5KA6A

Hiv-1 gp41 variant q552r and l555m resistance mutations
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
83
structure length
79
Chain Sequence
MQLLSGIVQQRNNMLRAIEAQQHLLQLTVWGIKQLQARILGGHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transmembrane protein gp41
publication title Receptor Activation of HIV-1 Env Leads to Asymmetric Exposure of the gp41 Trimer.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Membrane protein
total genus 35
structure length 79
sequence length 83
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ka6A00
2MK3A 1ENVA 4N21A 4G2KA 1JQ0A 1JPXA 1DLBA 1DF5A 1Y4MA 1MOFA 2EZOA 1QBZA 4FIPC 3M99B 2M7WA 2EBOA 1DF4A 5CMUA 1MG1A 1EBOA 3B77A 3CYOA 1I5YA 3P30A 5H9CA 3GWOA 3K9AA 1I5XA 1QR9A 5HFLA 5HFMA 5CN0A 4E2LA 4FJCC 5KA5A 1K33A 1QR8A 2P6JA 4FK5C 3CP1A 1F23A 5KA6A 1K34A 2EZPA 2LP7A 1SZTA 1QCEA 2OT5A 3B8MA 3MHSC 4N23A 4JPRA 3WFVA 3MHHC 3H01A 2X7RB 1Y66A 3B8NA 4JGSA 4JF3A
chains in the Genus database with same CATH superfamily
3JARB 3O9OA 3GWOA 1S76D 3HKBA 3OUFA 4F6EA 4TV9A 3CX5F 4J9YB 2CGNA 3T2MA 2YI8A 3W7UA 1SZTA 3HR0A 2YDEA 3WFVA 1HR0B 4FLVA 4KHPB 1AI5A 1Q43A 1UPGA 2UXBB 2B1GA 1NI8A 4JI2B 2JS5A 4ZI7A 5GTIZ 3B4SA 1PL0A 1Q7YW 2Y69B 3JD1A 1XNQB 2FTKA 1N33B 5CA1A 4DV1B 2DW4A 2WLJA 3APQA 2A9HA 3IGAC 4ABMA 1L0LH 4P30A 1Z5WA 1PKXA 2KG7A 4JI4O 2NN4A 3HKEB 4IIJA 3CCJV 4TUYB 1JVMA 1QR9A 4ZOLA 3BPZA 4NKGB 1MZEA 5IWAO 1VQ8V 5KA6A 1S0VA 3C3SA 4Z2WA 1IX9A 4UVBA 4ASUG 2LFSA 3CCUV 1GM9A 2IM9A 1XI1A 1U97A 1Z5VA 2FB5A 2W6JG 2YSUB 3OT7A 2KQXA 4DV7O 2QWPB 1ORQC 4PA7A 3CSXA 2VRZA 4LNUA 1N0NA 1H2LA 2UUCB 4H44B 3SYPA 3AG2B 2Y48A 2Y4UA 4DV3B 3SJBC 1FJGB 4R6ZA 4QGPA 1KB9F 2WLIA 1DK1A 3H1JH 5EZYA 2RDCA 4I9QA 3STZC 3AG3C 1ZWIC 5HFMA 3SPCA 2DN9A 3KG2A 4DV5B 4X1YB 3T1YO 3A0HZ 4YJ2B 3RVZA 2Q8VA 2WLKA 3K5LA 1Q6IA 1NR1A 1FD9A 1I0HA 5BR8B 1BCCH 2QTOA 4KUMA 4DV2O 5JVDA 4ZHQB 4X1IB 5EC2C 4I55B 3B8MA 3CB2A 1YITV 1M4UA 3CJHA 2QTSA 1GM8A 1Q6HA 2R9RB 1PD3A 4DUYO 5GONB 1N4CA 4TV8B 1RFYA 3E8HA 4QNHB 1FXKB 1KQSU 1VQOV 3G67A 4DR1O 1J5EB 1YF2A 4O2BA 2ITDC 4J7KA 1AVMA 4OGQB 3AG7A 5FPRA 3SR2C 4WCEV 2X6CA 3AK1A 4TWKA 3WU2Z 4U3JA 4IT5A 3ZHTA 4OX9O 4UCOA 5LGUA 3G71V 1GH6A 4JYAB 1SETA 1SQQH 4LP8A 5KLVH 2ZCEA 3RN4A 2F66C 3OD4A 3CXHF 3BEHA 5EK0A 4WFHA 1AJQA 2P90A 1XMQO 2CTPA 3R66A 4LH6A 3E8GA 5LMNB 5H2FZ 3D36A 3E89A 3B09A 3ZRWB 1FXVA 1XNRO 1QQCA 3JAMN 4B08A 1THZA 4CZZA 3DGEA 5KX5A 1H8EG 4K8ZA 4KHPO 3CS5A 1K97A 2WLMA 2OYQA 1OCZC 2UXBO 2IW5A 3AK2A 1OJHA 3AK3A 4JI2O 3JD3A 3F7YC 4DR3B 4O2AB 1XNQO 3OAAG 3HKCB 1N33O 4DV1O 3JALA 1ROPA 4QPJA 1M1KW 2ZXWB 2XNDG 3UT5A 1NKDA 5F2VO 4PHZA 4X8AA 2UXNA 5BMVB 5KMGA 4PA4A 1Q86W 2JGDB 5FL7G 1VIBA 4I4TB 2JS3A 1YCIA 1PM9A 4NXNO 4DR6B 1R3LC 3JCUZ 3HKBB 4DV0B 4TV9B 4GX0A 5CB4B 2R72A 1LNQA 2LW7A 5E79Z 5CMUA 4MW3A 4HNAA 3QG5A 3G6BA 1BT8A 1RPRA 1VF6A 1PNKA 4WFFA 1OCCC 1QU7A 2GUZA 2WLNA 4YIPA 3M7MX 1YDXA 2XAGA 3LSQA 1EFRG 2WWWA 4FVMA 4X1KB 4DXWA 1CXZB 2Q73A 5FPOA 3CPWU 4C7UA 2N04A 4Q20A 2Q7HA 1ZX3A 4FLXA 4MVUA 2UUCO 5IYDO 5CA1B 4YY3O 3N2GA 4JZGA 2BSKA 4PDRA 5IT9N 5JJJB 4DV3O 4TQDA 2P6JA 2WA4A 1FJGO 4AQYB 4OPHA 1KP2A 4NB5A 2KG7B 4IGGA 4I0XA 3ML0A 3MD0A 2H8PC 4JTAB 4ZOLB 2MW2B 1SA0B 4LBEC 4DV5O 4LFAO 3CRMA 3ZHUA 2YXLA 2AXTZ 3OMNB 3X2QC 3SJCC 4G28B 2LQTA 2ZM6B 1V55C 4HYOA 4MVZA 2ETNA 3G4SV 4UV9A 3E35A 4NYKA 5BR8O 2IH1C 3CRCA 2M6YA 4YJ3B 1IURA 2MK3A 2P5OA 2AZ2A 4LNUB 4MT8A 3GB7C 3SYOA 2EZOA 4RWUA 2EJ7A 1KYOF 1YXBA 1QR8A 2LGQA 3ABMC 4B3SB 3AG1B 2P06A 3HKEA 2RN9A 1OV9A 3PJSK 4TUYA 5J2UA 5EZYB 2PI5A 1M57C 1W59A 3A2FA 4TT3G 4MTFA 2HJFC 1WPBA 2BTQB 1J5EO 3IJ4A 1SESA 4X65B 3E2EA 3SJAC 4EB6A 4GKKB 4O4IA 3K0DA 3KZIZ 5JH7A 3D3IA 1NR7A 4B3TB 2F4VB 3BVOA 1WJZA 3RBZA 3N2KA 2Q5ZA 1YI2V 1K4CC 4UB6Z 2O57A 5FNVA 1FFTB 3BRCA 5LBQA 2K1EA 1Y67A 1Y4MA 4JTCB 1V54C 5B66Z 1B06A 5LMNO 5J2TA 3I55V 5CA0A 1NVPB 1HNWB 3L71H 3F5WC 4FZ0A 3LDCA 5LP6A 4L8JA 3WG7C 1WAZA 4GX1A 1BHBA 3SYAA 5JQGB 2CAZC 5IWAB 5B1AB 4YJ2A 2OTLV 2JRIA 3HPLC 1SQGA 1P7GA 1IDSA 5H6QA 4DR3O 2IU0A 5CN0A 3U11A 3BFRA 2ZR3A 4X66B 2DWEC 2P7TC 4XBFA 2E3CA 1R3JC 4CS4A 4JYCA 4BIZA 3M8AA 3X2QB 4I5SA 2WSSG 1NJIW 4ZHQA 1GMGA 4X1IA 2PGGA 2RMKB 4I55A 1PPJH 3CWBH 3P3NA 1Q6UA 2EX3A 1AI7A 1OCOB 4MSWC 4DR6O 1K73W 4DR5B 5LGTA 4NXMB 4DV0O 4U3FH 5GONA 2ILMA 1UFIA 1FXHA 2UUAO 4FLZA 4CC6A 1S5JA 1XMOB 1L0NH 2X6AA 4K3AA 4I7ZB 3OMAB 3BCCH 3K79A 5LHGA 3TXQA 3CE2A 3KCYA 5B1NA 1DTOA 3STLC 1N34B 2QE7G 4GYCB 2Q7EA 5H5NA 5KHGA 2QWNB 1QVFU 1WA8B 4PJ0Z 1H2GA 3QO8A 3ZBHA 3CXCU 5DM6V 2YIDA 3WB2A 1J95A 4IYHA 3UT5B 2ZE8A 5KMGB 2NLJC 1NVPD 2ZINA 2Z3YA 4JAAA 1M5IA 1RP3B 3UCSC 3OTFA 3RVYA 3ZRWA 3RYIB 5EIBD 3CCMV 1R6NA 3ZMSA 1NTZH 4UFZA 1COWG 1Y6XA 2ZM6O 1GN6A 2Z5UA 3LSSA 3AG2C 3A0BZ 4WBNB 1AR4A 3IAYA 2BOCC 2UXXA 3QO7A 2LGWA 4G27B 4R7CA 4E2LA 4FJCC 3L74H 2ZNJA 2ZKOA 2JIZG 3RWRD 1URFA 4FM2A 4DV6O 1N36B 3N2GB 2BSKB 4K35A 1GAXA 4B3SO 5L3FA 1MSWD 1U96A 3VOUA 1VQKV 2KKWA 4I4TA 2W0FC 2YUAA 4I0XB 3VBBA 3RW0A 4GX5A 3T4ZA 3CCQV 3WB0A 5CB4A 1XNRB 4HAMA 1NQTA 3K5MA 4X65O 1XREA 2YXHA 4QE7A 2EULA 3ASOB 1BSMA 3H01A 5KHIA 1CP9A 1M56C 1M93A 1Y66A 4GKKO 5DEDA 4B3TO 2F4VO 4X1KA 3RYHA 2FYUH 5DN6G 4O4JA 2ZT9B 3JAKB 4BIOA 1GM7A 2V7QG 1MA1A 3W7TA 1D2DA 4DYLA 3LNMB 1FXKC 3OMIB 2N74A 4JGSA 1HNWO 1BHAA 3CRQA 4TQFA 3H1IH 5C8YA 4JAUA 4PI2A 2DE0X 4J42A 1N8RW 4IYIA 5K1XA 1M90W 5J2UB 