5KAFE

Rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
81
structure length
81
Chain Sequence
b'TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
total genus 17
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5kafE00
4UB8E 5B66E 5B5EE 5GTIE 4UB6E 3A0BE 5KAIE 5E79E 5KAFE 3WU2E 1W5CE 3JCUE 3KZIE 3A0HE 5H2FE 5TISE 5GTHE 4PJ0E 4IL6E 2AXTE 1S5LE
chains in the Genus database with same CATH superfamily
1FJPA 1NTMJ 3BCCD 1FDOA 3AEDC 4OH8B 2PFXA 1K8AQ 2BCCD 3G71P 2OTJP 2K3RA 2AEJA 5KAIE 2M3EA 4JQ0D 2WPVB 1VQMP 1SQQE 1VQ9P 2KSJA 2P7JA 2OGUA 1PV3A 1YQ4C 1RF0C 2HYNA 3HD7B 1SQVD 5AVYB 1QVGO 3L74E 2VRSA 1LTBC 3H1LE 1FOSF 1AA0A 5CCHD 3L75D 2E74C 3KHUA 2WSCJ 1KMIZ 2AXTE 1X0TA 3MHVA 1YTZT 2XU6A 3L70J 1NKNA 1HF9A 2Y9YA 2ZVNB 4AUWA 3B5NB 1ZR2A 3OA7A 2FYUJ 5AW3B 1WMKA 3GHGC 2B87A 3H1HJ 1NAFA 2PRRA 1NTKJ 3B71A 3PTZA 1SQPE 3CCEP 1OZHA 1ZW0A 4PD4E 2IYPA 4IFFA 1SQXJ 4WVZA 3JCUH 1KB9H 4N78E 2MJZA 2WZ7A 3C9IA 1EZVI 3EWKA 5GTHH 1FZFA 2I1KA 2H88C 3IR9A 2Q1KA 1URQC 1S5LE 1GL2D 1G2CB 3L72G 3HE4A 1LT9A 3RK3C 2R3CA 2YMKA 3IFMA 2KS1A 5CBNA 3MGNA 1K04A 3CWBD 4H13B 2OYHA 2Y0DA 3BRTB 1QEXA 2B9BA 1IK9A 2P10A 2ZAEB 2E75B 2KUBA 1PPJG 3L74D 1Q86Q 1DEEG 1ZLLA 4H0LC 1R8EA 4WY4D 1VQ7P 2JEEA 1M1KQ 1QGKB 3G9RA 4I7ZC 4W7YA 3W68A 1FZCA 2AEFA 3AE2C 5AVVB 4L76A 3L72E 1KILE 1YIJP 1HWTC 1LTSC 5CCHA 2Q6QA 1ZN5A 1VF5B 2FYNC 3ABVC 5KAFH 2GUVA 2LXCB 1SQBK 1D7MA 1L0LK 3A7OA 2Q3IA 4U3FJ 3I56P 1NTZK 3CX5H 1NTMG 1HJBA 2XV5A 3AEFC 2Q9IA 3GHGB 4RJTA 2K1AA 1SFCC 1PPJE 4N78D 5B66E 1UIIA 4W80A 2IBZI 2Z5IA 4C7NB 1NWQA 5KKZB 3CD6P 5AW5B 2IBZG 1M1JC 2MKVA 3L36A 1Q81Q 2HPCA 1YHQP 3JSVC 3KPEA 1URQB 3FWNA 2O01N 1E79H 1ZXGA 3F89A 3KZIH 1GL2A 5KLVK 1L4AD 5APUA 3Q1MA 4R4MA 4I1LA 1NTME 2KP8A 3RK3B 2IYOA 2FYUG 2FXMA 2WSEJ 3H25A 3O6QB 3CCSP 4OGQD 3S1KA 3H1HG 5CMZA 5EFWB 3E1RA 1T2KC 1AQ5A 1BSNA 2XZRA 2IZ1A 1ZMEC 1NTKG 3LW5J 2ZXEB 1HGZA 3LIEA 1Q7YQ 1SQXG 1JCCA 1FZEA 1LTIC 1LWUC 2HG5D 4IOIH 3L72D 3BASA 5L8RJ 3T97A 1KILD 1MV8A 1OW6A 3EQ2A 4WY4A 2E76B 2WPSA 1EDKA 2K9JB 4JYBA 4YPCA 3CPWO 4I7ZB 2NPSC 2J58A 1SQQJ 2W6AA 4HH2A 3RK2B 3L70E 4GOFA 3S9OA 1KORA 1LTJB 3VOPA 1JOCA 1JEKA 1L0NK 4DCKA 2FFDC 2WPRA 1NHLA 4LC1A 1YBKA 1HVVA 1SQBJ 3L35A 1L0LJ 5APWA 3H1HE 3M9BA 4CPGA 1HTLC 1PPJD 1S9KD 3H1LJ 1VQ4P 2KOGA 2WWWA 4IL6E 1NTKE 1LGHB 3AE4C 2R3SA 1J1EB 2ZT9C 1VQ8P 3E1IA 2WITA 2D2CD 4H44C 4BRYA 1DD4A 3OJAB 1OX3A 1JY3P 1N2DC 3RL0B 1G1JA 1QLED 5E79H 1PL5A 4K3AA 1CI6A 2WTYA 2IFMA 1EDJA 3AE1C 4JPZB 3D6YA 4W7ZA 1GW3A 1L4AA 1RE4A 4D6TG 1S2EA 5GTIE 4U3FG 2N1TD 4HKZH 3A5TA 2WMMA 1EXIA 3WUTA 2IBZD 4PV1C 1AQTA 3CXHE 3PHLA 3PP5A 1VQ5P 3HUSA 1JB0J 5CCGC 1VPCA 2KI7B 2FXOA 1LWUB 3Q5SA 1KILA 3SFEC 3HD7C 2FYUD 2QIWA 5AVWB 4XA4A 1RQVA 1ZP0C 2BEQD 2QRXA 4UB6H 