3 C;  1G1X B;  1SF9 A;  1QLE C;  4J9Z B;  4DV7 O;  5BR8 B;  2JJ2 G;  1S77 D;  3ZHR A;  1H2M A;  3HB3 B;  1S5H C;  2CGO A;  3OFN G;  3QO5 A;  3A2F A;  4LR3 A;  3QNE A;  1XDC A;  5IY5 C;  1VAR A;  3A0R A;  3FD9 A;  1EN4 A;  2HHH O;  3BPZ A;  3VQY A;  2CDY A;  2RJZ A;  2LW7 A;  3BA8 A;  2BCC H;  5KMG A;  1HR0 O;  2EUL A;  4GX0 A;  2MK3 A;  1S0V A;  4U3F H;  1E1R G;  3OD4 A;  3SPG A;  3VBB A;  3LSU A;  4FLX A;  1AR4 A;  3ASO C;  5B5E Z;  1PNK A;  3SDL A;  1ZTE A;  3CCM V;  5L3G A;  3TGU H;  1I5Y A;  3AG1 B;  4DR4 O;  1VF5 B;  2HKO A;  4OXS A;  1AR5 A;  4BW9 A;  1VQP V;  4LH6 A;  1NR1 A;  3L74 H;  3CX5 F;  1IXM A;  3R66 A;  3D3I A;  4PDM A;  4MSW C;  1BZK A;  2ZDI A;  2HEP A;  2B5U A;  4I4T A;  4JAA A;  5KMG B;  4MVM A;  2E76 B;  1V9P A;  1RPR A;  4RUE A;  1P7B A;  1ORQ C;  3K9A A;  3CP1 A;  3STZ C;  2WLI A;  5JJJ B;  4IIJ B;  3H01 A;  5EZY A;  1KB9 F;  2GBO A;  4DR3 O;  1GAX A;  3DSQ A;  3JAR B;  1YZB A;  4WFE A;  4LF4 B;  2Q9L A;  1CXZ B;  5C8Y A;  4ZIB A;  5LA6 B;  2QGN A;  1M56 B;  1LNQ A;  4KUM A;  1EFR G;  2LFS A;  4KP4 A;  3RFR A;  3K5O A;  2E3C A;  4O4L A;  5FNV B;  4JI3 B;  3FAV B;  1FPO A;  1JPX A;  4IYH A;  3PJS K;  5BZB A;  2ZXW B;  4DUY B;  4I4T B;  1QU7 A;  4O4J A;  5B1O A;  4MW8 A;  2D2C B;  1F51 A;  3X2Q B;  1XHZ A;  4B3M B;  1WNS A;  1OCZ C;  3FB5 C;  4MVZ A;  1FXH A;  1YF2 A;  1AJQ A;  5JCO C;  3K3W A;  2P4K A;  2ADP A;  3OMN B;  1PD3 A;  4WFA V;  1Q82 W;  5C8Y B;  4CH3 A;  1MSD A;  3BAA A;  2N05 A;  2QEX V;  2EZO A;  1YCI A;  2YC0 A;  2YID A;  2DWE C;  2YXL A;  4LFB B;  5LMN B;  4MVO A;  2V1D A;  1XMQ B;  2AHZ A;  1EZV H;  2RMK B;  3GB7 C;  4NXM B;  5D5P A;  4IHJ B;  1N33 O;  4WFB V;  1JFF B;  3QO8 A;  5CN0 A;  4X65 B;  3JCU Z;  3D3Q A;  5JH7 A;  2QA4 V;  1XNR B;  4IYI A;  4B3T B;  1UPG A;  2R9I A;  2BTQ A;  1YVW A;  1B6Q A;  2E5L O;  4O4J B;  3MDS A;  5JQG B;  1QCE A;  4PJ0 Z;  4JTC B;  4X66 B;  3U10 A;  1WA8 A;  2P7T C;  4LF5 B;  4DR5 B;  3OMA B;  4JI0 O;  5LOV A;  4DV2 O;  4LCU C;  2IJI A;  3SYA A;  5EK0 A;  2ITD C;  3RYI A;  3SGI A;  1GN4 A;  4JTA B;  2YXY A;  3UM7 A;  1JJ2 U;  1EN5 A;  3ZX6 A;  2Y48 A;  5LL6 Y;  3I55 V;  2ARH A;  4MT8 A;  2JRI A;  1RM1 B;  5JVD A;  1TA8 A;  2CH7 A;  4H37 A;  1TAE A;  4J10 A;  1N0N A;  3APQ A;  4BIZ A;  5LYJ A;  4XDJ A;  5KHJ A;  3OTF A;  3S3X A;  1PM9 A;  4MTF A;  3H1K H;  1PV0 A;  1P7G A;  5LGT A;  1PKX A;  3JSN A;  1NH2 B;  2QWO B;  2UU9 O;  1NQT A;  3L73 H;  5LGU A;  1FJG B;  3OR7 C;  3K5M A;  3AG2 B;  4GKJ O;  4WFG A;  4IGG A;  5LOV B;  4QE7 A;  3SPH A;  4LF8 B;  1CPY A;  3CMA V;  3RYI B;  2X6B A;  2CGN A;  3A0H Z;  2A06 H;  2YSU B;  1YIT V;  4FLU A;  3WFV A;  4PDR A;  3RYC A;  4LF9 O;  1L0N H;  1S3J A;  1XQ8 A;  1GRJ A;  5JVD B;  1YEW A;  4CH6 A;  3BRC A;  2EIL C;  4OX9 B;  2ZIO A;  2X7R B;  1FFX B;  