1SA0A 4NXNB 2QGNA 4CH6A 3U10A 1IBLB 2AHYA 4PD4F 4UCTA 4LF5B 3CMAV 4EB6B 4O4IB 5JH7B 4HBNA 4X66O 2A79B 2QWRB 4NVPA 3ZRXA 2ADPA 4TOIA 2VQEB 2AW9A 1XBLA 3N2KB 4YJ3A 5FNVB 4CS2A 4J7ZA 1Y76A 3J80N 1US6A 3TCUA 4YY3B 3ZMZA 2QKAA 3TETA 5J2TB 2WLHA 5CA0B 5LL6Y 4JV5B 5B1BC 4DR5O 3E22A 3A8TA 4NXMO 1NTMH 2UXDO 1AP6A 5LP6B 1XMOO 2L6LA 1YHQV 2BTQA 1JJOA 2ARHA 4CC5A 3ZMUA 4LFAB 3THOA 1N34O 4B3MB 2ZXWC 3OW2U 3F7VC 5EBMC 2ZQMA 2JGUA 5KA5A 2EIJC 3RT3C 3AG4B 4JI1B 3K58A 3NR7A 3OUSA 3ZHRA 1X59A 2V4DA 5LXTB 1Q82W 3CC4V 4LF8B 1K34A 1M56B 1TUEB 2CH7A 1S72V 4X62O 2Q67A 1G6UA 4DK1A 2YIAA 5KUKA 4JF3A 3G80A 4BW5A 3D8CA 2CGOA 2QM7A 3FX7A 3OM3B 2AZ0A 2KSDA 5JQGA 1I5XA 1NTKH 5JJEB 3R65A 1W0JG 4RO2A 3FYEB 5D5PA 5L3DA 3SGIA 1N32B 2X7RB 1G1XB 1AJNA 1NT2B 4FLYA 4GUNA 1VEWA 1N36O 1AILA 1MZFA 4LWSB 4LF7B 1D5NA 1V9PA 1FFXA 3FD9A 1Z2GA 2F23A 1AR5A 1IXBA 1EZJA 3OR7C 1IBMB 1H2KA 2K9PA 1O9HA 3T1HB 1SF9A 2Q0OC 1KU9A 1W0KG 2EILB 4H33A 4FIPC 4J10A 5BXZA 1R6KA 3ETQA 1MABG 5L3EA 1WB7A 4EKWA 4U7OA 2DYRB 2HKOA 2IBZH 4YIOA 3TK1A 5B1BB 1H8HG 5FLXN 4LC1A 4PA3A 3AG1C 3RFRA 2ODMA 1WA8A 2KB1A 2QM8A 1TAEA 4LF6B 4CS3A 4F6RA 5DECA 1K4DC 1GRJA 4WFBV 1GK9A 1BGYH 1LR1A 1D5AA 3CP1A 1YSCA 5IJ9A 2EIJB 4D7TA 4WF9V 1QCEA 3DC5A 1BE3H 3AEIA 3RYIA 3MHHC 4JI6B 2ZDIA 2YIBD 4GT1A 3ICXA 3K9SA 2XAQA 1QLEB 1YJWV 2UUAB 4B7EA 1R73A 3JD2A 1IBLO 3CYOA 2OTJV 3SPGA 2PTMA 4U7NA 4LF5O 2NNUA 2IJIA 4W4LA 4WBNA 4DV4O 2EIMB 2JJ1G 4FPPA 3RYHB 2VQEO 4FMTA 4O4JB 4XDLA 5EIBC 4K8XA 2RJZA 2ITCC 3K5OA 3P3PA 1KC8W 1R6TA 5B1AC 3FKSG 2DOSA 4JV5O 3JASB 5BZBA 3ZHQA 5C8YB 4UCVA 3FB7C 1K5SA 3WB1A 2N05A 3QNEA 5KUMA 1DF4A 4B3MO 4PDLA 3EHBB 3CCVV 1OHHG 4UCRA 2XAFA 1I08A 3W7SA 1LUWA 3CCLV 4LFBB 4JI1O 4JI3B 4JI7B 1SQBH 4LCUC 5J9PC 3D36C 5IYZA 1OCOC 3JAKA 3C90A 2B5UA 1NZ6A 1H2SB 3O65A 2GBOA 2GSMB 3ETDA 4LF8O 3FAVA 1SQXH 5KAIZ 1YVWA 2WAMA 3K5NA 3B77A 1ZLZA 3ZRSA 1Y76B 3EFFK 4DV6B 2HLDG 1QVGU 5LMUB 4DK0A 3E22B 1E1RG 3ABUA 4JPRA 5LA6A 2Y0IA 3K0GA 1T5EA 4L87A 1BS3A 4Q6GA 3PN1A 1QNMA 3L70H 4DR2O 1YEWA 2Y0PA 4LF4B 1YJ9V 5CBHA 2OIEA 4ICGA 1EBOA 3UKMA 4PDMA 1BMFG 1N32O 1TVKB 2JK5C 5B5EZ 4MVMA 4DR4O 5BY1A 1JMKC 1KECA 2ZE6A 2ZDIC 1HNZB 4BW9A 2XUMA 3SJQC 5KHKA 1I94B 1AI6A 4H37A 4LF7O 3J7AU 2PI4A 2R9AA 2CH7B 3ASNB 2YICA 2HFEC 4UXNA 5IDJA 3ZHVA 2IU3A 1VF6C 1SZXA 1Q8IA 1JR9A 3ZEDA 1IBMO 3T1HO 3KCXA 1WNSA 5EBWC 2DQ0A 3H1KH 3OGCC 1HP8A 5JCOA 4P9OA 3CRRA 5JJNB 3JATA 2E74B 1AJPA 5KHHA 3K03A 1PNMA 1X4TA 3L72H 1HW7A 3B2EE 1JJ2U 2PY5A 1XEQA 2FL4A 4DR7B 4CH3A 1O9GA 2NR5A 5K1PA 1GN2A 3LNNA 3ABLB 4UVAA 3ZCCA 4LF6O 1XMQB 5LXTA 1S5HC 4DW0A 4KL1A 1EM1A 2JEUA 3IFXA 3B8NA 4J11A 2Q0AA 1GN4A 3ZIAG 3ASOC 3S3XA 3P30A 1TUBB 1FFXB 2QA4V 1I7FA 4HZ3A 1KKCA 4JI6O 2F95B 3ETEA 1TA8A 3K57A 2YIBA 2UXDB 3FYIB 2CTQA 3QF7A 4MS2A 2EINC 5A9GA 3FB8C 2ATKC 4D7SA 4DRXB 4JZ2A 2F43G 2CE4A 3CHXA 5L3CA 2UXCB 3JSNA 4FK5C 3GWKC 2YEVA 2B9ZA 4F6RB 1P49A 4Z1MG 4LWSA 4CH5A 2RQ6A 2JVDA 4X62B 5IJ9B 1K8AW 3A0RA 3K06A 5EC1C 2QR4A 5LGNA 3LDEA 5E1AC 2EZPA 4ZIBA 2G38A 1GO3F 1ZAUA 2IJHA 4LFBO 1DLBA 4FLUA 4JI3O 2XOKG 4JI7O 2EBOA 4KXRA 2JJ2G 4GKJB 1IBKB 1P7BA 2ADQB 2WPDG 3CD6V 5IE9A 5LP6C 1PNLA 5JCOC 2JDIG 2OCCB 2P4KA 1WP7A 3JCZA 1R3IC 3RGBA 2Q7GA 4DUZB 5LMUO 4RUFA 2ZE5A 4P2ZA 1RM1B 3W7XA 3AG4C 2QSAA 4MVRA 3ABKB 4LF4O 2EIKC 1Q81W 4RQFA 2YC0A 2CK3G 3CRAA 1FAFA 1Q3EA 2PYLA 3KKYA 3ZMTA 4FLWA 2PUSA 3CCEV 3MDSA 5LOVB 2XT9A 3DC6A 5IYZB 2ZNIA 1HNZO 2P4VA 1SS3A 1H2MA 1RSOB 1I94O 1PL4A 2EINB 3FAVB 1LUVA 1SKVA 1WLEA 1A32A 4LFCB 1TGOA 3JASA 1ZTEA 3UO2A 1JPXA 1JFFA 3BY6A 4BWAA 1SQPH 3QVNA 3GVMA 4LF9B 4I50B 2ZE7A 1GTOA 5D5QA 5LA6B 3ZRVA 1K92A 2ZD9A 3LDDA 4MTGA 1KBHA 1FS0G 2VWJA 2X0LA 3SPJA 1IZ3A 2XTAA 1VQ4V 3CC7V 4YHHB 4DV4B 4DR7O 4B3RB 2YS8A 1SC5B 1BQZA 3ABTA 3K9AA 3EXAA 5KHJA 2EILC 4BR6A 2E5LB 2B1IA 2WLLA 2GTAA 4IHJB 4FM0A 2HEPA 2QKCA 4P9PA 4JAVA 1EZVH 1H38A 4CBCA 4OXSA 2DYRC 3N27A 2XHBA 5C93A 1Q5OA 2OIGA 5GTHZ 5TISZ 2D3OW 1BL8A 3BA8A 3JSLA 1YJNV 3JATB 1F23A 3OEHG 1VQPV 3HB3B 5KAFZ 5B3SB 4X9QA 5EYPB 1TVKA 2E76B 2UXCO 3E8FA 1OCRC 5H6RA 3I56V 1K7DA 2F1MA 4X89A 2EIKB 2R70A 1QLEC 3UO3A 1VQMV 2QKSA 4J41A 1AB3A 4JYBA 1R3KC 1JOYA 5GW7A 5ITZB 2HJDA 4XDKA 1AI4A 1MMMA 2VWKA 2P67A 3K08A 2EIMC 3RYCB 4Z1VA 4OPAA 4AHCA 4GZRB 1HNXO 4DR2B 1HWYA 3FB5C 3BHPA 3VQXA 1QLNA 4PA9A 3H1HH 4X20B 2CTRA 3OR6C 1YTFB 4GKJO 1IBKO 4DR4B 4PDVA 1ENVA 2HP8A 3L73H 5A2QN 1XL4A 1XUQA 2YEVB 2VQFB 4ZKIA 2LFRA 3OEEG 2HVJC 3G6EV 2GDSA 4DUZO 4D6TH 1TUBA 4J7JA 3JAWA 4O4LB 3RYFB 3FB6C 1FYJA 1KMIZ 1XOUA 2JEXA 2YI9A 4EFEA 4J80A 1I5YA 1SQVH 1P84F 2RCVA 3L75H 3ZX6A 3VQYA 3CCRV 2F93B 1CEZA 4DW1A 4R8CA 1SRYA 4UCUA 3MHSC 4J9ZB 4NTWA 4DRXA 2A7WA 3JD4A 4N23A 1ZL8B 3IC9A 3Q4HB 1H2NA 1VQ6V 2ZIMA 3DXRA 1KD1W 4UV8A 2Q69A 1AROP 4UB8Z 3HKDA 5LYJA 4JYYA 1HDJA 1L8DA 1HR0O 5IJ0A 2VS0A 2FKXA 4O4HB 2QEXV 4LFCO 4LH7A 4MVOA 2GTSA 3H9VA 3IC7A 2LP7A 4FFBA 3I5DA 4QE9A 4UVCA 4B7KA 3DSQA 1OCRB 4LF9O 4X64B 4KFMA 4JASA 3AG3B 4FFKA 1Y74A 1P4RA 3ZN1A 2GHYA 2OWOA 3T4DA 2LO1A 1VQNV 2HR3A 2XAHA 1F51A 2QM4A 4GX2A 1AP5A 2AGAA 1YTFD 3ZN0A 3ASNC 1M9NA 1N0JA 1OZ0A 4YHHO 1WP8A 2R9IA 2A06H 1VQ7V 4B3RO 1BZKA 2QWOB 1S5LZ 2CTWA 4A5UB 3APOA 1PV0A 4N21A 4G2KA 2E5LO 1MOFA 2HHHB 1G4YB 3M99B 1ZUQA 4QJFB 1NU1H 4CH4A 4EEQA 3U0ZA 3BABA 1JFFB 2OT5A 1UJWB 4JI5B 4ZI7B 5CA3A 2W0XA 5L3GA 3ABLC 4I9WA 3BAAA 5LHIA 2P22C 4MVSA 3SPIA 1JA8A 3ETGA 1EN5A 