1RHZB 3V2RA 1L0NJ 4JYCA 2Q3EA 3CI9A 2V7QJ 1MFTA 1UIXA 2WQYC 1CW5A 1SQXD 2K9YA 2IX7C 1KQGB 3FGAD 2Y0CA 1QX8A 4WWIA 1YJ9P 3WU2H 3VN0A 1HJ0A 4C46A 4A7PA 3HE4B 3CCLP 1LT1A 3PH0A 1DH3A 1LT9B 1EXJA 2QE7H 1KYOE 1N8RQ 5DJUB 2FKWB 2KS1B 1DIPA 4YXWH 3H1JJ 3MP7B 3M9HA 2ZJSE 2QVAA 3H1KJ 1JY3O 2OYHB 2OARA 1OWAA 1SQQG 3AE3C 2W6BA 4LGDE 1NYHA 2O1JA 2M5AB 1AV1A 1OFCX 1IFMA 1SQBG 5B5EE 2QG4A 3B4SA 3H1LG 1MZ9A 2WT7B 4LLHA 2WSCH 3RL0g 2JDIH 2YMYA 1OXZA 2N1TA 3TGUJ 4PV1B 2AXCA 3C8VA 4BWNA 4H13C 1M57D 1N7SD 2E75C 4PD4I 4ZKUA 1VDFA 1K9MQ 2LR2A 3L71J 1SQPG 2G8YA 3CCVP 1FAVA 4D6TD 4U3FD 2ITAA 3H32B 2QSIA 1SQBE 1L0LE 3L73J 1T8ZA 2O01J 4ZKPA 1H89A 2RH0A 1GK4A 2OYIA 1VF5C 2WPQA 3SFDC 3AE7C 3M9QA 4L73A 1FJKA 1FZAA 2CPSA 1KYOD 1FC2C 1N73C 5APTA 1M56D 1SVFA 2WSFJ 3HE5A 3L37A 2QEXP 1JY3N 1GD2E 1E5WA 4PJ0E 3NMDA 3WUVA 1PP9J 1JM0A 4WBAA 4YXDC 5KKZC 4EIJA 3ZDMA 1PGQA 5KLVE 1SQVK 5TISH 2IPPA 1YI2P 3D71A 2H7HA 4UB8H 3RBZA 3AEGC 1HGVA 1H0TA 5AVRB 5KJ7D 2A06G 1Z56A 2RMZA 3TNUB 4WY4B 4JBZA 2FFDA 3P7KA 5KTBA 2CPBA 3B5ND 3AE8C 2B89A 2W27A 2W83C 3HTKB 3SSUA 1SQQD 1BSHA 1YTZI 1NU1K 1ZV8A 3VP9A 2W8ZA 3MUDC 3TYYA 1VQKP 4KHXA 3H1JG 1N7SA 2YXRB 4ZNCA 2R44A 2IZ0A 3H1KG 2PP6A 1YJNP 1NGMB 5K5GB 3D70A 3FWLA 3A0BH 3H1LD 1BDDA 1U7MA 1L0NE 3AEEC 3NTNA 1LP1A 2C0XA 2E76C 2A06E 3LIDA 1IFPA 2J59M 1CZQA 1P84E 3RK2C 5H2FE 3A2AA 1M8OB 1LTJC 4Z1MH 1RF1A 2SPZA 1NH4A 3II6A 3MZWB 2M0BA 3VTPC 2JP3A 1CI6B 3N7NA 4GKGA 1KQFB 3A0HH 1EDIA 2OYOA 1N73B 2P2UA 1SQPD 1Q2NA 1USEA 4PD4D 1J1EC 1TU3F 3B8EB 3E7KA 1L4AB 3RK3E 5AVSB 3H1JE 2KNCB 3H1KE 2YKQA 3LW5H 3L71G 3FX0A 1SQVJ 4I2LC 5AW8B 4ASWA 3AE6C 3RL0C 5AW7B 1X22A 3L75J 5AW9B 2M3BA 3V6IA 5KAIH 3P8CE 2KB7P 4YTPC 3L73G 3PLNA 2WVRA 1JTHB 2O1KA 5KJ7A 2E74D 3PRJA 3M91A 3L70G 3TGUE 1A02J 1XTGB 3QWOC 5C39A 4IFMA 3B5NA 3KDPB 3KQGA 5AVZB 1LJ2A 1NU1J 2Q7CA 1PP9G 2AXTH 3L71E 1GZLA 3CL3D 3CCUP 1XTCC 1SP4A 3R4YA 1FZGA 4GT1A 2A06D 3V5BA 3C1LA 1GU4A 2YKOA 1P84D 3H1IJ 1N86A 4HJGH 4EDFA 1GDTA 3L73E 5BVZA 2D2CB 3V2QA 2KZJA 1URQD 1X79B 2A45I 1QL1A 4PD4H 1X9VA 3GG2A 3M0DA 2JKVA 1KD1Q 1G2CA 5CHXA 3G6EP 1JNMA 4ZMDA 2OQQA 2BEZF 2KIKA 1SLQA 2A45G 1X8YA 1KC8Q 3HRNA 1NTZJ 2KXPB 1PIXA 1S5LH 2P1JA 1JY2P 1PP9E 3CXHI 2OTKE 4KT0J 3MD0A 1LT9C 3UIAA 3V4QA 5APYA 1ZR4A 1VL2A 2N1TB 4H0LD 4Y28J 2Z4EA 1T3UA 1NJIQ 2OYHC 2YO2A 1LNQA 2POHA 1JMBA 1RF0A 3CMEP 4XFJA 1NTMD 2P67A 5KLVJ 2H89C 2XNXA 1PGPA 1BE3J 5M1BA 1BCCJ 3GF3A 3BRVB 1FZCC 1BGYJ 2V7QH 4B86A 1VQPP 3RGUA 1IC2A 5BU5A 2HR3A 5CCHC 2KZIA 1VQLP 3NXSA 3GHGA 3SWKA 1GK6A 1SFCD 3A3YB 1KYOI 2KK7A 4DT0A 2Y9ZA 3L73D 3U59A 1SQVG 2I1JA 3AEBC 3JCUE 1KB9E 2P58A 3L70D 2C0WA 2B87B 3Q3DA 3BVHA 4C7RA 3TK1A 5GTHE 1RE3C 4R4LA 5B66H 2N9BA 4EOTA 1OIPA 3Q5PA 1IFDA 3H1HD 1URQA 1OW7A 1MUUA 1AJYA 