5B3S B;  3OAA G;  1YJN V;  1OCC C;  3LDC A;  5LYJ B;  4DV5 O;  2DJV A;  5J2U A;  1QVG U;  1QHT A;  2ZNJ A;  2B1I A;  4BW5 A;  1VQK V;  1K92 A;  3KKY A;  3G6B A;  2WLH A;  4JI2 B;  4JPR A;  4PDL A;  5B66 Z;  2Y69 C;  5LHG A;  4FK5 C;  4JZG A;  2EJ7 A;  4ZHQ A;  2HVK C;  3ETE A;  4DR1 O;  4J7J A;  1QLE B;  1VQO V;  4F6R B;  4HAM A;  2M6Y A;  3RYC B;  3CEI A;  2DYR C;  1P4R A;  4JI6 B;  1WLE A;  4O2A A;  3K08 A;  1Z2G A;  2PYL A;  3SPI A;  4OPH A;  3JD3 A;  5IY5 B;  1N34 B;  3CC7 V;  3ZHT A;  4FLW A;  1SQG A;  2IW5 A;  4LFC B;  1N32 O;  2PI4 A;  2XT9 A;  3RVZ A;  3L70 H;  3JD0 A;  5E1A C;  4DV6 B;  5H9C A;  3WG7 C;  1AVM A;  1H2G A;  4PI2 A;  5IJ9 A;  4UCS A;  1H2K A;  1BMF G;  2BOC C;  1R3K C;  4ZOL A;  4E2L A;  4FVM A;  2YUA A;  2PTM A;  2P5O A;  5IT9 N;  3CRC A;  2GTA A;  4J9Y B;  4QGP A;  2WSS G;  2W0F C;  1CEZ A;  2FML A;  4K35 A;  1FYJ A;  3TK1 A;  1BL8 A;  1UJW B;  4UFZ A;  4XBF A;  4O2A B;  2RQ6 A;  2C2A A;  4J7K A;  4AQY O;  1R6N A;  4RO2 A;  5CBF A;  5L3C A;  4CS4 A;  2WAM A;  3Q4H A;  4DRX A;  2Q4P A;  4YHH O;  4WFF A;  1PP9 H;  2QKS A;  1SA0 A;  4RAI A;  5GON A;  1SQB H;  4XDL A;  1H8H G;  4KFM A;  3LSS A;  4O4I A;  1XUQ A;  1YIJ V;  3I5D A;  3A0B Z;  4LFA B;  4P2Z A;  1BE3 H;  3K0D A;  5JCO A;  5KA6 A;  5EBM C;  1HWY A;  3K5N A;  3BAB A;  1MNG A;  4AHC A;  5CA0 A;  4IL6 Z;  4X20 B;  4WBN A;  2ATK C;  3CCV V;  2H8P C;  1NTZ H;  4X64 O;  2XAQ A;  5KUM A;  1ZL8 A;  2P22 C;  4LF6 O;  3TXS A;  4PA9 A;  2WLL A;  4DUZ O;  1FKA O;  3ZRS A;  4LF4 O;  3AK2 A;  2V7Q G;  4X8A A;  1T5E A;  2L6L A;  1Q7Y W;  4X9Q A;  4O4H A;  3CCE V;  4QIW F;  1TUE B;  3KCY A;  3CS5 A;  3FKS G;  3LNM B;  1SA0 B;  4HNA B;  2ZM6 B;  5GON B;  3HKD A;  4PA3 A;  1Q6I A;  4MVU A;  3OTO B;  3EFF K;  4O4I B;  2BSK A;  3ZN1 A;  1IXB A;  1HDJ A;  4PA6 A;  1U97 A;  1H2L A;  1MAB G;  4BAY A;  4TV9 A;  2UUC O;  5K1P A;  5CA0 B;  1JX9 A;  3QO7 A;  4X1I A;  1M1K W;  1Q5O A;  3EVK A;  2WWW A;  2EIN C;  3STL C;  3ZHV A;  1NVP D;  2UXB B;  3T1H O;  2M7W A;  3J80 N;  1ZL8 B;  1L8D A;  1DF5 A;  2ZE8 A;  4JI1 B;  4PHZ A;  2QR4 A;  5KHK A;  2WLL B;  3AK3 A;  4P9O A;  1SES A;  3OEH G;  3B4S A;  1AJN A;  3DC6 A;  2Y4U A;  1NI8 A;  4QPK A;  5ITZ A;  4KXR A;  1ENV A;  2EIJ C;  3CB2 A;  3WU2 Z;  3MHH C;  3HKD B;  4DR7 B;  3E8H A;  2DE0 X;  2E74 B;  4JI4 B;  2IU3 A;  4MS2 A;  5BXZ A;  4NXM O;  4K0K B;  1IBK B;  4X65 O;  3IFX A;  1XNR O;  2WLK A;  2X6A A;  4TV9 B;  1R3I C;  4JV5 B;  4X1I B;  1L1F A;  1AP5 A;  1MMM A;  1FXV A;  5BMV B;  4CH4 A;  4X66 O;  1VP7 A;  3JD2 A;  2UUB B;  2P6J A;  3JAT B;  4DR5 O;  2AGA A;  1W2B U;  5ITZ B;  4KHP B;  4TOI A;  3F5T A;  3G71 V;  1ZAU A;  1NTK H;  5IWA B;  1Y4M A;  2LJ2 A;  3LDE A;  3W7T A;  4N21 A;  4GUN A;  3CRR A;  1OCR C;  1R3L C;  3FYE B;  5L3F A;  1DF4 A;  1SRY