2UUBB 4UCSA 3JARA 4BIUA 1VQ9V 2IH3C 2IJKA 1F4MA 2DJVA 4IIJB 3NXSA 3ZHSA 5LOVA 1XQ8A 5CBGA 1K3EA 1XL6A 4KP4A 3VQWA 1MSDA 4JI0B 1RSOA 2CDYA 4K0KB 2V1DA 4JI8B 1JCHA 1F7YA 2QWQB 1B3QA 5L3BA 2WLLB 3L9DA 3SPHA 4YXWG 4NTXA 1JX9A 3VQVA 3TJTA 5IYBO 3OTOB 1DGSA 1K33A 2BOBC 2DYSC 2RNBA 3SDLA 3H1LH 4I50A 2BTOA 1KP3A 3F5TA 3K3WA 4NR1A 1SERA 4LR3A 2UU9B 4AI8A 4RAIA 1OCZB 1MG1A 4H13B 1FPOA 1B04A 3K04A 1R1BA 3SYQA 5HFLA 3T1CA 2H94A 2H3OA 1F4NA 2WLIB 1KKDA 1S77D 4EFBA 1KUQA 4FM1A 4WFAV 3BA9A 2VQFO 1B6QA 1K9MW 1E79G 1XILA 4IHJA 1E1QG 1VMGA 2Q68A 1YZBA 2HVKC 3UQ8A 1VF5B 2M7WA 1CPYA 3LUTB 3E8BA 4PA6A 2OCHA 3EVKA 3UM7A 3CEIA 1IXMA 4WFEA 2LJ2A 4JYAO 1XDCA 4MTXA 2DWDC 2FMLA 4FZ1A 4PELA 4MTOA 4BAYA 3OFNG 3S3WA 1K5QA 4PI0A 1OCCB 2OCCC 1ZSPA 5JVDB 2WA3A 1GKFA 5EYPA 4RQEA 5H9CA 1AR1B 1XHZA 4UUJC 3J81N 3CJHB 5EBLC 4QIWF 4JI4B 2BCCH 1RM1C 4IL6Z 2L35A 2XAJA 2Q4PA 4NTYA 1IVSA 1SQFA 1GN3A 4X1YA 3ABKC 5CBFA 1VARA 5IY5C 1NBMG 1VP7A 3C3TA 1PP9H 2E75B 4O2BB 4RUEA 1Q90D 2AHZA 3FFQA 5ITZA 2ZIOA 1VQLV 4WFGA 4ZBMA 4R50A 4U3JB 4X64O 3JAWB 2BE3A 3RYCA 5AG2A 2A0LA 1W2BU 1VQ5V 1RPOA 1NH2B 3E86A 4DV7B 2PZSA 3SYCA 4GLXA 1G8MA 1V55B 4X20A 4TSFG 3JD0A 4MVQA 2DYSB 2ZR2A 4F4LA 1L1FA 3CC2V 4E4EA 2QJ1A 3DXRB 1EN6A 3DTUB 4TV8A 4X88A 3JYCA 1EN4A 2LW1A 3QTCA 2HHHO 2Y69C 2D2CB 1FXKA 3HKDB 4MW8A 5LYJB 3TXSA 1WB8A 5KX5B 1VF7A 5IJ0B 1WPXA 3OE7G 3T1YB 1MNGA 3ABMB 3QO5A 4JTDB 4FFBB 4JI5O 4O4LA 3RYFA 3D3QA 5B1OA 1M57B 1Y74B 1FKAO 2CUGA 4W4KA 1S3JA 3W7WA 3JALB 2Y4TA 2QDOA 2A3QA 4DV2B 2UUBO 3E83A 3ZMVA 1NS1A 1HNXB 4AQYO 1JQ0A 2C2AA 1QBZA 2Z0AA 3CCSV 2PYJA 4DO2A 1ZL8A 3Q4HA 4JI0O 3K59A 1QHTA 4K0KO 5IYCO 4JI8O 3LSUA 4DUYB 3ZJZA 2W6IG 2XASA 1WN7A 1XHXA 2Q9LA 2GV9A 3CMEV 4HNAB 2PF4E 4O4HA 3P32A 1V54B 1BQ0A 4DR1B 2GUZB 3OTOO 2YXYA 3B40A 5JWPA 2EJRA 1DF5A 5B3SC 4O2AA 3WG7B 2Q6AA 4OX9B 1NH2D 5LHHA 4H0LB 3OGIB 3HKCA 1YIJV 4AILC 4GCZA 2HG5C 3MAQA 2DQ3A 4PV1B 4QPKA 2UU9O 3TGUH 3ZS8C 2IJJA 5IY5B 5BMVA 2X6BA 2JGDA 2DMXA 4XDJA 4FLTA
chains in the Genus database with same CATH topology
2EIMC 5B1AB 4XDLA 2OTLV 3HPLC 2ITCC 1KC8W 5H6QA 3GWOA 2IU0A 1S76D 5B1AC 5CN0A 3OUFA 3FKSG 1HWYA 4J9YB 3FB5C 2ZR3A 2DWEC 2P7TC 3T2MA 5BZBA 1QLNA 4PA9A 4XBFA 3W7UA 1R3JC 1SZTA 3OR6C 1YTFB 3FB7C 4JYCA 4BIZA 3WFVA 1K5SA 1AI5A 3X2QB 4I5SA 2WSSG 1NJIW 4PDVA 1ENVA 1GMGA 2B1GA 1XL4A 2YEVB 3QNEA 5KUMA 1DF4A 4PDLA 3EHBB 3CCVV 1OHHG 1PL0A 1Q7YW 2XAFA 2Y69B 4ZKIA 2LFRA 3W7SA 3OEEG 1AI7A 3JD1A 1OCOB 2HVJC 4MSWC 3CCLV 1K73W 5LGTA 2FTKA 3G6EV 1FXHA 4LCUC 2DW4A 2WLJA 5J9PC 2A9HA 2X6AA 1OCOC 3OMAB 3IGAC 2B5UA 3K79A 5LHGA 3FB6C 3ETDA 2GSMB 5B1NA 1DTOA 4P30A 3STLC 1PKXA 2JEXA 2WAMA 2QE7G 3B77A 3ZRSA 3CCJV 1I5YA 3EFFK 1JVMA 1QR9A 2HLDG 1QVGU 3CCRV 1VQ8V 1QVFU 5KA6A 1CEZA 1H2GA 3QO8A 4R8CA 1S0VA 1SRYA 3CXCU 1E1RG 3ABUA 3MHSC 4J9ZB 3JD4A 4N23A 5DM6V 4JPRA 3K0GA 4UVBA 1J95A 4FMTA 4L87A 1VQ6V 4ASUG 1KD1W 2LFSA 3CCUV 1GM9A 4UV8A 2Q69A 1YJ9V 1AROP 2NLJC 1NVPD 2W6JG 2Z3YA 2YSUB 5CBHA 1EBOA 3UKMA 1ORQC 4PDMA 1BMFG 4PA7A 3RVYA 3ZRWA 2JK5C 4MVMA 2QEXV 3CCMV 4MVOA 1R6NA 3IC7A 2LP7A 3ZMSA 4QE9A 4UVCA 3SYPA 3AG2B 1KECA 1OCRB 1COWG 2ZDIC 4KFMA 2Y48A 3SJQC 4JASA 3AG3B 4R6ZA 2WLIA 1AI6A 4H37A 1P4RA 2Z5UA 3LSSA 3AG2C 3ZN1A 2GHYA 3T4DA 2PI4A 1VQNV 2HR3A 3ASNB 2XAHA 2BOCC 1F51A 2HFEC 4UXNA 5IDJA 3STZC 3AG3C 1ZWIC 2IU3A 2UXXA 3QO7A 4GX2A 5HFMA 3SPCA 4G27B 4R7CA 3KG2A 4E2LA 4FJCC 1YTFD 3ZN0A 3ASNC 1M9NA 3RVZA 1OZ0A 2JIZG 2DQ0A 5EBWC 2R9IA 2WLKA 3OGCC 1VQ7V 4P9OA 1AJPA 4N21A 3K03A 4G2KA 1NR1A 1PNMA 1MOFA 5L3FA 1MSWD 1G4YB 3M99B 1JJ2U 3VOUA 1VQKV 2QTOA 4QJFB 4KUMA 2W0FC 3VBBA 3RW0A 4GX5A 3T4ZA 3CCQV 4HAMA 1NQTA 5EC2C 3ABLB 4UVAA 3ZCCA 3B8MA 2OT5A 1UJWB 5CA3A 1YITV 5L3GA 4QE7A 3ASOB 1S5HC 3H01A 1M56C 1CP9A 1Y66A 2JEUA 3B8NA 3IFXA 1GM8A 2R9RB 3ABLC 4I9WA 5LHIA 1PD3A 3ZIAG 3ASOC 4MVSA 3P30A 3SPIA 5DN6G 3ETGA 2QA4V 3E8HA 4QNHB 4HZ3A 1FXKB 1KQSU 1VQOV 3ETEA 1GM7A 2V7QG 3W7TA 4BIUA 2ITDC 3LNMB 1VQ9V 2IH3C 2IJKA 2X6CA 1F4MA 3FYIB 4TWKA 4WCEV 1FXKC 3NXSA 3OMIB 5CBGA 1K3EA 1XL6A 4KP4A 4MS2A 4JGSA 1BHAA 5LGUA 2EINC 3G71V 2V1DA 1SETA 4LP8A 1JCHA 3FB8C 4JAUA 2ATKC 2WLLB 5L3BA 3SPHA 4YXWG 1N8RW 3BEHA 5EK0A 1JX9A 4WFHA 1AJQA 2F43G 1M90W 5L3CA 2P90A 5IYBO 1K33A 4FK5C 2BOBC 2DYSC 2YEVA 3E8GA 2AHYA 3D36A 3E89A 1KP3A 3CMAV 4Z1MG 3K3WA 3ZRWB 1SERA 1FXVA 4RAIA 2A79B 1OCZB 1THZA 4CZZA 1MG1A 3DGEA 3ZRXA 1K8AW 3A0RA 3K06A 3SYQA 3K04A 5EC1C 1H8EG 5HFLA 3T1CA 5LGNA 1K97A 2H94A 3LDEA 2WLMA 1OCZC 1F4NA 5E1AC 2WLIB 1KKDA 2IW5A 2EZPA 1S77D 3JD3A 3TCUA 3F7YC 1GO3F 3ZMZA 4WFAV 3TETA 1B6QA 2WLHA 1K9MW 1E79G 2IJHA 5B1BC 1DLBA 1E1QG 3OAAG 2Q68A 2HVKC 2XOKG 2M7WA 2EBOA 1CPYA 3LUTB 2JJ2G 1ROPA 3E8BA 4QPJA 1M1KW 4PA6A 2ZXWB 1P7BA 2XNDG 1NKDA 1YHQV 3UM7A 4X8AA 2UXNA 2WPDG 4PA4A 3ZMUA 1Q86W 1IXMA 4WFEA 5FL7G 3CD6V 1PNLA 4MTXA 2JDIG 2OCCB 2ZXWC 3OW2U 3F7VC 2DWDC 5EBMC 3JCZA 2ZQMA 4MTOA 4PELA 1R3IC 4BAYA 5KA5A 2EIJC 3OFNG 3AG4B 1K5QA 1R3LC 1OCCB 2OCCC 3OUSA 4GX0A 1GKFA 1LNQA 4RUFA 4P2ZA 5CMUA 4RQEA 4MW3A 3W7XA 1RM1B 5H9CA 1AR1B 3AG4C 4UUJC 1Q82W 3CC4V 1RPRA 1PNKA 4WFFA 1OCCC 2WLNA 5EBLC 4QIWF 2XAGA 3LSQA 1EFRG 2WWWA 4MVRA 1K34A 3ABKB 1M56B 1TUEB 2EIKC 1RM1C 1S72V 1Q81W 4RQFA 2Q67A 2XAJA 4DXWA 3CPWU 5KUKA 3ABKC 4JF3A 2CK3G 5CBFA 5IY5C 1NBMG 4Q20A 3ZMTA 4BW5A 4RUEA 3CCEV 2QM7A 4MVUA 2AHZA 5IYDO 3OM3B 1VQLV 1I5XA 4WFGA 4ZBMA 4R50A 4PDRA 3R65A 