1NTKD 2IDBA 2JO1A 1PP9D 2XNDH 1H0TB 3K5BA 1ZRTE 2ZXXA 3USSA 3O6QA 1GL2C 2NRGA 1T2KD 1JY2O 1NU1G 1FS0E 4ASVA 1GU5A 4NPDA 1SQVE 1Y47A 2QA4P 1YYCA 2G3AA 1FE6A 3FXDA 2XDJA 4TT3H 3P8MC 3H1IG 5AW2B 1NKZB 3L75E 1IFIA 2FYUK 2HODA 3G4SP 1AVYA 2NPSD 2K9JA 1L2PA 5AW0B 3H6PA 3BATA 1SQXK 4WY4C 1L0LG 3CXHD 1NTZG 5KAFE 1FZCB 1HH0A 3CMAP 1NU1E 2GA1A 2E5YA 1FDMA 3CX5E 3CCRP 4GOEA 3Q2YA 3R2PA 3CCMP 1DX7A 2ZT9D 3H1IE 4DZOA 1RY3A 1SFCA 4H44D 3QH9A 2L5GB 4IL6H 1EQ7A 3M0AA 1FDIA 3VMXA 1M1JA 1VQNP 4L75A 1M90Q 2J5UA 5KLVG 2UWJE 1MKMA 1A02F 5AVQB 1BE3G 4BXLA 2O3JA 3KZIE 1BCCG 1NTZE 3CWBE 3PJSK 1JY2N 1ZRTD 3SWFA 2JWAA 1BGYG 2HPCB 2JJLA 1ZOYC 3L4FA 1HBWA 3U1CA 2E42A 2LKMA 3I55P 1KZUB 1GL2B 5KLIB 2A45H 1Y8AA 4PV1D 3JC22 3TSIA 1PZQA 1L4AC 2K37A 1RE4C 5CCGD 1FBMA 4KJMA 5GTIH 2YIUC 2FXPA 1Y9BA 4OGQC 2CK3H 1J1DB 1LWUA 2W6JH 3CXHH 3HUSC 2YXQB 4JF7A 2IFNA 2N9YB 1QVFO 3HD7D 1BE3E 1BCCE 1P84I 2NPSA 1L0NG 1BGYE 1NU1D 2DW3A 2QJPC 1JUNA 3T97B 3AECC 3CX5D 1KILC 2C9LY 3SWYA 5APQA 3H1ID 2YO3A 3G3ZA 2Q5UA 5AW6B 4NPEA 1EZVG 5BU8B 2QJYC 1T3JA 1WRGA 5APSA 2BASA 2FYZA 3D6ZA 2JWDA 5CJ0A 4WB4A 1DD3A 1RQUA 2WSSH 4K35A 5AVXB 3TF5A 3IF4A 3OAKA 1S5LX 4GODA 1SQBD 1L0LD 1T6AA 5AVTB 1NTZD 5E79E 2D2CC 3CCJP 1IJDB 4BRYB 1PFIA 1K05A 1KYOH 5CBOA 1USDA 3P32A 3VMZA 3NFQA 2KLVA 2M5AA 5APVA 1JO5A 3CLQA 1EZVE 2PGDA 2WT7A 1R5SA 3BCCJ 3WMM0 4M3LA 3TGUG 3CC2P 2QM7A 1SQQK 2YNYA 2BCCJ 1KFMA 5AW1B 2WSEH 3U1AA 1Q82Q 1R5LA 2E74B 2W90A 4U7JA 2KSEA 4GIFA 5B5EH 4H13D 5KLVD 3CC4P 1AVOA 5CCGA 2AEMA 1SS1A 2L91A 1BE3D 2E75D 1WT6A 1VQ6P 4D6TJ 1BCCD 2N1TC 2YIUB 2FY8A 3W67A 1BGYD 4OGQB 1J2JB 3HUSB 2M8RA 4RESB 1S9KE 3CC7P 1RE3A 2JR8A 3HD7A 1OVRA 3H32A 1JMMA 4UB6E 1NOHA 2QJPB 2ZYDA 3Q5RA 3IAOA 1KILB 3FXEA 1VF5D 2QM8A 1LTGC 3I5CA 4RKUJ 3MTUE 2H43A 3AEAC 1SQPK 1YITP 2R5BA 1H8AA 3MIWA 2QJYB 3F5HA 2ZVOB 2FBWC 3WU2E 1KQSO 1W2EA 1EDLA 1GW4A 2OYIC 2V4HA 4NPFX 1S4XA 1L0ND 1PGOA 3V2PA 2ZYAA 3RBXA 1IO4A 1PGJA 1KTMA 3IN6A 4IFDK 2R32A 3KYQA 4XE5B 4PJ0H 1S3JA 1EZVD 4DOJA 4HYTB 2QJKC 2IBZE 2Y0EA 1M7LA 2ZYGA 5AVUB 3KXDA 4H0LB 2B88A 2HODB 2GUSA 3TNUA 1KV4A 1U57A 4QMAA 5APXA 5TJHA 3RK3D 3H1JD 3H1KD 3CWBJ 3VMYA 4HB1A 3M06A 2ZFCA 3TDKA 2H8PD 2FYUE 3HTKA 3VYIA 3L74J 2FYNB 1KB9I 3P8CD 2C9NY 1IFNA 3V4WA 2RN0A 3VP8A 2K88A 3GMAA 1SQXE 2KLUA 2E5TA 2E76D 1SFCB 3EFFK 4Y99C 3TGUD 1N7SC 3RK2D 1GMJA 2I8DA 1Q90D 3GLMA 2RKLA 4IL6X 3WUUA 1M1JB 4N3YB 4EYYQ 1U7JA 5CJ4A 1SQPJ 4O9BA 1MFZA 3BCCG 1OVUA 3L71D 2BCCG 3V2NA 1P84H 3VMAA 1FU1A 5H2FH 1N73A 1RF1C 4MN4C 1W2BO 2OYIB 4AYCA 3GF7A 1IFJA 1CSBA 2KNCA 1OW8A 1AFOA 4C7NA 1LTTC 3EFGA 1DEBA 1LTAC 1QL2A 3HE5B 5TISE 3RL0D 3L75G 1NTMK 4UB8E 1KN7A 3AE9C 1S1CX 2Z5HA 2QJKB 1OMIA 1GTWA 1VQOP 2NZ2A 3BCCE 1JTHA 2LXBA 1S72P 2BCCE 1FZBA 2OTLP 3S4RA 