A;  1SZT A;  1I0H A;  1BS3 A;  4I50 B;  1D2D A;  3IGA C;  3UKM A;  2OTJ V;  4DO2 A;  1K4C C;  2JJ1 G;  2DOS A;  4NXN B;  4JYA O;  4K3A A;  3K59 A;  3CCU V;  4HYO A;  2PGG A;  3RWR D;  1YHQ V;  1K33 A;  4NVP A;  1IBL B;  4DV0 O;  1XRE A;  4B3R B;  4MTG A;  3OW2 U;  3H9V A;  1M93 A;  2EIL B;  1SQP H;  2QTO A;  5TIS Z;  1OCC B;  5J2T B;  5B1A C;  4IIJ A;  1XL6 A;  2GUZ A;  2EZP A;  4TQD A;  3JAR A;  4J42 A;  2OYQ A;  1NKD A;  1OCO C;  3C90 A;  4DR2 O;  2IJH A;  2ZIM A;  1VQM V;  4P30 A;  4FJC C;  3H1I H;  2JK5 C;  1L0L H;  5LHI A;  4BIU A;  5LA6 A;  1ARO P;  1D5A A;  2Y69 B;  4L87 A;  3RYH B;  2VRZ A;  5A2Q N;  2FL4 A;  5BY1 A;  3CME V;  1I5X A;  1KMI Z;  5FNV A;  3FAV A;  1IZ3 A;  1IVS A;  2L35 A;  4DV4 B;  3WB1 A;  1AI4 A;  3ZS8 C;  4UXN A;  2DYR B;  4X89 A;  3ZIA G;  1FXK C;  2HLD G;  2YIA A;  1S72 V;  3ABM C;  1IDS A;  2F95 B;  1WPB A;  2JVD A;  2KQX A;  2YIB A;  3CJH B;  5GW7 A;  1O9G A;  2ILM A;  4CZZ A;  2GUZ B;  3JAK B;  3SJC C;  4DV3 B;  1VQ6 V;  2EJR A;  3TCU A;  2BE3 A;  2LFR A;  4DR6 O;  3WG7 B;  3PN1 A;  2VQF B;  3CWB H;  2LGQ A;  2IM9 A;  1IBM B;  2LO1 A;  4FM0 A;  1J5E B;  2OCC C;  1QVF U;  4F4L A;  4YXW G;  1VF6 C;  2DN9 A;  1GKF A;  1FS0 G;  4QJF B;  5IDJ A;  3I56 V;  4IHJ A;  1JFF A;  3N2K B;  4FIP C;  3JSL A;  1KKD A;  1HW7 A;  1PL4 A;  4DV6 O;  4RUF A;  4CH5 A;  4EEQ A;  3CRA A;  4PA4 A;  2KG7 B;  3G67 A;  5JQG A;  1PL0 A;  1DGS A;  1JJO A;  3J81 N;  3GWK C;  5FL7 G;  3UO2 A;  1DK1 A;  3OMI B;  3RBZ A;  4GX2 A;  4L8J A;  1AB3 A;  1XIL A;  5KHI A;  1US6 A;  3UT5 A;  1BT8 A;  5FLX N;  1K73 W;  3P30 A;  3AEI A;  3LNN A;  1I94 B;  1Q3E A;  3ZHS A;  1GN6 A;  1XNQ B;  4LP8 A;  4JAU A;  4LF7 O;  1XBL A;  2D3O W;  1WPX A;  2YS8 A;  4FFK A;  1AP6 A;  1V54 C;  1WJZ A;  1ROP A;  4JYY A;  3ZMT A;  4MVR A;  4RQE A;  4FLY A;  2OCH A;  2VWK A;  1XEQ A;  1J95 A;  3OE7 G;  3FFQ A;  1N4C A;  1VQ7 V;  1K4D C;  4LFA O;  2RCV A;  3ETQ A;  2F1M A;  2F43 G;  2DYS C;  1Z5W A;  2X0L A;  3A8T A;  3TJT A;  1ZLZ A;  4LC1 A;  2LP7 A;  4TSF G;  3JD1 A;  1GTO A;  1SQF A;  2PF4 E;  3S3W A;  1G8M A;  4JAS A;  3UT5 B;  1ZX3 A;  5LMU B;  3ZMS A;  3SR2 C;  2WLN A;  3E83 A;  3T4Z A;  2JS3 A;  1NJI W;  4KL1 A;  5H6R A;  3K79 A;  5LP6 C;  2F4V B;  5IYC O;  2HJF C;  1HNZ B;  1XMO O;  1MOF A;  2YI9 A;  3FYI B;  1Q90 D;  2Q0O C;  4G27 B;  2DW4 A;  2H3O A;  1FFX A;  2EIN B;  4B7E A;  1Q86 W;  1N36 B;  2XAF A;  5KUK A;  1KUQ A;  2IU0 A;  5JWP A;  4DV1 O;  4UV8 A;  1SET A;  2CUG A;  5JJN B;  1BSM A;  3RN4 A;  2UXC O;  3B40 A;  3JYC A;  2R70 A;  1NU1 H;  5LGN A;  2EIJ B;  1P49 A;  4EB6 B;  3BCC H;  2CTQ A;  1Z5V A;  2XND G;  2HHH B;  2UXB O;  2UXD O;  2QWQ B;  4F6R A;  4YY3 B;  2YDE A;  2KB1 A;  1ZUQ A;  2YEV B;  3VOU A;  2Z0A A;  1HNX B;  1HR0 B;  5EIB C;  4J7Z A;  2ZQM A;  2BOB C;  