1W0JG 4RO2A 2P6JA 2A0LA 3FYEB 1W2BU 1VQ5V 1RPOA 1NH2B 2EINB 3E86A 1KP2A 5L3DA 3SYCA 3ML0A 1WLEA 3MD0A 2H8PC 4JTAB 2X7RB 1G8MA 4LBEC 1JPXA 1AJNA 1V55B 3BY6A 4TSFG 3JD0A 3OMNB 3X2QC 4MVQA 2DYSB 2ZR2A 4G28B 4F4LA 1L1FA 1GTOA 1V55C 3ZRVA 4HYOA 4MVZA 1K92A 2ZD9A 3LDDA 3CC2V 4MTGA 3G4SV 1FS0G 4UV9A 4X88A 3DTUB 3JYCA 2Y69C 1FXKA 3E35A 4MW8A 2X0LA 3SPJA 1EZJA 3OR7C 2IH1C 1VQ4V 2MK3A 1WPXA 3OE7G 3CC7V 1W0KG 4MT8A 2EILB 3GB7C 4H33A 3SYOA 2EZOA 3ABMB 3QO5A 4FIPC 1R6KA 4JTDB 1MABG 3ABTA 3K9AA 5L3EA 4EKWA 4U7OA 2EILC 5B1OA 1QR8A 3ABMC 2B1IA 2DYRB 2HKOA 3AG1B 1M57B 2WLLA 4P9PA 4JAVA 1S3JA 3TK1A 3PJSK 5B1BB 1H8HG 3W7WA 1H38A 4CBCA 4LC1A 4OXSA 2PI5A 2DYRC 4PA3A 3AG1C 1M57C 3E83A 4MTFA 2KB1A 2HJFC 2QM8A 4TT3G 3ZMVA 1JQ0A 2C2AA 5C93A 1SESA 4WFBV 1K4DC 1QBZA 3CCSV 3E2EA 4DO2A 1GK9A 2D3OW 1BL8A 3K0DA 1YJNV 3D3IA 1NR7A 3CP1A 3OEHG 1F23A 1YSCA 5IYCO 2EIJB 1VQPV 3ZJZA 4WF9V 2W6IG 3HB3B 2XASA 1QCEA 5B3SB 3RBZA 3CMEV 3AEIA 1YI2V 1K4CC 1V54B 3MHHC 3P32A 2ZDIA 4GT1A 1FFTB 5LBQA 2K1EA 2XAQA 1QLEB 3E8FA 2EJRA 1DF5A 1Y4MA 4JTCB 5B3SC 1OCRC 1YJWV 5H6RA 3I56V 1K7DA 1R73A 1V54C 3JD2A 4X89A 3CYOA 2OTJV 2EIKB 3WG7B 2Q6AA 3I55V 3SPGA 1NVPB 4U7NA 1NH2D 2NNUA 5LHHA 2IJIA 1QLEC 1YIJV 4GCZA 2HG5C 1VQMV 2DQ3A 3F5WC 4QPKA 2EIMB 2QKSA 2JJ1G 3LDCA 4FPPA 3WG7C 4JYBA 2IJJA 5IY5B 1R3KC 1JOYA 5GW7A 4GX1A 2X6BA 1BHBA 4XDKA 3SYAA 1AI4A 4XDJA 2P67A 3K08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MK3 A;  1ENV A;  4N21 A;  4G2K A;  1JQ0 A;  1JPX A;  1DLB A;  1DF5 A;  1Y4M A;  1MOF A;  2EZO A;  1QBZ A;  4FIP C;  3M99 B;  2M7W A;  2EBO A;  1DF4 A;  5CMU A;  1MG1 A;  1EBO A;  3B77 A;  3CYO A;  1I5Y A;  3P30 A;  5H9C A;  3GWO A;  3K9A A;  1I5X A;  1QR9 A;  5HFL A;  5HFM A;  5CN0 A;  4E2L A;  4FJC C;  5KA5 A;  1K33 A;  1QR8 A;  2P6J A;  4FK5 C;  3CP1 A;  1F23 A;  5KA6 A;  1K34 A;  2EZP A;  2LP7 A;  1SZT A;  1QCE A;  2OT5 A;  3B8M A;  3MHS C;  4N23 A;  4JPR A;  3WFV A;  3MHH C;  3H01 A;  2X7R B;  1Y66 A;  3B8N A;  4JGS A;  4JF3 A; 
#chains in the Genus database with same CATH topology
 3JAR B;  3O9O A;  3GWO A;  1S76 D;  3HKB A;  3OUF A;  4F6E A;  4TV9 A;  3CX5 F;  4J9Y B;  2CGN A;  3T2M A;  2YI8 A;  3W7U A;  1SZT A;  3HR0 A;  2YDE A;  3WFV A;  1HR0 B;  4FLV A;  4KHP B;  1AI5 A;  1Q43 A;  1UPG A;  2UXB B;  2B1G A;  1NI8 A;  4JI2 B;  2JS5 A;  4ZI7 A;  5GTI Z;  3B4S A;  1PL0 A;  1Q7Y W;  2Y69 B;  3JD1 A;  1XNQ B;  2FTK A;  1N33 B;  5CA1 A;  4DV1 B;  2DW4 A;  2WLJ A;  3APQ A;  2A9H A;  3IGA C;  4ABM A;  1L0L H;  4P30 A;  1Z5W A;  1PKX A;  2KG7 A;  4JI4 O;  2NN4 A;  3HKE B;  4IIJ A;  3CCJ V;  4TUY B;  1JVM A;  1QR9 A;  4ZOL A;  3BPZ A;  4NKG B;  1MZE A;  5IWA O;  1VQ8 V;  5KA6 A;  1S0V A;  3C3S A;  4Z2W A;  1IX9 A;  4UVB A;  4ASU G;  2LFS A;  3CCU V;  1GM9 A;  2IM9 A;  1XI1 A;  1U97 A;  1Z5V A;  2FB5 A;  2W6J G;  2YSU B;  3OT7 A;  2KQX A;  4DV7 O;  2QWP B;  1ORQ C;  4PA7 A;  3CSX A;  2VRZ A;  4LNU A;  1N0N A;  1H2L A;  2UUC B;  4H44 B;  3SYP A;  3AG2 B;  2Y48 A;  2Y4U A;  4DV3 B;  3SJB C;  1FJG B;  4R6Z A;  4QGP A;  1KB9 F;  2WLI A;  1DK1 A;  3H1J H;  5EZY A;  2RDC A;  4I9Q A;  3STZ C;  3AG3 C;  1ZWI C;  5HFM A;  3SPC A;  2DN9 A;  3KG2 A;  4DV5 B;  4X1Y B;  3T1Y O;  3A0H Z;  4YJ2 B;  3RVZ A;  2Q8V A;  2WLK A;  3K5L A;  1Q6I A;  1NR1 A;  1FD9 A;  1I0H A;  5BR8 B;  1BCC H;  2QTO A;  4KUM A;  4DV2 O;  5JVD A;  4ZHQ B;  4X1I B;  5EC2 C;  4I55 B;  3B8M A;  3CB2 A;  1YIT V;  1M4U A;  3CJH A;  2QTS A;  1GM8 A;  1Q6H A;  2R9R B;  1PD3 A;  4DUY O;  5GON B;  1N4C A;  4TV8 B;  1RFY A;  3E8H A;  4QNH B;  1FXK B;  1KQS U;  1VQO V;  3G67 A;  4DR1 O;  1J5E B;  1YF2 A;  4O2B A;  2ITD C;  4J7K A;  1AVM A;  4OGQ B;  3AG7 A;  5FPR A;  3SR2 C;  4WCE V;  2X6C A;  3AK1 A;  4TWK A;  3WU2 Z;  4U3J A;  4IT5 A;  3ZHT A;  4OX9 O;  4UCO A;  5LGU A;  3G71 V;  1GH6 A;  4JYA B;  1SET A;  1SQQ H;  4LP8 A;  5KLV H;  2ZCE A;  3RN4 A;  2F66 C;  3OD4 A;  3CXH F;  3BEH A;  5EK0 A;  4WFH A;  1AJQ A;  2P90 A;  1XMQ O;  2CTP A;  3R66 A;  4LH6 A;  3E8G A;  5LMN B;  5H2F Z;  3D36 A;  3E89 A;  3B09 A;  3ZRW B;  1FXV A;  1XNR O;  1QQC A;  3JAM N;  4B08 A;  1THZ A;  4CZZ A;  3DGE A;  5KX5 A;  1H8E G;  4K8Z A;  4KHP O;  3CS5 A;  1K97 A;  2WLM A;  2OYQ A;  1OCZ C;  2UXB O;  2IW5 A;  3AK2 A;  1OJH A;  3AK3 A;  4JI2 O;  3JD3 A;  3F7Y C;  4DR3 B;  4O2A B;  1XNQ O;  3OAA G;  3HKC B;  1N33 O;  4DV1 O;  3JAL A;  1ROP A;  4QPJ A;  1M1K W;  2ZXW B;  2XND G;  3UT5 A;  1NKD A;  5F2V O;  4PHZ A;  4X8A A;  2UXN A;  5BMV B;  5KMG A;  4PA4 A;  1Q86 W;  2JGD B;  5FL7 G;  1VIB A;  4I4T B;  2JS3 A;  1YCI A;  1PM9 A;  4NXN O;  4DR6 B;  1R3L C;  3JCU Z;  3HKB B;  4DV0 B;  4TV9 B;  4GX0 A;  5CB4 B;  2R72 A;  1LNQ A;  2LW7 A;  5E79 Z;  5CMU A;  4MW3 A;  4HNA A;  3QG5 A;  3G6B A;  1BT8 A;  1RPR A;  1VF6 A;  1PNK A;  4WFF A;  1OCC C;  1QU7 A;  2GUZ A;  2WLN A;  4YIP A;  3M7M X;  1YDX A;  2XAG A;  3LSQ A;  1EFR G;  2WWW A;  4FVM A;  4X1K B;  4DXW A;  1CXZ B;  2Q73 A;  5FPO A;  3CPW U;  4C7U A;  2N04 A;  4Q20 A;  2Q7H A;  1ZX3 A;  4FLX A;  4MVU A;  2UUC O;  5IYD O;  5CA1 B;  4YY3 O;  3N2G A;  4JZG A;  2BSK A;  4PDR A;  5IT9 N;  5JJJ B;  4DV3 O;  4TQD A;  2P6J A;  2WA4 A;  1FJG O;  4AQY B;  4OPH A;  1KP2 A;  4NB5 A;  2KG7 B;  4IGG A;  4I0X A;  3ML0 A;  3MD0 A;  2H8P C;  4JTA B;  4ZOL