2KYVA 2NPSB 4EI2A 4AQRD 3CX5I 2E43A 5KJ7C 5KLIC 4D6TE 4U3FE 1H88A 1RH5B 5AW4B 1W5CE 5DJTB 2FFDB 1KFNA 4OVNF 1YQ3C 3L72J 3MUDA 2R5DA 3B5NC 1NO4A 1BDCA 1J1DC 2HLOA 3A0BE 1JCDA 3O8ZA 2XKMA 1NVOA 2ZT9B 4DJGA 2HFED 2PAJA 4Y99B 4H44B 1G1IA 1EC5A 1N7SB 1NTKK 4TLFA 3GW6A 1YJWP 2GM4A 3AE5C 1LTJA 1N7LA 4I6MC 1LP1B 1IZNB 4RO0A 1OVVA 3CWBG 2O01H 1HUCA 3A0HE 1KQLA 1NAYA 1FOSE 2YKPA 3M0DC 4GDOA 1RF1B 3ITKA 3L74G 3N4XA 4OWFA 4N6JA 1KB9D 2WSFH 1IK7A 3CCQP 4L74A 3OW2O 1K73Q
chains in the Genus database with same CATH topology
4UB8E 5B66E 5B5EE 5GTIE 4UB6E 3A0BE 5KAIE 5E79E 5KAFE 3WU2E 1W5CE 3JCUE 3KZIE 3A0HE 5H2FE 5TISE 5GTHE 4PJ0E 4IL6E 2AXTE 1S5LE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 E;  5B66 E;  5B5E E;  5GTI E;  4UB6 E;  3A0B E;  5KAI E;  5E79 E;  5KAF E;  3WU2 E;  1W5C E;  3JCU E;  3KZI E;  3A0H E;  5H2F E;  5TIS E;  5GTH E;  4PJ0 E;  4IL6 E;  2AXT E;  1S5L E; 
#chains in the Genus database with same CATH topology
 1FJP A;  1NTM J;  3BCC D;  1FDO A;  3AED C;  4OH8 B;  2PFX A;  1K8A Q;  2BCC D;  3G71 P;  2OTJ P;  2K3R A;  2AEJ A;  5KAI E;  2M3E A;  4JQ0 D;  2WPV B;  1VQM P;  1SQQ E;  1VQ9 P;  2KSJ A;  2P7J A;  2OGU A;  1PV3 A;  1YQ4 C;  1RF0 C;  2HYN A;  3HD7 B;  1SQV D;  5AVY B;  1QVG O;  3L74 E;  2VRS A;  1LTB C;  3H1L E;  1FOS F;  1AA0 A;  5CCH D;  3L75 D;  2E74 C;  3KHU A;  2WSC J;  1KMI Z;  2AXT E;  1X0T A;  3MHV A;  1YTZ T;  2XU6 A;  3L70 J;  1NKN A;  1HF9 A;  2Y9Y A;  2ZVN B;  4AUW A;  3B5N B;  1ZR2 A;  3OA7 A;  2FYU J;  5AW3 B;  1WMK A;  3GHG C;  2B87 A;  3H1H J;  1NAF A;  2PRR A;  1NTK J;  3B71 A;  3PTZ A;  1SQP E;  3CCE P;  1OZH A;  1ZW0 A;  4PD4 E;  2IYP A;  4IFF A;  1SQX J;  4WVZ A;  3JCU H;  1KB9 H;  4N78 E;  2MJZ A;  2WZ7 A;  3C9I A;  1EZV I;  3EWK A;  5GTH H;  1FZF A;  2I1K A;  2H88 C;  3IR9 A;  2Q1K A;  1URQ C;  1S5L E;  1GL2 D;  1G2C B;  3L72 G;  3HE4 A;  1LT9 A;  3RK3 C;  2R3C A;  2YMK A;  3IFM A;  2KS1 A;  5CBN A;  3MGN A;  1K04 A;  3CWB D;  4H13 B;  2OYH A;  2Y0D A;  3BRT B;  1QEX A;  2B9B A;  1IK9 A;  2P10 A;  2ZAE B;  2E75 B;  2KUB A;  1PPJ G;  3L74 D;  1Q86 Q;  1DEE G;  1ZLL A;  4H0L C;  1R8E A;  4WY4 D;  1VQ7 P;  2JEE A;  1M1K Q;  1QGK B;  3G9R A;  4I7Z C;  4W7Y A;  3W68 A;  1FZC A;  2AEF A;  3AE2 C;  5AVV B;  4L76 A;  3L72 E;  1KIL E;  1YIJ P;  1HWT C;  1LTS C;  5CCH A;  2Q6Q A;  1ZN5 A;  1VF5 B;  2FYN C;  3ABV C;  5KAF H;  2GUV A;  2LXC B;  1SQB K;  1D7M A;  1L0L K;  3A7O A;  2Q3I A;  4U3F J;  3I56 P;  1NTZ K;  3CX5 H;  1NTM G;  1HJB A;  2XV5 A;  3AEF C;  2Q9I A;  3GHG B;  4RJT A;  2K1A A;  1SFC C;  1PPJ E;  4N78 D;  5B66 E;  1UII A;  4W80 A;  2IBZ I;  2Z5I A;  4C7N B;  1NWQ A;  5KKZ B;  3CD6 P;  5AW5 B;  2IBZ G;  1M1J C;  2MKV A;  