5H6Q A;  1M5I A;  4PDV A;  3ZMV A;  4TV8 B;  3UCS C;  1XL4 A;  1P84 F;  4B3S B;  2OIG A;  4GKK O;  1NZ6 A;  4DR7 O;  2FB5 A;  1VQL V;  4JI4 O;  1NTM H;  2P67 A;  1QLN A;  3FB8 C;  4CBC A;  4K0K O;  2F23 A;  1ZSP A;  1OJH A;  2PZS A;  1Q6U A;  1X4T A;  4F6E A;  3ABK C;  1QR8 A;  4O2B B;  3ZHU A;  3K04 A;  4UB6 Z;  4RWU A;  1K7D A;  2QKA A;  1RSO B;  2VQE O;  4UCV A;  2Y0P A;  5KHG A;  1OCR B;  2NNU A;  2GV9 A;  4JI7 B;  4DYL A;  3B2E E;  3M99 B;  4I7Z B;  3P3P A;  3W7X A;  3SPJ A;  5L3E A;  4GYC B;  3NR7 A;  4JGS A;  5IJ0 B;  3AG1 C;  1YDX A;  4MVS A;  5J9P C;  2FYU H;  2WA4 A;  5KLV H;  4W4L A;  2A0L A;  2JGU A;  1XI1 A;  4KHP O;  3JAS B;  4PV1 B;  5IWA O;  3ASN C;  4I9W A;  1MSW D;  4DR3 B;  4J80 A;  2KKW A;  4WFH A;  2Q69 A;  2ZCE A;  4I55 A;  4FLT A;  4P9P A;  4JI8 B;  2GHY A;  2ZT9 B;  1FXK A;  5BR8 O;  1BQZ A;  5KAI Z;  1EN6 A;  1Y66 A;  2CTW A;  3EXA A;  1JCH A;  2UUA B;  1JQ0 A;  3ASO B;  1OCO B;  1VEW A;  4FLV A;  3O9O A;  3G4S V;  3TXQ A;  4JYB A;  2ZKO A;  4B3R O;  3ZED A;  5K1X A;  1WP7 A;  5IYZ A;  2WA3 A;  1S5L Z;  4OPA A;  2Q67 A;  3OR6 C;  3BFR A;  2MW2 B;  4X20 A;  1VF6 A;  1QQC A;  2XTA A;  5EC1 C;  4UCU A;  1G4Y B;  2ETN A;  2R72 A;  1TUB A;  1AI7 A;  5IE9 A;  4Q20 A;  1WN7 A;  4I55 B;  3OT7 A;  4RQF A;  2FTK A;  2ZDI C;  1FXK B;  5KX5 B;  3E22 B;  4HNA A;  1B06 A;  5CA3 A;  3K57 A;  2WLJ A;  2QWR B;  1NT2 B;  1N8R W;  3CYO A;  3P3N A;  2VWJ A;  4UCO A;  4K8X A;  4H44 B;  3JCZ A;  1H2S B;  2NLJ C;  3L72 H;  1Q43 A;  1TGO A;  1PNL A;  2HJD A;  2N04 A;  3AG7 A;  4WF9 V;  4DXW A;  4JYC A;  5IYZ B;  2QM8 A;  1K3E A;  4DW1 A;  3JAW B;  1K5S A;  4ZBM A;  2HVJ C;  5EIB D;  2QSA A;  3SYQ A;  3MD0 A;  4GLX A;  1TUB B;  4OGQ B;  3LDD A;  4ABM A;  5HFM A;  5IYD O;  3CPW U;  4NKG B;  1BCC H;  5KA5 A;  3LUT B;  4JI0 B;  4DV2 B;  4EFE A;  1U96 A;  1PPJ H;  1OCZ B;  2QTS A;  4JI3 O;  3HKE A;  2Q73 A;  4PEL A;  4UCT A;  3CRQ A;  1VIB A;  3C3S A;  2W6I G;  2K9P A;  4DUY O;  3IAY A;  1HP8 A;  2F66 C;  3ZCC A;  1NBM G;  5BMV A;  5KHH A;  1M9N A;  3KG2 A;  4B3M O;  3HKB A;  4B7K A;  3T1Y B;  3L71 H;  4ZI7 B;  1SZX A;  1YSC A;  1RFY A;  2AXT Z;  1V54 B;  2Z3Y A;  2Q8V A;  3JAT A;  3VQV A;  4NB5 A;  2WLM A;  3D36 C;  4GKJ B;  4YJ2 B;  4LH7 A;  1KYO F;  5DM6 V;  4G28 B;  4LFB O;  2Q0A A;  5LMN O;  3T2M A;  4I0X B;  2Y0I A;  1XMQ O;  2DYS B;  3HKE B;  1XNQ O;  1TVK B;  3VQW A;  3QG5 A;  4I50 A;  3QTC A;  4B3T O;  2OT5 A;  5CMU A;  4FMT A;  4DV5 B;  4FM2 A;  1LUV A;  2GDS A;  3WB2 A;  5LP6 B;  3HKB B;  3C3T A;  2QKC A;  1S5J A;  2WPD G;  4LF5 O;  1GK9 A;  4I5S A;  3T4D A;  1COW G;  3N27 A;  5CB4 A;  5J2T A;  5LMU O;  1HNW B;  2XAJ A;  1LUW A;  2FKX A;  4J11 A;  1URF A;  3B8N A;  3K0G A;  1FFT B;  2GTS A;  4YIO A;  3RVY A;  2CAZ C;  3RYH A;  1H8E G;  3NXS A;  3ZMU