B;  2MW2 B;  1SA0 B;  4LBE C;  4DV5 O;  4LFA O;  3CRM A;  3ZHU A;  2YXL A;  2AXT Z;  3OMN B;  3X2Q C;  3SJC C;  4G28 B;  2LQT A;  2ZM6 B;  1V55 C;  4HYO A;  4MVZ A;  2ETN A;  3G4S V;  4UV9 A;  3E35 A;  4NYK A;  5BR8 O;  2IH1 C;  3CRC A;  2M6Y A;  4YJ3 B;  1IUR A;  2MK3 A;  2P5O A;  2AZ2 A;  4LNU B;  4MT8 A;  3GB7 C;  3SYO A;  2EZO A;  4RWU A;  2EJ7 A;  1KYO F;  1YXB A;  1QR8 A;  2LGQ A;  3ABM C;  4B3S B;  3AG1 B;  2P06 A;  3HKE A;  2RN9 A;  1OV9 A;  3PJS K;  4TUY A;  5J2U A;  5EZY B;  2PI5 A;  1M57 C;  1W59 A;  3A2F A;  4TT3 G;  4MTF A;  2HJF C;  1WPB A;  2BTQ B;  1J5E O;  3IJ4 A;  1SES A;  4X65 B;  3E2E A;  3SJA C;  4EB6 A;  4GKK B;  4O4I A;  3K0D A;  3KZI Z;  5JH7 A;  3D3I A;  1NR7 A;  4B3T B;  2F4V B;  3BVO A;  1WJZ A;  3RBZ A;  3N2K A;  2Q5Z A;  1YI2 V;  1K4C C;  4UB6 Z;  2O57 A;  5FNV A;  1FFT B;  3BRC A;  5LBQ A;  2K1E A;  1Y67 A;  1Y4M A;  4JTC B;  1V54 C;  5B66 Z;  1B06 A;  5LMN O;  5J2T A;  3I55 V;  5CA0 A;  1NVP B;  1HNW B;  3L71 H;  3F5W C;  4FZ0 A;  3LDC A;  5LP6 A;  4L8J A;  3WG7 C;  1WAZ A;  4GX1 A;  1BHB A;  3SYA A;  5JQG B;  2CAZ C;  5IWA B;  5B1A B;  4YJ2 A;  2OTL V;  2JRI A;  3HPL C;  1SQG A;  1P7G A;  1IDS A;  5H6Q A;  4DR3 O;  2IU0 A;  5CN0 A;  3U11 A;  3BFR A;  2ZR3 A;  4X66 B;  2DWE C;  2P7T C;  4XBF A;  2E3C A;  1R3J C;  4CS4 A;  4JYC A;  4BIZ A;  3M8A A;  3X2Q B;  4I5S A;  2WSS G;  1NJI W;  4ZHQ A;  1GMG A;  4X1I A;  2PGG A;  2RMK B;  4I55 A;  1PPJ H;  3CWB H;  3P3N A;  1Q6U A;  2EX3 A;  1AI7 A;  1OCO B;  4MSW C;  4DR6 O;  1K73 W;  4DR5 B;  5LGT A;  4NXM B;  4DV0 O;  4U3F H;  5GON A;  2ILM A;  1UFI A;  1FXH A;  2UUA O;  4FLZ A;  4CC6 A;  1S5J A;  1XMO B;  1L0N H;  2X6A A;  4K3A A;  4I7Z B;  3OMA B;  3BCC H;  3K79 A;  5LHG A;  3TXQ A;  3CE2 A;  3KCY A;  5B1N A;  1DTO A;  3STL C;  1N34 B;  2QE7 G;  4GYC B;  2Q7E A;  5H5N A;  5KHG A;  2QWN B;  1QVF U;  1WA8 B;  4PJ0 Z;  1H2G A;  3QO8 A;  3ZBH A;  3CXC U;  5DM6 V;  2YID A;  3WB2 A;  1J95 A;  4IYH A;  3UT5 B;  2ZE8 A;  5KMG B;  2NLJ C;  1NVP D;  2ZIN A;  2Z3Y A;  4JAA A;  1M5I A;  1RP3 B;  3UCS C;  3OTF A;  3RVY A;  3ZRW A;  3RYI B;  5EIB D;  3CCM V;  1R6N A;  3ZMS A;  1NTZ H;  4UFZ A;  1COW G;  1Y6X A;  2ZM6 O;  1GN6 A;  2Z5U A;  3LSS A;  3AG2 C;  3A0B Z;  4WBN B;  1AR4 A;  3IAY A;  2BOC C;  2UXX A;  3QO7 A;  2LGW A;  4G27 B;  4R7C A;  4E2L A;  4FJC C;  3L74 H;  2ZNJ A;  2ZKO A;  2JIZ G;  3RWR D;  1URF A;  4FM2 A;  4DV6 O;  1N36 B;  3N2G B;  2BSK B;  4K35 A;  1GAX A;  4B3S O;  5L3F A;  1MSW D;  1U96 A;  3VOU A;  1VQK V;  2KKW A;  4I4T A;  2W0F C;  2YUA A;  4I0X B;  3VBB A;  3RW0 A;  4GX5 A;  3T4Z A;  3CCQ V;  3WB0 A;  5CB4 A;  1XNR B;  4HAM A;  1NQT A;  3K5M A;  4X65 O;  1XRE A;  2YXH A;  4QE7 A;  2EUL A;  3ASO B;  1BSM A;  3H01 A;  5KHI A;  1CP9 A;  1M56 C;  1M93 A;  1Y66 A;  4GKK O;  5DED A;  4B3T O;  2F4V O;  4X1K A;  3RYH A;  2FYU H;  5DN6 G;  4O4J A;  2ZT9 B;  3JAK B;  4BIO A;  1GM7 A;  2V7Q G;  1MA1 A;  3W7T A;  1D2D A;  4DYL A;  3LNM B;  1FXK C;  3OMI B;  2N74 A;  4JGS A;  1HNW O;  1BHA A;  3CRQ A;  4TQF A;  3H1I H;  5C8Y A;  4JAU A;  4PI2 A;  2DE0 X;  4J42 A;  1N8R W;  4IYI A;  5K1X A;  1M90 W;  5J2U B;  1SA0 A;  4NXN B;  2QGN A;  4CH6 A;  3U10 A;  1IBL B;  2AHY A;  4PD4 F;  4UCT A;  4LF5 B;  3CMA V;  4EB6 B;  4O4I B;  5JH7 B;  4HBN A;  4X66 O;  2A79 B;  2QWR B;  4NVP A;  3ZRX A;  2ADP A;  4TOI A;  2VQE B;  2AW9 A;  1XBL A;  3N2K B;  4YJ3 A;  5FNV B;  4CS2 A;  4J7Z A;  1Y76 A;  3J80 N;  1US6 A;  3TCU A;  4YY3 B;  3ZMZ A;  2QKA A;  3TET A;  5J2T B;  2WLH A;  5CA0 B;  5LL6 Y;  4JV5 B;  5B1B C;  4DR5 O;  3E22 A;  3A8T A;  4NXM O;  1NTM H;  2UXD O;  1AP6 A;  5LP6 B;  1XMO O;  2L6L A;  1YHQ V;  2BTQ A;  1JJO A;  2ARH A;  4CC5 A;  3ZMU A;  4LFA B;  3THO A;  1N34 O;  4B3M B;  2ZXW C;  3OW2 U;  3F7V C;  5EBM C;  2ZQM A;  2JGU A;  5KA5 A;  2EIJ C;  3RT3 C;  3AG4 B;  4JI1 B;  3K58 A;  3NR7 A;  3OUS A;  3ZHR A;  1X59 A;  2V4D A;  5LXT B;  1Q82 W;  3CC4 V;  4LF8 B;  1K34 A;  1M56 B;  1TUE B;  2CH7 A;  1S72 V;  4X62 O;  2Q67 A;  1G6U A;  4DK1 A;  2YIA A;  5KUK A;  4JF3 A;  3G80 A;  4BW5 A;  3D8C A;  2CGO A;  2QM7 A;  3FX7 A;  3OM3 B;  2AZ0 A;  2KSD A;  5JQG A;  1I5X A;  1NTK H;  5JJE B;  3R65 A;  1W0J G;  4RO2 A;  3FYE B;  5D5P A;  5L3D A;  3SGI A;  1N32 B;  2X7R B;  1G1X B;  1AJN A;  1NT2 B;  4FLY A;  4GUN A;  1VEW A;  1N36 O;  1AIL A;  1MZF A;  4LWS B;  4LF7 B;  1D5N A;  1V9P A;  1FFX A;  3FD9 A;  1Z2G A;  2F23 A;  1AR5 A;  1IXB A;  1EZJ A;  3OR7 C;  1IBM B;  1H2K A;  2K9P A;  1O9H A;  3T1H B;  1SF9 A;  2Q0O C;  1KU9 A;  1W0K G;  2EIL B;  4H33 A;  4FIP C;  4J10 A;  5BXZ A;  1R6K A;  3ETQ A;  1MAB G;  5L3E A;  1WB7 A;  4EKW A;  4U7O A;  2DYR B;  2HKO A;  2IBZ H;  4YIO A;  3TK1 A;  5B1B B;  1H8H G;  5FLX N;  4LC1 A;  4PA3 A;  3AG1 C;  3RFR A;  2ODM A;  1WA8 A;  2KB1 A;  2QM8 A;  1TAE A;  4LF6 B;  4CS3 A;  4F6R A;  5DEC A;  1K4D C;  1GRJ A;  4WFB V;  1GK9 A;  1BGY H;  1LR1 A;  1D5A A;  3CP1 A;  1YSC A;  5IJ9 A;  2EIJ B;  4D7T A;  4WF9 V;  1QCE A;  3DC5 A;  1BE3 H;  3AEI A;  3RYI A;  3MHH C;  4JI6 B;  2ZDI A;  2YIB D;  4GT1 A;  3ICX A;  3K9S A;  2XAQ A;  1QLE B;  1YJW V;  2UUA B;  4B7E A;  1R73 A;  3JD2 A;  1IBL O;  3CYO A;  2OTJ V;  3SPG A;  2PTM A;  4U7N A;  4LF5 O;  2NNU A;  2IJI A;  4W4L A;  4WBN