3L36 A;  1Q81 Q;  2HPC A;  1YHQ P;  3JSV C;  3KPE A;  1URQ B;  3FWN A;  2O01 N;  1E79 H;  1ZXG A;  3F89 A;  3KZI H;  1GL2 A;  5KLV K;  1L4A D;  5APU A;  3Q1M A;  4R4M A;  4I1L A;  1NTM E;  2KP8 A;  3RK3 B;  2IYO A;  2FYU G;  2FXM A;  2WSE J;  3H25 A;  3O6Q B;  3CCS P;  4OGQ D;  3S1K A;  3H1H G;  5CMZ A;  5EFW B;  3E1R A;  1T2K C;  1AQ5 A;  1BSN A;  2XZR A;  2IZ1 A;  1ZME C;  1NTK G;  3LW5 J;  2ZXE B;  1HGZ A;  3LIE A;  1Q7Y Q;  1SQX G;  1JCC A;  1FZE A;  1LTI C;  1LWU C;  2HG5 D;  4IOI H;  3L72 D;  3BAS A;  5L8R J;  3T97 A;  1KIL D;  1MV8 A;  1OW6 A;  3EQ2 A;  4WY4 A;  2E76 B;  2WPS A;  1EDK A;  2K9J B;  4JYB A;  4YPC A;  3CPW O;  4I7Z B;  2NPS C;  2J58 A;  1SQQ J;  2W6A A;  4HH2 A;  3RK2 B;  3L70 E;  4GOF A;  3S9O A;  1KOR A;  1LTJ B;  3VOP A;  1JOC A;  1JEK A;  1L0N K;  4DCK A;  2FFD C;  2WPR A;  1NHL A;  4LC1 A;  1YBK A;  1HVV A;  1SQB J;  3L35 A;  1L0L J;  5APW A;  3H1H E;  3M9B A;  4CPG A;  1HTL C;  1PPJ D;  1S9K D;  3H1L J;  1VQ4 P;  2KOG A;  2WWW A;  4IL6 E;  1NTK E;  1LGH B;  3AE4 C;  2R3S A;  1J1E B;  2ZT9 C;  1VQ8 P;  3E1I A;  2WIT A;  2D2C D;  4H44 C;  4BRY A;  1DD4 A;  3OJA B;  1OX3 A;  1JY3 P;  1N2D C;  3RL0 B;  1G1J A;  1QLE D;  5E79 H;  1PL5 A;  4K3A A;  1CI6 A;  2WTY A;  2IFM A;  1EDJ A;  3AE1 C;  4JPZ B;  3D6Y A;  4W7Z A;  1GW3 A;  1L4A A;  1RE4 A;  4D6T G;  1S2E A;  5GTI E;  4U3F G;  2N1T D;  4HKZ H;  3A5T A;  2WMM A;  1EXI A;  3WUT A;  2IBZ D;  4PV1 C;  1AQT A;  3CXH E;  3PHL A;  3PP5 A;  1VQ5 P;  3HUS A;  1JB0 J;  5CCG C;  1VPC A;  2KI7 B;  2FXO A;  1LWU B;  3Q5S A;  1KIL A;  3SFE C;  3HD7 C;  2FYU D;  2QIW A;  5AVW B;  4XA4 A;  1RQV A;  1ZP0 C;  2BEQ D;  2QRX A;  4UB6 H;  1RHZ B;  3V2R A;  1L0N J;  4JYC A;  2Q3E A;  3CI9 A;  2V7Q J;  1MFT A;  1UIX A;  2WQY C;  1CW5 A;  1SQX D;  2K9Y A;  2IX7 C;  1KQG B;  3FGA D;  2Y0C A;  1QX8 A;  4WWI A;  1YJ9 P;  3WU2 H;  3VN0 A;  1HJ0 A;  4C46 A;  4A7P A;  3HE4 B;  3CCL P;  1LT1 A;  3PH0 A;  1DH3 A;  1LT9 B;  1EXJ A;  2QE7 H;  1KYO E;  1N8R Q;  5DJU B;  2FKW B;  2KS1 B;  1DIP A;  4YXW H;  3H1J J;  3MP7 B;  3M9H A;  2ZJS E;  2QVA A;  3H1K J;  1JY3 O;  2OYH B;  2OAR A;  1OWA A;  1SQQ G;  3AE3 C;  2W6B A;  4LGD E;  1NYH A;  2O1J A;  2M5A B;  1AV1 A;  1OFC X;  1IFM A;  1SQB G;  5B5E E;  2QG4 A;  3B4S A;  3H1L G;  1MZ9 A;  2WT7 B;  4LLH A;  2WSC H;  3RL0 g;  2JDI H;  2YMY A;  1OXZ A;  2N1T A;  3TGU J;  4PV1 B;  2AXC A;  3C8V A;  4BWN A;  4H13 C;  1M57 D;  1N7S D;  2E75 C;  4PD4 I;  4ZKU A;  1VDF A;  1K9M Q;  2LR2 A;  3L71 J;  1SQP G;  2G8Y A;  3CCV P;  1FAV A;  4D6T D;  4U3F D;  2ITA A;  3H32 B;  2QSI A;  1SQB E;  1L0L E;  3L73 J;  1T8Z A;  2O01 J;  4ZKP A;  1H89 A;  2RH0 A;  1GK4 A;  2OYI A;  1VF5 C;  2WPQ A;  