A;  4NR1 A;  5DN6 G;  2N74 A;  1N32 B;  1V55 C;  2PYJ A;  1IUR A;  5EC2 C;  1FAF A;  2NR5 A;  1M57 C;  5FPR A;  3ABT A;  2B9Z A;  1FJG O;  3CXH F;  3SJB C;  3E86 A;  3DXR A;  4X1K B;  2HFE C;  3JAL B;  3CJH A;  4D7S A;  5CB4 B;  4LF8 O;  4N23 A;  4MVQ A;  3JAK A;  4QPJ A;  3IC9 A;  2HG5 C;  3P32 A;  4YY3 O;  2ZE6 A;  1PNM A;  2QJ1 A;  1VMG A;  1RPO A;  2Q68 A;  1HNX O;  4D7T A;  3ABL C;  1KD1 W;  4U3J A;  4X1Y B;  3ABK B;  2KSD A;  3CCR V;  2CE4 A;  1OV9 A;  1R3J C;  3CRM A;  2YI8 A;  1W0K G;  3E35 A;  3KZI Z;  4CS3 A;  5CBG A;  4OX9 O;  4B3S O;  3APO A;  4AQY B;  4G2K A;  3DTU B;  3G80 A;  5GTH Z;  1QNM A;  3BHP A;  4B08 A;  4FM1 A;  3RYF B;  2XHB A;  3N2K A;  3VQX A;  5H5N A;  1GN3 A;  5EYP B;  1NVP B;  2DQ0 A;  3HR0 A;  3CXC U;  4YHH B;  1JR9 A;  1G6U A;  1S76 D;  1VQN V;  3BY6 A;  4NTW A;  2ODM A;  3FX7 A;  4JI2 O;  3DXR B;  2KG7 A;  3ZHQ A;  3BA9 A;  5FPO A;  2ZIN A;  3ASN B;  1Q6H A;  4ZKI A;  4H33 A;  3ETD A;  4JI7 O;  3ZMZ A;  2X6C A;  3HPL C;  5EBL C;  4Z2W A;  5KAF Z;  3H1J H;  4PA7 A;  1SQV H;  3MHS C;  3ZJZ A;  4U3J B;  2XOK G;  4JI6 O;  3U11 A;  1EBO A;  4X64 B;  2ZNI A;  2EIM C;  1N34 O;  2QDO A;  1NH2 D;  3CHX A;  4AIL C;  4LF6 B;  4TWK A;  4JI5 B;  3E2E A;  4LFC O;  5CA1 A;  4JI8 O;  4DUZ B;  1KC8 W;  1I08 A;  5L3B A;  4NTY A;  2RN9 A;  4U7O A;  3IJ4 A;  4UVA A;  1EM1 A;  1AIL A;  3M8A A;  4UUJ C;  3F5W C;  2UUA O;  2HP8 A;  3OUS A;  3CC2 V;  3OGI B;  2PY5 A;  1R1B A;  3THO A;  3OM3 B;  5LHH A;  1VQ5 V;  1W59 A;  2AZ0 A;  4JTD B;  1JOY A;  1B04 A;  2UUC B;  3K06 A;  3SJA C;  4U7N A;  3T1H B;  4FZ0 A;  2WLI B;  1K9M W;  4UV9 A;  4DW0 A;  5EZY B;  1E79 G;  3N2G A;  2JS5 A;  1AI6 A;  2LW1 A;  2EBO A;  3AG4 C;  2EIK C;  1NR7 A;  5CA1 B;  3BVO A;  3AG3 C;  3TET A;  2AW9 A;  1KKC A;  4FLZ A;  2ADQ B;  2JIZ G;  1YTF D;  4Z1M G;  1R6T A;  4PD4 F;  1F23 A;  5B1N A;  2Q6A A;  4LWS A;  1VQ4 V;  1KU9 A;  2JEU A;  3O65 A;  5B1B C;  2CTP A;  1FD9 A;  3L75 H;  3IC7 A;  4O4L B;  4CS2 A;  3QVN A;  1N0J A;  5DEC A;  1O9H A;  3RGB A;  3D36 A;  4E4E A;  1RP3 B;  1BQ0 A;  4YIP A;  4EB6 A;  3ZRV A;  2W0X A;  1H2N A;  2NN4 A;  3DGE A;  2YEV A;  1EZJ A;  1F4N A;  3N2G B;  4CC6 A;  4EFB A;  4X62 B;  2E75 B;  1NS1 A;  1WB8 A;  1BHA A;  1Y76 A;  1AR1 B;  4TV8 A;  5F2V O;  2OTL V;  3CSX A;  3BEH A;  1MZE A;  2ZM6 O;  4LWS B;  3OTO O;  5C93 A;  2Q5Z A;  1XHX A;  4DV7 B;  2OWO A;  2XAS A;  5DED A;  2ZD9 A;  1DLB A;  3SYC A;  5JH7 B;  3CCJ V;  1MG1 A;  2XAH A;  3M7M X;  4O2B A;  1SC5 B;  2BTQ B;  4QE9 A;  3T1C A;  1RSO A;  2LGW A;  1GM8 A;  1W0J G;  4JYA B;  4X88 A;  3ZRX A;  3J7A U;  4H0L B;  1KP2 A;  5CBH A;  1GN2 A;  2IJJ A;  3T1Y O;  3H1H H;  4JI1 O;  4DV0 B;  5EBW C;  2A7W A;  1QBZ A;  1B3Q A;  5IJ0 A;  1WA8 B;  1D5N A;  2R9R B;  1Y76 B;  2RDC A;  2ZR3 A;  3JAS A;  