A;  4DV4 O;  2EIM B;  2JJ1 G;  4FPP A;  3RYH B;  2VQE O;  4FMT A;  4O4J B;  4XDL A;  5EIB C;  4K8X A;  2RJZ A;  2ITC C;  3K5O A;  3P3P A;  1KC8 W;  1R6T A;  5B1A C;  3FKS G;  2DOS A;  4JV5 O;  3JAS B;  5BZB A;  3ZHQ A;  5C8Y B;  4UCV A;  3FB7 C;  1K5S A;  3WB1 A;  2N05 A;  3QNE A;  5KUM A;  1DF4 A;  4B3M O;  4PDL A;  3EHB B;  3CCV V;  1OHH G;  4UCR A;  2XAF A;  1I08 A;  3W7S A;  1LUW A;  3CCL V;  4LFB B;  4JI1 O;  4JI3 B;  4JI7 B;  1SQB H;  4LCU C;  5J9P C;  3D36 C;  5IYZ A;  1OCO C;  3JAK A;  3C90 A;  2B5U A;  1NZ6 A;  1H2S B;  3O65 A;  2GBO A;  2GSM B;  3ETD A;  4LF8 O;  3FAV A;  1SQX H;  5KAI Z;  1YVW A;  2WAM A;  3K5N A;  3B77 A;  1ZLZ A;  3ZRS A;  1Y76 B;  3EFF K;  4DV6 B;  2HLD G;  1QVG U;  5LMU B;  4DK0 A;  3E22 B;  1E1R G;  3ABU A;  4JPR A;  5LA6 A;  2Y0I A;  3K0G A;  1T5E A;  4L87 A;  1BS3 A;  4Q6G A;  3PN1 A;  1QNM A;  3L70 H;  4DR2 O;  1YEW A;  2Y0P A;  4LF4 B;  1YJ9 V;  5CBH A;  2OIE A;  4ICG A;  1EBO A;  3UKM A;  4PDM A;  1BMF G;  1N32 O;  1TVK B;  2JK5 C;  5B5E Z;  4MVM A;  4DR4 O;  5BY1 A;  1JMK C;  1KEC A;  2ZE6 A;  2ZDI C;  1HNZ B;  4BW9 A;  2XUM A;  3SJQ C;  5KHK A;  1I94 B;  1AI6 A;  4H37 A;  4LF7 O;  3J7A U;  2PI4 A;  2R9A A;  2CH7 B;  3ASN B;  2YIC A;  2HFE C;  4UXN A;  5IDJ A;  3ZHV A;  2IU3 A;  1VF6 C;  1SZX A;  1Q8I A;  1JR9 A;  3ZED A;  1IBM O;  3T1H O;  3KCX A;  1WNS A;  5EBW C;  2DQ0 A;  3H1K H;  3OGC C;  1HP8 A;  5JCO A;  4P9O A;  3CRR A;  5JJN B;  3JAT A;  2E74 B;  1AJP A;  5KHH A;  3K03 A;  1PNM A;  1X4T A;  3L72 H;  1HW7 A;  3B2E E;  1JJ2 U;  2PY5 A;  1XEQ A;  2FL4 A;  4DR7 B;  4CH3 A;  1O9G A;  2NR5 A;  5K1P A;  1GN2 A;  3LNN A;  3ABL B;  4UVA A;  3ZCC A;  4LF6 O;  1XMQ B;  5LXT A;  1S5H C;  4DW0 A;  4KL1 A;  1EM1 A;  2JEU A;  3IFX A;  3B8N A;  4J11 A;  2Q0A A;  1GN4 A;  3ZIA G;  3ASO C;  3S3X A;  3P30 A;  1TUB B;  1FFX B;  2QA4 V;  1I7F A;  4HZ3 A;  1KKC A;  4JI6 O;  2F95 B;  3ETE A;  1TA8 A;  3K57 A;  2YIB A;  2UXD B;  3FYI B;  2CTQ A;  3QF7 A;  4MS2 A;  2EIN C;  5A9G A;  3FB8 C;  2ATK C;  4D7S A;  4DRX B;  4JZ2 A;  2F43 G;  2CE4 A;  3CHX A;  5L3C A;  2UXC B;  3JSN A;  4FK5 C;  3GWK C;  2YEV A;  2B9Z A;  4F6R B;  1P49 A;  4Z1M G;  4LWS A;  4CH5 A;  2RQ6 A;  2JVD A;  4X62 B;  5IJ9 B;  1K8A W;  3A0R A;  3K06 A;  5EC1 C;  2QR4 A;  5LGN A;  3LDE A;  5E1A C;  2EZP A;  4ZIB A;  2G38 A;  1GO3 F;  1ZAU A;  2IJH A;  4LFB O;  1DLB A;  4FLU A;  4JI3 O;  2XOK G;  4JI7 O;  2EBO A;  4KXR A;  2JJ2 G;  4GKJ B;  1IBK B;  1P7B A;  2ADQ B;  2WPD G;  3CD6 V;  5IE9 A;  5LP6 C;  1PNL A;  5JCO C;  2JDI G;  2OCC B;  2P4K A;  1WP7 A;  3JCZ A;  1R3I C;  3RGB A;  2Q7G A;  4DUZ B;  5LMU O;  4RUF A;  2ZE5 A;  4P2Z A;  1RM1 B;  3W7X A;  3AG4 C;  2QSA A;  4MVR A;  3ABK B;  4LF4 O;  2EIK C;  1Q81 W;  4RQF A;  2YC0 A;  2CK3 G;  3CRA A;  1FAF A;  1Q3E A;  2PYL A;  3KKY A;  3ZMT A;  4FLW A;  2PUS A;  3CCE V;  3MDS A;  5LOV B;  2XT9 A;  3DC6 A;  5IYZ B;  2ZNI A;  1HNZ O;  2P4V A;  1SS3 A;  1H2M A;  1RSO B;  1I94 O;  1PL4 A;  2EIN B;  3FAV B;  1LUV A;  1SKV A;  1WLE A;  1A32 A;  4LFC B;  1TGO A;  3JAS A;  1ZTE A;  3UO2 A;  1JPX A;  1JFF A;  3BY6 A;  4BWA A;  1SQP H;  3QVN A;  3GVM A;  4LF9 B;  4I50 B;  2ZE7 A;  1GTO A;  5D5Q A;  5LA6 B;  3ZRV A;  1K92 A;  2ZD9 A;  3LDD A;  4MTG A;  1KBH A;  1FS0 G;  2VWJ A;  2X0L A;  3SPJ A;  1IZ3 A;  2XTA A;  1VQ4 V;  3CC7 V;  4YHH B;  4DV4 B;  4DR7 O;  4B3R B;  2YS8 A;  1SC5 B;  1BQZ A;  3ABT A;  3K9A A;  3EXA A;  5KHJ A;  2EIL C;  4BR6 A;  2E5L B;  2B1I A;  2WLL A;  2GTA A;  4IHJ B;  4FM0 A;  2HEP A;  2QKC A;  4P9P A;  4JAV A;  1EZV H;  1H38 A;  4CBC A;  4OXS A;  2DYR C;  3N27 A;  2XHB A;  5C93 A;  1Q5O A;  2OIG A;  5GTH Z;  5TIS Z;  2D3O W;  1BL8 A;  3BA8 A;  3JSL A;  1YJN V;  3JAT B;  1F23 A;  3OEH G;  1VQP V;  3HB3 B;  5KAF Z;  5B3S B;  4X9Q A;  5EYP B;  1TVK A;  2E76 B;  2UXC O;  3E8F A;  1OCR C;  5H6R A;  3I56 V;  1K7D A;  2F1M A;  4X89 A;  2EIK B;  2R70 A;  1QLE C;  3UO3 A;  1VQM V;  2QKS A;  4J41 A;  1AB3 A;  4JYB A;  1R3K C;  1JOY A;  5GW7 A;  5ITZ B;  2HJD A;  4XDK A;  1AI4 A;  1MMM A;  2VWK A;  2P67 A;  3K08 A;  2EIM C;  3RYC B;  4Z1V A;  4OPA A;  4AHC A;  4GZR B;  1HNX O;  4DR2 B;  1HWY A;  3FB5 C;  3BHP A;  3VQX A;  1QLN A;  4PA9 A;  3H1H H;  4X20 B;  2CTR A;  3OR6 C;  1YTF B;  4GKJ O;  1IBK O;  4DR4 B;  4PDV A;  1ENV A;  2HP8 A;  3L73 H;  5A2Q N;  1XL4 A;  1XUQ A;  2YEV B;  2VQF B;  4ZKI A;  2LFR A;  3OEE G;  2HVJ C;  3G6E V;  2GDS A;  4DUZ O;  4D6T H;  1TUB A;  4J7J A;  3JAW A;  4O4L B;  3RYF B;  3FB6 C;  1FYJ A;  1KMI Z;  1XOU A;  2JEX A;  2YI9 A;  4EFE A;  4J80 A;  1I5Y A;  1SQV H;  1P84 F;  2RCV A;  3L75 H;  3ZX6 A;  3VQY A;  3CCR V;  2F93 B;  1CEZ A;  4DW1 A;  4R8C A;  1SRY A;  4UCU A;  3MHS C;  4J9Z B;  4NTW A;  4DRX A;  2A7W A;  3JD4 A;  4N23 A;  1ZL8 B;  3IC9 A;  3Q4H B;  1H2N A;  1VQ6 V;  2ZIM A;  3DXR A;  1KD1 W;  4UV8 A;  2Q69 A;  1ARO P;  4UB8 Z;  3HKD A;  5LYJ A;  4JYY A;  1HDJ A;  1L8D A;  1HR0 O;  5IJ0 A;  2VS0 A;  2FKX A;  4O4H B;  2QEX V;  4LFC O;  4LH7 A;  4MVO A;  2GTS A;  3H9V A;  3IC7 A;  2LP7 A;  4FFB A;  3I5D A;  4QE9 A;  4UVC A;  4B7K A;  3DSQ A;  1OCR B;  4LF9 O;  4X64 B;  4KFM A;  4JAS A;  3AG3 B;  4FFK A;  1Y74 A;  1P4R A;  3ZN1 A;  2GHY A;  2OWO A;  3T4D A;  2LO1 A;  1VQN V;  2HR3 A;  