3SFD C;  3AE7 C;  3M9Q A;  4L73 A;  1FJK A;  1FZA A;  2CPS A;  1KYO D;  1FC2 C;  1N73 C;  5APT A;  1M56 D;  1SVF A;  2WSF J;  3HE5 A;  3L37 A;  2QEX P;  1JY3 N;  1GD2 E;  1E5W A;  4PJ0 E;  3NMD A;  3WUV A;  1PP9 J;  1JM0 A;  4WBA A;  4YXD C;  5KKZ C;  4EIJ A;  3ZDM A;  1PGQ A;  5KLV E;  1SQV K;  5TIS H;  2IPP A;  1YI2 P;  3D71 A;  2H7H A;  4UB8 H;  3RBZ A;  3AEG C;  1HGV A;  1H0T A;  5AVR B;  5KJ7 D;  2A06 G;  1Z56 A;  2RMZ A;  3TNU B;  4WY4 B;  4JBZ A;  2FFD A;  3P7K A;  5KTB A;  2CPB A;  3B5N D;  3AE8 C;  2B89 A;  2W27 A;  2W83 C;  3HTK B;  3SSU A;  1SQQ D;  1BSH A;  1YTZ I;  1NU1 K;  1ZV8 A;  3VP9 A;  2W8Z A;  3MUD C;  3TYY A;  1VQK P;  4KHX A;  3H1J G;  1N7S A;  2YXR B;  4ZNC A;  2R44 A;  2IZ0 A;  3H1K G;  2PP6 A;  1YJN P;  1NGM B;  5K5G B;  3D70 A;  3FWL A;  3A0B H;  3H1L D;  1BDD A;  1U7M A;  1L0N E;  3AEE C;  3NTN A;  1LP1 A;  2C0X A;  2E76 C;  2A06 E;  3LID A;  1IFP A;  2J59 M;  1CZQ A;  1P84 E;  3RK2 C;  5H2F E;  3A2A A;  1M8O B;  1LTJ C;  4Z1M H;  1RF1 A;  2SPZ A;  1NH4 A;  3II6 A;  3MZW B;  2M0B A;  3VTP C;  2JP3 A;  1CI6 B;  3N7N A;  4GKG A;  1KQF B;  3A0H H;  1EDI A;  2OYO A;  1N73 B;  2P2U A;  1SQP D;  1Q2N A;  1USE A;  4PD4 D;  1J1E C;  1TU3 F;  3B8E B;  3E7K A;  1L4A B;  3RK3 E;  5AVS B;  3H1J E;  2KNC B;  3H1K E;  2YKQ A;  3LW5 H;  3L71 G;  3FX0 A;  1SQV J;  4I2L C;  5AW8 B;  4ASW A;  3AE6 C;  3RL0 C;  5AW7 B;  1X22 A;  3L75 J;  5AW9 B;  2M3B A;  3V6I A;  5KAI H;  3P8C E;  2KB7 P;  4YTP C;  3L73 G;  3PLN A;  2WVR A;  1JTH B;  2O1K A;  5KJ7 A;  2E74 D;  3PRJ A;  3M91 A;  3L70 G;  3TGU E;  1A02 J;  1XTG B;  3QWO C;  5C39 A;  4IFM A;  3B5N A;  3KDP B;  3KQG A;  5AVZ B;  1LJ2 A;  1NU1 J;  2Q7C A;  1PP9 G;  2AXT H;  3L71 E;  1GZL A;  3CL3 D;  3CCU P;  1XTC C;  1SP4 A;  3R4Y A;  1FZG A;  4GT1 A;  2A06 D;  3V5B A;  3C1L A;  1GU4 A;  2YKO A;  1P84 D;  3H1I J;  1N86 A;  4HJG H;  4EDF A;  1GDT A;  3L73 E;  5BVZ A;  2D2C B;  3V2Q A;  2KZJ A;  1URQ D;  1X79 B;  2A45 I;  1QL1 A;  4PD4 H;  1X9V A;  3GG2 A;  3M0D A;  2JKV A;  1KD1 Q;  1G2C A;  5CHX A;  3G6E P;  1JNM A;  4ZMD A;  2OQQ A;  2BEZ F;  2KIK A;  1SLQ A;  2A45 G;  1X8Y A;  1KC8 Q;  3HRN A;  1NTZ J;  2KXP B;  1PIX A;  1S5L H;  2P1J A;  1JY2 P;  1PP9 E;  3CXH I;  2OTK E;  4KT0 J;  3MD0 A;  1LT9 C;  3UIA A;  3V4Q A;  5APY A;  1ZR4 A;  1VL2 A;  2N1T B;  4H0L D;  4Y28 J;  2Z4E A;  1T3U A;  1NJI Q;  2OYH C;  2YO2 A;  1LNQ A;  2POH A;  1JMB A;  1RF0 A;  3CME P;  4XFJ A;  1NTM D;  2P67 A;  5KLV J;  2H89 C;  2XNX A;  1PGP A;  1BE3 J;  5M1B A;  1BCC J;  3GF3 A;  3BRV B;  1FZC C;  1BGY J;  2V7Q H;  4B86 A;  1VQP P;  3RGU A;  1IC2 A;  5BU5 A;  2HR3 A;  5CCH C;  2KZI A;  1VQL P;  3NXS A;  3GHG A;  3SWK A;  1GK6 A;  