1YJW V;  4R8C A;  4UVB A;  4ASU G;  3HKC A;  4DR2 B;  4LBE C;  5JJE B;  2Q7G A;  1IBK O;  3E89 A;  4TT3 G;  4DR4 B;  1K97 A;  4JF3 A;  4JZ2 A;  1AI5 A;  4GT1 A;  2CH7 B;  1MA1 A;  4JV5 O;  3W7U A;  4MTO A;  3SJQ C;  4YJ3 A;  4R6Z A;  1YXB A;  1BHB A;  4LNU A;  2P06 A;  2AHY A;  2F93 B;  4BIO A;  3SYP A;  1KBH A;  5LXT A;  3QF7 A;  1GMG A;  2UUB O;  1H38 A;  4TUY A;  4EKW A;  3ETG A;  1BGY H;  1WB7 A;  2A9H A;  3B09 A;  1YTF B;  1HNW O;  1V55 B;  3UO3 A;  3K5L A;  4JAV A;  3EHB B;  5D5Q A;  3K03 A;  1M57 B;  4DR6 B;  3HKC B;  3H1L H;  5KX5 A;  2JGD A;  3E22 A;  1AJP A;  2HR3 A;  4TQF A;  3GVM A;  5B1A B;  3RW0 A;  4NXN O;  3W7W A;  1Y74 A;  1GM7 A;  3AK1 A;  4YJ3 B;  5J2U B;  1IBL O;  5GTI Z;  3OGC C;  1SS3 A;  3ABL B;  2PUS A;  4LNU B;  1A32 A;  5LXT B;  4GX1 A;  2QWP B;  4TUY B;  2ITC C;  3JAW A;  1VF7 A;  2G38 A;  1M56 C;  1XOU A;  3ZRW A;  4ZHQ B;  4BR6 A;  4GZR B;  4R7C A;  4UVC A;  4W4K A;  1YI2 V;  2XUM A;  2ZXW C;  2JGD B;  3ABM B;  2AZ2 A;  2EX3 A;  4QNH B;  1KEC A;  2VS0 A;  4FPP A;  1R6K A;  1Y74 B;  3X2Q C;  1THZ A;  5A9G A;  1N33 B;  4LF7 B;  4DV4 O;  1Q81 W;  1Y67 A;  4A5U B;  4C7U A;  2LQT A;  4HZ3 A;  4FZ1 A;  1QR9 A;  5IYB O;  1GM9 A;  3MAQ A;  1K8A W;  3DC5 A;  3CC4 V;  5IJ9 B;  2OCC B;  2E5L B;  2EIM B;  3K58 A;  1WP8 A;  2OIE A;  4FFB A;  5L3D A;  4ZOL B;  1OHH G;  4ZI7 A;  4XDK A;  3ZRW B;  2GSM B;  4DV3 O; 
#chains in the Genus database with same CATH homology
 5FL7 G;  3ML0 A;  1H8E G;  3NXS A;  2EIL C;  3SPC A;  3ZMU A;  4GX5 A;  2X7R B;  5B3S B;  5DN6 G;  3OAA G;  1YJN V;  3OMI B;  1OZ0 A;  1OCC C;  3RBZ A;  3LDC A;  4GX2 A;  1V55 C;  1VQ9 V;  2CK3 G;  1QVG U;  5EC2 C;  2B1I A;  4BW5 A;  1M57 C;  2JDI G;  2QE7 G;  1K73 W;  3P30 A;  3AEI A;  1VQK V;  1M90 W;  3ABT A;  3SYO A;  2IH1 C;  1K92 A;  3E86 A;  2WLH A;  2HFE C;  4LP8 A;  4JAU A;  4JPR A;  4PDL A;  2Y69 C;  2P90 A;  5LHG A;  2D3O W;  4FK5 C;  2UXN A;  1WPX A;  4N23 A;  1V54 C;  4MVQ A;  2HVK C;  1SER A;  1ROP A;  4QPJ A;  3ETE A;  3ABU A;  2HG5 C;  3ZMT A;  1QLE B;  3P32 A;  1VQO V;  4MVR A;  4RQE A;  1PNM A;  4HAM A;  1RPO A;  2Q68 A;  1J95 A;  1K5Q A;  3LSQ A;  3OE7 G;  3ABL C;  1KD1 W;  2DYR C;  3ABK B;  1P4R A;  1VQ7 V;  3CCR V;  1WLE A;  1R3J C;  1K4D C;  2EIK B;  3AG4 B;  3K08 A;  3SPI A;  1W0K G;  3E35 A;  2F43 G;  3JD3 A;  5IY5 B;  2DYS C;  5CBG A;  2X0L A;  3AG3 B;  4G2K A;  3DTU B;  4LC1 A;  2LP7 A;  4TSF G;  3CC7 V;  3JD1 A;  2UXX A;  1RM1 C;  2IW5 A;  3CCL V;  1CP9 A;  3B77 A;  3F7V C;  3CCS V;  1GTO A;  2ZR2 A;  5HFL A;  3CCQ V;  2PI4 A;  2A79 B;  1G8M A;  3RVZ A;  1NVP B;  2PI5 A;  4JAS A;  4WCE V;  5B1B B;  2DQ0 A;  3JD0 A;  5E1A C;  3OEE G;  3ZMS A;  3CXC U;  3G6E V;  1R73 A;  5H9C A;  3E8F A;  1S76 D;  2WLN A;  3E83 A;  3WG7 C;  3T4Z A;  3BY6 A;  1VQN V;  1NJI