2XAH A;  1F51 A;  2QM4 A;  4GX2 A;  1AP5 A;  2AGA A;  1YTF D;  3ZN0 A;  3ASN C;  1M9N A;  1N0J A;  1OZ0 A;  4YHH O;  1WP8 A;  2R9I A;  2A06 H;  1VQ7 V;  4B3R O;  1BZK A;  2QWO B;  1S5L Z;  2CTW A;  4A5U B;  3APO A;  1PV0 A;  4N21 A;  4G2K A;  2E5L O;  1MOF A;  2HHH B;  1G4Y B;  3M99 B;  1ZUQ A;  4QJF B;  1NU1 H;  4CH4 A;  4EEQ A;  3U0Z A;  3BAB A;  1JFF B;  2OT5 A;  1UJW B;  4JI5 B;  4ZI7 B;  5CA3 A;  2W0X A;  5L3G A;  3ABL C;  4I9W A;  3BAA A;  5LHI A;  2P22 C;  4MVS A;  3SPI A;  1JA8 A;  3ETG A;  1EN5 A;  2UUB B;  4UCS A;  3JAR A;  4BIU A;  1VQ9 V;  2IH3 C;  2IJK A;  1F4M A;  2DJV A;  4IIJ B;  3NXS A;  3ZHS A;  5LOV A;  1XQ8 A;  5CBG A;  1K3E A;  1XL6 A;  4KP4 A;  3VQW A;  1MSD A;  4JI0 B;  1RSO A;  2CDY A;  4K0K B;  2V1D A;  4JI8 B;  1JCH A;  1F7Y A;  2QWQ B;  1B3Q A;  5L3B A;  2WLL B;  3L9D A;  3SPH A;  4YXW G;  4NTX A;  1JX9 A;  3VQV A;  3TJT A;  5IYB O;  3OTO B;  1DGS A;  1K33 A;  2BOB C;  2DYS C;  2RNB A;  3SDL A;  3H1L H;  4I50 A;  2BTO A;  1KP3 A;  3F5T A;  3K3W A;  4NR1 A;  1SER A;  4LR3 A;  2UU9 B;  4AI8 A;  4RAI A;  1OCZ B;  1MG1 A;  4H13 B;  1FPO A;  1B04 A;  3K04 A;  1R1B A;  3SYQ A;  5HFL A;  3T1C A;  2H94 A;  2H3O A;  1F4N A;  2WLI B;  1KKD A;  1S77 D;  4EFB A;  1KUQ A;  4FM1 A;  4WFA V;  3BA9 A;  2VQF O;  1B6Q A;  1K9M W;  1E79 G;  1XIL A;  4IHJ A;  1E1Q G;  1VMG A;  2Q68 A;  1YZB A;  2HVK C;  3UQ8 A;  1VF5 B;  2M7W A;  1CPY A;  3LUT B;  3E8B A;  4PA6 A;  2OCH A;  3EVK A;  3UM7 A;  3CEI A;  1IXM A;  4WFE A;  2LJ2 A;  4JYA O;  1XDC A;  4MTX A;  2DWD C;  2FML A;  4FZ1 A;  4PEL A;  4MTO A;  4BAY A;  3OFN G;  3S3W A;  1K5Q A;  4PI0 A;  1OCC B;  2OCC C;  1ZSP A;  5JVD B;  2WA3 A;  1GKF A;  5EYP A;  4RQE A;  5H9C A;  1AR1 B;  1XHZ A;  4UUJ C;  3J81 N;  3CJH B;  5EBL C;  4QIW F;  4JI4 B;  2BCC H;  1RM1 C;  4IL6 Z;  2L35 A;  2XAJ A;  2Q4P A;  4NTY A;  1IVS A;  1SQF A;  1GN3 A;  4X1Y A;  3ABK C;  5CBF A;  1VAR A;  5IY5 C;  1NBM G;  1VP7 A;  3C3T A;  1PP9 H;  2E75 B;  4O2B B;  4RUE A;  1Q90 D;  2AHZ A;  3FFQ A;  5ITZ A;  2ZIO A;  1VQL V;  4WFG A;  4ZBM A;  4R50 A;  4U3J B;  4X64 O;  3JAW B;  2BE3 A;  3RYC A;  5AG2 A;  2A0L A;  1W2B U;  1VQ5 V;  1RPO A;  1NH2 B;  3E86 A;  4DV7 B;  2PZS A;  3SYC A;  4GLX A;  1G8M A;  1V55 B;  4X20 A;  4TSF G;  3JD0 A;  4MVQ A;  2DYS B;  2ZR2 A;  4F4L A;  1L1F A;  3CC2 V;  4E4E A;  2QJ1 A;  3DXR B;  1EN6 A;  3DTU B;  4TV8 A;  4X88 A;  3JYC A;  1EN4 A;  2LW1 A;  3QTC A;  2HHH O;  2Y69 C;  2D2C B;  1FXK A;  3HKD B;  4MW8 A;  5LYJ B;  3TXS A;  1WB8 A;  5KX5 B;  1VF7 A;  5IJ0 B;  1WPX A;  3OE7 G;  3T1Y B;  1MNG A;  3ABM B;  3QO5 A;  4JTD B;  4FFB B;  4JI5 O;  4O4L A;  3RYF A;  3D3Q A;  5B1O A;  1M57 B;  1Y74 B;  1FKA O;  2CUG A;  4W4K A;  1S3J A;  3W7W A;  3JAL B;  2Y4T A;  2QDO A;  2A3Q A;  4DV2 B;  2UUB O;  3E83 A;  3ZMV A;  1NS1 A;  1HNX B;  4AQY O;  1JQ0 A;  2C2A A;  1QBZ A;  2Z0A A;  3CCS V;  2PYJ A;  4DO2 A;  1ZL8 A;  3Q4H A;  4JI0 O;  3K59 A;  1QHT A;  4K0K O;  5IYC O;  4JI8 O;  3LSU A;  4DUY B;  3ZJZ A;  2W6I G;  2XAS A;  1WN7 A;  1XHX A;  2Q9L A;  2GV9 A;  3CME V;  4HNA B;  2PF4 E;  4O4H A;  3P32 A;  1V54 B;  1BQ0 A;  4DR1 B;  2GUZ B;  3OTO O;  2YXY A;  3B40 A;  5JWP A;  2EJR A;  1DF5 A;  5B3S C;  4O2A A;  3WG7 B;  2Q6A A;  4OX9 B;  1NH2 D;  5LHH A;  4H0L B;  3OGI B;  3HKC A;  1YIJ V;  4AIL C;  4GCZ A;  2HG5 C;  3MAQ A;  2DQ3 A;  4PV1 B;  4QPK A;  2UU9 O;  3TGU H;  3ZS8 C;  2IJJ A;  5IY5 B;  5BMV A;  2X6B A;  2JGD A;  2DMX A;  4XDJ A;  4FLT A; 
#chains in the Genus database with same CATH homology
 2EIM C;  5B1A B;  4XDL A;  2OTL V;  3HPL C;  2ITC C;  1KC8 W;  5H6Q A;  3GWO A;  2IU0 A;  1S76 D;  5B1A C;  5CN0 A;  3OUF A;  3FKS G;  1HWY A;  4J9Y B;  3FB5 C;  2ZR3 A;  2DWE C;  2P7T C;  3T2M A;  5BZB A;  1QLN A;  4PA9 A;  4XBF A;  3W7U A;  1R3J C;  1SZT A;  3OR6 C;  1YTF B;  3FB7 C;  4JYC A;  4BIZ A;  3WFV A;  1K5S A;  1AI5 A;  3X2Q B;  4I5S A;  2WSS G;  1NJI W;  4PDV A;  1ENV A;  1GMG A;  2B1G A;  1XL4 A;  2YEV B;  3QNE A;  5KUM A;  1DF4 A;  4PDL A;  3EHB B;  3CCV V;  1OHH G;  1PL0 A;  1Q7Y W;  2XAF A;  2Y69 B;  4ZKI A;  2LFR A;  3W7S A;  3OEE G;  1AI7 A;  3JD1 A;  1OCO B;  2HVJ C;  4MSW C;  3CCL V;  1K73 W;  5LGT A;  2FTK A;  3G6E V;  1FXH A;  4LCU C;  2DW4 A;  2WLJ A;  5J9P C;  2A9H A;  2X6A A;  1OCO C;  3OMA B;  3IGA C;  2B5U A;  3K79 A;  5LHG A;  3FB6 C;  3ETD A;  2GSM B;  5B1N A;  1DTO A;  4P30 A;  3STL C;  1PKX A;  2JEX A;  2WAM A;  2QE7 G;  3B77 A;  3ZRS A;  3CCJ V;  1I5Y A;  3EFF K;  1JVM A;  1QR9 A;  2HLD G;  1QVG U;  3CCR V;  1VQ8 V;  1QVF U;  5KA6 A;  1CEZ A;  1H2G A;  3QO8 A;  4R8C A;  1S0V A;  1SRY A;  3CXC U;  1E1R G;  3ABU A;  3MHS C;  4J9Z B;  3JD4 A;  4N23 A;  5DM6 V;  4JPR A;  3K0G A;  4UVB A;  1J95 A;  4FMT A;  4L87 A;  1VQ6 V;  4ASU G;  1KD1 W;  2LFS A;  3CCU V;  1GM9 A;  4UV8 A;  2Q69 A;  1YJ9 V;  1ARO P;  2NLJ C;  1NVP D;  2W6J G;  2Z3Y A;  2YSU B;  5CBH A;  1EBO A;  3UKM A;  1ORQ C;  4PDM A;  1BMF G;  4PA7 A;  3RVY A;  3ZRW A;  2JK5 C;  4MVM A;  2QEX V;  3CCM V;  4MVO A;  1R6N A;  3IC7 A;  2LP7 A;  3ZMS A;  4QE9 A;  4UVC A;  3SYP A;  3AG2 B;  1KEC A;  1OCR B;  1COW G;  2ZDI C;  4KFM A;  2Y48 A;  3SJQ C;  4JAS A;  3AG3 B;  4R6Z A;  2WLI A;  1AI6 A;  4H37 A;  1P4R A;  2Z5U A;  3LSS A;  3AG2 C;  3ZN1 A;  