1SFC D;  3A3Y B;  1KYO I;  2KK7 A;  4DT0 A;  2Y9Z A;  3L73 D;  3U59 A;  1SQV G;  2I1J A;  3AEB C;  3JCU E;  1KB9 E;  2P58 A;  3L70 D;  2C0W A;  2B87 B;  3Q3D A;  3BVH A;  4C7R A;  3TK1 A;  5GTH E;  1RE3 C;  4R4L A;  5B66 H;  2N9B A;  4EOT A;  1OIP A;  3Q5P A;  1IFD A;  3H1H D;  1URQ A;  1OW7 A;  1MUU A;  1AJY A;  1NTK D;  2IDB A;  2JO1 A;  1PP9 D;  2XND H;  1H0T B;  3K5B A;  1ZRT E;  2ZXX A;  3USS A;  3O6Q A;  1GL2 C;  2NRG A;  1T2K D;  1JY2 O;  1NU1 G;  1FS0 E;  4ASV A;  1GU5 A;  4NPD A;  1SQV E;  1Y47 A;  2QA4 P;  1YYC A;  2G3A A;  1FE6 A;  3FXD A;  2XDJ A;  4TT3 H;  3P8M C;  3H1I G;  5AW2 B;  1NKZ B;  3L75 E;  1IFI A;  2FYU K;  2HOD A;  3G4S P;  1AVY A;  2NPS D;  2K9J A;  1L2P A;  5AW0 B;  3H6P A;  3BAT A;  1SQX K;  4WY4 C;  1L0L G;  3CXH D;  1NTZ G;  5KAF E;  1FZC B;  1HH0 A;  3CMA P;  1NU1 E;  2GA1 A;  2E5Y A;  1FDM A;  3CX5 E;  3CCR P;  4GOE A;  3Q2Y A;  3R2P A;  3CCM P;  1DX7 A;  2ZT9 D;  3H1I E;  4DZO A;  1RY3 A;  1SFC A;  4H44 D;  3QH9 A;  2L5G B;  4IL6 H;  1EQ7 A;  3M0A A;  1FDI A;  3VMX A;  1M1J A;  1VQN P;  4L75 A;  1M90 Q;  2J5U A;  5KLV G;  2UWJ E;  1MKM A;  1A02 F;  5AVQ B;  1BE3 G;  4BXL A;  2O3J A;  3KZI E;  1BCC G;  1NTZ E;  3CWB E;  3PJS K;  1JY2 N;  1ZRT D;  3SWF A;  2JWA A;  1BGY G;  2HPC B;  2JJL A;  1ZOY C;  3L4F A;  1HBW A;  3U1C A;  2E42 A;  2LKM A;  3I55 P;  1KZU B;  1GL2 B;  5KLI B;  2A45 H;  1Y8A A;  4PV1 D;  3JC2 2;  3TSI A;  1PZQ A;  1L4A C;  2K37 A;  1RE4 C;  5CCG D;  1FBM A;  4KJM A;  5GTI H;  2YIU C;  2FXP A;  1Y9B A;  4OGQ C;  2CK3 H;  1J1D B;  1LWU A;  2W6J H;  3CXH H;  3HUS C;  2YXQ B;  4JF7 A;  2IFN A;  2N9Y B;  1QVF O;  3HD7 D;  1BE3 E;  1BCC E;  1P84 I;  2NPS A;  1L0N G;  1BGY E;  1NU1 D;  2DW3 A;  2QJP C;  1JUN A;  3T97 B;  3AEC C;  3CX5 D;  1KIL C;  2C9L Y;  3SWY A;  5APQ A;  3H1I D;  2YO3 A;  3G3Z A;  2Q5U A;  5AW6 B;  4NPE A;  1EZV G;  5BU8 B;  2QJY C;  1T3J A;  1WRG A;  5APS A;  2BAS A;  2FYZ A;  3D6Z A;  2JWD A;  5CJ0 A;  4WB4 A;  1DD3 A;  1RQU A;  2WSS H;  4K35 A;  5AVX B;  3TF5 A;  3IF4 A;  3OAK A;  1S5L X;  4GOD A;  1SQB D;  1L0L D;  1T6A A;  5AVT B;  1NTZ D;  5E79 E;  2D2C C;  3CCJ P;  1IJD B;  4BRY B;  1PFI A;  1K05 A;  1KYO H;  5CBO A;  1USD A;  3P32 A;  3VMZ A;  3NFQ A;  2KLV A;  2M5A A;  5APV A;  1JO5 A;  3CLQ A;  1EZV E;  2PGD A;  2WT7 A;  1R5S A;  3BCC J;  3WMM 0;  4M3L A;  3TGU G;  3CC2 P;  2QM7 A;  1SQQ K;  2YNY A;  2BCC J;  1KFM A;  5AW1 B;  2WSE H;  3U1A A;  1Q82 Q;  1R5L A;  2E74 B;  2W90 A;  4U7J A;  2KSE A;  4GIF A;  5B5E H;  4H13 D;  5KLV D;  3CC4 P;  1AVO A;  5CCG A;  2AEM A;  1SS1 A;  2L91 A;  1BE3 D;  2E75 D;  1WT6 A;  1VQ6 P;  4D6T J;  1BCC D;  2N1T C;  2YIU B;  2FY8 A;  3W67 A;  1BGY D;  4OGQ B;  