W;  1H2G A;  1VQ8 V;  2W6J G;  5H6R A;  4MTX A;  3K79 A;  1BMF G;  2BOC C;  1R3K C;  5IYC O;  4E2L A;  2Z5U A;  2H94 A;  2B1G A;  4R50 A;  2HJF C;  3ASN B;  3E8G A;  3JD4 A;  1F4M A;  4ZKI A;  2QM7 A;  1MOF A;  4H33 A;  2XAG A;  3FYI B;  5LBQ A;  4G27 B;  2DW4 A;  3ETD A;  4J9Y B;  2JEX A;  2W0F C;  2EIN B;  2WSS G;  3AG2 C;  3ZMZ A;  2X6C A;  1Q86 W;  2XAF A;  3HPL C;  1E1Q G;  3E8B A;  5KUK A;  1CEZ A;  3F7Y C;  5EBL C;  2IU0 A;  3TK1 A;  4PA7 A;  1BL8 A;  3MHS C;  3ZJZ A;  1UJW B;  1KP3 A;  2XOK G;  4UV8 A;  4XBF A;  1SET A;  1EBO A;  2C2A A;  3R65 A;  2EIM C;  1NH2 D;  1R6N A;  4RO2 A;  4TWK A;  5CBF A;  2IJK A;  3JYC A;  3E2E A;  5L3C A;  1JVM A;  5LGN A;  2EIJ B;  1KC8 W;  2WAM A;  5L3B A;  4GCZ A;  4U7O A;  2XND G;  5B3S C;  4WFF A;  4UVA A;  1YJ9 V;  2QKS A;  3W7S A;  1KQS U;  4UUJ C;  4RAI A;  2KB1 A;  4XDL A;  2YEV B;  3VOU A;  3CD6 V;  1H8H G;  3F5W C;  4KFM A;  4MW3 A;  3LSS A;  3OUS A;  1GO3 F;  3GWO A;  1ZWI C;  3CC2 V;  3FB7 C;  2ZQM A;  2BOB C;  3OM3 B;  5H6Q A;  1YIJ V;  2DWD C;  4PDV A;  3ZMV A;  3FB6 C;  2K1E A;  4P2Z A;  3K0D A;  5KA6 A;  5LHH A;  1XL4 A;  1VQ5 V;  5EBM C;  3OUF A;  1HWY A;  1VQL V;  4JTD B;  1JOY A;  3B8M A;  1DTO A;  2P67 A;  3K06 A;  2DQ3 A;  1QLN A;  3ZN0 A;  3FB8 C;  1K34 A;  2IH3 C;  4CBC A;  2ATK C;  3CCV V;  4U7N A;  1QLE C;  4J9Z B;  2H8P C;  2JJ2 G;  1S77 D;  2XAQ A;  5KUM A;  2WLI B;  1K9M W;  4UV9 A;  3HB3 B;  1S5H C;  3QO5 A;  3OFN G;  3ABK C;  4PA9 A;  1E79 G;  1QR8 A;  1AI6 A;  2EBO A;  2WLL A;  3AG4 C;  2EIK C;  1NR7 A;  3K04 A;  1K7D A;  3QNE A;  5IY5 C;  3AG3 C;  3A0R A;  3ZRS A;  3TET A;  2V7Q G;  4X8A A;  1OCR B;  2JIZ G;  2NNU A;  1Q7Y W;  1YTF D;  4Z1M G;  3CCE V;  4QIW F;  1TUE B;  1F23 A;  3FKS G;  3LNM B;  2Q6A A;  5B1N A;  3M99 B;  3W7X A;  1VQ4 V;  4PA3 A;  3SPJ A;  2JEU A;  4MVU A;  5B1B C;  5L3E A;  4JGS A;  3EFF K;  3AG1 C;  4MVS A;  3IC7 A;  5J9P C;  4GX0 A;  2MK3 A;  1S0V A;  3ZN1 A;  1E1R G;  2A0L A;  3SPG A;  3VBB A;  4PA6 A;  3D36 A;  3ASO C;  3ASN C;  4I9W A;  1MSW D;  1MAB G;  4BAY A;  1PNK A;  2Q69 A;  4WFH A;  3CCM V;  1M1K W;  1JX9 A;  3QO7 A;  4P9P A;  2GHY A;  5L3G A;  2WWW A;  1FXK A;  2EIN C;  3STL C;  3ZRV A;  1NVP D;  1I5Y A;  2M7W A;  3AG1 B;  2HKO A;  4OXS A;  1DF5 A;  1Y66 A;  3DGE A;  2YEV A;  1JCH A;  1VQP V;  1EZJ A;  1F4N A;  1NR1 A;  2WLL B;  1JQ0 A;  4P9O A;  3ASO B;  1SES A;  3OEH G;  1IXM A;  3D3I A;  1BHA A;  1AJN A;  1AR1 B;  1OCO B;  4PDM A;  4QPK A;  4MSW C;  3G4S V;  2OTL V;  2ZDI A;  4JYB A;  1ENV A;  3BEH A;  2EIJ C;  3MHH C;  3E8H A;  2B5U A;  2IU3 A;  2Q67 A;  4MS2 A;  4MVM A;  3OR6 C;  5C93 A;  1RPR A;  4RUE A;  1P7B A;  1ORQ C;  2XAS A;  3K9A A;  3CP1 A;  5EC1 C;  3STZ C;  1G4Y B;  2WLI A;  2ZD9 A;  1DLB A;  3SYC A;  3IFX A;  1AI7 A;  3CCJ V;  1MG1 A;  