2GHY A;  3T4D A;  2PI4 A;  1VQN V;  2HR3 A;  3ASN B;  2XAH A;  2BOC C;  1F51 A;  2HFE C;  4UXN A;  5IDJ A;  3STZ C;  3AG3 C;  1ZWI C;  2IU3 A;  2UXX A;  3QO7 A;  4GX2 A;  5HFM A;  3SPC A;  4G27 B;  4R7C A;  3KG2 A;  4E2L A;  4FJC C;  1YTF D;  3ZN0 A;  3ASN C;  1M9N A;  3RVZ A;  1OZ0 A;  2JIZ G;  2DQ0 A;  5EBW C;  2R9I A;  2WLK A;  3OGC C;  1VQ7 V;  4P9O A;  1AJP A;  4N21 A;  3K03 A;  4G2K A;  1NR1 A;  1PNM A;  1MOF A;  5L3F A;  1MSW D;  1G4Y B;  3M99 B;  1JJ2 U;  3VOU A;  1VQK V;  2QTO A;  4QJF B;  4KUM A;  2W0F C;  3VBB A;  3RW0 A;  4GX5 A;  3T4Z A;  3CCQ V;  4HAM A;  1NQT A;  5EC2 C;  3ABL B;  4UVA A;  3ZCC A;  3B8M A;  2OT5 A;  1UJW B;  5CA3 A;  1YIT V;  5L3G A;  4QE7 A;  3ASO B;  1S5H C;  3H01 A;  1M56 C;  1CP9 A;  1Y66 A;  2JEU A;  3B8N A;  3IFX A;  1GM8 A;  2R9R B;  3ABL C;  4I9W A;  5LHI A;  1PD3 A;  3ZIA G;  3ASO C;  4MVS A;  3P30 A;  3SPI A;  5DN6 G;  3ETG A;  2QA4 V;  3E8H A;  4QNH B;  4HZ3 A;  1FXK B;  1KQS U;  1VQO V;  3ETE A;  1GM7 A;  2V7Q G;  3W7T A;  4BIU A;  2ITD C;  3LNM B;  1VQ9 V;  2IH3 C;  2IJK A;  2X6C A;  1F4M A;  3FYI B;  4TWK A;  4WCE V;  1FXK C;  3NXS A;  3OMI B;  5CBG A;  1K3E A;  1XL6 A;  4KP4 A;  4MS2 A;  4JGS A;  1BHA A;  5LGU A;  2EIN C;  3G71 V;  2V1D A;  1SET A;  4LP8 A;  1JCH A;  3FB8 C;  4JAU A;  2ATK C;  2WLL B;  5L3B A;  3SPH A;  4YXW G;  1N8R W;  3BEH A;  5EK0 A;  1JX9 A;  4WFH A;  1AJQ A;  2F43 G;  1M90 W;  5L3C A;  2P90 A;  5IYB O;  1K33 A;  4FK5 C;  2BOB C;  2DYS C;  2YEV A;  3E8G A;  2AHY A;  3D36 A;  3E89 A;  1KP3 A;  3CMA V;  4Z1M G;  3K3W A;  3ZRW B;  1SER A;  1FXV A;  4RAI A;  2A79 B;  1OCZ B;  1THZ A;  4CZZ A;  1MG1 A;  3DGE A;  3ZRX A;  1K8A W;  3A0R A;  3K06 A;  3SYQ A;  3K04 A;  5EC1 C;  1H8E G;  5HFL A;  3T1C A;  5LGN A;  1K97 A;  2H94 A;  3LDE A;  2WLM A;  1OCZ C;  1F4N A;  5E1A C;  2WLI B;  1KKD A;  2IW5 A;  2EZP A;  1S77 D;  3JD3 A;  3TCU A;  3F7Y C;  1GO3 F;  3ZMZ A;  4WFA V;  3TET A;  1B6Q A;  2WLH A;  1K9M W;  1E79 G;  2IJH A;  5B1B C;  1DLB A;  1E1Q G;  3OAA G;  2Q68 A;  2HVK C;  2XOK G;  2M7W A;  2EBO A;  1CPY A;  3LUT B;  2JJ2 G;  1ROP A;  3E8B A;  4QPJ A;  1M1K W;  4PA6 A;  2ZXW B;  1P7B A;  2XND G;  1NKD A;  1YHQ V;  3UM7 A;  4X8A A;  2UXN A;  2WPD G;  4PA4 A;  3ZMU A;  1Q86 W;  1IXM A;  4WFE A;  5FL7 G;  3CD6 V;  1PNL A;  4MTX A;  2JDI G;  2OCC B;  2ZXW C;  3OW2 U;  3F7V C;  2DWD C;  5EBM C;  3JCZ A;  2ZQM A;  4MTO A;  4PEL A;  1R3I C;  4BAY A;  5KA5 A;  2EIJ C;  3OFN G;  3AG4 B;  1K5Q A;  1R3L C;  1OCC B;  2OCC C;  3OUS A;  4GX0 A;  1GKF A;  1LNQ A;  4RUF A;  4P2Z A;  5CMU A;  4RQE A;  4MW3 A;  3W7X A;  1RM1 B;  5H9C A;  1AR1 B;  3AG4 C;  4UUJ C;  1Q82 W;  3CC4 V;  1RPR A;  1PNK A;  4WFF A;  1OCC C;  2WLN A;  5EBL C;  4QIW F;  2XAG A;  3LSQ A;  1EFR G;  2WWW A;  4MVR A;  1K34 A;  3ABK B;  1M56 B;  1TUE B;  2EIK C;  1RM1 C;  1S72 V;  1Q81 W;  4RQF A;  2Q67 A;  2XAJ A;  4DXW A;  3CPW U;  5KUK A;  3ABK C;  4JF3 A;  2CK3 G;  5CBF A;  5IY5 C;  1NBM G;  4Q20 A;  3ZMT A;  4BW5 A;  4RUE A;  3CCE V;  2QM7 A;  4MVU A;  2AHZ A;  5IYD O;  3OM3 B;  1VQL V;  1I5X A;  4WFG A;  4ZBM A;  4R50 A;  4PDR A;  3R65 A;  1W0J G;  4RO2 A;  2P6J A;  2A0L A;  3FYE B;  1W2B U;  1VQ5 V;  1RPO A;  1NH2 B;  2EIN B;  3E86 A;  1KP2 A;  5L3D A;  3SYC A;  3ML0 A;  1WLE A;  3MD0 A;  2H8P C;  4JTA B;  2X7R B;  1G8M A;  4LBE C;  1JPX A;  1AJN A;  1V55 B;  3BY6 A;  4TSF G;  3JD0 A;  3OMN B;  3X2Q C;  4MVQ A;  2DYS B;  2ZR2 A;  4G28 B;  4F4L A;  1L1F A;  1GTO A;  1V55 C;  3ZRV A;  4HYO A;  4MVZ A;  1K92 A;  2ZD9 A;  3LDD A;  3CC2 V;  4MTG A;  3G4S V;  1FS0 G;  4UV9 A;  4X88 A;  3DTU B;  3JYC A;  2Y69 C;  1FXK A;  3E35 A;  4MW8 A;  2X0L A;  3SPJ A;  1EZJ A;  3OR7 C;  2IH1 C;  1VQ4 V;  2MK3 A;  1WPX A;  3OE7 G;  3CC7 V;  1W0K G;  4MT8 A;  2EIL B;  3GB7 C;  4H33 A;  3SYO A;  2EZO A;  3ABM B;  3QO5 A;  4FIP C;  1R6K A;  4JTD B;  1MAB G;  3ABT A;  3K9A A;  5L3E A;  4EKW A;  4U7O A;  2EIL C;  5B1O A;  1QR8 A;  3ABM C;  2B1I A;  2DYR B;  2HKO A;  3AG1 B;  1M57 B;  2WLL A;  4P9P A;  4JAV A;  1S3J A;  3TK1 A;  3PJS K;  5B1B B;  1H8H G;  3W7W A;  1H38 A;  4CBC A;  4LC1 A;  4OXS A;  2PI5 A;  2DYR C;  4PA3 A;  3AG1 C;  1M57 C;  3E83 A;  4MTF A;  2KB1 A;  2HJF C;  2QM8 A;  4TT3 G;  3ZMV A;  1JQ0 A;  2C2A A;  5C93 A;  1SES A;  4WFB V;  1K4D C;  1QBZ A;  3CCS V;  3E2E A;  4DO2 A;  1GK9 A;  2D3O W;  1BL8 A;  3K0D A;  1YJN V;  3D3I A;  1NR7 A;  3CP1 A;  3OEH G;  1F23 A;  1YSC A;  5IYC O;  2EIJ B;  1VQP V;  3ZJZ A;  4WF9 V;  2W6I G;  3HB3 B;  2XAS A;  1QCE A;  5B3S B;  3RBZ A;  3CME V;  3AEI A;  1YI2 V;  1K4C C;  1V54 B;  3MHH C;  3P32 A;  2ZDI A;  4GT1 A;  1FFT B;  5LBQ A;  2K1E A;  2XAQ A;  1QLE B;  3E8F A;  2EJR A;  1DF5 A;  1Y4M A;  4JTC B;  5B3S C;  1OCR C;  1YJW V;  5H6R A;  3I56 V;  1K7D A;  1R73 A;  1V54 C;  3JD2 A;  4X89 A;  3CYO A;  2OTJ V;  2EIK B;  3WG7 B;  2Q6A A;  3I55 V;  3SPG A;  1NVP B;  4U7N A;  1NH2 D;  2NNU A;  5LHH A;  2IJI A;  1QLE C;  1YIJ V;  4GCZ A;  2HG5 C;  1VQM V;  2DQ3 A;  3F5W C;  4QPK A;  2EIM B;  2QKS A;  2JJ1 G;  3LDC A;  4FPP A;  3WG7 C;  4JYB A;  2IJJ A;  5IY5 B;  1R3K C;  1JOY A;  5GW7 A;  4GX1 A;  2X6B A;  1BHB A;  4XDK A;  3SYA A;  1AI4 A;  4XDJ A;  2P67 A;  3K08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...