1J2J B;  3HUS B;  2M8R A;  4RES B;  1S9K E;  3CC7 P;  1RE3 A;  2JR8 A;  3HD7 A;  1OVR A;  3H32 A;  1JMM A;  4UB6 E;  1NOH A;  2QJP B;  2ZYD A;  3Q5R A;  3IAO A;  1KIL B;  3FXE A;  1VF5 D;  2QM8 A;  1LTG C;  3I5C A;  4RKU J;  3MTU E;  2H43 A;  3AEA C;  1SQP K;  1YIT P;  2R5B A;  1H8A A;  3MIW A;  2QJY B;  3F5H A;  2ZVO B;  2FBW C;  3WU2 E;  1KQS O;  1W2E A;  1EDL A;  1GW4 A;  2OYI C;  2V4H A;  4NPF X;  1S4X A;  1L0N D;  1PGO A;  3V2P A;  2ZYA A;  3RBX A;  1IO4 A;  1PGJ A;  1KTM A;  3IN6 A;  4IFD K;  2R32 A;  3KYQ A;  4XE5 B;  4PJ0 H;  1S3J A;  1EZV D;  4DOJ A;  4HYT B;  2QJK C;  2IBZ E;  2Y0E A;  1M7L A;  2ZYG A;  5AVU B;  3KXD A;  4H0L B;  2B88 A;  2HOD B;  2GUS A;  3TNU A;  1KV4 A;  1U57 A;  4QMA A;  5APX A;  5TJH A;  3RK3 D;  3H1J D;  3H1K D;  3CWB J;  3VMY A;  4HB1 A;  3M06 A;  2ZFC A;  3TDK A;  2H8P D;  2FYU E;  3HTK A;  3VYI A;  3L74 J;  2FYN B;  1KB9 I;  3P8C D;  2C9N Y;  1IFN A;  3V4W A;  2RN0 A;  3VP8 A;  2K88 A;  3GMA A;  1SQX E;  2KLU A;  2E5T A;  2E76 D;  1SFC B;  3EFF K;  4Y99 C;  3TGU D;  1N7S C;  3RK2 D;  1GMJ A;  2I8D A;  1Q90 D;  3GLM A;  2RKL A;  4IL6 X;  3WUU A;  1M1J B;  4N3Y B;  4EYY Q;  1U7J A;  5CJ4 A;  1SQP J;  4O9B A;  1MFZ A;  3BCC G;  1OVU A;  3L71 D;  2BCC G;  3V2N A;  1P84 H;  3VMA A;  1FU1 A;  5H2F H;  1N73 A;  1RF1 C;  4MN4 C;  1W2B O;  2OYI B;  4AYC A;  3GF7 A;  1IFJ A;  1CSB A;  2KNC A;  1OW8 A;  1AFO A;  4C7N A;  1LTT C;  3EFG A;  1DEB A;  1LTA C;  1QL2 A;  3HE5 B;  5TIS E;  3RL0 D;  3L75 G;  1NTM K;  4UB8 E;  1KN7 A;  3AE9 C;  1S1C X;  2Z5H A;  2QJK B;  1OMI A;  1GTW A;  1VQO P;  2NZ2 A;  3BCC E;  1JTH A;  2LXB A;  1S72 P;  2BCC E;  1FZB A;  2OTL P;  3S4R A;  2KYV A;  2NPS B;  4EI2 A;  4AQR D;  3CX5 I;  2E43 A;  5KJ7 C;  5KLI C;  4D6T E;  4U3F E;  1H88 A;  1RH5 B;  5AW4 B;  1W5C E;  5DJT B;  2FFD B;  1KFN A;  4OVN F;  1YQ3 C;  3L72 J;  3MUD A;  2R5D A;  3B5N C;  1NO4 A;  1BDC A;  1J1D C;  2HLO A;  3A0B E;  1JCD A;  3O8Z A;  2XKM A;  1NVO A;  2ZT9 B;  4DJG A;  2HFE D;  2PAJ A;  4Y99 B;  4H44 B;  1G1I A;  1EC5 A;  1N7S B;  1NTK K;  4TLF A;  3GW6 A;  1YJW P;  2GM4 A;  3AE5 C;  1LTJ A;  1N7L A;  4I6M C;  1LP1 B;  1IZN B;  4RO0 A;  1OVV A;  3CWB G;  2O01 H;  1HUC A;  3A0H E;  1KQL A;  1NAY A;  1FOS E;  2YKP A;  3M0D C;  4GDO A;  1RF1 B;  3ITK A;  3L74 G;  3N4X A;  4OWF A;  4N6J A;  1KB9 D;  2WSF H;  1IK7 A;  3CCQ P;  4L74 A;  3OW2 O;  1K73 Q; 
#chains in the Genus database with same CATH homology
 4UB8 E;  5B66 E;  5B5E E;  5GTI E;  4UB6 E;  3A0B E;  5KAI E;  5E79 E;  5KAF E;  3WU2 E;  1W5C E;  3JCU E;  3KZI E;  3A0H E;  5H2F E;  5TIS E;  5GTH E;  4PJ0 E;  4IL6 E;  2AXT E;  1S5L E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...