3H01 A;  4Q20 A;  2WLK A;  2XAH A;  2X6A A;  1R3I C;  4QE9 A;  3T1C A;  4RQF A;  4WFE A;  2FTK A;  1GM8 A;  1W0J G;  1L1F A;  4X88 A;  2ZDI C;  3ZRX A;  1FXK B;  1KP2 A;  5CBH A;  1FXV A;  2IJJ A;  5CA3 A;  2WLJ A;  5EBW C;  1M56 B;  1LNQ A;  4KUM A;  1QBZ A;  1EFR G;  2LFS A;  4KP4 A;  3JD2 A;  1N8R W;  3CYO A;  2P6J A;  1JPX A;  2R9R B;  3JCZ A;  2ZR3 A;  2NLJ C;  3PJS K;  1W2B U;  1YJW V;  1PNL A;  4R8C A;  4UVB A;  3G71 V;  5BZB A;  4WF9 V;  2ZXW B;  1Y4M A;  3LDE A;  4ASU G;  4DXW A;  4N21 A;  3W7T A;  4JYC A;  1OCR C;  1R3L C;  2QM8 A;  4LBE C;  5B1O A;  3FYE B;  5L3F A;  1K3E A;  1DF4 A;  4MW8 A;  1SRY A;  1K5S A;  1SZT A;  3E89 A;  1F51 A;  4TT3 G;  2HVJ C;  4ZBM A;  3X2Q B;  3SYQ A;  1K97 A;  3MD0 A;  1OCZ C;  3FB5 C;  4JF3 A;  1AI5 A;  4GT1 A;  3IGA C;  3UKM A;  2OTJ V;  4DO2 A;  4MVZ A;  1K4C C;  1FXH A;  2JJ1 G;  3LDD A;  5HFM A;  1AJQ A;  3W7U A;  5IYD O;  4MTO A;  3CPW U;  3CCU V;  3K3W A;  4HYO A;  3SJQ C;  3OMN B;  4R6Z A;  5KA5 A;  3LUT B;  1PD3 A;  1YHQ V;  1K33 A;  4WFA V;  1Q82 W;  2QEX V;  1BHB A;  2EZO A;  2DWE C;  2AHY A;  4MTG A;  3OW2 U;  3SYP A;  4MVO A;  1GMG A;  1OCZ B;  2V1D A;  1H38 A;  2AHZ A;  2EIL B;  2QTO A;  3GB7 C;  4PEL A;  4EKW A;  4WFB V;  3QO8 A;  5CN0 A;  3ETG A;  1OCC B;  2A9H A;  1YTF B;  5B1A C;  1XL6 A;  2W6I G;  2QA4 V;  1V55 B;  2EZP A;  1NKD A;  1OCO C;  2R9I A;  4JAV A;  3EHB B;  3K03 A;  1B6Q A;  1M57 B;  2IJH A;  1VQM V;  3ZCC A;  1NBM G;  4P30 A;  4FJC C;  1M9N A;  3KG2 A;  1QCE A;  1AJP A;  2JK5 C;  5LHI A;  2HR3 A;  4BIU A;  1ARO P;  2Y69 B;  4L87 A;  1YSC A;  4JTC B;  3CME V;  5B1A B;  3RW0 A;  1I5X A;  1V54 B;  2Z3Y A;  3W7W A;  1GM7 A;  2P7T C;  2WLM A;  3OMA B;  1AI4 A;  4LCU C;  2IJI A;  3OGC C;  3SYA A;  5DM6 V;  3ABL B;  4UXN A;  5EK0 A;  2ITD C;  2DYR B;  4X89 A;  4G28 B;  4JTA B;  3ZIA G;  3UM7 A;  1JJ2 U;  1FXK C;  3T2M A;  2HLD G;  4GX1 A;  1S72 V;  2DYS B;  3ABM C;  2Y48 A;  3I55 V;  2ITC C;  4MT8 A;  1M56 C;  1RM1 B;  5GW7 A;  3ZRW A;  4CZZ A;  4H37 A;  1VQ6 V;  2OT5 A;  2EJR A;  3TCU A;  2LFR A;  4R7C A;  4BIZ A;  4UVC A;  1YI2 V;  5CMU A;  4XDJ A;  3WG7 B;  4FMT A;  4MTF A;  2ZXW C;  3ABM B;  5LGT A;  1PKX A;  2OCC C;  1QVF U;  4F4L A;  4QNH B;  1NH2 B;  4YXW G;  1KEC A;  2WPD G;  1NQT A;  5LGU A;  1GKF A;  1FS0 G;  4FPP A;  1R6K A;  4QJF B;  3X2Q C;  5IDJ A;  3I56 V;  1GK9 A;  1THZ A;  3OR7 C;  4I5S A;  3AG2 B;  3T4D A;  1COW G;  4FIP C;  4WFG A;  1Q81 W;  1KKD A;  4QE7 A;  3SPH A;  2XAJ A;  4RUF A;  1CPY A;  3CMA V;  4HZ3 A;  1QR9 A;  5IYB O;  1GM9 A;  2X6B A;  1K8A W;  3CC4 V;  2OCC B;  2YSU B;  3B8N A;  2EIM B;  3K0G A;  1YIT V;  3WFV A;  4PDR A;  4PA4 A;  5L3D A;  1FFT B;  1OHH G;  1S3J A;  3RVY A;  1PL0 A;  4XDK A;  3ZRW B;  2GSM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...